(data stored in ACNUC7421 zone)

EMBL: AM889136

ID   AM889136; SV 1; circular; genomic DNA; STD; PRO; 2145295 BP.
XX
AC   AM889136;
XX
PR   Project:PRJNA39689;
XX
DT   23-JUL-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Neisseria meningitidis alpha14 complete genome
XX
KW   complete genome.
XX
OS   Neisseria meningitidis alpha14
OC   Bacteria; Proteobacteria; Betaproteobacteria; Neisseriales; Neisseriaceae;
OC   Neisseria.
XX
RN   [1]
RP   1-2145295
RA   Linke B.;
RT   ;
RL   Submitted (13-SEP-2007) to the INSDC.
RL   Linke B., Center For Biotechnology, Bielefeld University,
RL   Universitaetsstrasse 25, 33501 Bielefeld, GERMANY.
XX
RN   [2]
RX   DOI; 10.1073/pnas.0800151105.
RX   PUBMED; 18305155.
RA   Schoen C., Blom J., Claus H., Schramm-Gluck A., Brandt P., Muller T.,
RA   Goesmann A., Joseph B., Konietzny S., Kurzai O., Schmitt C., Friedrich T.,
RA   Linke B., Vogel U., Frosch M.;
RT   "Whole-genome comparison of disease and carriage strains provides insights
RT   into virulence evolution in Neisseria meningitidis";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(9):3473-3478(2008).
XX
DR   MD5; 7f92ca3ac993399c3928cbf7554e1241.
DR   BioSample; SAMEA3138289.
DR   EnsemblGenomes-Gn; EBG00001202288.
DR   EnsemblGenomes-Gn; EBG00001202289.
DR   EnsemblGenomes-Gn; EBG00001202290.
DR   EnsemblGenomes-Gn; EBG00001202291.
DR   EnsemblGenomes-Gn; EBG00001202292.
DR   EnsemblGenomes-Gn; EBG00001202293.
DR   EnsemblGenomes-Gn; EBG00001202294.
DR   EnsemblGenomes-Gn; EBG00001202295.
DR   EnsemblGenomes-Gn; EBG00001202296.
DR   EnsemblGenomes-Gn; EBG00001202297.
DR   EnsemblGenomes-Gn; EBG00001202298.
DR   EnsemblGenomes-Gn; EBG00001202299.
DR   EnsemblGenomes-Gn; EBG00001202300.
DR   EnsemblGenomes-Gn; EBG00001202301.
DR   EnsemblGenomes-Gn; EBG00001202302.
DR   EnsemblGenomes-Gn; EBG00001202303.
DR   EnsemblGenomes-Gn; EBG00001202304.
DR   EnsemblGenomes-Gn; EBG00001202305.
DR   EnsemblGenomes-Gn; EBG00001202306.
DR   EnsemblGenomes-Gn; EBG00001202307.
DR   EnsemblGenomes-Gn; EBG00001202308.
DR   EnsemblGenomes-Gn; EBG00001202309.
DR   EnsemblGenomes-Gn; EBG00001202310.
DR   EnsemblGenomes-Gn; EBG00001202311.
DR   EnsemblGenomes-Gn; EBG00001202312.
DR   EnsemblGenomes-Gn; EBG00001202313.
DR   EnsemblGenomes-Gn; EBG00001202314.
DR   EnsemblGenomes-Gn; EBG00001202315.
DR   EnsemblGenomes-Gn; EBG00001202316.
DR   EnsemblGenomes-Gn; EBG00001202317.
DR   EnsemblGenomes-Gn; EBG00001202318.
DR   EnsemblGenomes-Gn; EBG00001202319.
DR   EnsemblGenomes-Gn; EBG00001202320.
DR   EnsemblGenomes-Gn; EBG00001202321.
DR   EnsemblGenomes-Gn; EBG00001202322.
DR   EnsemblGenomes-Gn; EBG00001202323.
DR   EnsemblGenomes-Gn; EBG00001202324.
DR   EnsemblGenomes-Gn; EBG00001202325.
DR   EnsemblGenomes-Gn; EBG00001202326.
DR   EnsemblGenomes-Gn; EBG00001202327.
DR   EnsemblGenomes-Gn; EBG00001202328.
DR   EnsemblGenomes-Gn; EBG00001202329.
DR   EnsemblGenomes-Gn; EBG00001202330.
DR   EnsemblGenomes-Gn; EBG00001202331.
DR   EnsemblGenomes-Gn; EBG00001202332.
DR   EnsemblGenomes-Gn; EBG00001202333.
DR   EnsemblGenomes-Gn; EBG00001202334.
DR   EnsemblGenomes-Gn; EBG00001202335.
DR   EnsemblGenomes-Gn; EBG00001202336.
DR   EnsemblGenomes-Gn; EBG00001202337.
DR   EnsemblGenomes-Gn; EBG00001202338.
DR   EnsemblGenomes-Gn; EBG00001202339.
DR   EnsemblGenomes-Gn; EBG00001202340.
DR   EnsemblGenomes-Gn; EBG00001202341.
DR   EnsemblGenomes-Gn; EBG00001202342.
DR   EnsemblGenomes-Gn; EBG00001202343.
DR   EnsemblGenomes-Gn; EBG00001202344.
DR   EnsemblGenomes-Gn; EBG00001202345.
DR   EnsemblGenomes-Gn; EBG00001202346.
DR   EnsemblGenomes-Gn; EBG00001202347.
DR   EnsemblGenomes-Gn; EBG00001202348.
DR   EnsemblGenomes-Gn; EBG00001202349.
DR   EnsemblGenomes-Gn; EBG00001202350.
DR   EnsemblGenomes-Gn; EBG00001202351.
DR   EnsemblGenomes-Gn; EBG00001202352.
DR   EnsemblGenomes-Gn; EBG00001202353.
DR   EnsemblGenomes-Gn; EBG00001202354.
DR   EnsemblGenomes-Gn; EBG00001202355.
DR   EnsemblGenomes-Gn; EBG00001202356.
DR   EnsemblGenomes-Gn; EBG00001202357.
DR   EnsemblGenomes-Gn; EBG00001202358.
DR   EnsemblGenomes-Gn; EBG00001202359.
DR   EnsemblGenomes-Gn; EBG00001202360.
DR   EnsemblGenomes-Gn; EBG00001202361.
DR   EnsemblGenomes-Gn; EBG00001202362.
DR   EnsemblGenomes-Gn; EBG00001202363.
DR   EnsemblGenomes-Gn; EBG00001202364.
DR   EnsemblGenomes-Gn; EBG00001202365.
DR   EnsemblGenomes-Gn; EBG00001202366.
DR   EnsemblGenomes-Gn; EBG00001202367.
DR   EnsemblGenomes-Gn; EBG00001202368.
DR   EnsemblGenomes-Gn; EBG00001202369.
DR   EnsemblGenomes-Gn; EBG00001202370.
DR   EnsemblGenomes-Gn; EBG00001202371.
DR   EnsemblGenomes-Gn; EBG00001202372.
DR   EnsemblGenomes-Gn; EBG00001202373.
DR   EnsemblGenomes-Gn; EBG00001202374.
DR   EnsemblGenomes-Gn; NMO_0048.
DR   EnsemblGenomes-Gn; NMO_0050.
DR   EnsemblGenomes-Gn; NMO_0151.
DR   EnsemblGenomes-Gn; NMO_0154.
DR   EnsemblGenomes-Gn; NMO_0188.
DR   EnsemblGenomes-Gn; NMO_0213.
DR   EnsemblGenomes-Gn; NMO_0275.
DR   EnsemblGenomes-Gn; NMO_0336.
DR   EnsemblGenomes-Gn; NMO_0359.
DR   EnsemblGenomes-Gn; NMO_0394.
DR   EnsemblGenomes-Gn; NMO_0406.
DR   EnsemblGenomes-Gn; NMO_0434.
DR   EnsemblGenomes-Gn; NMO_0541.
DR   EnsemblGenomes-Gn; NMO_0543.
DR   EnsemblGenomes-Gn; NMO_0606.
DR   EnsemblGenomes-Gn; NMO_0661.
DR   EnsemblGenomes-Gn; NMO_0714.
DR   EnsemblGenomes-Gn; NMO_0715.
DR   EnsemblGenomes-Gn; NMO_0821.
DR   EnsemblGenomes-Gn; NMO_0857.
DR   EnsemblGenomes-Gn; NMO_0875.
DR   EnsemblGenomes-Gn; NMO_0959.
DR   EnsemblGenomes-Gn; NMO_0981.
DR   EnsemblGenomes-Gn; NMO_0995.
DR   EnsemblGenomes-Gn; NMO_1032.
DR   EnsemblGenomes-Gn; NMO_1033.
DR   EnsemblGenomes-Gn; NMO_1095.
DR   EnsemblGenomes-Gn; NMO_1096.
DR   EnsemblGenomes-Gn; NMO_1140.
DR   EnsemblGenomes-Gn; NMO_1157.
DR   EnsemblGenomes-Gn; NMO_1215.
DR   EnsemblGenomes-Gn; NMO_1237.
DR   EnsemblGenomes-Gn; NMO_1320.
DR   EnsemblGenomes-Gn; NMO_1360.
DR   EnsemblGenomes-Gn; NMO_1403.
DR   EnsemblGenomes-Gn; NMO_1454.
DR   EnsemblGenomes-Gn; NMO_1518.
DR   EnsemblGenomes-Gn; NMO_1522.
DR   EnsemblGenomes-Gn; NMO_1538.
DR   EnsemblGenomes-Gn; NMO_1548.
DR   EnsemblGenomes-Gn; NMO_1597.
DR   EnsemblGenomes-Gn; NMO_1598.
DR   EnsemblGenomes-Gn; NMO_1736.
DR   EnsemblGenomes-Gn; NMO_1744.
DR   EnsemblGenomes-Gn; NMO_1830.
DR   EnsemblGenomes-Gn; NMO_1978.
DR   EnsemblGenomes-Gn; NMO_PS71.
DR   EnsemblGenomes-Gn; NMO_PS72.
DR   EnsemblGenomes-Gn; NMO_PS73.
DR   EnsemblGenomes-Gn; NMO_PS74.
DR   EnsemblGenomes-Gn; NMO_PS75.
DR   EnsemblGenomes-Gn; NMO_PS76.
DR   EnsemblGenomes-Gn; NMO_rRNA01.
DR   EnsemblGenomes-Gn; NMO_rRNA02.
DR   EnsemblGenomes-Gn; NMO_rRNA03.
DR   EnsemblGenomes-Gn; NMO_rRNA04.
DR   EnsemblGenomes-Gn; NMO_rRNA05.
DR   EnsemblGenomes-Gn; NMO_rRNA06.
DR   EnsemblGenomes-Gn; NMO_rRNA07.
DR   EnsemblGenomes-Gn; NMO_rRNA08.
DR   EnsemblGenomes-Gn; NMO_rRNA09.
DR   EnsemblGenomes-Gn; NMO_rRNA10.
DR   EnsemblGenomes-Gn; NMO_rRNA11.
DR   EnsemblGenomes-Gn; NMO_rRNA12.
DR   EnsemblGenomes-Gn; NMO_tRNA01.
DR   EnsemblGenomes-Gn; NMO_tRNA02.
DR   EnsemblGenomes-Gn; NMO_tRNA03.
DR   EnsemblGenomes-Gn; NMO_tRNA04.
DR   EnsemblGenomes-Gn; NMO_tRNA05.
DR   EnsemblGenomes-Gn; NMO_tRNA06.
DR   EnsemblGenomes-Gn; NMO_tRNA07.
DR   EnsemblGenomes-Gn; NMO_tRNA08.
DR   EnsemblGenomes-Gn; NMO_tRNA09.
DR   EnsemblGenomes-Gn; NMO_tRNA10.
DR   EnsemblGenomes-Gn; NMO_tRNA11.
DR   EnsemblGenomes-Gn; NMO_tRNA12.
DR   EnsemblGenomes-Gn; NMO_tRNA13.
DR   EnsemblGenomes-Gn; NMO_tRNA14.
DR   EnsemblGenomes-Gn; NMO_tRNA15.
DR   EnsemblGenomes-Gn; NMO_tRNA16.
DR   EnsemblGenomes-Gn; NMO_tRNA17.
DR   EnsemblGenomes-Gn; NMO_tRNA18.
DR   EnsemblGenomes-Gn; NMO_tRNA19.
DR   EnsemblGenomes-Gn; NMO_tRNA20.
DR   EnsemblGenomes-Gn; NMO_tRNA21.
DR   EnsemblGenomes-Gn; NMO_tRNA22.
DR   EnsemblGenomes-Gn; NMO_tRNA23.
DR   EnsemblGenomes-Gn; NMO_tRNA24.
DR   EnsemblGenomes-Gn; NMO_tRNA25.
DR   EnsemblGenomes-Gn; NMO_tRNA26.
DR   EnsemblGenomes-Gn; NMO_tRNA27.
DR   EnsemblGenomes-Gn; NMO_tRNA28.
DR   EnsemblGenomes-Gn; NMO_tRNA29.
DR   EnsemblGenomes-Gn; NMO_tRNA30.
DR   EnsemblGenomes-Gn; NMO_tRNA31.
DR   EnsemblGenomes-Gn; NMO_tRNA32.
DR   EnsemblGenomes-Gn; NMO_tRNA33.
DR   EnsemblGenomes-Gn; NMO_tRNA34.
DR   EnsemblGenomes-Gn; NMO_tRNA35.
DR   EnsemblGenomes-Gn; NMO_tRNA36.
DR   EnsemblGenomes-Gn; NMO_tRNA37.
DR   EnsemblGenomes-Gn; NMO_tRNA38.
DR   EnsemblGenomes-Gn; NMO_tRNA39.
DR   EnsemblGenomes-Gn; NMO_tRNA40.
DR   EnsemblGenomes-Gn; NMO_tRNA41.
DR   EnsemblGenomes-Gn; NMO_tRNA42.
DR   EnsemblGenomes-Gn; NMO_tRNA43.
DR   EnsemblGenomes-Gn; NMO_tRNA44.
DR   EnsemblGenomes-Gn; NMO_tRNA45.
DR   EnsemblGenomes-Gn; NMO_tRNA46.
DR   EnsemblGenomes-Gn; NMO_tRNA47.
DR   EnsemblGenomes-Gn; NMO_tRNA48.
DR   EnsemblGenomes-Gn; NMO_tRNA49.
DR   EnsemblGenomes-Gn; NMO_tRNA50.
DR   EnsemblGenomes-Gn; NMO_tRNA51.
DR   EnsemblGenomes-Gn; NMO_tRNA52.
DR   EnsemblGenomes-Gn; NMO_tRNA53.
DR   EnsemblGenomes-Gn; NMO_tRNA54.
DR   EnsemblGenomes-Gn; NMO_tRNA55.
DR   EnsemblGenomes-Gn; NMO_tRNA56.
DR   EnsemblGenomes-Gn; NMO_tRNA57.
DR   EnsemblGenomes-Gn; NMO_tRNA58.
DR   EnsemblGenomes-Tr; EBT00001573265.
DR   EnsemblGenomes-Tr; EBT00001573266.
DR   EnsemblGenomes-Tr; EBT00001573267.
DR   EnsemblGenomes-Tr; EBT00001573268.
DR   EnsemblGenomes-Tr; EBT00001573269.
DR   EnsemblGenomes-Tr; EBT00001573270.
DR   EnsemblGenomes-Tr; EBT00001573271.
DR   EnsemblGenomes-Tr; EBT00001573272.
DR   EnsemblGenomes-Tr; EBT00001573273.
DR   EnsemblGenomes-Tr; EBT00001573274.
DR   EnsemblGenomes-Tr; EBT00001573275.
DR   EnsemblGenomes-Tr; EBT00001573276.
DR   EnsemblGenomes-Tr; EBT00001573277.
DR   EnsemblGenomes-Tr; EBT00001573278.
DR   EnsemblGenomes-Tr; EBT00001573279.
DR   EnsemblGenomes-Tr; EBT00001573280.
DR   EnsemblGenomes-Tr; EBT00001573281.
DR   EnsemblGenomes-Tr; EBT00001573282.
DR   EnsemblGenomes-Tr; EBT00001573283.
DR   EnsemblGenomes-Tr; EBT00001573284.
DR   EnsemblGenomes-Tr; EBT00001573285.
DR   EnsemblGenomes-Tr; EBT00001573286.
DR   EnsemblGenomes-Tr; EBT00001573287.
DR   EnsemblGenomes-Tr; EBT00001573288.
DR   EnsemblGenomes-Tr; EBT00001573289.
DR   EnsemblGenomes-Tr; EBT00001573291.
DR   EnsemblGenomes-Tr; EBT00001573293.
DR   EnsemblGenomes-Tr; EBT00001573294.
DR   EnsemblGenomes-Tr; EBT00001573296.
DR   EnsemblGenomes-Tr; EBT00001573297.
DR   EnsemblGenomes-Tr; EBT00001573299.
DR   EnsemblGenomes-Tr; EBT00001573301.
DR   EnsemblGenomes-Tr; EBT00001573302.
DR   EnsemblGenomes-Tr; EBT00001573305.
DR   EnsemblGenomes-Tr; EBT00001573308.
DR   EnsemblGenomes-Tr; EBT00001573309.
DR   EnsemblGenomes-Tr; EBT00001573312.
DR   EnsemblGenomes-Tr; EBT00001573314.
DR   EnsemblGenomes-Tr; EBT00001573316.
DR   EnsemblGenomes-Tr; EBT00001573318.
DR   EnsemblGenomes-Tr; EBT00001573320.
DR   EnsemblGenomes-Tr; EBT00001573322.
DR   EnsemblGenomes-Tr; EBT00001573324.
DR   EnsemblGenomes-Tr; EBT00001573325.
DR   EnsemblGenomes-Tr; EBT00001573327.
DR   EnsemblGenomes-Tr; EBT00001573329.
DR   EnsemblGenomes-Tr; EBT00001573331.
DR   EnsemblGenomes-Tr; EBT00001573334.
DR   EnsemblGenomes-Tr; EBT00001573336.
DR   EnsemblGenomes-Tr; EBT00001573337.
DR   EnsemblGenomes-Tr; EBT00001573340.
DR   EnsemblGenomes-Tr; EBT00001573341.
DR   EnsemblGenomes-Tr; EBT00001573343.
DR   EnsemblGenomes-Tr; EBT00001573345.
DR   EnsemblGenomes-Tr; EBT00001573347.
DR   EnsemblGenomes-Tr; EBT00001573349.
DR   EnsemblGenomes-Tr; EBT00001573351.
DR   EnsemblGenomes-Tr; EBT00001573353.
DR   EnsemblGenomes-Tr; EBT00001573355.
DR   EnsemblGenomes-Tr; EBT00001573357.
DR   EnsemblGenomes-Tr; EBT00001573359.
DR   EnsemblGenomes-Tr; EBT00001573361.
DR   EnsemblGenomes-Tr; EBT00001573362.
DR   EnsemblGenomes-Tr; EBT00001573364.
DR   EnsemblGenomes-Tr; EBT00001573366.
DR   EnsemblGenomes-Tr; EBT00001573369.
DR   EnsemblGenomes-Tr; EBT00001573370.
DR   EnsemblGenomes-Tr; EBT00001573372.
DR   EnsemblGenomes-Tr; EBT00001573374.
DR   EnsemblGenomes-Tr; EBT00001573375.
DR   EnsemblGenomes-Tr; EBT00001573377.
DR   EnsemblGenomes-Tr; EBT00001573379.
DR   EnsemblGenomes-Tr; EBT00001573381.
DR   EnsemblGenomes-Tr; EBT00001573384.
DR   EnsemblGenomes-Tr; EBT00001573386.
DR   EnsemblGenomes-Tr; EBT00001573388.
DR   EnsemblGenomes-Tr; EBT00001573390.
DR   EnsemblGenomes-Tr; EBT00001573394.
DR   EnsemblGenomes-Tr; EBT00001573395.
DR   EnsemblGenomes-Tr; EBT00001573396.
DR   EnsemblGenomes-Tr; EBT00001573398.
DR   EnsemblGenomes-Tr; EBT00001573401.
DR   EnsemblGenomes-Tr; EBT00001573403.
DR   EnsemblGenomes-Tr; EBT00001573405.
DR   EnsemblGenomes-Tr; EBT00001573406.
DR   EnsemblGenomes-Tr; EBT00001573408.
DR   EnsemblGenomes-Tr; EBT00001573410.
DR   EnsemblGenomes-Tr; NMO_0048.
DR   EnsemblGenomes-Tr; NMO_0050.
DR   EnsemblGenomes-Tr; NMO_0151.
DR   EnsemblGenomes-Tr; NMO_0154.
DR   EnsemblGenomes-Tr; NMO_0188.
DR   EnsemblGenomes-Tr; NMO_0213.
DR   EnsemblGenomes-Tr; NMO_0275.
DR   EnsemblGenomes-Tr; NMO_0336.
DR   EnsemblGenomes-Tr; NMO_0359.
DR   EnsemblGenomes-Tr; NMO_0394.
DR   EnsemblGenomes-Tr; NMO_0406.
DR   EnsemblGenomes-Tr; NMO_0434.
DR   EnsemblGenomes-Tr; NMO_0541.
DR   EnsemblGenomes-Tr; NMO_0543.
DR   EnsemblGenomes-Tr; NMO_0606.
DR   EnsemblGenomes-Tr; NMO_0661.
DR   EnsemblGenomes-Tr; NMO_0714.
DR   EnsemblGenomes-Tr; NMO_0715.
DR   EnsemblGenomes-Tr; NMO_0821.
DR   EnsemblGenomes-Tr; NMO_0857.
DR   EnsemblGenomes-Tr; NMO_0875.
DR   EnsemblGenomes-Tr; NMO_0959.
DR   EnsemblGenomes-Tr; NMO_0981.
DR   EnsemblGenomes-Tr; NMO_0995.
DR   EnsemblGenomes-Tr; NMO_1032.
DR   EnsemblGenomes-Tr; NMO_1033.
DR   EnsemblGenomes-Tr; NMO_1095.
DR   EnsemblGenomes-Tr; NMO_1096.
DR   EnsemblGenomes-Tr; NMO_1140.
DR   EnsemblGenomes-Tr; NMO_1157.
DR   EnsemblGenomes-Tr; NMO_1215.
DR   EnsemblGenomes-Tr; NMO_1237.
DR   EnsemblGenomes-Tr; NMO_1320.
DR   EnsemblGenomes-Tr; NMO_1360.
DR   EnsemblGenomes-Tr; NMO_1403.
DR   EnsemblGenomes-Tr; NMO_1454.
DR   EnsemblGenomes-Tr; NMO_1518.
DR   EnsemblGenomes-Tr; NMO_1522.
DR   EnsemblGenomes-Tr; NMO_1538.
DR   EnsemblGenomes-Tr; NMO_1548.
DR   EnsemblGenomes-Tr; NMO_1597.
DR   EnsemblGenomes-Tr; NMO_1598.
DR   EnsemblGenomes-Tr; NMO_1736.
DR   EnsemblGenomes-Tr; NMO_1744.
DR   EnsemblGenomes-Tr; NMO_1830.
DR   EnsemblGenomes-Tr; NMO_1978.
DR   EnsemblGenomes-Tr; NMO_PS71.
DR   EnsemblGenomes-Tr; NMO_PS72.
DR   EnsemblGenomes-Tr; NMO_PS73.
DR   EnsemblGenomes-Tr; NMO_PS74.
DR   EnsemblGenomes-Tr; NMO_PS75.
DR   EnsemblGenomes-Tr; NMO_PS76.
DR   EnsemblGenomes-Tr; NMO_rRNA01-1.
DR   EnsemblGenomes-Tr; NMO_rRNA02-1.
DR   EnsemblGenomes-Tr; NMO_rRNA03-1.
DR   EnsemblGenomes-Tr; NMO_rRNA04-1.
DR   EnsemblGenomes-Tr; NMO_rRNA05-1.
DR   EnsemblGenomes-Tr; NMO_rRNA06-1.
DR   EnsemblGenomes-Tr; NMO_rRNA07-1.
DR   EnsemblGenomes-Tr; NMO_rRNA08-1.
DR   EnsemblGenomes-Tr; NMO_rRNA09-1.
DR   EnsemblGenomes-Tr; NMO_rRNA10-1.
DR   EnsemblGenomes-Tr; NMO_rRNA11-1.
DR   EnsemblGenomes-Tr; NMO_rRNA12-1.
DR   EnsemblGenomes-Tr; NMO_tRNA01-1.
DR   EnsemblGenomes-Tr; NMO_tRNA02-1.
DR   EnsemblGenomes-Tr; NMO_tRNA03-1.
DR   EnsemblGenomes-Tr; NMO_tRNA04-1.
DR   EnsemblGenomes-Tr; NMO_tRNA05-1.
DR   EnsemblGenomes-Tr; NMO_tRNA06-1.
DR   EnsemblGenomes-Tr; NMO_tRNA07-1.
DR   EnsemblGenomes-Tr; NMO_tRNA08-1.
DR   EnsemblGenomes-Tr; NMO_tRNA09-1.
DR   EnsemblGenomes-Tr; NMO_tRNA10-1.
DR   EnsemblGenomes-Tr; NMO_tRNA11-1.
DR   EnsemblGenomes-Tr; NMO_tRNA12-1.
DR   EnsemblGenomes-Tr; NMO_tRNA13-1.
DR   EnsemblGenomes-Tr; NMO_tRNA14-1.
DR   EnsemblGenomes-Tr; NMO_tRNA15-1.
DR   EnsemblGenomes-Tr; NMO_tRNA16-1.
DR   EnsemblGenomes-Tr; NMO_tRNA17-1.
DR   EnsemblGenomes-Tr; NMO_tRNA18-1.
DR   EnsemblGenomes-Tr; NMO_tRNA19-1.
DR   EnsemblGenomes-Tr; NMO_tRNA20-1.
DR   EnsemblGenomes-Tr; NMO_tRNA21-1.
DR   EnsemblGenomes-Tr; NMO_tRNA22-1.
DR   EnsemblGenomes-Tr; NMO_tRNA23-1.
DR   EnsemblGenomes-Tr; NMO_tRNA24-1.
DR   EnsemblGenomes-Tr; NMO_tRNA25-1.
DR   EnsemblGenomes-Tr; NMO_tRNA26-1.
DR   EnsemblGenomes-Tr; NMO_tRNA27-1.
DR   EnsemblGenomes-Tr; NMO_tRNA28-1.
DR   EnsemblGenomes-Tr; NMO_tRNA29-1.
DR   EnsemblGenomes-Tr; NMO_tRNA30-1.
DR   EnsemblGenomes-Tr; NMO_tRNA31-1.
DR   EnsemblGenomes-Tr; NMO_tRNA32-1.
DR   EnsemblGenomes-Tr; NMO_tRNA33-1.
DR   EnsemblGenomes-Tr; NMO_tRNA34-1.
DR   EnsemblGenomes-Tr; NMO_tRNA35-1.
DR   EnsemblGenomes-Tr; NMO_tRNA36-1.
DR   EnsemblGenomes-Tr; NMO_tRNA37-1.
DR   EnsemblGenomes-Tr; NMO_tRNA38-1.
DR   EnsemblGenomes-Tr; NMO_tRNA39-1.
DR   EnsemblGenomes-Tr; NMO_tRNA40-1.
DR   EnsemblGenomes-Tr; NMO_tRNA41-1.
DR   EnsemblGenomes-Tr; NMO_tRNA42-1.
DR   EnsemblGenomes-Tr; NMO_tRNA43-1.
DR   EnsemblGenomes-Tr; NMO_tRNA44-1.
DR   EnsemblGenomes-Tr; NMO_tRNA45-1.
DR   EnsemblGenomes-Tr; NMO_tRNA46-1.
DR   EnsemblGenomes-Tr; NMO_tRNA47-1.
DR   EnsemblGenomes-Tr; NMO_tRNA48-1.
DR   EnsemblGenomes-Tr; NMO_tRNA49-1.
DR   EnsemblGenomes-Tr; NMO_tRNA50-1.
DR   EnsemblGenomes-Tr; NMO_tRNA51-1.
DR   EnsemblGenomes-Tr; NMO_tRNA52-1.
DR   EnsemblGenomes-Tr; NMO_tRNA53-1.
DR   EnsemblGenomes-Tr; NMO_tRNA54-1.
DR   EnsemblGenomes-Tr; NMO_tRNA55-1.
DR   EnsemblGenomes-Tr; NMO_tRNA56-1.
DR   EnsemblGenomes-Tr; NMO_tRNA57-1.
DR   EnsemblGenomes-Tr; NMO_tRNA58-1.
DR   EuropePMC; PMC2265139; 18305155.
DR   EuropePMC; PMC2937706; 20592156.
DR   EuropePMC; PMC2944513; 20675487.
DR   EuropePMC; PMC3078933; 21533118.
DR   EuropePMC; PMC3082526; 21541312.
DR   EuropePMC; PMC3122619; 21508163.
DR   EuropePMC; PMC3125207; 21711902.
DR   EuropePMC; PMC3133314; 21622743.
DR   EuropePMC; PMC3346468; 22327577.
DR   EuropePMC; PMC3898611; 19477564.
DR   EuropePMC; PMC3940162; 24291226.
DR   EuropePMC; PMC4392821; 25901274.
DR   EuropePMC; PMC5084427; 27793092.
DR   EuropePMC; PMC5855746; 29425124.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01344; CRISPR-DR34.
DR   RFAM; RF01416; NrrF.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01843; neisseria_FSE.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02270; nse_sRNA.
DR   RFAM; RF02274; AniS.
DR   SILVA-LSU; AM889136.
DR   SILVA-SSU; AM889136.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2145295
FT                   /organism="Neisseria meningitidis alpha14"
FT                   /strain="alpha14"
FT                   /serotype="cnl"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:662598"
FT   CDS_pept        574..2022
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="NMO_0001"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /function="6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03303"
FT                   /db_xref="GOA:C6S4B5"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4B5"
FT                   /protein_id="CBA03303.1"
FT                   /translation="MKGDIGVIGLAVMGQNLILNMNDCGFKVVAYNRTIGKVDEFLNGA
FT                   AKGTDIVGAYSLQDLVDKLAKPRKIMMMVRAGSVVDDFIEQLLPLLEEGDIVIDGGNAN
FT                   YPDTTRRTHYLAEKGILFVGAGVSGGEEGARHGPSIMPGGDKRAWEAVKPIFQAIAAKT
FT                   PQGEPCCDWVGKDGAGHFVKMVHNGIEYGDMQLICEAYQFMKDGLGLSYDEMHRVFAEW
FT                   NKTELDSYLIEITAAILGYKDEGGEPLVEKILDTAGQKGTGKWTGINALDLGIPLTLIS
FT                   EAVFARCVSSFKEQRVQTGKLFARTVTPVEGGKQEWVEALRQALLASKIISYAQGFMLI
FT                   REAGESYGWDLDYGNTALLWREGCIIRSAFLGNIRDAYENNPDLVFLGEDGYFKNILEN
FT                   CLPAWRRVVAKAVECGIPMPCMASAITFLDGYTTERLPANLLQAQRDYFGAHTYERTDK
FT                   PRGEFFHTNWTGKGGDTASTTYDI"
FT   CDS_pept        2085..3356
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="NMO_0002"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03305"
FT                   /db_xref="GOA:C6S4B6"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4B6"
FT                   /protein_id="CBA03305.1"
FT                   /translation="MFQWLYDVLWLLAPIWIRRYLDKRSGSAPAYRAHRDERFGKPYPN
FT                   PVTGAVWIHAVSVGETRAAQPLIRELRQRFPDAPLLMTQMTPTGRETAQVLFPDAQCRY
FT                   LPYDKKTWVRQFLREHRPMFGILMETEIWPNLMKECRKSGVPLFLANARLSEKSLNGYL
FT                   KVRRLIRPAAASLTGCLAQTEADAARLAKLGAASVQVCGNTKYDIIPSEQMKTLAGQFE
FT                   KRIGGRPVAVCGSTRVYRGEDEAEKLLAAWQQYRGDALLVVVPRHPEHFQTVFETAKRF
FT                   GFKVQRRSDGLPVEPDTQVWIGDSMGELYAYYLCADVAFVGGSLVDSGCQNIIEPLSCG
FT                   VPTIFGFSTYNFSEACRHALASGAAVQVESADAWREAVEKTLSSEGGGMQMQARVDGFI
FT                   AQHRGAGARIAEAVREAVCGHRGR"
FT   CDS_pept        3397..3846
FT                   /transl_table=11
FT                   /locus_tag="NMO_0003"
FT                   /product="putative membrane protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03307"
FT                   /db_xref="GOA:C6S4B7"
FT                   /db_xref="InterPro:IPR007418"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4B7"
FT                   /protein_id="CBA03307.1"
FT                   /translation="MSIYAVAHIVHLYCAIAFVGGVFFEVLVLSVLHTGRVSCEARREV
FT                   EKAMSYRAVRVMPFVVGLLFASGIVMAANRYLSILGEPFATSFGTMLTLKILLAFSVLA
FT                   HFAIAVVKMARSTLTVGWSKYIHAVVFTHMLLIVFLAKAMFYISW"
FT   CDS_pept        3879..4853
FT                   /transl_table=11
FT                   /locus_tag="NMO_0004"
FT                   /product="putative transport protein TerC"
FT                   /function="Membrane protein TerC possibly involved in
FT                   tellurium resistance"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03308"
FT                   /db_xref="GOA:C6S4B8"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4B8"
FT                   /protein_id="CBA03308.1"
FT                   /translation="MTEYPGIGSPLFYGVFFAAVLVMIALDMFSLKKNGSHKVGIKEAL
FT                   AWSGLWVAVSCLFAGWLYFELAGNPGYGAAVAKEKVLEFFTGYILEKSLAVDNIFVFLM
FT                   IFGYFKVAPQFQHRVLLYGVLGALVLRTVMIFVGAALVRQFEWILYLFGAFLLYTGIHM
FT                   MKPEGDEEGDLANSRLLNAVKKVVPVGTEFHGEKFFTVENGKKIATPLFLVLVMIELSD
FT                   VVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAMYFLLSDVEERFIFLKYGLAFVLSF
FT                   IGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIYTKKQPDK"
FT   tRNA            4922..4997
FT                   /locus_tag="NMO_tRNA01"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:4955..4957,aa:Lys)"
FT   CDS_pept        5217..6470
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="NMO_0005"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /function="UDP-N-acetylglucosamine enolpyruvyl transferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03311"
FT                   /db_xref="GOA:C6S4B9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4B9"
FT                   /protein_id="CBA03311.1"
FT                   /translation="MDKLKISANGPLNGEITVSGAKNAALPLMCAGLLTSGTLRLKNVP
FT                   MLADVKTTQKLLQGMGARVLTDNISEFEINGGTVNNTCAPYELVRTMRASILVLGPTLA
FT                   RFGEAQVSLPGGCAIGSRPVDQHLKGLEAMGAEIVIEHGYVKAKGKLKGTRVAMDVVTV
FT                   GGTENLLMAATLAEGTTVLENCAIEPEVVDLAECLVKMGAKISGIGTSTMIVEGVDELH
FT                   GCEHSVVPDRIEAGTFLCAVAITGGRVVLRNAAPKTMEVVLDKLVEAGAVIEAGDDWIA
FT                   IDMRQRPKAVDIRTVVHPGFPTDMQAQFMALNAVAEGSCRVVETIFENRFMHVPELNRM
FT                   GANITTEGNTAFVQGVEQLSGAVVKATDLRASASLVIAGLAARGETVVEQIYHLDRGYE
FT                   NIEKKLGSVGAKIERVSG"
FT   CDS_pept        6551..7729
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="NMO_0006"
FT                   /product="phosphoglycerate kinase"
FT                   /function="3-phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03313"
FT                   /db_xref="GOA:C6S4C0"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4C0"
FT                   /protein_id="CBA03313.1"
FT                   /translation="MAFLKLTEQNVQGKTVLIRADMNVPFKDGKISDDTRIRASLASIQ
FT                   YCMDNGASVIVMIHLGRPTEGEFHPEDDVAPVAAHLGGLLGKDVKVLNDWRENKPALNA
FT                   GDVVMLQNVRINKGEKKNDLELGKAYASLCDVFVNDAFGTAHRAQASTEAVAQAAPVAC
FT                   AGVLMAGELDALGKALKQPARPMVAIVAGSKVSTKLTILESLADKVDQLIVGGGIANTF
FT                   LLAEGKAIGKSLAEHDLVEESKKIMAKMAAKGGSVPLPTDVVVAKAFAADEEAVVKDIA
FT                   DVAEDEMILDIGPKSAAALADLLKAAGTVVWNGPVGVFEFDQFAGGTKALAEAIAQSKA
FT                   FSIAGGGDTLAAIAKFGVTDQIGYISTGGGAFLEFLEGKELPAVAALEKRGE"
FT   CDS_pept        complement(7794..8042)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0007"
FT                   /product="BolA-like protein"
FT                   /function="Predicted transcriptional regulator BolA
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03314"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4C1"
FT                   /protein_id="CBA03314.1"
FT                   /translation="MLTPEQVKALIAGVAKCEHIEVEGDGHHFFAVIVSSEFEGKARLA
FT                   RHRLIKDGLKAQLESNELHALSISVAATPAEWAAKAQ"
FT   CDS_pept        complement(8134..9051)
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="NMO_0008"
FT                   /product="cell division protein FtsX"
FT                   /function="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03316"
FT                   /db_xref="GOA:C6S4C2"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4C2"
FT                   /protein_id="CBA03316.1"
FT                   /translation="MSIIHYLSLHVESARTALKQLLRQPFGTLLTLIMLAVAMTLPLFM
FT                   YLGIQSGQSVLGKLNESPQITIYMETAAAQSDSDTVRSLLTRDKRLDNIRFISKEDGLE
FT                   ELQSNLDQNLISMLDGNPLPDVFIVTPDPATTPDQMQAIYRDITNLPMVESANMDTEWV
FT                   QTLYQINEFIRKILWFLSLTLGMAFVLVAHNTIRLQILSRKEEIEITKLLGAPASFIRR
FT                   PFLYQAMWQSILSAAVSLGLCGWLLSAVRPLVDAIFKPYGLNIGWRFFYPGEIALVFGF
FT                   VIALGVFGAWLATTQHLLGFKAKK"
FT   CDS_pept        complement(9048..9698)
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="NMO_0009"
FT                   /product="cell division ATP-binding protein"
FT                   /function="Predicted ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03319"
FT                   /db_xref="GOA:C6S4C3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4C3"
FT                   /protein_id="CBA03319.1"
FT                   /translation="MIRFEQVSKTYPGGFEALKNVSFQINKGEMIFIAGHSGSGKSTVL
FT                   KLISGITKPSRGKILFNGQDLGTLSDNQIGFMRQHIGIVFQDHKILYDRNVLQNVILPL
FT                   RIIGYPPRKAEERARIAIEKVGLKGRELDDPVTLSGGEQQRLCIARAVVHQPGLLIADE
FT                   PSANLDRAYALDIMELFKTFHEAGTTVIVAAHDETLMADYGHRILRLSKGRLA"
FT   CDS_pept        complement(9695..9886)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03321"
FT                   /db_xref="GOA:C6S4C4"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4C4"
FT                   /protein_id="CBA03321.1"
FT                   /translation="MPSESASDGIFPARPSVSAKLIHYLKTGGIFIIGTVLPIVQTAYP
FT                   CGRNRPKRYAAHSLQDLL"
FT   CDS_pept        complement(9894..10376)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0011"
FT                   /product="periplasmic thiredoxin"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03322"
FT                   /db_xref="GOA:C6S4C5"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4C5"
FT                   /protein_id="CBA03322.1"
FT                   /translation="MKYLNLAAITLAATFAAHTASADELAGWKDNTPQSLQSLKAPVRI
FT                   VNLWATWCGPCRKEMPAMSKWYKAQKKGSVDMVGIALDTSDNIGNFLKQTPVSYPIWRY
FT                   TGANSRNFMKSYGNNIGVLPFTVVEAPKCGYRQTITGEANEKSLTEAVKLAHSKCR"
FT   CDS_pept        10500..10853
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="NMO_0012"
FT                   /product="putative arsenate reductase"
FT                   /function="Arsenate reductase and related proteins
FT                   glutaredoxin family"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03325"
FT                   /db_xref="GOA:C6S4C6"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4C6"
FT                   /protein_id="CBA03325.1"
FT                   /translation="MSEIKIFHNPRCSKSRAALSLLEERGIAAEVVKYLDTPPDLSELK
FT                   DIFNKLGLASARGMMRVKDDLYKELGLDNPNLDNDALLRAIADHPALLERPIVLANGKA
FT                   AVGRPLENIEAVL"
FT   CDS_pept        10850..11506
FT                   /transl_table=11
FT                   /locus_tag="NMO_0013"
FT                   /product="conserved hypothetical periplasmic protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03327"
FT                   /db_xref="GOA:C6S4C7"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4C7"
FT                   /protein_id="CBA03327.1"
FT                   /translation="MNKRLFCSRNGLRYYLLGGFCLSVFPFLLVFASSVWAVYRTGGQV
FT                   LPPYVRADAALVLGAAAWDKHPSPVFRERINHAIALYQSRRVGKIVFTGGRTKKGYMTE
FT                   AEVGRRYALKQGVPARNILFENTSRNTYENLNNIRPVLRANGIASVVIVSDPYHLARAA
FT                   EMAEDLGVRVYMSATPTTRFDAGNKKKIFMLQEGYALSLYRLEKWGWDFFNWLFH"
FT   CDS_pept        11641..13092
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="NMO_0014"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /function="Glutamyl- and glutaminyl-tRNA synthetases"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03328"
FT                   /db_xref="GOA:C6S4C8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4C8"
FT                   /protein_id="CBA03328.1"
FT                   /translation="MPKHGKNSKISRFKDSGAIMTVKTRFAPSPTGYLHIGGVRTALFS
FT                   WAFARHHKGEFLLRIEDTDLARSTAESVNIILDGMEWVGLDYDNADNVVYQTRRFERYK
FT                   EVIAELLAKGDAYYCYCSKEELEAMREKAEKEGTATYDRRWRPEAGKTLPEIPADVQPV
FT                   VRFKTPLDGVTKWADLVKGEISIPNEALDDLIIARSDGSPTYNFCVVVDDYDMGVTHVI
FT                   RGDDHVNNTPKQINILKAIGANLPEYGHLPMILNEQGKKISKRSGDTVAITDFGAMGIL
FT                   PEAMLNYLARLGWAHGDDEFFTMEQFIEWFDLKDVSPSPSRMDLKKLYWINGEHIKITP
FT                   NGKLAELIKPRLALRDIHETEKPALEDVLALVKDRAQDLNALTDECLYFYKKQVPAEAD
FT                   VAKHWDDEAAARMLRFAERLEGLEDWNAEAIHDLFKPFCDEEGIKMGKLGMPLRLAVCG
FT                   TAKTPSVDAVLALIGKEEVLKRIRA"
FT   CDS_pept        13113..13508
FT                   /transl_table=11
FT                   /locus_tag="NMO_0015"
FT                   /product="conserved hypothetical periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03331"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4C9"
FT                   /protein_id="CBA03331.1"
FT                   /translation="MPSDVGMRLQTAFKRKLNMKKIFYFLMVVFSTSVWAGDAEDNLLS
FT                   IQSGYRALLQKQNRLDGKIIGMQSDLEDARRRLQAAQADIARLEAEIPAAMAQKARQAE
FT                   ELRQIGVRLDHAWNAVYGAGGTKASGN"
FT   CDS_pept        13512..14003
FT                   /transl_table=11
FT                   /locus_tag="NMO_0016"
FT                   /product="putative acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03332"
FT                   /db_xref="GOA:C6S4D0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4D0"
FT                   /protein_id="CBA03332.1"
FT                   /translation="MNSLFVDNTVFITRLKAGHIGRLVQALFEEWHGFEPWSSVDKIHA
FT                   YYGRCLKDDELPLAFAAVDDFGTLLGSAAVKRHDMESFPQYEYWLGDVFVLPEYRGKGI
FT                   GRRLVAHCIGAARSLGIKFLYLYTPDVQIFYESFGWAVVGRHFHNGEWVTVMRLDMDKV
FT                   "
FT   CDS_pept        complement(14127..16721)
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="NMO_0017"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /function="Mismatch repair ATPase (MutS family)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03335"
FT                   /db_xref="GOA:C6S4D1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4D1"
FT                   /protein_id="CBA03335.1"
FT                   /translation="MSKSAVSPMMQQYLGIKAQHTDKLVFYRMGDFYEMFFDDAVEAAK
FT                   LLDITLTTRGQMDGVPIKMAGVPFHAAEQYLARLVKLGKSVAICEQVGEVGAGKGPVER
FT                   KVVRIVTPGTLTDSALLEDKETNRIVAVSPDKKYIGLAWASLQSGEFKTKLTTVDKLDD
FT                   ELARLQAAEILLPDSKNAPQLQTASGVTRLNAWQFAADAGEKLLTEYFGCQDLRGFGLD
FT                   GKEHAVAIGAAGALLNYIRLTQNLMPQHLDGLSLETDSQYIGMDAATRRNLEITQTLSG
FT                   KKSPTLMSTLDLCATHMGSRLLALWLHHPLRNHAHIRARQEAVAALESQYEPLQCRLKS
FT                   IADIERIAARIAVGNARPRDLAALRDSLFALSEIELSAECSSLLGTLKAVFPENLSTAE
FT                   QLRQAILPEPSVWLKDGNVINHGFHPELDELRCIQNHGDEFLLDLEAKERERTGLSTLK
FT                   VEFNRVHGFYIELSKTQAEQAPADYQRRQTLKNAERFITPELKAFEDKVLTAQEQALAL
FT                   EKQLFDGVLKNLQTALPQLQKAAKAAAALDVLSTFSALAKERNFVRPEFADYPVIHIEN
FT                   GRHPVVEQQVRHFTANHTDLDHKHRLMLLTGPNMGGKSTYMRQVALIVLLAHTGCFVPA
FT                   DAATIGPIDQIFTRIGASDDLASNRSTFMVEMSETAYILHHATEQSLVLMDEVGRGTST
FT                   FDGLALAHAVAEHLLQKNKSFSLFATHYFELTYLPETHAAAVNMHLSALEQGQDIVFLH
FT                   QIQPGPAGKSYGIAVAKLAGLPVRALKSAQKHLNELEDQAAANRPQLDIFSTMPSEKGD
FT                   EPNVESFVDKAEEKHFEGILAAALEKLDPDSLTPREALSELYRLKDLCKSVS"
FT   CDS_pept        17165..18169
FT                   /transl_table=11
FT                   /gene="gapC"
FT                   /locus_tag="NMO_0018"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /function="Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03336"
FT                   /db_xref="GOA:C6S4D2"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4D2"
FT                   /protein_id="CBA03336.1"
FT                   /translation="MSIKVAINGFGRIGRLALRQIEKAHGIEVVAVNDLTPAEMLLHLF
FT                   KYDSTQGRFQGTAELKDDAIVVNGKEIKVFANPNPEELPWGELGVDVVLECTGFFTNKT
FT                   KAEAHIRAGARKVVISAPGGNDVKTVVYGVNQDILDGSETVISAASCTTNCLALMAAVL
FT                   QKEFGVVEGLMTTIHAYTGDQNTLDAPHRKGDLRRARAAALNIVPNSTGAAKAIGLVIP
FT                   ELNGKLDGSAQRVPVATGSLTELVSVLERPVTKEEINAAMKAAASESYGYNEDQIVSSD
FT                   VVGIEYGSLFDATQTRVMTVGGKQLVKTVAWYDNEMSYTCQLVRTLEYFAGKI"
FT   CDS_pept        18213..18326
FT                   /transl_table=11
FT                   /locus_tag="NMO_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03339"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4D3"
FT                   /protein_id="CBA03339.1"
FT                   /translation="MRSDGIVYLYSGLNLNQYGVTSPCRTICTVCGFVALS"
FT   CDS_pept        complement(18427..19107)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0020"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03340"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4D4"
FT                   /protein_id="CBA03340.1"
FT                   /translation="MTYTIVPIATARSPYKQKFGIARQPGLVSAAEVCIELNPEFTADS
FT                   VRGLEDFDYVWISFIFHGVLDEGWAQMVRPPRLGGKQKMGVFATRSPHRPNHLGLSLLK
FT                   LNRIETGKPVRLYCSGADLLDGTPIIDIKPYIPFVESKPDAASGFVSGKPVELEVVWQE
FT                   NIGAENLSANTKNLISQSIAQDPRPAYQNIPERIYVMNIADYEVRFQIEENRATVIDLS
FT                   PTPL"
FT   CDS_pept        19222..19854
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="NMO_0021"
FT                   /product="putative nicotinamidase"
FT                   /function="Amidases related to nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03343"
FT                   /db_xref="GOA:C6S4D5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4D5"
FT                   /protein_id="CBA03343.1"
FT                   /translation="MIVSIDVDAQKTFTPLCPKELPVNEGHLIVEELNAQAALADLRVM
FT                   TKDAHHAAAKWLVDNPVDMLKPTGLPDADLTWVAHAMVGTRGYELLDGLPSAKEYDYCV
FT                   WKGVDPELHPYGACFHDIEEKLSTGLIEWLRCQNTDMVIVGGLATDYCVKTTVLQLLKG
FT                   GNWQVIVNEAACRGIAPETIETAWQEMRSSGAMILKNAKEIKKYINN"
FT   CDS_pept        19893..20861
FT                   /transl_table=11
FT                   /gene="rfaC"
FT                   /locus_tag="NMO_0022"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /function="ADP-heptose:LPS heptosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03345"
FT                   /db_xref="GOA:C6S4D6"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4D6"
FT                   /protein_id="CBA03345.1"
FT                   /translation="MKILLVRLSSMGDLIHTLPAIEDLARQCPDVELHWLCEAGFADIA
FT                   RLHPFVKKIHVMKWRQWRKHLFRAETWREMGHLKQTLRQEAFDFVLDSQGLIKSACFAK
FT                   MAKSPIYGLDKNSAREGLAAVVYEKTYAVPKGKNAVWRNRELFAQVFGYAMPETQVFGL
FT                   TVPEAGRLKNLAQPYYAALHATSRDSKLWPVENWRSLLQKLNEEQQCNIYLPWGSEVEK
FT                   TRAEQIADGLPFAIVCDKMNLLQAAYLLKYAVGIVGVDTGLLHLANALEKPVVGIYTDT
FT                   DPIKTGVQVSPIAKNLGNIGQIPTADLVYQTLMDCVAADKG"
FT   CDS_pept        21087..21836
FT                   /transl_table=11
FT                   /gene="etfB"
FT                   /locus_tag="NMO_0023"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /function="Electron transfer flavoprotein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03347"
FT                   /db_xref="GOA:C6S4D7"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4D7"
FT                   /protein_id="CBA03347.1"
FT                   /translation="MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEE
FT                   AVRLKEAGKVSEIVAVSLGEKKCEETLRTALAMGADRAIHVETDTKLESLAVAKLLKAV
FT                   ADKENPQIFFLGKQAIDDDANQVAQMLAALLNAAQGTFASKVHIEGGEVQIVREIDGGE
FT                   ETIALKLPAVISADLRLNEPRFVKLPNIMAAKKKPLEKLAPADLATDILPRLKTVKFAE
FT                   PKARQAGVKVASVAELVEKLKNEAKVI"
FT   CDS_pept        21847..22782
FT                   /transl_table=11
FT                   /gene="etfA"
FT                   /locus_tag="NMO_0024"
FT                   /product="electron transfer flavoprotein alpha-subunit"
FT                   /function="Electron transfer flavoprotein alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03348"
FT                   /db_xref="GOA:C6S4D8"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4D8"
FT                   /protein_id="CBA03348.1"
FT                   /translation="MSVLIIVEHDNKQLNPTTLHAVTAAAKLGKIDLLIAGSGASAVVE
FT                   FAKQVAGVEKVLVADAAHYAEGLAEELAPLVVKLAADYCYVAATATTFGKNLLPRVAAL
FT                   LDVPQISDLTEIVDNTTFVRPIYAGNAFETVQADSEKLVLTFRATVFDAVAAQGGNAEV
FT                   INVEATPAQNLSRFVNRQLSHSDRPELTQAKVIVSGGRALGSAEKFNEVLTPLADVLGA
FT                   AIGASRAAVDAEYAPNDAQVGQTGKVVAPQLYFAIGISGAIQHVAGMQDSKVIVAINKD
FT                   ADAPIFNVADYGLVGDLFEIVPQLTEVLKN"
FT   CDS_pept        22845..23456
FT                   /transl_table=11
FT                   /locus_tag="NMO_0025"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03350"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4D9"
FT                   /protein_id="CBA03350.1"
FT                   /translation="MITTYKTITSSTQAEFKDKGSRFIVFAYPIRTLADVKKYLDPLKE
FT                   EHHKARHWCYAYRLGVDGVQFRANDDGEPSGSAGRPILGQIDSVGITDVLVVVVRYFGG
FT                   TLLGVPGLIHAYKEATAQALAVAEVVEKNIEKTVWLKCEYPFLNEAIRIAKQYQADILE
FT                   RDLQLDCRLTVSLSLANYEACVAAWKNTRQIEVNTEKPFE"
FT   CDS_pept        complement(23510..23827)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03353"
FT                   /db_xref="InterPro:IPR025384"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4E0"
FT                   /protein_id="CBA03353.1"
FT                   /translation="MQKRIDEIQSKYREWCHLLPQLEEDIRRWKHAVALIRDMDNFYTH
FT                   EYQACHRAIEDEAEVDLRTEGEYSIMSEDALWNALGEFHQLAWLYLRSSVDALDRYTQE
FT                   D"
FT   CDS_pept        23985..25256
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="NMO_0027"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /function="Phosphoribosylamine-glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03355"
FT                   /db_xref="GOA:C6S4E1"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4E1"
FT                   /protein_id="CBA03355.1"
FT                   /translation="MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQN
FT                   IALTAHQDLIEFCRKENIAFTVVGPEAPLAAGIVDEFRAAGLKIFGPTQYAAQLESSKD
FT                   FAKAFMAKYNIPTAQYQTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAH
FT                   AAIDDMLLGNKMGNAGARVVIEDFLQGEEASFIVMVDGNHVLPMATSQDHKRLLDGDKG
FT                   PNTGGMGAYSPAPVVTPVVYERAMNEIILPTVAGMKAEGYEFTGFLYAGLMIDQSGAPY
FT                   TIEFNCRFGDPETQPIMSRLNSDLADLVEAAIDGKLDSVTAEWNPQTAVGVVLAAQNYP
FT                   ETPKKGDVISGLDAANQIGKVFHAGTTANEKGDVLTNGGRVLCVVGLGDNVVQAKAKAY
FT                   GALEKISFDGMQYRKDIADKAINR"
FT   CDS_pept        25290..25892
FT                   /transl_table=11
FT                   /locus_tag="NMO_0028"
FT                   /product="putative translation factor"
FT                   /function="Putative translation factor (SUA5)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03357"
FT                   /db_xref="GOA:C6S4E2"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4E2"
FT                   /protein_id="CBA03357.1"
FT                   /translation="MTNVLQTVFYIMLFPRIIAASAQRKLSVYLKKGGLVAYPTESCYG
FT                   LGCLPTLAKALGKLAHLKKRPQHKGMIVIGNQFEQLQPLLQMPSENLQDMLRKEWPAPK
FT                   TFLLSAKSCVLPELRGKQRSKLAVRVPAHVGARRLCQALQTPLVSTSCNRAGKRACRTE
FT                   REVRRQFGRDVWIVGGRIGRQKSPSQIIDGETGKRLR"
FT   CDS_pept        25920..26351
FT                   /transl_table=11
FT                   /locus_tag="NMO_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03358"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4E3"
FT                   /protein_id="CBA03358.1"
FT                   /translation="MHTQRKNFSDSISLHDCYCTGIKVEGRNVCFNFEDGFVVPDNNPN
FT                   NQAGKHLKTDFSRVVLTHKNENAEDDYLFDIFEDIVFLGKRLFTVRKFLDFSELLEMVN
FT                   TQGYFLEFLYLYSGLNLNQYGVASPCRTICTVCGFVALS"
FT   CDS_pept        complement(26525..26965)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0030"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03360"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4E4"
FT                   /protein_id="CBA03360.1"
FT                   /translation="MIKETLMRPIFLSFVLLPILITACSTPDKSARWENIGTISNGNIH
FT                   TYINKDSVRKNGNLMIFQDKKVVTNLKQERFANIPAYKTAIAEWEIHCNNKTYRLSSLQ
FT                   LFDTKNTEISTQNYTASSLRPMSILSGTLTEKQYETVCGKKL"
FT   CDS_pept        complement(27382..27969)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0031"
FT                   /product="RNA polymerase sigma factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03363"
FT                   /db_xref="GOA:C6S4E5"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014289"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4E5"
FT                   /protein_id="CBA03363.1"
FT                   /translation="MPLPDLTDAELIESRKLLLHFARLQLPDHPDLAEDLVQETLLSAY
FT                   SAGDSFQGRALVNSWLFAILKNKIIDALRQIGRQRKVFTALDDELLDEAFESHFSQNGH
FT                   WTPEGQPQHWNTPEKSLNNNEFQKILQSCLYNLPENTARVFTLKEILGFSSDEIQQMCG
FT                   ISTSNYHTIMHRARESLRQCLQIKWFNQENPK"
FT   CDS_pept        complement(27991..28737)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0032"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria."
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03365"
FT                   /db_xref="InterPro:IPR018640"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4E6"
FT                   /protein_id="CBA03365.1"
FT                   /translation="MQPETSAQYQHRFAQAIRGGEAADGLPQDRLNVYIRLIRNNIHSF
FT                   IDRCYTETRQYFDSEEWSRLKEGFVRDAHAQTPYFQEIPGEFLQYCQSLPLSDGILALM
FT                   DFEYTQLLAEVAQIPDIPDIHYSNDSKYTPSPAAFIRQYRYDVTDDLHEAETALLIWRN
FT                   AEDDVMYQTLDGFDMMLLEIMGSSALSFDTLAQTLVEFMPEDDNWKNILLGKWSGWTEQ
FT                   RIIIPSLSAISENMEGNSPGQNHLSA"
FT   CDS_pept        complement(28727..29569)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0033"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03367"
FT                   /db_xref="InterPro:IPR007801"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4E7"
FT                   /protein_id="CBA03367.1"
FT                   /translation="MIQHAGLGYRRDLAEDFLSLSENSPICFIEAAPENWLKMGGWARK
FT                   QFDRVAERLPLALHGLSMSLGGQAPLDTDLIDGIKEMMRRYDCTFFSDHLSYCHDGGHL
FT                   YDLLPLPFTEEMVHHTARRIREVQDRLGCRIAVENTSYYLHSPLAEMNEVEFLNAVARE
FT                   ADCGIHLDVNNIYVNAVNHGLLSPEAFLKNVDADRVCYIHIAGHDVETPELLIDTHGAA
FT                   VLPTVWDLLELAYAKLPTIPPTLLERDFNFPPFAELEAEVAKIADYQTRAGKECRRAA"
FT   CDS_pept        complement(29685..29993)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0034"
FT                   /product="putative membrane protein"
FT                   /function="Uncharacterized low-complexity protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03369"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4E8"
FT                   /protein_id="CBA03369.1"
FT                   /translation="MNKNIAAALAGALSLSLAAGAVAANKPASNATGVHKSAHGSCGAS
FT                   KSAEGSCGAAGSKAGEGKCGEGKCGATVKKTHKHTKASKAKAKSAEGKCGEGKCGSK"
FT   CDS_pept        complement(30067..30516)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0035"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03371"
FT                   /db_xref="GOA:C6S4E9"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4E9"
FT                   /protein_id="CBA03371.1"
FT                   /translation="MKIGTTWQTASAMLVLRLFAAYEFLESGLQKWNGENWFSEINDQF
FT                   PFPFNLLPDALNWNLAMYAELLLPVLLLLGLATRLSALGLMVVTAVAWAAVHAGSGYNV
FT                   CDNGYKMALIYIVVLIPLLFQGAGGWSLDTLLKKRFCPQCRLKQD"
FT   CDS_pept        30858..31751
FT                   /transl_table=11
FT                   /locus_tag="NMO_0036"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03373"
FT                   /db_xref="GOA:C6S4F0"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4F0"
FT                   /protein_id="CBA03373.1"
FT                   /translation="MVTFSKIRPLLAIAAAALLAACGTAGNNAARKPVQTAKPAAVVGL
FT                   ALGGGASKGFAHVGIIKVLKENGIPVKVVTGTSAGSIVGSLFASGMSPDRLELEAEILG
FT                   KTDLVDLTLSTSGFIKGEKLQNYINRKVGGRRIQQFPIKFAAVATDFETGKAVAFNQGN
FT                   AGQAVRASAAIPNVFQPVIIGRHTYVDGGLSQPVPVSAARRQGANFVIAVDISARPGKN
FT                   ISQGFFSYLDQTLNVMSVSALQNELGQADVVIKPQVLDLGAVGGFDQKKRAIRLGEEAA
FT                   RAALPEIKRKLAAYRY"
FT   CDS_pept        31854..32957
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="NMO_0037"
FT                   /product="peptide chain release factor 2"
FT                   /function="Protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03375"
FT                   /db_xref="GOA:C6S4F1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4F1"
FT                   /protein_id="CBA03375.1"
FT                   /translation="MEAEVINQLNNTLNDLEKRSEDIRVYMDYQGKKDRLEEVVGLSED
FT                   PELWNDPKRAQEIGKERKILEGIVLTLDNIASGIEDNRMLIEMTVEENDEEGFAAVQED
FT                   VAGLEKQMADLEFKRMFNQPADPNNCFIDITAGAGGTEAEDWAGMLFRMYSRYAERKGF
FT                   KIEILEEDDGEIAGINRATIRVEGEYAYGLLRTETGVHRLVRYSPFDSNNKRHTSFASV
FT                   FVYPEIDDSIEIEINPADLRIDTYRASGAGGQHINKTDSAVRITHEPTGIVVQCQNDRS
FT                   QHANKAAAMEMLKSKLYELEMRKRNEEKQALEEGKSDVGWGSQIRSYVLDSSRIKDLRT
FT                   GYEVGNTKAVLDGDLDGFIEASLKQGV"
FT   misc_RNA        33070..33370
FT                   /locus_tag="NMO_sRNA1"
FT                   /product="rnpB"
FT   CDS_pept        complement(33867..35324)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0038"
FT                   /product="peptide transporter"
FT                   /function="Dipeptide/tripeptide permease"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03377"
FT                   /db_xref="GOA:C6S4F2"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4F2"
FT                   /protein_id="CBA03377.1"
FT                   /translation="MSRHPAPTGEKTFFGHPFQLSTLFHIELWERFSFYGMQGILLIYL
FT                   YYTADKGGLGIDKTLAGGIVGAYSGSVYLSTILGAWFADRVWGAEKTLFLSGIVVMLGH
FT                   IVLAAAPGLYGLLIGLIFIALGSGGVKSTASSMVGALYEQDEMRPLRDAGFSIFYIAIN
FT                   IGGFLGPLLTGLLQENIGFHYGFGAAAVGMAFGLWRYSLGRKNLPHPTVPHPLSKGQGK
FT                   TAAAVGITLIAALATAIKTGLVNLDNFSGILLSTVILAVIAYFARLLTNPRVSSDNKRH
FT                   IIAYIPLFLTICMFWAVWFQIYTVATVYFDETVNRTIGSFTVPVAWKDSMQSLWVILFS
FT                   GLMAAMWTKMGRKQPKTPLKFAMAVFVTGASFLGFVPFISAGTPMPIAVFALIVLAITI
FT                   GELMISPIALSISTKIAPPLFKTQMVALNFLAFSLGFTLGGVLFEKGYQAGDEIGFYRL
FT                   LFYIGAATGFLLLLLVPKLNKMLEGTD"
FT   CDS_pept        complement(36364..40533)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0039"
FT                   /product="putative periplasmic protei"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03379"
FT                   /db_xref="GOA:C6S4F3"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4F3"
FT                   /protein_id="CBA03379.1"
FT                   /translation="MTDTAPTDTDPTENGTRKMPSEHRPAPPAKKRRPLLKLSAALLSV
FT                   LILAVCFLGWLAGTEAGLRFGLYQIPSWFGVNISSQNLKGTLLDGFDGDNWSIETEGAD
FT                   LKISRFRFAWKPSELMRRSLHITEISAGDIAIVTKPTPPKEERPPQGLPDSIDLPAAVY
FT                   LDRFETGKISMGKTFDKQTVYLERLNAVYRYDRKGHRLDLKAADTPWSSSSGSASVGLK
FT                   KPFALDTAIYTKGGLEGKTIHSTARLSGSLKDVRAELAIDGGNIRLSGKSVIHPFAESL
FT                   DKTLEEVLVKGFNINPAAFVPSLPDAGLNFDLTAIPSFSDGIALEGSLDLENTKAGFAD
FT                   RNGIPVRQVLGSFVIRQDGTVHIGNTSVALLGRGGIRLSGKIDTGKDILDLNIGINSVG
FT                   AEDVLQTAFKGRLDGSIGIGGTTASPKISWQLGIGTARTDGSLAIASDPANGQRKLVLD
FT                   TVNIAAGQGSLTAQGYLELFKDRLLKLDIRSRAFDPSRIDPQLPAGNINGSINLAGELA
FT                   KEKFTGKMRFLPGTFNGVPIAGSADIVYESRHLPRAAVDLRLGRNIIKTDGGFGKKGDR
FT                   LNLNITAPDLSRFGFGLAGSLNVRGHLSGDLDGGIRTFETDLSGAARNLHIGKAADIRS
FT                   LDFTLKGSPDTSRPIRADIKGSRLSLSGGAAVVDTADLMLDGTGVQHRIRTHAAMTLDG
FT                   KPFKFDLDASGGINRELTRWKGSIGILDIGGAFNLKLQNRMTLEAGAERVAASAANWQA
FT                   MGGSLNLQHFSWDKKTGISAKGGAHGLHIAELHNFFKPPFEHNLVLNGDWDVAYGRNAR
FT                   GYLNISRQSGDAVLPGGQALGLNAFSLKTRFQNDRIGILLDGGARFGRINADLGIGNAF
FT                   GGNMANAPLGGRITASLPDLGALKPFLPAAAQNITGSLNAAAQIGGRVGSPSVNAAVNG
FT                   SSNYGKINGNITVGQSNSFSTSPLGGKLNLTVADAEVFRNFLPVGQTVKGSLNAAVTLG
FT                   GSIADPHLGGSINGDKLYYRNQTQGIILDNGSLRSHIAGRKWVIDSLKFRHEGTAELSG
FT                   TVGMENSGPDVDIGAVFDKYRILSRPNRRLTVSGNTRLRYSPQKGISVTGMIKTDQGLF
FT                   GSQKSSMPSVGDDVVVLGEVKKEAAAPLPVNMNLTLDLNDGIRFAGYGADVTIGGKLTL
FT                   TAQSGGSVRGVGTVRVIKGRYKAYGQDLDITKGTVSFVGPLNDPNLNIRAERRLSPVGA
FT                   GVEILGSLNSPRITLTANEPMSEKDKLSWLILNRAASGSSGDNAALSAAAGALLAGQIN
FT                   DRIGLVDDLGFTSKRSRNAQTGELNPAEQVLTVGKQLTGKLYIGYEYSISSAEQSVKLI
FT                   YRLTRAIQAVARIGSRSSGGELTYTIRFDRFSGSDKKDSAGNGKGK"
FT   CDS_pept        complement(40588..42435)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0040"
FT                   /product="putative outer membrane protein"
FT                   /function="Predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03381"
FT                   /db_xref="GOA:C6S4F4"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4F4"
FT                   /protein_id="CBA03381.1"
FT                   /translation="MHDTRTMMIKPTALLLPALFFFPHAYAPAADLSENKAAGFALFKN
FT                   KSPDTESVKLKPKFPVRIDTQDSEIKDMVEEHLPLITQQQEEVLDKEQTGFLAEEAPDN
FT                   VKTMLRSKGYFSSKVSLTEKDGAYTVHITPGPRTKIANVGVAILGDILSDGNLAEYYRN
FT                   ALENWQQPVGSDFNQDSWENSKTSVLGAVTRKGYPLAKLGNTRAAVNPDTATADLNVVV
FT                   DSGRPIAFGDFEITGTQRYPEQIVSGLARFQPGTPYDLDLLLDFQQALEQNGHYSGASV
FT                   QADFDRLQGDRVPVKVSVTEVKRHKLETGIRLDSEYGLGGKIAYDYYNLFNKGYIGSVV
FT                   WDMDKYETTLAVGISQPRNYRGNYWTSNVSYNRSTTQNLEKRAFSGGIWYVRDRAGIDA
FT                   RLGAEFLAEGRKIPGSDVDLGNSHATMLTASWKRQLLNNVLHPENGHYLDGKIGTTLGT
FT                   FLSSTALIRTSARAGYFFTPENKKLGTFIIRGQAGYTVARDNADVPSGLMFRSGGASSV
FT                   RGYELDSIGLAGPNGSVLPERALLVGSLEYQLPFTRTLSGAVFHDMGDAAANFKRMKLK
FT                   HGSGLGVRWFSPLAPFSFDIAYGHSDKKIRWHISLGTRF"
FT   CDS_pept        42847..44076
FT                   /transl_table=11
FT                   /locus_tag="NMO_0041"
FT                   /product="sodium/dicarboxylate symporter family protein"
FT                   /function="Na+/serine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03382"
FT                   /db_xref="GOA:C6S4F5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4F5"
FT                   /protein_id="CBA03382.1"
FT                   /translation="MAFGKSLFHAIGRVSLVRQIAAGLALGIVIGSVSPQLGLAAGLFG
FT                   SLFVGALKAVAPVLVFILVAATIAQHQKGNKAHIRPIIILYLIGTFSAALTAVIAGMVF
FT                   PTHIVLAGAGDVSAAPPSGIVEVLKSLLMNLVANPINAIANANYIGILAWALVLGAALR
FT                   NHGSDVTRQVVADLAEAVSTVVKWIIRFAPLGIFGLVSSTIAETGFGALAGYAKLLAVL
FT                   LGCMAFIALAVNPAIVWWKIRRNPYPLVFTCLRESGVYAFFTRSSAANIPVNMALAKKL
FT                   GLHEDTYSISIPLGATVNMGGAAITITVLAMAAAHTQGIQVDFATALLLSLVATVSACG
FT                   ASGVAGGSLLLIPLACSLFGISNDVAMQVVAVGFIIGVIQDSAETALNSSTDVLFTAAA
FT                   DLGRQRNRAE"
FT   CDS_pept        44188..45672
FT                   /transl_table=11
FT                   /locus_tag="NMO_0042"
FT                   /product="periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03385"
FT                   /db_xref="InterPro:IPR001677"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4F6"
FT                   /protein_id="CBA03385.1"
FT                   /translation="MFERSVIAMACIFALSACGGGGGGSPDVKSADTPSKPAAPVVTED
FT                   VGEEVLPKEKKDEEAVSGAPQADTQDATAGKGGQDMAAVSAENTGNGGAATTDKPKNED
FT                   AGVQNDMPQNAADTDSLTPNHTPAPNMPTGDMGNQAPDSGESAQPANQPDMENAADGIQ
FT                   GDDPSAGGENAGNTAAQGTNQAENNQAAGSSDSAPASNPAPANGGGDFGRTNVANGVLI
FT                   DGPSQNITLTHCKGDSCDNGNLLDEEAPSKSEFESLNDSGRIDKYKKDGQDKFTNLVAT
FT                   KVEKKGLNKYVIFYTDTPPTRSARSRRLRRSLPAEMPLIPVNQADTLIVDGEAVSLTGH
FT                   SGNIFAPEGNYRYLTYGAEKLSGGSYALSVQGEPAKGEMLAGTAVYNGEVLHFHTENGR
FT                   SYPTKGRFAAKVDFGSKSVDGIIDSGDDLHMGKQKFKAAIDGNGFKGNWTENGGGDVSG
FT                   RFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQD"
FT   CDS_pept        complement(45747..45962)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03386"
FT                   /db_xref="GOA:C6S4F7"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4F7"
FT                   /protein_id="CBA03386.1"
FT                   /translation="MFKLGVYACLGLFAGWVLLLIVQLWFSFLEAELFFKITLTMAGLF
FT                   VIILAALLVFGQYFSEKKMKDDGFIN"
FT   CDS_pept        complement(45955..46197)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03389"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4F8"
FT                   /protein_id="CBA03389.1"
FT                   /translation="MIPYVKRNPMKEYKVVIYQESPLSSLFFGAAKVNPVNFSAFLNKQ
FT                   TPEGWRVVTMEKDLRRMLLFFKREAYVVILERDRV"
FT   CDS_pept        complement(46245..47588)
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="NMO_0045"
FT                   /product="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03391"
FT                   /db_xref="GOA:C6S4F9"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4F9"
FT                   /protein_id="CBA03391.1"
FT                   /translation="MSQNHTILQNLPVGQKVGIAFSGGLDTSAALLWMKLKGALPYAYT
FT                   ANLGQPDEDDYNAIPKKAMEYGAENARLIDCRTQLAHEGIAAIQCGAFHVSTGGIAYFN
FT                   TTPLGRAVTGTMLVSAMKEDDVNIWGDGSTYKGNDIERFYRYGLLTNPALKIYKPWLDQ
FT                   QFIDELGGRHEMSEFLIANGFNYKMSVEKAYSTDSNMLGATHEAKDLEFLNSGIKIVKP
FT                   IMGVAFWDENVEIEPEEVSVRFEEGVPVALNGKEYADPVELFLEANRIGGRHGLGMSDQ
FT                   IENRIIEAKSRGIYEAPGMALFHIAYERLVTGIHNEDTIEQYRINGLRLGRLLYQGRWF
FT                   DSQALMLRETAQRWVAKAVTGEVTLELRRGNDYSILNTESPNLTYQPERLSMEKVEDAA
FT                   FTPLDRIGQLTMRNLDITDTRAKLGIYSQSGLLSLGEGSVLPQLGNKQ"
FT   CDS_pept        48052..48852
FT                   /transl_table=11
FT                   /locus_tag="NMO_0046"
FT                   /product="putative molybdopterin-binding protein"
FT                   /function="Predicted nucleotide-utilizing enzyme related to
FT                   molybdopterin-biosynthesis enzyme MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03392"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4G0"
FT                   /protein_id="CBA03392.1"
FT                   /translation="MNAFNLIIIGDEILHGSRQDKHFAFFKSLLESKGLKLNQVQYLPD
FT                   EPDLLVRQLSRSFSDGIPTFVTGGIGATPDDHTRQAAAAALDLPVVRHPEAAKFIEGVT
FT                   QKRSEPLDSPEHAQRLKMADFPEGAELVPNPFNNIAGFSIREHYFFPGFPVMAHPMAEW
FT                   VLETYYADRFNQTERGSRSVYVFEQPESRITPLMEHIEQTYPGVRSYSLPSVGWTHSDG
FT                   TQVKPHIEFGIKAEGEAVNLLDAAWAEVLHSLDGLGAELKNRVN"
FT   CDS_pept        48892..49878
FT                   /transl_table=11
FT                   /locus_tag="NMO_0047"
FT                   /product="putative ClpP class peptidase"
FT                   /function="Periplasmic serine proteases (ClpP class)"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03394"
FT                   /db_xref="GOA:C6S4G1"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4G1"
FT                   /protein_id="CBA03394.1"
FT                   /translation="MQYRIRRENEAPEAKNAGETLWERDIMREVLLSAYRDRRRERMWK
FT                   NIWRAVSTLILVALIAGIFRKDEAALQLAGNTPHTAVVNLYGEIGNGVEDQVKKLKDGM
FT                   EAAYKNPQAKAIIIRANSPGGSPVVSNTAFEEIRRLKAQHPGIPVYLVAEDMCASGCYY
FT                   IAAAADKIYADPSSIVGSIGVIGSSFDATGLMEKIGVKRRVKIAGSNKGMGDPFSPETP
FT                   EQSKIWEEMLTGIHGEFIKAVKTGRGGRLKFRQYPDVFSGRVYTGADAQKVGLVDGLGN
FT                   IYSVARDVVKAPDVVDYTPKDDFGRILGRRFGAELKASVREALQAVR"
FT   CDS_pept        50012..50452
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0048"
FT   mobile_element  50553..50768
FT                   /mobile_element_type="other:ISHpa1"
FT                   /locus_tag="NMO_0049"
FT   CDS_pept        complement(50835..51209)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0050"
FT   CDS_pept        complement(51382..51738)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03399"
FT                   /db_xref="InterPro:IPR031891"
FT                   /db_xref="InterPro:IPR038223"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4G2"
FT                   /protein_id="CBA03399.1"
FT                   /translation="MNEHNLLIFCLKDNVSISEYTEMIDWAYKNIQSETVVEITESQII
FT                   EYQNRGLWRLVSEITDNWLFGPSEGDWLIDKESILAVKEKLQNSDFSTEPLVKNIIHVL
FT                   EYAIKNEKTVIFHF"
FT   CDS_pept        complement(51743..51937)
FT                   /transl_table=11
FT                   /gene="mafB1"
FT                   /locus_tag="NMO_0052"
FT                   /product="putative MafB alternative C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03401"
FT                   /db_xref="InterPro:IPR008106"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4G3"
FT                   /protein_id="CBA03401.1"
FT                   /translation="MGINANPNCADEAGKLIWENDPNKNWWANRMDDIRGIIQGAVNPL
FT                   IYKVSKQKIIYNNKLILRT"
FT   CDS_pept        complement(52007..52215)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_PS73"
FT   CDS_pept        complement(52292..52651)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03404"
FT                   /db_xref="InterPro:IPR028964"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4G4"
FT                   /protein_id="CBA03404.1"
FT                   /translation="MRLKLKNYDCSDFDLEDFPQDKLENFCILLTLSIGFDESNGADYF
FT                   YVYIYSTEWLLSNIHRPMSLKNSIVTNRFNIEHILKLINDILEICNSTSEDKSISNLAK
FT                   YFDWEFDDYNLNIQD"
FT   CDS_pept        complement(52648..52866)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03406"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4G5"
FT                   /protein_id="CBA03406.1"
FT                   /translation="MMTESHGYLSNNLPVKIINDIIYATQLVEDLVLGKIKIVDFLKSY
FT                   NNFYCWLGFDELPQSEKIKFLSYLNIL"
FT   CDS_pept        complement(53059..54582)
FT                   /transl_table=11
FT                   /gene="mafB5"
FT                   /locus_tag="NMO_0056"
FT                   /product="putative adhesin MafB"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03408"
FT                   /db_xref="InterPro:IPR008106"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4G6"
FT                   /protein_id="CBA03408.1"
FT                   /translation="MNLPIQKFMMLFAAAISLLQIPISHANGLDARLRDDMQAKHYEPG
FT                   GKYHLFGDGRGSVKNRVYAVQTFDATAVGPILPITHERTGFEGVIGYETHFSGHGHEVH
FT                   SPFDHHDSKSTSDFSGGVDGGFTVYQLHRTGSEIHPEDGYDGPQGSDYPPPGGARDIYS
FT                   YYVKGTSTKTKTNIVPQAPFSDRWLKENAGAASGFFSRADEAGKLIWENDPNKNWWANR
FT                   MDDIRGIVQGAVNPFLTGFQGVGIGAITDSAVSPVTDTAAQQTLQGINHLGNLSPEAQL
FT                   AAATALQDSAFAVKDGINSARQWADTHPNITATAQTALAVAEAAGTVWGGKKVELNPTK
FT                   WDWVKNTGYKKPAARPMQTLDGEMAGGNKPPKPSTQQHPTHSDNNIGLPASYVKPDTSI
FT                   SPTGTIQDRIRWTKSKFPTEKSLNGHFKAHGKEFGDITIEDYQKMASDLLSKQTSDKIL
FT                   GYQTEHRRVRYDINIYVLANPKTFKIKTMFKPNLGKKYYDGEFKKDMGN"
FT   CDS_pept        54702..54836
FT                   /transl_table=11
FT                   /locus_tag="NMO_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03410"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4G7"
FT                   /protein_id="CBA03410.1"
FT                   /translation="MGRSYPYDCRMVGYLYPTKIFDASIVSEMPLLENVGFENPTYGC"
FT   CDS_pept        complement(55076..55486)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03412"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4G8"
FT                   /protein_id="CBA03412.1"
FT                   /translation="MKIYNLDNIITSSALSLYKSTWVKLDLISCAKFIIEGTDFTFDWD
FT                   EGIENWIVFFHKNKVIGYLCAKLPFAILDNEQLKNQLYHKYPHVLTLQIKNIETEKISL
FT                   NVNICRLTLCPSFHDEHDTLVCSVQDFYVNTV"
FT   CDS_pept        complement(56369..56725)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03413"
FT                   /db_xref="InterPro:IPR031891"
FT                   /db_xref="InterPro:IPR038223"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4G9"
FT                   /protein_id="CBA03413.1"
FT                   /translation="MNEHNLLIFCLKDNVSISEYTEMVDWAYKNIQSETVVEITENQII
FT                   EYQNRGLWGLVSEITDNWLFGPSEGDWLIDKESILAVKEKLQNSDFSTEPLVKNIIHVL
FT                   EYAIKNEKTVIFHF"
FT   CDS_pept        complement(56891..57265)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03416"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4H0"
FT                   /protein_id="CBA03416.1"
FT                   /translation="MIIQNEFNLYPSNMLPEGFCYPEKYVRISNDTSLIPYIQPHNFHW
FT                   WFENYGTEGAEVAYIFRNSILPDLNLIPFASNGEWEAYFDGNDVTGNPRVIVINLDNIE
FT                   NHEFFNSFEEWLELAIKDTW"
FT   CDS_pept        complement(57262..58158)
FT                   /transl_table=11
FT                   /gene="mafB7"
FT                   /locus_tag="NMO_0062"
FT                   /product="putative adhesin MafB"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03418"
FT                   /db_xref="InterPro:IPR008106"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4H1"
FT                   /protein_id="CBA03418.1"
FT                   /translation="MDDIRGIVQGAVNPFLTGFQGVGIGAITDSAVSPVTDTAAQQTLQ
FT                   GINHLGNLSPEAQLAAATALQDSAFAVKDGINSAKQWADAHPNITATAQTALSAAEAAG
FT                   TVWRSKKVKLNPTKWDWVKNTGYETTVTRKTLDGQIAGKNKPIKPSSGDYVLPVGRQII
FT                   DPTRTSFSQATVSYQKRGANYNYDSLVAAMNEKKSWVGDRVDVVNMPDGAPTSMDNTRI
FT                   MAAREAGVKVEANVHNFNDPIPLERAKSISYQGKIPKTWGEAIQFRIKKQSENGLAPPN
FT                   WSTQFPNGSIYDPKVTK"
FT   CDS_pept        complement(58260..58778)
FT                   /transl_table=11
FT                   /gene="mafB9"
FT                   /locus_tag="NMO_0063"
FT                   /product="putative adhesin MafB, truncated"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03419"
FT                   /db_xref="InterPro:IPR008106"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4H2"
FT                   /protein_id="CBA03419.1"
FT                   /translation="MNLPIQKFMMLFAAAISLLQIPISHANGLDARLRDDMQAKHYEPG
FT                   GKYHLFGDGRGSVKNRVYAVQTFDATAVGPILPITHERTGFEGVIGYETHFSGHGHEVH
FT                   SPFDHHDSKSTSDFSGGVDGGFTVYQLHRTGSEIHPEEQGIYTAIMSKELQQKQRLILS
FT                   LKPHFQTVG"
FT   CDS_pept        complement(58818..59780)
FT                   /transl_table=11
FT                   /gene="mafA"
FT                   /locus_tag="NMO_0064"
FT                   /product="putative adhesin MafA"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03422"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4H3"
FT                   /protein_id="CBA03422.1"
FT                   /translation="MQARLLIPILFSVFILSACGTLTGIPSHGGGKRFAVEQELVAASA
FT                   RSAVKDMDLQALHGRKVALYIATMGDQGSGSLTGGRYSIDALIRGEYINSPAVRTDYTY
FT                   PRYETTAETTSGGLTGLTTSLSTLNAPARSRTQSDGSGSKSSLGLNIGGMGDYRNETLT
FT                   TNPRDTAFLSHLVQTVFFLRGIDVVSPANADTDVFINIDVFGTIRNRTEMHLYNAETLK
FT                   AQTKLEYFAVDRTNKKLLIKPKTNAFEAAYKENYALWMGPYKVSKGIKPTEGLMVDFSD
FT                   IRPYGNHTGNSAPSVEADNSHEGYGYSDEVVRQHRQGQP"
FT   CDS_pept        complement(59964..60683)
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="NMO_0065"
FT                   /product="Uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03424"
FT                   /db_xref="GOA:C6S4H4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4H4"
FT                   /protein_id="CBA03424.1"
FT                   /translation="MTQQIKYKRVLLKLSGESLMGSDPFGINHDTIVQTVGEIAEVVKM
FT                   GVQVGIVVGGGNIFRGVSAQAGSMDRATADYMGMMATVMNALALKDAFETLGIKARVQS
FT                   ALSMQQIAETYARPKAIQYLEEGKVVIFAAGTGNPFFTTDTAAALRGAEMNCDVMLKAT
FT                   NVDGVYTADPKKDPSATRYETITFDEALLKNLKVMDATAFALCRERKLNIVVFGIAKEG
FT                   SLKRVITGEDEGTLVHC"
FT   CDS_pept        complement(60900..61754)
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="NMO_0066"
FT                   /product="elongation factor EF-Ts"
FT                   /function="Translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03426"
FT                   /db_xref="GOA:C6S4H5"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4H5"
FT                   /protein_id="CBA03426.1"
FT                   /translation="MAEITAKMVADLRAATGLGMMECKKALVEAEGNFDKAEEILRIKS
FT                   GAKAGKLAGRTAAEGVLAYAINGNVGALVEVNCETDFVAKDAGFVEFANFVAKTAAEKK
FT                   PASVEELSELVEAERKAIIAKLGENMSVRRFQVIDTANQLVAYIHGALATEGVLVEFKG
FT                   SEDVARKIGMHIVAAKPQCVSEAEVDAETVEKERHIYTEQAIASGKPADIAAKMVEGRI
FT                   RKFLAEITLNGQAFVMNPDQTVAQFAKENGTEVVSFVRYKVGDGIEKAVVDYAAEVAAA
FT                   AKV"
FT   CDS_pept        complement(61884..62645)
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="NMO_0067"
FT                   /product="30S ribosomal protein S2"
FT                   /function="Ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03428"
FT                   /db_xref="GOA:C6S4H6"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4H6"
FT                   /protein_id="CBA03428.1"
FT                   /translation="MCALNPFKEIKMSQITMRQMIEAGVHFGHQTRFWNPKMAQYIFGA
FT                   RNKIHIVNLEKTLPMFQDAQEAVRRLVANKGTVLFVGTKRQARDIIREEATRAGMPFVD
FT                   YRWLGGMLTNYKTVKQSIKRLEEKTAALENAAESGFSKKEILEMQRDVEKLERSLGGIK
FT                   NMKGLPDAIFVIDTGYQKGTLVEAEKLGIPVIAVVDTNNSPDGVKYVIPGNDDSAKAIR
FT                   LYCRGIADAVLEGKNQALQETVAAAQEAAAE"
FT   CDS_pept        complement(62789..63022)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0068"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03430"
FT                   /db_xref="GOA:C6S4H7"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4H7"
FT                   /protein_id="CBA03430.1"
FT                   /translation="MWHIVAIGYLFVAVMYSAAQPSIARSLIYLVFWAVLPTVFTVFVV
FT                   TVRRRNRLMKRQEQAEFEQQRAQRQKDSGTKP"
FT   CDS_pept        63100..63681
FT                   /transl_table=11
FT                   /locus_tag="NMO_0069"
FT                   /product="putative formyltetrahydrofolate cyclo-ligase"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03432"
FT                   /db_xref="GOA:C6S4H8"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4H8"
FT                   /protein_id="CBA03432.1"
FT                   /translation="MRNEEKRALRRELRGRRSQMGRDVRAAATVKINHLLKRYIKKGRK
FT                   IGVYWPMGKELRLDGFVRAAQKRGAELYLPYIEPRSRRMWFTPYPADGVKQERKRGRAK
FT                   LHVPQFAGRKKRVHDLNLLLVPVVGMDRLGYRLGQAGGYYDATLAAMKYRLQAKTVGVG
FT                   FACQLVGTLPREAHDLPLDGFVSEAGILCF"
FT   CDS_pept        63742..64332
FT                   /transl_table=11
FT                   /locus_tag="NMO_0070"
FT                   /product="conserved hypothetical protein"
FT                   /function="Acetyltransferases including N-acetylases of
FT                   ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03434"
FT                   /db_xref="GOA:C6S4H9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4H9"
FT                   /protein_id="CBA03434.1"
FT                   /translation="MSERIILPVLSLGGVRLEPLDVHHETGLREAVCDGEVWKLGVTSA
FT                   PHPDRVADYIGTALATRLAFAVVDEEAGRVVGTTAYYHFEPQIPRLDIGFTWYAASARR
FT                   TRINTCCKIMLLDYAFDVLACRCVGWRTDILNLASQRAIERLGAEKDGVLRMHILRKDG
FT                   SVRDTVVYSMLRKDWCKNREILTGRLAGYGVQV"
FT   CDS_pept        64869..66335
FT                   /transl_table=11
FT                   /gene="mqo"
FT                   /locus_tag="NMO_0071"
FT                   /product="malate:quinone oxidoreductase"
FT                   /function="Predicted dehydrogenase"
FT                   /EC_number="1.1.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03435"
FT                   /db_xref="GOA:C6S4I0"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4I0"
FT                   /protein_id="CBA03435.1"
FT                   /translation="MAEATDVVLVGGGIMSATLGVLLKELEPSWEITLIERLEDVALES
FT                   SNAWNNAGTGHSALCELNYAPLGADGIINPARALNIAEQFHISRQFWATLVAEGKLEDN
FT                   SFVNAVPHMSLVMNEDHCRYLQKRYDVFKTQKLFENMEFSTDRNKISDWAPLIMRGRDE
FT                   NQPVAANYSAEGTDVDFGQLTRQMVKYLQGKGVKTEFNRHVEDIKRESDGAWVLKTADT
FT                   RNPDGQLTLRTRFLFLGAGGGALTLLQKSGIPEGKGYGGFPVSGLFFRNSNPETAEQHN
FT                   AKVYGQASVGAPPMSVPHLDTRNVDGKRHLMFGPYAGFRSNFLKQGSLMDLPLSIHMDN
FT                   LYPMLRAGWANMPLTKYLLGELRKTKEERFASLLEYYPEANPDDWELITAGQRVQIIKK
FT                   DSEKGGVLQFGTEIVAHADGSLAALLGASPGASTAVPLMIRLMHQCFPKRAPSWEGRLK
FT                   ELVPGYGIKLNENPERADEIIAYTAKVLDI"
FT   CDS_pept        complement(66523..67083)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03438"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4I1"
FT                   /protein_id="CBA03438.1"
FT                   /translation="MPSETPDRSPYPACRPCLKPPNRPNPPFYKLYPISCLFQDTPTLE
FT                   CQTARNGQTPHPSKGIKMKLLTTAILSSAIALSSMAAAAGTNNPTVAKKTVSYVCQQGK
FT                   KVKVTYGFNKQGLTTYASAVINGKRVQMPVNLDKSDNVETFYGKEGGYVLGTGVMDGKS
FT                   YRKQPIMITAPDNQIVFKDCSPR"
FT   CDS_pept        complement(67135..67434)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03439"
FT                   /db_xref="GOA:C6S4I2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4I2"
FT                   /protein_id="CBA03439.1"
FT                   /translation="MKIFENIEDVKAIRKKTGLNQIDFWGKVGVTQSGGSRYETGRKMP
FT                   KPVRELLRLVHIECIDLAKVNKKDMEIAALLKKHHPDLYAELSKQTKSERKKQS"
FT   CDS_pept        complement(67589..68368)
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="NMO_0074"
FT                   /product="Methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03441"
FT                   /db_xref="GOA:C6S4I3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4I3"
FT                   /protein_id="CBA03441.1"
FT                   /translation="MNGIIIKTPEEIEKMRELGKLVAEALDYIGQFVKPGVTTDEIDKL
FT                   VYDYHVNVQGGYPAPLHYGNPPYPKSCCTSVNHVICHGIPDDKPLKEGDIINIDLTIKK
FT                   DGFHGDSSRMFTVGKVSPIAQRLIDVTHASMMAGIEAVKPGATLGDVGYACQQVAENAG
FT                   YSVVQEFCGHGIGRGFHEAPQVLHYGKKGQGPVLKPGMIFTVEPMINQGKRHLRILNDG
FT                   WTVVTKDRSLSAQWEHEVLVTETGYEILTVSPASGKP"
FT   CDS_pept        complement(68408..69058)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0075"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03443"
FT                   /db_xref="GOA:C6S4I4"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4I4"
FT                   /protein_id="CBA03443.1"
FT                   /translation="MPSEPPSDGIARHPKSTIKMAKKPNKPFRLTPKLLIRVVLLICIT
FT                   AIGALAIGIVSTFNPNGGKTLQTEPQHTDSPRETEFWLPNGVVGQDAAQPEHHHAASSE
FT                   PAQPDGTDESGSGLPSPAAPKKNRVKPQPADTAQTDRQPDDAGTQAENTLKETPVLPTN
FT                   VPRPEPRKETPEKQAQPKETPKEKETPKENHTKPDTPKNTPPKPHKEILDNLF"
FT   CDS_pept        complement(69066..69674)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0076"
FT                   /product="putative outer membrane or periplasmic OsmY-type
FT                   protein"
FT                   /function="Predicted periplasmic or secreted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03445"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4I5"
FT                   /protein_id="CBA03445.1"
FT                   /translation="MKPKPHTVRTLIAAIFSLALSGCVSAVIGSAAVGAKSAVDRRTTG
FT                   AQTDDNVMALRIETTARSYLRQNNQTKGYTLQISVVGYNRHLLLLGQVATEGEKQFVGQ
FT                   IARSEQAAEGVYNYITVASLPRTAGDIAGDTWNTSKVRATLLGISPATQARVKIVTYGN
FT                   VTYVMGILTPEEQAQITQKVSTTVGVQKVITLYQNYVQR"
FT   CDS_pept        complement(69738..70331)
FT                   /transl_table=11
FT                   /gene="lpcA"
FT                   /locus_tag="NMO_0077"
FT                   /product="Phosphoheptose isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03448"
FT                   /db_xref="GOA:C6S4I6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4I6"
FT                   /protein_id="CBA03448.1"
FT                   /translation="MTTLQERVAAHFAESIRAKQEAGKVLVEPTVQAAELMLQCLMNDG
FT                   KILACGNGGSAADAQHFAAEMTGRFEKERMELAAVALTTDTSALTAIGNDYGFNHVFSK
FT                   QVRALGRAGDILVGISTSGNSANVIEAIKAAHERDMHVIALTGRDGGKIAAILKDTDVL
FT                   LNVPHPRTARIQENHILLIHAICDCIDSVLLEGM"
FT   CDS_pept        complement(70336..70683)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0078"
FT                   /product="putative endonuclease"
FT                   /function="Predicted endonuclease distantly related to
FT                   archaeal Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03449"
FT                   /db_xref="GOA:C6S4I7"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4I7"
FT                   /protein_id="CBA03449.1"
FT                   /translation="MRLNHKQGEAGEDAALAFLQSQGCTLLARNWHCAYGEIDLIVKNG
FT                   GMILFVEVKYRKNRQFGGAAYSISPSKLLKLQRSVEYYLQQNRLTNVPCRLDAVLIEGS
FT                   RPPEWIQNITG"
FT   CDS_pept        70703..71605
FT                   /transl_table=11
FT                   /locus_tag="NMO_0079"
FT                   /product="putative methyltransferase"
FT                   /function="Predicted methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03451"
FT                   /db_xref="GOA:C6S4I8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4I8"
FT                   /protein_id="CBA03451.1"
FT                   /translation="MSVFQTAFFMFQKHLQKASDSVVGGTLYVVATPIGNLADITLRAL
FT                   AVLQKADIICAEDTRVTAQLLSAYGIQGKLVSVREHNERQMADKIVGYLSDGMVVAQVS
FT                   DAGTPAVCDPGAKLARRVREVGFKVVPVVGASAVMAALSVAGVAGSDFYFNGFVPPKSG
FT                   ERRKLFAKWVRAAFPVVMFETPHRIGATLADMAELFSERRLMLAREITKTFETFLSGTV
FT                   GEIQTALSADGNQSRGEMVLVLYPAQDEKHEGLSESAQNIMKILTAELPTKQAAELAAK
FT                   ITGEGKKALYNLALSWKNK"
FT   CDS_pept        complement(71640..71993)
FT                   /transl_table=11
FT                   /gene="cybB"
FT                   /locus_tag="NMO_0080"
FT                   /product="putative cytochrome b561"
FT                   /function="Cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03454"
FT                   /db_xref="GOA:C6S4I9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4I9"
FT                   /protein_id="CBA03454.1"
FT                   /translation="MITLRIVWAVANRAKRPQSDSKAAAAGHGILYLLMLAVPVIGMIR
FT                   QYGSGRGPLKVFGVEVMQGSPEKIEWMANLGNTFHGNLGWLLFAAVVGHVAMVVVHRVQ
FT                   GKDVLYRMTGRVR"
FT   CDS_pept        72551..73705
FT                   /transl_table=11
FT                   /locus_tag="NMO_0081"
FT                   /product="probable GTP-binding protein"
FT                   /function="Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03456"
FT                   /db_xref="GOA:C6S4J0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4J0"
FT                   /protein_id="CBA03456.1"
FT                   /translation="MKFIDEAKIEVAAGKGGNGATSFRREKFVPRGGPDGGDGGKGGSV
FT                   WAEADENTNTLVEYRFVKRYQAKNGEKGHGSDRYGAGADDIVLKMPVGTLIRDLDTDEI
FT                   VADLTYHGQRVCLAKGGKGGLGNIHFKSSVNRAPKQSTPGEEGETRSLQLELKVLADVG
FT                   LLGMPNVGKSTLITAVSAARPKIANYPFTTLHPNLGVVRIDENHSFVMADIPGLIEGAA
FT                   EGAGLGHRFLKHLSRTGLLLHVVDLAPFDETVNPAEEALAIINELRKYDEELYGKPRWL
FT                   VLNKLDMLDEEEAQTRTAAFLEAVGWDYPKPDDRFQFDMETPRLFQISALTHQGTQELV
FT                   HQINQYLTEKKRIEAEKAEAEKAAANVEIAEQQPKTDTGVFKPE"
FT   CDS_pept        73759..74706
FT                   /transl_table=11
FT                   /locus_tag="NMO_0082"
FT                   /product="putative type II DNA modification
FT                   methyltransferase"
FT                   /function="Site-specific DNA methylase"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03458"
FT                   /db_xref="GOA:C6S4J1"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4J1"
FT                   /protein_id="CBA03458.1"
FT                   /translation="MYKTIDLFSGIGGIRLGFEKYGCTNVFSSEWDKYARQMYEANFGE
FT                   KPFGDINGIDPSDIPDHDILLAGFPCQPFSIAGKGLGFEDTRGTLFFNIAEILKTKQPK
FT                   AFLLENVKRLTTHDSGRTFRIILETLKQLGYTVYFKVLNTLDFGLPQKRERIYIIGFSD
FT                   NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDALKQKRLAALKKAPPTPSIWHENIG
FT                   GNVSALPYSCALRAGGSYNYLVVNGVRRLTGREMLRLQGFPDDFEINIPYSQVRKVAGN
FT                   SVSVPVIEAIAENMLASLSGKVEQKGQLDLLEAG"
FT   CDS_pept        74703..75755
FT                   /transl_table=11
FT                   /locus_tag="NMO_0083"
FT                   /product="putative type II restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03459"
FT                   /db_xref="GOA:C6S4J2"
FT                   /db_xref="InterPro:IPR019058"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4J2"
FT                   /protein_id="CBA03459.1"
FT                   /translation="MTLEEQQAKEALDGIIKKSRVHLYKPIQIAEILYHDRCIKQLDFL
FT                   NLDTYRNQSKRWRDEICRRFLGRISTSSAKFQDNLFEKNAMPPEKLAVLGTLNRQLDGG
FT                   VESYIYKQFFNRFSQMSEALAYVGNTDRYSFQLSEFLNLFWLEPGLKRSIDKIYEIVVY
FT                   ALFDALVSELGITVSIDFPKENLFLWEEYQDFAEKIVSIPQNGHLKLPAKIHRVGVTNA
FT                   ADRGLDMWSNFGLAIQVKHLSLDEELAEDIVSSISADRIVIVCKKAEQSVIVSLLTQIG
FT                   WKSRIQNIVTEDDLIRWYEKALRGQYPIAEALLENIKTEIMREFPAVNEANEFLDFAQS
FT                   RGYDITVTHF"
FT   CDS_pept        75765..77192
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="NMO_0084"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03462"
FT                   /db_xref="GOA:C6S4J3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4J3"
FT                   /protein_id="CBA03462.1"
FT                   /translation="MNMTTIYNTLTRQKEPFAPIDPENVRMYVCGMTVYDYCHLGHARV
FT                   MVVFDMIARWLRECGYPLTYVRNITDIDDKIIARAAENGETIGKLTARFIQAMHEDADA
FT                   LGVLRPDIEPKATENIPQMIAMIETLIQNGKAYPAANGDVYYAVREFAAYGQLSGKSLD
FT                   DLRAGERVEVDGFKRDPLDFVLWKAAKAGEPAWESPWGNGRPGWHIECSAMSENLFGDT
FT                   FDIHGGGADLQFPHHENEIAQSVGASGHTCGHDHAQTHHGQSIASHVKYWLHNGFIRVD
FT                   GEKMSKSLGNFFTIREVLKQYDPEVVRFFILRAHYRSPLNYSDAHLDDAKGALTRLYTT
FT                   LKNTPAAEFGLSENANDYTRRFYAAMNDDFGTVEAVAVLFELAGEVNKTNDAHLAGCLK
FT                   ALGGIIGLLQRDPIEFLQGGAVSDGLSNEEIDDLIARRKQARADKNWAESDRIRDLLNE
FT                   HKIILEDNAGGTTWRRG"
FT   CDS_pept        77275..78054
FT                   /transl_table=11
FT                   /locus_tag="NMO_0085"
FT                   /product="putative DNA repair endonuclease"
FT                   /function="Exonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03464"
FT                   /db_xref="GOA:C6S4J4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4J4"
FT                   /protein_id="CBA03464.1"
FT                   /translation="MLKIISANVNGIRSAYKKGFYEYIAASGADIVCVQELKAQEADLS
FT                   ADMKNPHGMHGYWHCAEKRGYSGVAVYSKRKPDNVQIGMGIEEFDREGRFVRCDFDRLS
FT                   VISLYLPSGSSAEERQQVKYRFLDAFYPMLEAMKNEGRDIVVCGDWNIAHQNIDLKNWK
FT                   GNQKNSGFLPEEREWIGKVIHKLGWTDMWRTLYPDVPGYTWWSNRGQAYAKDVGWRIDY
FT                   QMVTPELAAKAVSAHVYKDEKFSDHAPLVMEYDYAAE"
FT   CDS_pept        78035..78385
FT                   /transl_table=11
FT                   /locus_tag="NMO_0086"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03466"
FT                   /db_xref="GOA:C6S4J5"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4J5"
FT                   /protein_id="CBA03466.1"
FT                   /translation="MTMLPNKVLGKYDWNVDGKTGIGAAWVVAAFILPILVWAIFMLSR
FT                   MQGWLAPTKANPTWALVWLLICMPCLLIASKCLGWKGWRRVVNIFACLTVCAILSVPAS
FT                   LLIAFTLRDLLK"
FT   CDS_pept        78396..78926
FT                   /transl_table=11
FT                   /locus_tag="NMO_0087"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03468"
FT                   /db_xref="GOA:C6S4J6"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4J6"
FT                   /protein_id="CBA03468.1"
FT                   /translation="MQGFELEDLTLWLIRDAGEDQMWIDRWAISYPVVQMSEASAGQSI
FT                   GEWQAGLRTAFERIRGKYVAVVAHGAGAAAFLAWLYQADILTRKKIANIILVPQRPDIF
FT                   PDDAEHTFQRVRCPCRAALVVPEHGGVPHGWAQKQADLWNARLLVSPHSGSLNGMLGGW
FT                   QWGMKLMQEMLLA"
FT   CDS_pept        complement(79154..80269)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0088"
FT                   /product="Aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03470"
FT                   /db_xref="GOA:C6S4J7"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4J7"
FT                   /protein_id="CBA03470.1"
FT                   /translation="MKVGFVGWRGMVGSVLMQRMKEENDFAHIPEAFFFTTSNVGGAAP
FT                   DFGQAAKTLLDANDVAELAKMDIIVTCQGGDYTKSVFQALRDSGWNGYWVDAASSLRMK
FT                   DDAIIVLDPVNRNVIDNGLKNGVKNYIGGNCTVSLMLMALGGLFQNDLVEWATSMTYQA
FT                   ASGAGAKNMRELISGMGAVHAQVADELADPAGSILDIDRKVSDFLRSEDYPKANFGVPL
FT                   AGSLIPWIDVDLGNGQSKEEWKGGVETNKILGRSDNPTVIDGLCVRVGAMRCHSQAITL
FT                   KLKKDLPVSEIETILAGANDWVKVIPNEKEASIHELTPAKVTGTLSVPVGRIRKLGMGG
FT                   EYISAFTVGDQLLWGAAEPLRRVLRIVLGSL"
FT   CDS_pept        80598..81179
FT                   /transl_table=11
FT                   /locus_tag="NMO_0089"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein/domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03471"
FT                   /db_xref="GOA:C6S4J8"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4J8"
FT                   /protein_id="CBA03471.1"
FT                   /translation="MEEKNDYTDAASDNRNGQEIEVGIAGAGDRILAALLNQLFTFLVL
FT                   LVPFAGLIAFAIKNEGRIGGSEEIFGLLLGMTSFWVGLAGILVYTVVQIYYMSRDGQSL
FT                   GKKIMRIRVLKTDGRNPGFVGTVLVREIAWSVLVAIIAAVIGLAVGDNGENAINLLAFL
FT                   ANFVLLFMVKRDRRTLYDILADTVVVKLPK"
FT   CDS_pept        complement(81241..82095)
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="NMO_0090"
FT                   /product="methylenetetrahydrofolatedehydrogenase/cyclohydro
FT                   lase"
FT                   /function="510-methylene-tetrahydrofolate
FT                   dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03473"
FT                   /db_xref="GOA:C6S4J9"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4J9"
FT                   /protein_id="CBA03473.1"
FT                   /translation="MSAQLINGKEVSQKRLQAVAEAVAQRQQDNLHMPCLAVVLVGGDP
FT                   ASAVYVRNKKTACQKCGIKSLSYELPESTSQEELLALVDRLNADSEVDGILVQLPLPKH
FT                   LDSQAVLERISPDKDVDGFHPYNVGRLAVKMPLMRPCTPKGVMTLLEAYGIDPKGKKAV
FT                   VVGASNIVGRPQALELLLARATVTVCHSATENLTDEVAGADILVVGVGIPNFVKGEWIK
FT                   PGAVVIDVGINRLDDGSLCGDVEFETAKERAAMITPVPGGVGPMTIATLMENTLHAASL
FT                   HDA"
FT   tRNA            82318..82395
FT                   /locus_tag="NMO_tRNA02"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:82353..82355,aa:Pro)"
FT   tRNA            82420..82496
FT                   /locus_tag="NMO_tRNA03"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:82454..82456,aa:Arg)"
FT   tRNA            82524..82599
FT                   /locus_tag="NMO_tRNA04"
FT                   /product="tRNA-His"
FT                   /anticodon="(pos:82557..82559,aa:His)"
FT   CDS_pept        82813..83319
FT                   /transl_table=11
FT                   /locus_tag="NMO_0091"
FT                   /product="putative ltransferase"
FT                   /function="ADP-heptose synthase bifunctional sugar
FT                   kinase/adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03475"
FT                   /db_xref="GOA:C6S4K0"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4K0"
FT                   /protein_id="CBA03475.1"
FT                   /translation="MVDAWSVPDFESKICPPEALAARLALLPRPLVFTNGCFDILHRGH
FT                   VTYLAQARSAGAALVLALNTDASVRRLGKGGDRPINPLENRAAVAAALESVDLVTWFDG
FT                   DTPAALIEAVKPEILVKGGDWAADKIVGAAETLARGGQVFSIPFLHQTSTTKTLAKIRA
FT                   AEGGK"
FT   CDS_pept        83316..85094
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="NMO_0092"
FT                   /product="putative biotin protein ligase"
FT                   /function="Biotin-(acetyl-CoA carboxylase) ligase"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03477"
FT                   /db_xref="GOA:C6S4K1"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4K1"
FT                   /protein_id="CBA03477.1"
FT                   /translation="MTVLKPSHWRVLAELADGLPQHVSQLARMADMKPQQLNGFWQQMP
FT                   AHIRGLLRQHDGYWRLVRPLAVFDAEGLRELGERSGFQTALKHECASSNDEILELARIA
FT                   PDKAHKTICVTHLQSKGRGRQGRKWSHRLGECLMFSFGWVFDRPQYELGSLSPVAAVAC
FT                   RRALSRLGLKTQIKWPNDLVVGRDKLGGILIETVRTGGKTVAIIGIGINFVLPKEVENA
FT                   ASVQSLFQTASRRGNADAAVLLETLLAELDAVLLQYARDGFAPFVAEYQAANRDHGKAV
FT                   LLLRDGETVFEGTVKGVDGQGVLHLETAEGKQTVVSGEISLRSDDRPVSVPKRRDSERF
FT                   LLLDGGNSRLKWAWVENGTFATVGSAPYRDLSPLGAEWAEKADGNVRIVGCAVCGEFKK
FT                   AQVQEQLARKIEWLPSSAQALGIRNHYRHPEEHGSDRWFNALGSRRFSRNACVVVSCGT
FT                   AVTVDALTDDGHYLGGTIMPGFHLMKESLAVRTANLNRHAGKRYPFPTTTGNAVASGMM
FT                   DAVCGSVMMMHGRLKEKTGAGKPVDVIITGGGAAKVAEALPPAFLAENTVRVADNLVIH
FT                   GLLNLIAAEGGESEHT"
FT   CDS_pept        85207..86031
FT                   /transl_table=11
FT                   /locus_tag="NMO_0093"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03479"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4K2"
FT                   /protein_id="CBA03479.1"
FT                   /translation="MKWLFTLLAVLNIAVFGGTVGYKLAVKATGGVPENRAVENTPPAT
FT                   PAADNAAASVEDTAALLKPGDILTEEQAEQLRLKKEAEQKKLREKKQREEKARREKLAA
FT                   EKAQAERENGAADALCAAQASLTMDEDDYHRIKGLLGKWSHVASRSVEKRTAKAKPADK
FT                   TYRVVLPVSADAENQAAELSAKGFNPIPFDGALSLGVGNSRENAQALQNRLAGAGFGGA
FT                   HIVEHFAEADRQDDSLSVSRMTVLFTGVNAADADEIRKITSLYGKLNLKSCK"
FT   CDS_pept        complement(86249..86452)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03481"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4K3"
FT                   /protein_id="CBA03481.1"
FT                   /translation="MTTLSAPNRTDVQTRATLFPSGTKPSAMTADPNLSDTMKVCRPES
FT                   QTSADRLICLFFIVLQKICIYF"
FT   CDS_pept        complement(86794..87582)
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="NMO_0095"
FT                   /product="thiG protein"
FT                   /function="Uncharacterized enzyme of thiazole biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03484"
FT                   /db_xref="GOA:C6S4K4"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4K4"
FT                   /protein_id="CBA03484.1"
FT                   /translation="MLTLYSETFPSRLLLGTAAYPTPEILKQSVRTARPAMITVSLRRA
FT                   GCGGEAHGQGFWSLLQETGVPVLPNTAGCQSVQEAVTTAQMAREVFETDWIKLELIGDD
FT                   DTLQPDVFQLVEAAEILIKDGFKVLPYCTEDLIACRRLLDAGCQALMPWAAPIGTGLGA
FT                   VHAYALNVLRERLPDTPLIIDAGLGLPSQAAQVMEWGFDGVLLNTAVSRSGDPVNMARA
FT                   FALAVESGRLAFEAGPVEARDKAQASTPTVGQPFWHSAEY"
FT   CDS_pept        complement(87796..87990)
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="NMO_0096"
FT                   /product="thiamin biosynthesis ThiS"
FT                   /function="Sulfur transfer protein involved in thiamine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03485"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4K5"
FT                   /protein_id="CBA03485.1"
FT                   /translation="MNIILNGGPAELHGTSVADLIAQTAPQKPFAVAVNTVFVPKGAYA
FT                   ETVLNENDKIDIVRPVVGG"
FT   CDS_pept        complement(88412..89029)
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="NMO_0097"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /function="Thiamine monophosphate synthase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03487"
FT                   /db_xref="GOA:C6S4K6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4K6"
FT                   /protein_id="CBA03487.1"
FT                   /translation="MTFPPLKSPLKFYAVVPTADWVGRMVKAGADTVQLRCKALHGDEL
FT                   KREIARCVAACQGSHTQLFINDHWREAIEAGAYGVHLGQEDMDTADLAAIAAAGLRLGL
FT                   STHSVAELDRALSVHPSYIASGAIFPTTTKQMPTAPQGLDKLCEYVKQAGGTPVVAIGG
FT                   IDLNNARAVLATGVSSLAAVRAVTEAANPEAVVKAFQALWDG"
FT   CDS_pept        complement(89050..90150)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0098"
FT                   /product="FAD dependent oxidoreductase"
FT                   /function="Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03490"
FT                   /db_xref="GOA:C6S4K7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4K7"
FT                   /protein_id="CBA03490.1"
FT                   /translation="MTRIAILGGGLSGRLTALQLAEQGYQIALFDKGCRRGEHAAAYVA
FT                   AAMLAPAAEAVEATPEVVRLGRQSIPLWRGIRCRLNTHTMMQENGSLIVWHGQDKPLSS
FT                   EFVRHLKRGGVADDEIVRWRADDIAEREPQLGGRFSDGIYLPTEGQLDGRQILSALADA
FT                   LDELNVPCHWEHECAPEDLQAQYDWLIDCRGYGAKTAWNQPPEYTSTLRGIRGEVARVY
FT                   TPEITLNRPVRLLHPRYPLYIAPKENHVFVIGATQIESESQAPASVRSGLELLSALYAV
FT                   HPAFGEADILEIATGLRPTLNHHNPEIRYSRKRRLIEINGLFRHGFMISPAVTAAAVRL
FT                   AVALFDGKDAPERDEESGLAYIRRQD"
FT   CDS_pept        complement(90147..91373)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0099"
FT                   /product="purine-cytosine transport protein"
FT                   /function="Purine-cytosine permease and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03492"
FT                   /db_xref="GOA:C6S4K8"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012732"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4K8"
FT                   /protein_id="CBA03492.1"
FT                   /translation="MSGNASSPSSSAGIGLIWFGAAVSIAEISTGTLLAPLGWQRGLAA
FT                   LLLGHAVGGALFFAAAYIGALTGRSSMESVRLSFSKRGSVLFSVANMLQLAGWTAVMIY
FT                   AGATVSSALGKVLWDVESFVWWALANGALIVLWLVFGARKTGGLKTVSMLLMLLAVLWL
FT                   SVEVFASSGTNAAPAVSDGMSFGTAVELSAVMPLSWLPLAADYTRHARRPFAATLTATL
FT                   AYTLTGCWMYALGLAAALFTGETDVAKILLGAGLGAAGILAVVLSTVTTTFLDAYSAGA
FT                   SANNISARFAETPVAVGVTLIGTVLAVMLPVTEYENFLLLIGSVFAPMAAVLIADFFVL
FT                   KRREEIESFDFAGLVLWLAGFILYRFLLSSGWESSIGLTAPVMSAVAIATVSVRLFFKK
FT                   TQSLQRNPS"
FT   CDS_pept        91617..93101
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="NMO_0100"
FT                   /product="TldD protein"
FT                   /function="Predicted Zn-dependent proteases and their
FT                   inactivated homologs"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03494"
FT                   /db_xref="GOA:C6S4K9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4K9"
FT                   /protein_id="CBA03494.1"
FT                   /translation="MPYNQAPDFLCADTMHPTYSAVQARLLEANRLSPELLAKSLCIIG
FT                   AHHVDYADIYCQRTAYESWHLEEGIVKSGSFQINQGVGVRAVSGDKTAFAYADSLCIDS
FT                   INRSARAVRAIGAAGGKVSAKMPSETRGKPVCSASDPIAGLDSAAKVALLNKVEAIAKA
FT                   ADPRIVQVMAGLTCEYDMVYLARLDGKHAADIRPMVRLNVTVIAKQGERREQGSAGGGG
FT                   RYDLAYFDENLVRQFVDAAVKQALTNLESRPAPAGEMTVVLGNGWPGVLLHEAVGHGLE
FT                   GDFNRKGTSVFSGRIGERVAAKGVTVVDQGDIAGRRGSLNIDDEGNETRRTVLIEDGIL
FT                   VGYMQDETNARLTGTQSTGNGRRESYASAPMPRMTNTFMENGSYEPEEIIASIDKGIYA
FT                   VNFGGGQVDITSGKFVFSASEAWWVEGGRLQYPVKGATIIGNGPEVLKHVSMIGNDTAL
FT                   DSGVGVCGKEGQSVPVGVGQPTLRIDAGLTVGGSAI"
FT   CDS_pept        93166..93627
FT                   /transl_table=11
FT                   /locus_tag="NMO_0101"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03495"
FT                   /db_xref="GOA:C6S4L0"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4L0"
FT                   /protein_id="CBA03495.1"
FT                   /translation="MQEQNRKSSFPIVMLLVSVALWIASLSNVAFYLGNHGSMEGLTVL
FT                   ILGSIFASLDIRYCAVYANYVWLAAIVLLALRKKVVPVHAALWGLALVAFSVKAVYVDE
FT                   AGNTSDIVRYGAGFYLWYAAFAVATIGTFAGKNKERKAASAADGIKNDV"
FT   CDS_pept        93617..94438
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="NMO_0102"
FT                   /product="heme biosynthesis protein"
FT                   /function="Methylase of polypeptide chain release factors"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03497"
FT                   /db_xref="GOA:C6S4L1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4L1"
FT                   /protein_id="CBA03497.1"
FT                   /translation="MTFDEWLGLSKLPKNEARMLLQYVSEYTRVQLLTRGGEEMPDEVR
FT                   QRADRLAQRRLNGEPVAYILGVREFYGRRFTVNPSVLIPRPETEHLVEAVLARLPENGR
FT                   VWDLGTGSGAVAVTVALERPDAFVRASDISPPALETARKNAADLGARVEFAHGSWFDTD
FT                   MPSEGKWDIIVSNPPYIENGDKHLLQGDLRFEPQIALTDFSDGLSCIRTLAQGAPDRLA
FT                   EGGFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRVTLGKYMKHLK"
FT   CDS_pept        94524..95912
FT                   /transl_table=11
FT                   /locus_tag="NMO_0103"
FT                   /product="probable transporter"
FT                   /function="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03500"
FT                   /db_xref="GOA:C6S4L2"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="InterPro:IPR032813"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4L2"
FT                   /protein_id="CBA03500.1"
FT                   /translation="MNAVVVAVIVMLVLSLSRVHVVLSLTVGAFVGGAVAGMPLQNIAD
FT                   AAGQVSQAGIIPVFNKGLEGGAKIALSYAMLGAFAMAITHSGLPQQLAGAVVRKLNRGG
FT                   MPDSVRSGEGAVKWLLLSIILVMGIMSQNIIPIHIAFIPMIVPPLLLVFNRLKIDRRLI
FT                   ACVITFGLVTTYMFLPYGFGAIFLNEILLGNIHSAAPQLDVKNINVMAAMAIPALGMLA
FT                   GLLLAFVHYRKPRLYQSNNADTAGNADAANRPQPSAYRSLAAAAAIAVCFAIQLMYEDS
FT                   LVLGAMLGFAVFMMLGVINRDKANDVFGEGIKMMAMVGFIMIAAQGFAAVMNATGHIQP
FT                   LVESSMAIFGNSKGMAALAMLVVGLLVTMGIGSSFSTLPIIAAIYVPLCVGLGFSPLAT
FT                   VAIVGTAGALGDAGSPASDSTLGPTMGLNADGQHDHIRDSVIPTFIHYNIPLLIAGWIA
FT                   AMVL"
FT   CDS_pept        95913..96137
FT                   /transl_table=11
FT                   /gene="slyX"
FT                   /locus_tag="NMO_0104"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03501"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4L3"
FT                   /protein_id="CBA03501.1"
FT                   /translation="MDAVQELEHRITELEIQSALQEDVIAGLNAMVAELRQTLDLQQAQ
FT                   LRLLYQKMQDRNPDAQEPYSLRDEIPPHY"
FT   CDS_pept        complement(96846..97793)
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="NMO_0105"
FT                   /product="adenylyltransferase"
FT                   /function="Dinucleotide-utilizing enzymes involved in
FT                   molybdopterin and thiamine biosynthesis family 2"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03505"
FT                   /db_xref="GOA:C6S4L5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4L5"
FT                   /protein_id="CBA03505.1"
FT                   /translation="MQLHDFSLIAVNTVNVPQMPHPCQTVHTLTARVPKCRLKLNAARR
FT                   QRYNRPQLFFPNIIMTTTEHDNDDAFLLRYSRHILLDEIGIEGQQKLSAAHILVVGCGG
FT                   LGAAALPYLAASGIGTLTIADSDTVELHNLQRQVAFDEGDVGKPKAEALADRLKRINHN
FT                   VDVRTVNEKLDGCRLTGLVQTADIVLDCCDNYATRQAVNRVCVQTKTPLVSGAAVRFEG
FT                   QLAVYRPDLPDSPCYACLFDGGSASDGICSLFGVFSPLVGIIGCTQAAEALKILLDVGE
FT                   PSHGRLAVYRALEGGWQYFDLPRNPECPICGTER"
FT   CDS_pept        97731..100484
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="NMO_0106"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03503"
FT                   /db_xref="GOA:C6S4L4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4L4"
FT                   /protein_id="CBA03503.1"
FT                   /translation="MRHLGYIYSIYGNERKIMQLHILNNPKDAALAADAEFLKQSLFNL
FT                   LHEEASPLVVETVKLLSTSDDSAALIEKVLPQLDEQQTHDLTLACGLFAQILNIAEDVH
FT                   HERRRQIHEEAGRGGAEGSLTETVRRLKAGKADGKSVQRQLDNTSVTAVLTAHPTEVQR
FT                   QTVLNFNRRIRALLPQRERCTNADALARLRREIDTILLGLWQTSETRRHKLSVNDEINN
FT                   GVSIFPMSFFEALPKLYRNMEHDFQMVYPDVCVPNILKIGGWIGGDRDGNPFVSAETLR
FT                   FAFRRHADAVFRFYRGELDKLYRELPLSIRRVKVNDDVMALAALSPDEELARTEEPYRR
FT                   AIAYIMARAMGKARALGLGMGCKFGFLEPYASAQEFLDDLKKLQRSLIDNGSRLLAEGR
FT                   LADLIRSVSVFGFHMMPLDLRQHAGKHADVVAELFQHAGLEDYNSLDEEQKQAALLREL
FT                   GHQRPLYSPFITYSDHTRRELAIFNEARKIKDEFGEDAVTQSIISNCEQPGDLLALALL
FT                   LKESGLLAVENGKPRSRINIVPLFETIEALENACPVMETMFRLDWYDALLESRGNIQEI
FT                   MLGYSDSNKDGGYVTSSWCLYQAELGLVELFKKYDVRMRLFHGRGGSVGRGGGPSYQAI
FT                   LAQPAGSVAGQIRITEQGEVITAKYADPGNAQRNLETLVAATLEASILPDKKDPDAKLM
FT                   QALSDVSFKYYRELITHPDFIDYFLQTSPIQEIATLNLGSRPASRKTLARIQDLRAIPW
FT                   VFSWMQNRLMLPAWYGFGSAVETLCEDKPETLAALREHAQSNPFFQAMLSNMEQVMAKT
FT                   DITLAENYAGLSESPDKAKIIFGMIKEEYRRSRKALLDLLQTEELLRDNRSLARSLALR
FT                   IPYLNALNGLQVAMLKRLRKEPDNPHALLMVHLTINGVAQGLRNTG"
FT   CDS_pept        100607..101596
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="NMO_0107"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03507"
FT                   /db_xref="GOA:C6S4L6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4L6"
FT                   /protein_id="CBA03507.1"
FT                   /translation="MKITVIGAGSWGTALALHFSQHGNRVSLWTRNADQVRQMQEAREN
FT                   KRGLPGFSFPETLEVCADLADALKDSGLVLIVTSVAGLRSSAELLKQYGAGHLPVLAAC
FT                   KGFEQDTGLLTFQVLKEVLPDNKKIGVLSGPSFAQELAKQLPCAVVLASENQEWIEELV
FT                   PQLNTTVMRLYGSTDVIGVAVGGAVKNVMAIATGLSDGLEYGLNARAALVTRGLAEITR
FT                   LASAMGAQPKTMMGLAGIGDLILTCTGALSRNRRVGLGLAEGKELHQVLVEIGHVSEGV
FT                   STIEEVFNTACKYQIDMPITQTLLQLIRKEMTPQQVVERLMERSARFE"
FT   CDS_pept        101651..101980
FT                   /transl_table=11
FT                   /locus_tag="NMO_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03509"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4L7"
FT                   /protein_id="CBA03509.1"
FT                   /translation="MKQNIEKLESSVYTLVQKFETLVSENRRLKETVAELKRAHERQKL
FT                   EHETAVDELSEALLVQVGKLKEDLQNKIDSLTEENTRYRSLLEQSREKISALAARLPQW
FT                   QETQQ"
FT   CDS_pept        101991..102296
FT                   /transl_table=11
FT                   /locus_tag="NMO_0109"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03511"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4L8"
FT                   /protein_id="CBA03511.1"
FT                   /translation="MNIEQVHIEVMHARLTVNTPAEEKDTLLQAVGMLNGKAEAIREGG
FT                   RVADSEKIVIMATLNVVHDLLKTSLNGGDLAIGDFARKIADMDNACQKALSRLAQE"
FT   CDS_pept        102659..103090
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="NMO_0110"
FT                   /product="50S ribosomal protein L13"
FT                   /function="Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03513"
FT                   /db_xref="GOA:C6S4L9"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4L9"
FT                   /protein_id="CBA03513.1"
FT                   /translation="MKTFSAKPHEVKREWFVIDAQDKVLGRVAAEVASRLRGKHKPEYT
FT                   PHVDTGDYIIVINADKLRVTGAKFEDKKYFRHSGFPGGIYERTFREMQEQFPGRALEQA
FT                   VKGMLPKGPLGYAMIKKLKVYAGAEHAHAAQQPKVLELK"
FT   CDS_pept        103100..103492
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="NMO_0111"
FT                   /product="30S ribosomal protein S9"
FT                   /function="Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03515"
FT                   /db_xref="GOA:C6S4M0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4M0"
FT                   /protein_id="CBA03515.1"
FT                   /translation="MNGKYYYGTGRRKSSVARVFLIKGTGQIIVNGRPVDEFFARETSR
FT                   MVVRQPLVLTENAESFDIKVNVVGGGETGQSGAIRHGITRALIDFDAALKPALSQAGFV
FT                   TRDAREVERKKPGLRKARRAKQFSKR"
FT   mobile_element  103643..104650
FT                   /mobile_element_type="other:ISNme1"
FT                   /locus_tag="NMO_0112"
FT   CDS_pept        complement(104981..105958)
FT                   /transl_table=11
FT                   /gene="metR"
FT                   /locus_tag="NMO_0113"
FT                   /product="transcriptional activator MetR"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03517"
FT                   /db_xref="GOA:C6S4M1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4M1"
FT                   /protein_id="CBA03517.1"
FT                   /translation="MNYFNMRRFNMPSEAPMDSIIELRHLKTLLALEETGSVSLAAKRV
FT                   FLTQSALSHQIRMLENHYGTPLFERKSTPLRFTPVGERLLRLAHELIPQVAVAERDLAR
FT                   ITEGEAGELRIAVECHTCFDWLMPAMGEFRPMWPQVELDIVSGFQADPVGLLLQHRADL
FT                   AIVSEAEKQNGISFQPLFAYEMVGICAPDHPLAAKNVWTAEDFIGETLITYPVPDEMLD
FT                   LPKKILIPKNINPPRRHSELTIAIIQLVASRRGIAAFPYWTVMPYLEKGYVVHRQITAD
FT                   GLQSKLYAAIRTEDTDKSYLNNFCQIIRERGFADLPGLSELEPV"
FT   CDS_pept        106041..106790
FT                   /transl_table=11
FT                   /locus_tag="NMO_0114"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03519"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4M2"
FT                   /protein_id="CBA03519.1"
FT                   /translation="MVLRRDFLAWCDETLQTASFKDYAPNGLQVEGREYIGKIVTSVTA
FT                   SRAAIDFAVEQKADLLLVHHGMFWKNELPTVTGWKKERIAALLRHDINMAGYHLPLDAH
FT                   PTLGNNAQLADRLGFATEKRFGEQNLLNSGSLKQAKTLGALAAHIETVLQRKPVVIGKP
FT                   EREIRRVAWCSGGAQGFFQTAIDEGVDLYLTGEISEAQYHLANETGTAFISAGHHATER
FT                   YGVRALAESAAEVFGLEVCHFDENNPA"
FT   CDS_pept        106913..107494
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="NMO_0115"
FT                   /product="ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /function="Rieske Fe-S protein"
FT                   /EC_number="1.10.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03521"
FT                   /db_xref="GOA:C6S4M3"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4M3"
FT                   /protein_id="CBA03521.1"
FT                   /translation="MDNQEINNGRRRFLTLATCGAGGVAALGVATPFVASFFPSEKAKA
FT                   AGAAVEVDVSKIEAGQLLTAEWQGKPIWVLNRTDQQLKDLKGLNGELTDPNSDAEQQPE
FT                   YAKNETRSIKPNILVAIGICTHLGCSPTFRPDIAPADLGADWKGGFFCPCHGSKFDLAG
FT                   RVYKGVPAPTNLVVPPYKYLSDTTILVGED"
FT   CDS_pept        107513..108862
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="NMO_0116"
FT                   /product="ubiquinol-cytochrome c reductase cytochrome b
FT                   subunit"
FT                   /function="Cytochrome b subunit of the bc complex"
FT                   /EC_number="1.10.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03523"
FT                   /db_xref="GOA:C6S4M4"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4M4"
FT                   /protein_id="CBA03523.1"
FT                   /translation="MANQTNSKAKALLGWMDARFPLSKMWNEHLAQYYAPKNFNFWYYF
FT                   GSLALLVLVIQIVSGIFLTMNYKPDGNLNAYHLPAAFTAVEYIMRDVSGGWIIRYMHST
FT                   GASFFFIVVYLHMFRGLIYGSYKKPRELVWIFGSLIFLALMAEAFMGYLLPWGQMSFWG
FT                   AQVIINLFSAIPVIGPDLSTWIRGDFNVSDVTLNRFFALHVIAVPLVLLGLVVAHIIAL
FT                   HEVGSNNPDGVEIKKNKDENGIPRDGIPFHPYYTVKDILGVVVFLIVFCAVLFFAPEGG
FT                   GYFLEAPNFDAANALKTPPHIAPVWYFTPFYAILRAIPSFLGTQVWGVIGMGAAVVLIA
FT                   LLPWLDRGEVKSVRYRGPIFKTALVLFIISFIGLGILGAMVATDTRTLVARILSFVYFA
FT                   FFLGMPFYTKLDKNKPVPERVTMSTAKQKIMFFVYVGITAVGAYLFATNI"
FT   CDS_pept        108877..109665
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="NMO_0117"
FT                   /product="ubiquinol-cytochrome c reductase cytochrome c1
FT                   subunit"
FT                   /function="Cytochrome c1"
FT                   /EC_number="1.10.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03525"
FT                   /db_xref="GOA:C6S4M5"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4M5"
FT                   /protein_id="CBA03525.1"
FT                   /translation="MKQAMKNWFAALLLAVPMGAAFASGGHAHYEKVDIDLRDQVSLQR
FT                   GAQIFTNYCLSCHSASGMRFNRLKDIGLTDEEIKKNLMFTTDNVGDVMHSAMNPKDAAK
FT                   WFGAAPPDLTLIARSKGADYLYAYMRGFYKDPTRPSGWNNTVFDKVGMPHPLWEQQGVQ
FT                   AVELDAKGQPVMVKDEHGEMKPKLYWESTGLHSRRLPNGKVIQKEYDAYVRDLVNYLVY
FT                   MGEPAQLQRKRIGYVVMIFLFAVMLPLAYFLKKEYWKDVH"
FT   CDS_pept        110004..111788
FT                   /transl_table=11
FT                   /locus_tag="NMO_0118"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03528"
FT                   /db_xref="GOA:C6S4M6"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4M6"
FT                   /protein_id="CBA03528.1"
FT                   /translation="MELMTVLLPLAALVSGVLFTWLLMKGRFQGEFAGLNAHLAEKAAR
FT                   CDFVEQAHGKTVSELAVLDGKYRHLQDENYALGNRFSAAEKQIAYLQEKEAESAHLKQS
FT                   YIDLQEKAQGLAVENERLATQLGQERKAFADQYALERQIRQRVETDLEESRQTVRDVQN
FT                   DLADVGNRFAAAEKQIAHLQEKEAEAERLRQSHTELQEKAQGLAVENERLATQIEQERL
FT                   ASEEKLSLLGEARKSLSDQFQNLANTILEEKSRRFTEQNREQLHQVLNPLNERIHGFGE
FT                   LVKQTYDKESRERLTLENELKRLQGLNAQLHSEAKALTNALTGTQNKVQGNWGEMILET
FT                   VLENSGLQKGREYVVQAASVRKEEDGGTRRLQPDVLVNLPDNKQIVIDSKVSLTAYVRY
FT                   TQAADADTAARELAAHVASIRAHMKGLSLKDYTDLEGVNTLDFVFMFIPVEPAYLLALQ
FT                   NDAGLFQECFDKRIMLVGPSTLLATLRTVANIWRNEQQNQNALAIADEGGKLYDKFVGF
FT                   VQTLESVGKGIDQAQNSFQTAFKQLAEGRGNLVGRAEKLRLLGVKANKQLARDLTERAN
FT                   ETTALSESLEYVAEDEAV"
FT   CDS_pept        complement(111994..112626)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0119"
FT                   /product="putative Zn-dependent hydrolase"
FT                   /function="Zn-dependent hydrolases including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03530"
FT                   /db_xref="GOA:C6S4M7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4M7"
FT                   /protein_id="CBA03530.1"
FT                   /translation="MTLRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALA
FT                   NRKLTLTAIWLTHGHLDHAGGVVEMLKTHKVPVLGPHPDDEFLLQSLPQTTAQYGFPVS
FT                   PAFAPNRWLEEGETLTVGRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRT
FT                   DFPRGNHADLINNIRNKLFTLPETVQVVAGHGRMTSIGHEKRHNPFF"
FT   CDS_pept        112679..113542
FT                   /transl_table=11
FT                   /locus_tag="NMO_0120"
FT                   /product="DNA ligase"
FT                   /function="ATP-dependent DNA ligase"
FT                   /EC_number="6.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03532"
FT                   /db_xref="GOA:C6S4M8"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029319"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4M8"
FT                   /protein_id="CBA03532.1"
FT                   /translation="MAVCRLFGYWGNRVIKKTIGGIIPIFMAVFIPASAGAADLMLAQE
FT                   YKDQEIAGWAMSEKLDGVRAYWDGKHLISRQGYAFTPPKGFTAQFPPYPLDGELYSGRG
FT                   QFEQISATVRSVSSDWRGIRLHVFDVPKAQGNLYQRLAVATQWLKTHPNAPITIIPQIK
FT                   VRDRQHAMDFLKQIEAQGGEGVMLRQPESRYSGGRSSQLLKLKSQYDDECTVTRHYEGK
FT                   GRNAGRLGAVGCKNRHGEFRIGSGFKDKDRDNPPKIGTLITYRYRGFTRKGTPKFATFV
FT                   RVRTDR"
FT   CDS_pept        113611..114174
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="NMO_0121"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /function="Hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03534"
FT                   /db_xref="GOA:C6S4M9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4M9"
FT                   /protein_id="CBA03534.1"
FT                   /translation="MTDLETKRLETQAMLENADLLFDQGQCRAALQKVADEITRDLGGK
FT                   YPLLLPVMGGAVVFTGQLLPLLRFPLDFDYVHVSRYGDKLEGGAFNWKRMPDAEQIRGR
FT                   HVVVLDDILDEGHTMSAIQAKLLEMGAASCRAAVFANKLIDKPKPIRADYVGLDVPNRY
FT                   VFGYGMDAAGCWRNLGEIYALDGK"
FT   CDS_pept        114255..114692
FT                   /transl_table=11
FT                   /locus_tag="NMO_0122"
FT                   /product="putative mannose-specific phosphotransferase
FT                   system component IIAB"
FT                   /function="Phosphotransferase system mannose/fructose-
FT                   specific component IIA"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03536"
FT                   /db_xref="GOA:C6S4N0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4N0"
FT                   /protein_id="CBA03536.1"
FT                   /translation="MIGLLIITHETIGEAYRKLAHHFFPGGLPENVRILGVQPTEDQDD
FT                   IINNAIAALQEFPDNDGVLIMTDIFGATPCNAARRLVRENKSAILTGLNAPMMVKAVQY
FT                   SPAAEDLAAFTECVREAAVKGIFAITSAPEDLVCRRSGDAV"
FT   CDS_pept        114761..115030
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="NMO_0123"
FT                   /product="phosphocarrier protein HPr"
FT                   /function="Phosphotransferase system HPr-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03538"
FT                   /db_xref="GOA:C6S4N1"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4N1"
FT                   /protein_id="CBA03538.1"
FT                   /translation="MLKQSIEIINKLGLHARASNKFTQTASQFKSEVWVTKNDSRVNGK
FT                   SIMGLMMLAAAKGTVIELETDGADEAEAMRALTDLINGYFGEGE"
FT   CDS_pept        115030..116805
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="NMO_0124"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /function="Phosphoenolpyruvate-protein kinase (PTS system
FT                   EI component in bacteria)"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03539"
FT                   /db_xref="GOA:C6S4N2"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4N2"
FT                   /protein_id="CBA03539.1"
FT                   /translation="MSIVLHGVAAGKGIAVGCAHLIARGTEEVPQYDVAEADTDAEAER
FT                   FDAAVKATRKELEQLRSAIPENAPTELGAFISLHLMLLTDVTLSREPVDILREQKINAE
FT                   WALKQQSDKLAAQFDNMDDAYLRERKQDMLQVVRRIHNNLIGQGNELEVADNLFDETVL
FT                   IANDLSPADTVLFKEQRIAAFVTDAGGPTGHTAILGRSLDIPSVVGLHNARKLITEGET
FT                   VIVDGINGVLIIAPDESVLNEYRRRAREYRSHKRDLNKLKKTAAATADGVCIELVGNIE
FT                   SAEDVKPLHNLGADGIGLFRSEFLYLNRDTMPSEDEQYEVYSAIVKKMKGKSVTIRTVD
FT                   LGVDKNPRWFGKNSTPNGSLNPALGMTGIRLCLAEPVMFRTQMRAILRAAVHGPVRMMW
FT                   PMITSVSEVRQCLIHLDTAQRQLAERGDAFGKVGIGCMIEIPSAALTVGSILKLVDFIS
FT                   VGTNDLIQYILSVDRGDDSVSHLYQPGHPAVLKMLQHVIRTANRMDKDVSVCGEMAGDT
FT                   AFTRVLLGMGLRRFSMNPNNILPVKNIILHSNVGQLESDIAKVIRCEDEEKAEKLIKQM
FT                   NSVSVEEEADFKGRK"
FT   CDS_pept        complement(117728..118666)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0125"
FT                   /product="putative ABC transporter"
FT                   /function="ABC-type spermidine/putrescine transport systems
FT                   ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03542"
FT                   /db_xref="GOA:C6S4N3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4N3"
FT                   /protein_id="CBA03542.1"
FT                   /translation="MLELNGLCKRFGGKTVADDICLTVGRGKILAVLGRSGCGKSTLLN
FT                   MIAGIVRPDGGEIQLNGENITRMPPEKRRISLMFQDYALFPHMSALENAAFGLKMQKMP
FT                   KAEAERLAMAALAEVGLENEVHRKPEKLSGGEKQRLALARALVVRPSLLLLDESFSSLD
FT                   THLRDRLRRMTAERIRNGGIPAVLVTHSPEEACTTADEIAVMYEGRILQYGTPETLVKT
FT                   PSCVQVARLMGLPNTNDDRHIPQHAVRFDQDGMECRVLSRTCLPESFSLSVLHPEHGIL
FT                   WLNLDMRHAGAVSGKDTVRIHIEEREIVRFR"
FT   CDS_pept        complement(118675..119724)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0126"
FT                   /product="conserved hypothetical protein"
FT                   /function="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03544"
FT                   /db_xref="GOA:C6S4N4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4N4"
FT                   /protein_id="CBA03544.1"
FT                   /translation="MPRGFVLPVSCFLFPAASIFCRIFLPAAISERQTAVCLRLQIQAV
FT                   WLQSSALSSRKPTMPTVRFTESVSKHDLDALFEWAKASYGAKSCWKTLYLNRLPLGNLS
FT                   PEWAERVKKDWEAGCSESSDGIFLNADGWPDMGRRLQHLTRTWNKAGLLHGWRNECFDL
FT                   TDGGGNILFSLERAAFRPFGLLSRAVHLNGLTESDGRWHFWIGRRSPHKAVDPGKLDNT
FT                   AAGGVSGGEMPSEAVCRESSEEAGLDKTLFPFIRPVSRLHSLRPVSRGVHNEILYVFDA
FT                   VLPETFLPENQDGEVAGFEKMDIGSLVAAMLSENMMHDAQLVTLDAFCRYGLIDAAHPL
FT                   SEWLDGIRL"
FT   tRNA            complement(119746..119822)
FT                   /locus_tag="NMO_tRNA05"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:119786..119788,aa:Met)"
FT   CDS_pept        120162..122063
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="NMO_0127"
FT                   /product="thiamine biosynthesis protein"
FT                   /function="Thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03546"
FT                   /db_xref="GOA:C6S4N5"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4N5"
FT                   /protein_id="CBA03546.1"
FT                   /translation="MTTPKKTAKTSGNEARELADLSEDIGIRFKYPNSERVYLQGSRDD
FT                   IRVPLREIRQDDTYTAQGTEANPPIPVYDTSGVYGDPAAHINLKQGLPHIRTAWLDERG
FT                   DTEILPKLSSEYGIERAHDPKTAHLRFNQITRPRRAKAGRNVTQLHYARQGIITPEMEF
FT                   VAIRERLKLDELSQKPEYAKLLKQHAGQSFGANIPTHPDQITPEFVRREIAAGRAIIPA
FT                   NINHPELEPMIIGRNFRVKINGNLGNSAVTSSLTEEVEKMVWSLRWGADTIMDLSTGAH
FT                   IHETREWIIRNAPVPIGTVPIYQALEKTGGIAEDLTWDLFRDTLIEQAEQGVDYFTIHA
FT                   GVLLRYVPMTANRLTGIVSRGGSIMAKWCLAHHRENFLYTHFDEICEIMKAYDVSFSLG
FT                   DGLRPGCIADANDESQFAELHTLGELTDKAWKHDVQVMIEGPGHVPLQRVKENMTEELQ
FT                   HCFEAPFYTLGPLVTDIAPGYDHITSGIGAANIGWYGTAMLCYVTPKEHLGLPDKEDVR
FT                   TGIITYKLAAHAADLAKGWPGAQLRDNALSKARFEFRWRDQFRLSLDPERAESFHDETL
FT                   PAEGAKIAHFCSMCGPKFCSMKITQEVRDYADKQKAQRQGMEEKAVEFVKKGAKIYS"
FT   CDS_pept        complement(123361..124350)
FT                   /transl_table=11
FT                   /gene="porB"
FT                   /locus_tag="NMO_0128"
FT                   /product="porin, major outer membrane protein P.I"
FT                   /function="Outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03547"
FT                   /db_xref="GOA:C6S4N6"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4N6"
FT                   /protein_id="CBA03547.1"
FT                   /translation="MKKSLIALTLAALPVAAMADVTLYGTIKAGVETSRSLDYQDGQVY
FT                   SVETGTGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGF
FT                   GKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQY
FT                   ALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHQNVDDVKIEKYQIHRLVSGYDND
FT                   ALYASVAVQQQDAKLVEDNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGSFDDADIGN
FT                   EYDQVVVGAEYDFSKRTSALVSAGWLQEGKGAYKFVSTAGGVGLRHKF"
FT   CDS_pept        complement(125181..125504)
FT                   /transl_table=11
FT                   /gene="mazF"
FT                   /locus_tag="NMO_0129"
FT                   /product="PemK-like putative growth inhibitor"
FT                   /function="Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03549"
FT                   /db_xref="GOA:C6S4N7"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4N7"
FT                   /protein_id="CBA03549.1"
FT                   /translation="MDMVVRGGIYLVSLDQTVGSEIKKTRPCVVVSPPEIHNYLKTVLI
FT                   VPMTSGSRPAPFRVNVRFQDKDGLLLPEQIRAVDKAGLVKHLGNLDNSTAEKLFAVLQE
FT                   MFA"
FT   CDS_pept        complement(125492..125731)
FT                   /transl_table=11
FT                   /gene="mazE"
FT                   /locus_tag="NMO_0130"
FT                   /product="putative growth regulator"
FT                   /function="Growth regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03551"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4N8"
FT                   /protein_id="CBA03551.1"
FT                   /translation="MILNIRKMGNSQGVILPKSLLGQIGAVDSLAVTVEKGNIILSCPT
FT                   VRRGWAEAAAMLVETEQEHFFSEIENEADKEWIW"
FT   CDS_pept        complement(125854..126651)
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="NMO_0131"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /function="Pseudouridylate synthase (tRNA psi55)"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03553"
FT                   /db_xref="GOA:C6S4N9"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4N9"
FT                   /protein_id="CBA03553.1"
FT                   /translation="MDTAQKQRWAITLSYDGSRFYGWQKQADGVPTVQAALETALAQIA
FT                   GESVATTVAGRTDTGVHATAQVVHFDTAAARPQQAWIRGVNAHLPEGIAVLHARQVAPE
FT                   FHARFDAYGRHYRYLLESAPVRSPLLKNRAGWTHLKLDIEPMRQAAAYLIGEQDFSSFR
FT                   AAECQAKSPVKTIYRADLTQSAGLVRLDLHGNAFLHHMVRNIMGALVYVGSGRLSVEGF
FT                   AALIQERSRLKAPPTFMPDGLYLTGVDYPEAYGIIRPQIPEWL"
FT   CDS_pept        complement(127579..128271)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0132"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03555"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4P0"
FT                   /protein_id="CBA03555.1"
FT                   /translation="MTAFVHTLSDGMELPVEIKRRAKKNLIIRPAGTHTVRISVPPCFS
FT                   VSALNRWLYENEAVLRQTLAKTPPPQTAENRLPEHIWFHGRQLALTAHQDTQILLMPSE
FT                   ILVPEGAPEKQLALLRDFLERQAHSYLIPRLERHARTTQLFPAPSSLTSAKTFWGVCRK
FT                   TTGIRFNWRLVGAPEYVADYVCIHELCHLAHADHSRAFWALTRRFAPYTPEAKQWLKIH
FT                   GRELFALG"
FT   CDS_pept        complement(128268..129011)
FT                   /transl_table=11
FT                   /gene="nlaB"
FT                   /locus_tag="NMO_0133"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03557"
FT                   /db_xref="GOA:C6S4P1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4P1"
FT                   /protein_id="CBA03557.1"
FT                   /translation="MLIIRNLIYWLILCSTLIFLFPFMLLASPFRDGAHKMARVWVKIL
FT                   NLSLKHIVGLKYRIIGAENIPDRPAVICAKHQSGWETLALQDIFPPQVYVAKRELFKIP
FT                   FFGWGLKLVKTIGIDRNNRREANEQLIKQGLARKNEGYWITIFPEGTRLAPGKRGKYKL
FT                   GGARMAKMFEMDIVPVALNSGEFWPKNSFLKYPGEITVVICPTIPHASGSEAELMEKCE
FT                   HLIETQQPLISGAGPFAAKMPSETA"
FT   CDS_pept        complement(129041..129604)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0134"
FT                   /product="putative histidinol-phosphatase"
FT                   /function="Histidinol phosphatase and related phosphatases"
FT                   /EC_number="3.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03559"
FT                   /db_xref="GOA:C6S4P2"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4P2"
FT                   /protein_id="CBA03559.1"
FT                   /translation="MKLIILDRDGVINQDRDDFVKSVDEWIPVEGSMDAVAFLTQAGCT
FT                   VAVATNQSGIGRKYFTVQDLTEMHAKMHRLVRQAGGEINGIWFCPHTGADGCGCRKPKP
FT                   GMIEDILERFNAQASETWLVGDSLRDLQAIDAVGGKPALVLTGKGKKTLSQHGHELPEH
FT                   TQVFDTLLDFSQYIMQENAAPQAD"
FT   CDS_pept        complement(129737..130978)
FT                   /transl_table=11
FT                   /gene="mtr"
FT                   /locus_tag="NMO_0135"
FT                   /product="tryptophan-specific transport protein"
FT                   /function="Amino acid permeases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03561"
FT                   /db_xref="GOA:C6S4P3"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR013061"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4P3"
FT                   /protein_id="CBA03561.1"
FT                   /translation="MPTKTPSLFGGAMIIAGTVIGAGMLANPTATSGVWFTGSLAVLLY
FT                   TWFSMLSSGLMILEVNTHYPHGASFDTMVKDLLGRSWNIINGIAVAFVLYLLTYAYIFV
FT                   GGDLTAKGIGNALGGNVSLTVGQLFFFGILAFCVWASARLVDRFTSVLIGGMVLTFIWA
FT                   TGGLIADAKMPVLFDTQAPAGTNYWIYAATALPVCLASFGFHGNVSSLLKYFKGDAPKV
FT                   AKSIWMGTLIALVIYVLWQTAIQGNLPRNEFAPVIAAEGQVSVLIETLSKFAQTGNMDK
FT                   ILALFSYMAIATSFLGVTLGLFDYIADIFKWNDSVSGRTKTAALTFLPPLISCLLFPTS
FT                   FVTAIGYVGLAATVWTGIIPAMLLYRSRKKFGAGKTYKVYGGLWLMVWVFLFGIINIAA
FT                   QVLSQMELVPVFKG"
FT   CDS_pept        131142..131858
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="NMO_0136"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /function="2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-14-
FT                   benzoquinol methylase"
FT                   /EC_number="2.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03563"
FT                   /db_xref="GOA:C6S4P4"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4P4"
FT                   /protein_id="CBA03563.1"
FT                   /translation="MSDKKYNVDEGEIAKFSRIADKWWDKSGEFKTLHDINPLRLDYID
FT                   GHADLRGKRVLDVGCGGGILAESMARRGAAFVKGIDMAEQSLETARLHAALNNVADIEY
FT                   ECIRVEDLAEAEPHSFDVVTCMEMMEHVPDPAAIVRACANLVKPDGMVFFSTINKNPKS
FT                   YLHLIVAAEYLLKFVPKGTHDWKKFIAPAELARMCRQAGLDVADTKGMTYHVLSQTYAL
FT                   CDSTDVNYMFACRPAF"
FT   CDS_pept        131895..132812
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="NMO_0137"
FT                   /product="homoserine kinase"
FT                   /function="Putative homoserine kinase type II (protein
FT                   kinase fold)"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03565"
FT                   /db_xref="GOA:C6S4P5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4P5"
FT                   /protein_id="CBA03565.1"
FT                   /translation="MSVYTSVSDDEMRGFLSGYDLGEFVSLQGIAQGITNSNYFLTTTS
FT                   GRYVLTVFEVLKQEELPFFLELNRHLSMKGVAVAAPVARKDGRLDSVLAGKPACLVACL
FT                   KGSDTALPTAEQCFHTGAMLAKMHLAAADFPLEMENPRYDAWWTEACARLLPVLSQDDA
FT                   ALLCSEIDALKDNLGNHLPSGIIHADLFKDNVLLDGGQVSGFIDFYYACRGNFMYDLAI
FT                   AVNDWARTADNKLDEALKKAFIGGYEGVRPLSAEEKAYFPTAQRAGCIRFWVSRLLDFH
FT                   FPQAGEMTFIKDPNAFRNLLLSLG"
FT   CDS_pept        complement(133151..133669)
FT                   /transl_table=11
FT                   /gene="gntK"
FT                   /locus_tag="NMO_0138"
FT                   /product="thermoresistant gluconokinase"
FT                   /function="Gluconate kinase"
FT                   /EC_number="2.7.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03567"
FT                   /db_xref="GOA:C6S4P6"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4P6"
FT                   /protein_id="CBA03567.1"
FT                   /translation="MTTHFVVMGVCGCGKTTAALSLQKHLGQCPYAEGDEFHTQAKRDK
FT                   MGAGIPLTDEDRYPWLGNLRDWMTKQAQNGANHTIVTCSALKRGYRDILRGAEGKAAFI
FT                   HLSPPQDINLERMMSRKGHYMKAGMLDSQLEILEELGEGEYGVKIANPGTPEAVEADIL
FT                   NWVASENLL"
FT   CDS_pept        complement(133689..135074)
FT                   /transl_table=11
FT                   /gene="gntP"
FT                   /locus_tag="NMO_0139"
FT                   /product="putative gluconate permease"
FT                   /function="H+/gluconate symporter and related permeases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03569"
FT                   /db_xref="GOA:C6S4P7"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4P7"
FT                   /protein_id="CBA03569.1"
FT                   /translation="MDGWTQTLSAQTLLGISAAAIILILILIVKFRIHALLTLVIVSLL
FT                   TALATGLPTGSIVNDVLVKNFGGTLGGVALLVGLGAMLGRLVETSGGAQSLADALIRMF
FT                   GEKRAPFALGVASLIFGFPIFFDAGLIVMLPIVFATARRMKQDVLPFALASIGAFSVMH
FT                   VFLPPHPGPIAASEFYGANIGQVLILGLPTAFITWYFSGYMLGKVLGRTIHVPVPELLS
FT                   GGTQDNDLPKEPAKAGTVVAIMLIPMLLIFLNTGVSALISEKLVSADETWVQTAKIIGS
FT                   TPIALLISVLVALFVLGRKRGESGSALEKTVDGALAPVCSVILITGAGGMFGGVLRASG
FT                   IGKALADSMADLGIPVLLGCFLVALALRIAQGSATVALTTAAALMAPAVAAAGFTDWQL
FT                   ACIVLATAAGSVGCSHFNDSGFWLVGRLLDMDVPTTLKTWTVNQTLIALIGFALSALLF
FT                   AIV"
FT   CDS_pept        135466..137007
FT                   /transl_table=11
FT                   /locus_tag="NMO_0140"
FT                   /product="putative thiamine transport system permease
FT                   protein"
FT                   /function="ABC-type Fe3+ transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03571"
FT                   /db_xref="GOA:C6S4P8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4P8"
FT                   /protein_id="CBA03571.1"
FT                   /translation="MDGRRWAVWGAFALLPSAFLAVMVVAPLWAVAAYDGLAWRAVLSD
FT                   AYMLKRLAWTVFQAAATCVLVLPLGVPVAWVLARLAFPGRALVLRLLMLPFVMPTLVAG
FT                   VGVLALFGADGLLWRGRQDTPYLLLYGNVFFNLPVLVRAAYQGFVQVPAARLQTARTLG
FT                   AGAWRRFWDIEMPVLRPWLAGGVCLVFLYCFSGFGLALLLGGSRYATVEVEIYQLVMFE
FT                   LDMAVASVLVWLVLGVTAAAGLLYAWFGRCAVSDKAVSPVMPSPPQSVGEYVLLAFAAA
FT                   VLSVCCLFPLLAIVVKAWSAGESWRVLMESETWQAVWNTLRFSAAAVYAAAVLGVVYAA
FT                   AARRSAWMRGLMFLPFMVSPVCVSAGVLLLYPQWTASLPLLLAMYALLAYPFVAKDVLS
FT                   AWDALPPDYGRAAAGLGANGFQTACRITFPLLKPALRRGLTLAAATCVGEFAATLFLSR
FT                   PEWQTLTTLIYAYLGRAGADNYARAMVLTLLLSAFALGIFLLLDGGEGGKQTETL"
FT   CDS_pept        137036..137635
FT                   /transl_table=11
FT                   /locus_tag="NMO_0141"
FT                   /product="putative carbonic anhydrase"
FT                   /function="Carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03573"
FT                   /db_xref="GOA:C6S4P9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4P9"
FT                   /protein_id="CBA03573.1"
FT                   /translation="MSELDNILAHNRQFVESGEYEKYFTDKYPERGLAVLSCMDARIIG
FT                   LLPDALGLKNGDAKLIKNAGALVTHPWGSVMRSLLVAVFELKVREIMVIAHHDCGMQGL
FT                   NAEEFLGRVRESRIPEDRIETLRYAGVDLDGWLTGFDNVEDSVRHTVELIRRHPLMPRH
FT                   IAVHGLVIHPVTGKLTLVVDGSVSDGMDLSEGMETS"
FT   CDS_pept        137632..138237
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="NMO_0142"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /function="Nicotinic acid mononucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03575"
FT                   /db_xref="GOA:C6S4Q0"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Q0"
FT                   /protein_id="CBA03575.1"
FT                   /translation="MKKIGLFGGTFDPIHNGHLHIARAFADEIGLDTVVFLPAGGPYHK
FT                   DAASASAADRLAMVELATAEDARFAVSDCDIVREGATYTFDTVQIFRQQFPSAQLWWLM
FT                   GSDSLMKLHTWKKWQMLVRETNIAVAMRQGDSLHQTPRELHAWLGKSLQDGSVRILSAP
FT                   MHNVSSTEIRRNLAGQGVSDGIPPAAARYIREHGLYEK"
FT   CDS_pept        138296..138682
FT                   /transl_table=11
FT                   /locus_tag="NMO_0143"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized homolog of plant Iojap protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03577"
FT                   /db_xref="GOA:C6S4Q1"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Q1"
FT                   /protein_id="CBA03577.1"
FT                   /translation="MNEQELQDLQKMVGVAVNALEDIKAKDISVLETQDKTSLFARMII
FT                   ASGDSTRQVKALANNVAVDLKEAGFEILSTEGDSGEWTLVDAGDLVVHVMLPAVRDFYD
FT                   IDTLWGGEKPSFHAGMQKPWHAAD"
FT   CDS_pept        138700..139206
FT                   /transl_table=11
FT                   /locus_tag="NMO_0144"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03579"
FT                   /db_xref="GOA:C6S4Q2"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Q2"
FT                   /protein_id="CBA03579.1"
FT                   /translation="MFRRHFPVREKALNITVLAVGTKMPRWVDEAVAEYAKRFGRDVAY
FT                   VLKEIKPEKRGAGVNAAQGMAAEEKRILEAIPQGAFLVVLDERGKAPTSVELAEHLKSW
FT                   QQNGEHVCFVIGGADGMTDRLKQQARMMMRLSSLTLPHGMVRVLLTEQLYRAASILHNH
FT                   PYHRE"
FT   CDS_pept        139279..139545
FT                   /transl_table=11
FT                   /locus_tag="NMO_0145"
FT                   /product="putative Fe(II) trafficking protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03581"
FT                   /db_xref="GOA:C6S4Q3"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Q3"
FT                   /protein_id="CBA03581.1"
FT                   /translation="MARMVFCVKLNKEAEGMKFPPLPNELGKRIFENVSQEAWAAWTRH
FT                   QTMLINENRLSLADPCAREYLAQQMEQYFFGDGADAVQGYVPQ"
FT   CDS_pept        139702..140385
FT                   /transl_table=11
FT                   /locus_tag="NMO_0146"
FT                   /product="putative integral membrane protein"
FT                   /function="Integral membrane protein interacts with FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03583"
FT                   /db_xref="GOA:C6S4Q4"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Q4"
FT                   /protein_id="CBA03583.1"
FT                   /translation="MQHDVYDYTAHTVSKNTVLQKTYRLLGFSFIPAAAGAALAANAGF
FT                   NFYAAFGSRWIGFAVVLAFFYGMIHFIEKNRYSNTGVTLLMVFTFGMGVLIGPVLQYAL
FT                   HIADGAKIVGIAAAMTAAVFLTMSALARRTRLDMNALGRFLTVGAVILMVAVVANLFLG
FT                   IPALALTISAGFVLFSSLMIMWQVRTVIDGGEDSHISAALTLFISLYNIFSSLLNILLS
FT                   LNGED"
FT   CDS_pept        140613..141125
FT                   /transl_table=11
FT                   /gene="kdtB"
FT                   /locus_tag="NMO_0147"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /function="Phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03585"
FT                   /db_xref="GOA:C6S4Q5"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Q5"
FT                   /protein_id="CBA03585.1"
FT                   /translation="MLPNTPRRAVYAGSFDPPTLGHLWMIRQAQSMFDELIVAIGINPD
FT                   KRSTYTVAERQDMLCDITKMFPNVRTDVFENRFLVHYAREVDAGFIVRGIRSASDYEYE
FT                   RSMRHINSDLAPEISTVFLMPPREIAEVSSTMVKGLVGPEGWTETIHRYVPQAVYEKIL
FT                   AEHQHEN"
FT   CDS_pept        141100..141810
FT                   /transl_table=11
FT                   /locus_tag="NMO_0148"
FT                   /product="pseudouridylate synthase, 23S RNA-specific"
FT                   /function="Pseudouridylate synthases 23S RNA-specific"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03587"
FT                   /db_xref="GOA:C6S4Q6"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006508"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Q6"
FT                   /protein_id="CBA03587.1"
FT                   /translation="MPNINTKIEPFYFCKAYMDMLEILFRHQDFVAINKPGGISVHQDS
FT                   GETGLARTLAIQLGVERVWLLHRLDKQTSGILLFALNRESASALSGQFAGKSIKKTYLA
FT                   LSDRKPSKKQGWIKGGMEKSRRGMWKLTRNTENIAVTRFHSISIAEKLRLFILEPHTGK
FT                   THQLRVAMKSLGSPILGDSLYGGTESETMFLYAWKIQFAYQNRQIEIVAPLKNEWQTEN
FT                   ISHALEEFYMAKAG"
FT   rRNA            142152..143695
FT                   /locus_tag="NMO_rRNA01"
FT                   /product="16S rRNA"
FT   tRNA            143795..143871
FT                   /locus_tag="NMO_tRNA06"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:143829..143831,aa:Ile)"
FT   tRNA            143877..143952
FT                   /locus_tag="NMO_tRNA07"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:143910..143912,aa:Ala)"
FT   rRNA            144360..147251
FT                   /locus_tag="NMO_rRNA02"
FT                   /product="23S rRNA"
FT   rRNA            147347..147463
FT                   /locus_tag="NMO_rRNA03"
FT                   /product="5S rRNA"
FT   CDS_pept        147515..147961
FT                   /transl_table=11
FT                   /gene="comEA1"
FT                   /locus_tag="NMO_0149"
FT                   /product="putative DNA transport competence protein"
FT                   /function="DNA uptake protein and related DNA-binding
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03589"
FT                   /db_xref="GOA:C6S4Q7"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Q7"
FT                   /protein_id="CBA03589.1"
FT                   /translation="MSGMAGRHPYGVRSGLRRNGLKLWDIHFRMTRFIVARCGLLFATL
FT                   KGKTMKKMFVLFCMLFSCTFSLAAVNINAASLQELEALPGIGPAKAKAIAEYRAQNGAF
FT                   KSVDDLTKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPADKK"
FT   CDS_pept        148049..148498
FT                   /transl_table=11
FT                   /locus_tag="NMO_0150"
FT                   /product="putative type IV pilus protein"
FT                   /function="Tfp pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03591"
FT                   /db_xref="GOA:C6S4Q8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Q8"
FT                   /protein_id="CBA03591.1"
FT                   /translation="MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAA
FT                   LLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEGFCIRLNGIARGALDSKFMLKAVAI
FT                   DKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK"
FT   CDS_pept        complement(148659..148928)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0151"
FT                   /db_xref="PSEUDO:CBA03593.1"
FT   CDS_pept        149041..149241
FT                   /transl_table=11
FT                   /locus_tag="NMO_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03595"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4R0"
FT                   /protein_id="CBA03595.1"
FT                   /translation="MFVPLDIRAIAAPVLNVQITIQLQPYRIVFRTAHLCPITPGVSFL
FT                   DIANLALLKIQQAAFGDMGRE"
FT   CDS_pept        149558..150613
FT                   /transl_table=11
FT                   /locus_tag="NMO_0153"
FT                   /product="putative type II DNA modification methylase"
FT                   /function="Site-specific DNA methylase"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03597"
FT                   /db_xref="GOA:C6S4R1"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4R1"
FT                   /protein_id="CBA03597.1"
FT                   /translation="MKNSKLKAVDFFCGGGGMSYGMQSAGIQVLAGIDYEPSCKETYEA
FT                   NINAKFIQADVFELQPETLEKELGLKKNDDDLILIGCSPCQYWSVIQTDKRKSEKSKSL
FT                   LLEFQRFVEYFNPGYVVVENVPGILSRMKESRLDNFIKLLEEKGFTVHFGIHNTADYGI
FT                   PQSRKRFTLIANRITKEKLEPVKYSGKRLTVRDVLGMENGFPKIMAGHQDETDFMHSCA
FT                   GLSDINLKRLALIPKNGGNRLAFAHIPELQLECFIGKDNSFKDTFGRLWWDKPAPTITT
FT                   KFFSISNGRFAHPEEDRALSLREGATLQSFPRNYVFKAGSRDKIARLIGNAVPPMYAEK
FT                   IGRAIVDNIEC"
FT   CDS_pept        150627..152272
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0154"
FT   CDS_pept        152276..152698
FT                   /transl_table=11
FT                   /gene="vsr"
FT                   /locus_tag="NMO_0155"
FT                   /product="putative very-short-patch-repair endonuclease"
FT                   /function="DNA G:T-mismatch repair endonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03600"
FT                   /db_xref="GOA:C6S4R2"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4R2"
FT                   /protein_id="CBA03600.1"
FT                   /translation="MTDIFTTSKRSFVMSKIHSKETKPEILVRKFLFSQGFRYRKNDKR
FT                   YAGKPDIVLPKYKTVVFIHGCFWYGHSCNKGHIPKSNTDFWLEKITKNCERDIKNETEL
FT                   EKIGFKVIVVWECELKNKAICRERLNRLVREIKDAV"
FT   CDS_pept        complement(152721..156032)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0156"
FT                   /product="ATP-dependent helicase"
FT                   /function="HrpA-like helicases"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03602"
FT                   /db_xref="GOA:C6S4R3"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4R3"
FT                   /protein_id="CBA03602.1"
FT                   /translation="MQNMKNQVRGSGMDARSNPANVSDGLQNSSGHIGTNTRYRLTKLG
FT                   EQMARLPIDPKIARILLAAKKHDCMAEILVIASALSIQDPRERPLEARDAAAKAHERFT
FT                   DKQSDFLAYLNIWDSFQRERDKGLSNKQLVQWCRQYFLSHLRMREWRELHHQLAQTAIE
FT                   MGLTTKEAAFRRPPEVRQLTSSENAGDQDLSAKLKQKQLDKKQHRAQIRAAKEAGYEQI
FT                   HRALLTGLIANVGMKSPDGNDYTGARGSRFHLFPASALFKAKPKWVMAAELVETTKLYA
FT                   RDVAAIQPEWIEQEAPHLVRYHYFEPHWEQKRGEVVASERVTLYGLTVLPRRPVPYGKV
FT                   APEEAREIFIRSALVAQECDLKADFFVHNKKLIKEITELEHKSRKQDVLVDDEALFAFY
FT                   NERLPEMAWKDAQGSVWGSEDSVRIIESDKAERSSENERNEFRKNKRNGSRQNENHGNT
FT                   VGWVENPTSAATAKTVGFDNPTYATQQPTPSPAREGRGEGKTVAAQTNFSATAANPLPN
FT                   PLPQEREQSAAASAVSNDLHPANPQQTAPSPVGEGRGEGKTVASQTNFSATTANPLPNP
FT                   LPQEGEQSAAASAVSNDPQPQKQPAPQKDRLKPLPLADIRTFQAWLKTAERENPRLLFL
FT                   SRDDLMQHAAAHITEEQFPKFWQTADGKFKLSYRFEPHHPLDGVTLTLPLTVLNRLHAP
FT                   SLEWLVPGMLREKIQLLIKALPKQIRRICVPVPDFITQFLSQNPDRNAPILPQLAQAIA
FT                   KTAGDIRILEQINQDEWAAFRLPEHCYFNLRIIDDGGQELAGGRKLHELQQQLGQAAAT
FT                   TFRDNTQEFERDNVTAWDIGTLPESIKFARGKQQLTGYLGLQKEKDGRIALRLCDTIEA
FT                   AEQAHRQGVIELMKLQLKEQVKDLNKGIQGFTQAAMLLKHINADTLRDDLTQAVCDRAF
FT                   IGEDELPRNEKAFKEQIKRARSRLPAVKEALSRYLQETAAAYAELNGKLGKHPLTHLLR
FT                   LRLQTLLAAGFATRTPWAQWPRLPIYLKTMTLRLEKYSSNPARDAAREADTQELEQMWQ
FT                   EKTDSLIKQGLPISDGLAAFKWMIEELRVSLFAQELKTPYPVSVKRLLKEWEDLN"
FT   CDS_pept        complement(156098..157672)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0157"
FT                   /product="putative membrane-associated hydrolase"
FT                   /function="Predicted membrane-associated metal-dependent
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03604"
FT                   /db_xref="GOA:C6S4R4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4R4"
FT                   /protein_id="CBA03604.1"
FT                   /translation="MKKSLFVLFLYSSLLTASEIAYRFVFGIETLPAAKMAETFALTFV
FT                   IAALYLFARYKTSRLLIALFFAFSIIANNVHYAVYQSWMTGINYWLMLKEVTEVGSAGA
FT                   SMLDKLWLPALWGVLEVMLFCSLAKFRRKTHFSADILFAFLMLMIFVRSFDTKQEHGIS
FT                   PKPTYSRIKANYFSFGYFVGRVLPYQLFDLSRIPAFKQPAPSKIGQGSVQNIVLIMGES
FT                   ESAAHLKLFGYGRETSPFLTRLSQADFTPIVKQSYSAGFMTAVSLPSFFNAIPHANGLE
FT                   QISGGDTNMFRLAKEQGYETYFYSAQAENEMAILNLIGKKWIDHLIQPTQLGYGNGDNM
FT                   PDEKLLPLFDKINLQQGRHFIVLHQRGSHAPYSALLQPQDKVFGEADIVDKYDNTIHKT
FT                   DQMIQTVFEQLQKQPDGNWLFAYTSDHGQYVRQDIYNQGTVQPDSYLVPLVLYSSNKAV
FT                   QQAANQAFAPCEIAFHQQLSTFLIHTLGYDMPVSGCREGSVTGNLITGDAGSLNIRDGK
FT                   AEYVYPQ"
FT   CDS_pept        complement(157852..158979)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03606"
FT                   /db_xref="InterPro:IPR041494"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4R5"
FT                   /protein_id="CBA03606.1"
FT                   /translation="MKHLLIDFENVQPQNLDKLPTENTHIWLFIGVLHKMLPISLVQSL
FT                   LRFGERVHLVQLQKTGKNALDFYLSYYLGQITATDPNAQVGILSRDGGYDVLVEHILKN
FT                   HQAKGIVRLANIDEVQHQKIATEPPSALRENTPQPETTLKPQQPLTSYFQAALTALRRP
FT                   DAFRPCRLHNLRQNLRKHILSDLFKEKTDEECEITTANVINKLKAQNFISIDEQETVSY
FT                   HLSDNDLLQRIQRHILSQRPKTYADFQAVVQNRADALHLTVGTNDIQSFARHLRDQNLI
FT                   RQNNGKIEYAPFTEPKPQPTPKQPKKTAWEPDEIIWKKVIAALSLKNRPNKTKTLRNTI
FT                   QALTKSNAQETDKLLQHLQDTQVLRIDGTKIVYIK"
FT   CDS_pept        complement(159080..160567)
FT                   /transl_table=11
FT                   /gene="hrpA"
FT                   /locus_tag="NMO_0159"
FT                   /product="ATP-dependent helicase"
FT                   /function="HrpA-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03608"
FT                   /db_xref="GOA:C6S4R6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042035"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4R6"
FT                   /protein_id="CBA03608.1"
FT                   /translation="MRFSDGISPSRYCPNPTKAFAIILFFTAYAPIMFPDFSQTLSKDR
FT                   HFLQSAFKNPNKYGGLSKVEEKYRKSHEIFLKRLAALPKPEFDNTLPVHEKLDEIKKTV
FT                   AEHQVTIICGETGSGKTTQLPKICLELGRGAAGLIGHTQPRRLAARSVAERIAEELKSE
FT                   IGSAVGYKVRFTDHTSRDACVKLMTDGILLAETQTDRYLAAYDTIIIDEAHERSLNIDF
FT                   LLGYLKQLLPRRPDLKVIITSATIDTEGFSRHFNGAPVLEVSGRTYPVEILYSPLTGKD
FT                   EDDAEVELTDAIVDAADELAQYGEGDILVFLPGEREIREAAEALRKSTLRRNDEILPLF
FT                   ARLSHAEQHKIFHPSGAKRRIVLATNVAETSLTVPGIKYVIDTGLARVKRYSARAKVEQ
FT                   LHIEKISQAAAHQRSGRCGRVSAGVCIRLFSEENFNNRPEFTDPEIARSNLAAVILRMA
FT                   SLKLGDVAAFPFLEMPDSRYINDGFQVLLELGAVEAA"
FT   CDS_pept        complement(160661..162070)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0160"
FT                   /product="conserved hypothetical protein"
FT                   /function="Chloride channel protein EriC"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03610"
FT                   /db_xref="GOA:C6S4R7"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4R7"
FT                   /protein_id="CBA03610.1"
FT                   /translation="MTSTFPRRLARKIRQTRRLSRKSIAFLFLLAGSALVALTALFFAH
FT                   LADFALELNAKLVQQYPWFAWVALPLGLPLIAWLTRKFAPFTAGSGIPQVIASLSLPYG
FT                   AQKTRLIRLGQTLLKIPLTFLGMLFGASIGREGPSVQVGAAVMGAWGAWCKKHGLAFKG
FT                   MQENDLMAAGAAGGLAAAFNAPLAGVIFAIEELGRGIMLRWERQILLGVLASGFIQVAI
FT                   QGNNPYFSGFNGGVLEHIFLWVALSGLVCGAAGGLFGRLLYRGAAAFAPRKIRGFIRNR
FT                   PLLLAALMGLLLALLGTFYQGKTYGTGYHEAAQALHGIYEAPFGLAAAKWLATVFSYWA
FT                   GVPGGIFTPSLTIGAVLGEHIAAIADISQGANIIVLICMAAFLAGATQSPITSAVVVME
FT                   MTGGQSLLFWMLIACIFASQVSRQFSPRPFYHASGMRFRQRVLQETAAQTGNAPARPQT
FT                   ANSKTGMPSEN"
FT   CDS_pept        complement(162130..163350)
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="NMO_0161"
FT                   /product="glutamate N-acetyltransferase / amino-acid
FT                   N-acetyltransferase"
FT                   /function="N-acetylglutamate synthase (N-acetylornithine
FT                   aminotransferase)"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03612"
FT                   /db_xref="GOA:C6S4R8"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4R8"
FT                   /protein_id="CBA03612.1"
FT                   /translation="MAVNLTEKTAEQLPDIDGIALYTAQAGVKKPGHTDLTLIAVAAGS
FT                   TVGAVFTTNRFCAAPVHIAKSHLFDEDGVRALIINTGNANAGTGAQGRIDALAVCAAAA
FT                   RQIGCKPNQVLPFSTGVILEPLPADKIIAALPKMQPAFWNEAARAIMTTDTVPKAASRE
FT                   GKVGDKHTVRATGIAKGSGMIHPNMATMLSFIATDAKVSQPVLQLMTQEIADETFNTIT
FT                   VDGDTSTNDSFVIIATGKNSQSEIDNIADPRYAQLKELLCSLALELAQAIVRDGEGATK
FT                   FITVRVENAKTRDEARQAAYAVARSPLVKTAFFASDPNLGRLLAAIGYAGVADLDTDLV
FT                   EMYLDDILVAEHGGRAASYTEAQGQAVMSKDEITVRIKLHRGQAAATVYTCDLSHGYVS
FT                   INADYRS"
FT   CDS_pept        complement(163417..164109)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0162"
FT                   /product="putative membrane protein"
FT                   /function="Putative effector of murein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03614"
FT                   /db_xref="GOA:C6S4R9"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4R9"
FT                   /protein_id="CBA03614.1"
FT                   /translation="MNEILRQPSILLFLTLAVYALAIIVRTRTGNIFCNPVLVSTIVLI
FT                   AYLKILGIDYAVYHNAAQFIDFWLKPAVVVLAVPLYQNRRKIFNQWLPVIVSQLAGSVT
FT                   GIVTGMYFAKWLGAEREVVLSLASKSVTNPIAIEITRSIGGIPAITAATVIIAGLVGQI
FT                   AGYKMLKNTVVMPSSVGMSLGTASHAMGIAASLERSRRMAAYAGLGLTFNGVLTALIAP
FT                   LLIPVLGF"
FT   CDS_pept        complement(164109..164453)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0163"
FT                   /product="hypothetical inner membrane protein"
FT                   /function="Putative effector of murein hydrolase LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03616"
FT                   /db_xref="GOA:C6S4S0"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4S0"
FT                   /protein_id="CBA03616.1"
FT                   /translation="MNIIRALLIILGCLAAGETAVFLAGIKLPGSIVGMGVLFALLQAG
FT                   WVKTSWLQQLTDALMANLTLFLVPPCVAVISYLDLIADDWFSILVSASASTLCVLLVTG
FT                   KVHRWIRSII"
FT   CDS_pept        complement(164450..164548)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03618"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4S1"
FT                   /protein_id="CBA03618.1"
FT                   /translation="MRGFGFSDGIFDVMIKQLTRFITTPSKDRHTT"
FT   CDS_pept        complement(164598..164816)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03620"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4S2"
FT                   /protein_id="CBA03620.1"
FT                   /translation="MSMPEMPKWYDDDGQIVSCTEKVKVMSENMAELYQTAQDAFEDAL
FT                   LMGCGERQLRDYLLALIEGLENPYRKV"
FT   CDS_pept        complement(164835..165590)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0166"
FT                   /product="putative lipoprotein"
FT                   /function="Cell wall-associated hydrolases (invasion-
FT                   associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03622"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4S3"
FT                   /protein_id="CBA03622.1"
FT                   /translation="MDSFFKPAVWAVLWLMFAVRPALADELTNLLSSREQILRQFAEDE
FT                   QPVLPINRAPARRAGNADELIGSAMGLNEQPVLPVNRVPARRAGNADELIGNAMGLNEQ
FT                   PVLPVNRAPARRAGNADELIGNAMGLLGIAYRYGGTSVSTGFDCSGFMQHIFKRAMGIN
FT                   LPRTSAEQARMGTPVARSELQPGDMVFFRTLGGSRISHVGLYIGNNRFIHAPRTGKNIE
FT                   ITSLSHKYWSGKYAFARRVKKNDPSRFLN"
FT   CDS_pept        165835..166743
FT                   /transl_table=11
FT                   /locus_tag="NMO_0167"
FT                   /product="Hsp33-like chaperonin"
FT                   /function="Disulfide bond chaperones of the HSP33 family"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03624"
FT                   /db_xref="GOA:C6S4S4"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4S4"
FT                   /protein_id="CBA03624.1"
FT                   /translation="MNQTAINRADVRTRFIFDDMPVRGLHVRLENVWQHIVKQKNYPAA
FT                   IRRALGELLAAGVLLSGNLKNEGTLIVQVQGQGRLKMLVAEATSDRTVRATARWDEAAE
FT                   IGEDESLVDLLGEGGVFVLTLQPKDGEPWQGVVPLEGDGIAQMLMNYMKRSEQLDTHIV
FT                   LSASDEAAGGLLVQRLPEEVLDEEAWEHVSTLARTLTAEELAELDAQHVLYRLFHETPP
FT                   RVFEPETFEFSCTCSRGKVSDMLLMLGGEEVGGVVVEQGSIEVDCDFCHSKYVFDETDV
FT                   NALFGEDVVGVAKGLPRHTVQ"
FT   CDS_pept        complement(166829..168283)
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="NMO_0168"
FT                   /product="magnesium transporter"
FT                   /function="Mg/Co/Ni transporter MgtE (contains CBS domain)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03626"
FT                   /db_xref="GOA:C6S4S5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4S5"
FT                   /protein_id="CBA03626.1"
FT                   /translation="MSIEHTPPTHDGETGQNHAERPSADFDRVHSLCEILEPAFEQIEN
FT                   GTPLEDAPLRDKLTELTVLLGELHPADVAAVLESLPPRERNVVWLLVKPEDDGEVLLEV
FT                   SDAVRETLIESMDKDELLAAVDDLDADELAELADDLPHQVVYEALQTRDEEERAQVKAA
FT                   MSYEDNQVGAIMDFELVSIRADVACEVVLRYLRRFDSLPDHTDKIFVVDENDVLQGVLP
FT                   IRKLLVADPEDLVENVMAKDVVRFRAEDDVEEAAQAFERYDLVTAPVVDENKKLIGRIT
FT                   VDEMVDVIREESEADMLNMAGLQEEEDLFAPVWDSVKNRWMWLAVNLCTAFLASRVIGA
FT                   FEGSIEKIVALAALMPIVAGIGGNSGNQTITMIVRAMAMGQLTGMQAGRLLKKEVGVAL
FT                   VNGIIWGTVMGAVSWLLYGSLGIGLVMVAAMTLNLLLAATVGVLIPVVMEKFGRDPALG
FT                   SSVLITAVTDSGGFLIFLGLATLFLL"
FT   CDS_pept        complement(168515..172990)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0169"
FT                   /product="serine-type peptidase"
FT                   /function="Type V secretory pathway adhesin AidA"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03628"
FT                   /db_xref="GOA:C6S4S6"
FT                   /db_xref="InterPro:IPR000710"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR030396"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4S6"
FT                   /protein_id="CBA03628.1"
FT                   /translation="MRFTHTTPFCSVLSTLGLFAVSPAYSSIVRNDVDYQYFRDFAENK
FT                   GAFAVGASNISIQDKQGKILGRVLNGIPMPDFRVSNRQTAIATLIHPQYVNSVKHNVGY
FT                   GSIQFGNDTQNPEEQAYTYRLVSRNPHPDYDYHLPRLNKLVTEISPAALSSVPLLGNGQ
FT                   PKANAYLDTDRFPYFVRLGSGTQQVRKADGTRTRTAPAYQYLTGGTPLKVLGFQNHGLL
FT                   VGGSLTDQPLNTYAIAGDSGSPLFAFDKHENRWVLAGVLSTYAGFDNFFNKYIVTQPEF
FT                   IRSTIRQYETRLDVGLTTNELIWRDNGNGDSTLQGLNERITLPIANPSLAPQNDSRHMP
FT                   SEDAGKTLILSSRFDNKTLMLADNINQGAGALQFDSNFTVVGKNHTWQGAGVIVADGKR
FT                   VFWQVSNPKGDRLSKLGAGTLIANGQGINQGDISIGEGTVVLAQKAASDGSKQAFNQVG
FT                   ITSGRGTAVLADSQQIKPENLYFGFRGGRLDLNGNNLAFTHIRHADGGAQIVNHNPDQA
FT                   ATLTLTGNPVLSPEHVEWVQWGNRPQGNAAVYEYINPHRNRRTDYFILKPGGNPREFFP
FT                   LNMENSTSWQFIGNNRQQAAKQVAQAENARPDLITFGGYLGENAQTGKAAPSYSKTNIE
FT                   WVNGPNTPHKPSPYTNTPTRTGAGVPTITASKKAATPAPTSHGMPTAPKTGNFSDMTGE
FT                   AAIEKNRHIANAAVYGRPEYRYNGALNLHYRPKRTDSTLLLNGGMNLNGEVLIEGGNMI
FT                   VSGRPVPHAYDHQAKREPVLENEWTDGSFKAARFTLRNHARLTAGRNTAHLDGDITAYN
FT                   LSGIDLGFTQGKTPECYRSYHSGSTHCTPNAVLKAENYRALPATQVRGDITLNDRSELR
FT                   LGKAHLYGSIRAGKDTAVRMEADSNWTLSQSSHTGALTLDGAQITLNPDFANNTHNNRF
FT                   NTLTVNGTLDGFGTFRFLTGIVRKQNAPPLKLEGDSRGAFQIHVKNTGQEPQTTESLAL
FT                   VSLNPKHSHQARFTLQNGYADLGAYRYILRKNNNGYSLYNPLKEAELQIEATRAEHECN
FT                   QQAYNQLQATDISRQVQHDSDATRQALQTWQNSQTELARIDSQVQYLSAQLKQTDPLTG
FT                   ILTRAQNLCAAQGYSADICRQVAKAADTNDLTLFETELDTYIERVEMAESELDKARQGG
FT                   DAQAVETARHAYLNALNRLSRQIHSLKTGVAGIRMPNLAELISRSANTAVSEQAAYNTG
FT                   RQQAGRRIDRHLTDPQQQNIWLETGTQQTDYHSGTHRPYQQTTNYAHIGIQTGITDRLS
FT                   VGTILTDERTNNRFDEGVSARNRSNGAHLFVKGENGALFAAADLGYSNSRTRFTDYDGA
FT                   AVRRHAWDAGINTGIKIDTGISLRPYAGIRINRSNGNRYVLDGAEINSPAQIQTTWHAG
FT                   IRLDKTVELGQAKLTPAFSSDYYHTRQNSGSALSVNDRTLLQQAAHGTLHTLQIDAGYK
FT                   GWNAKLHAAYGKDSNTARHKQAGIKIGYNW"
FT   CDS_pept        complement(173304..174062)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0170"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /function="Zn-dependent hydrolases including glyoxylases"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03630"
FT                   /db_xref="GOA:C6S4S7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4S7"
FT                   /protein_id="CBA03630.1"
FT                   /translation="MKITPVKALTDNYIWMIQHGNHAVCVDPSEPSPVLEFLVRNRLML
FT                   AQTWVTHPHPDHEGGAAALWRGYMESPVYGESDIEAATHTVTAGTQFTFGDGQVTVWAT
FT                   PGHTDRHTSYLLETSDGIHVFCGDTLFSAGCGRVFTGTIEQLYDSFQRFNRLPENTLFY
FT                   PAHEYTAANLDFAAHIEPDNADIQTALKAAAHTPTLPVTLAHERRVNPFLRVDLPHVRD
FT                   RAEALSGKTLNSSLDTFVALRELKNQYRTK"
FT   CDS_pept        complement(174157..178119)
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="NMO_0171"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /function="Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase synthetase domain"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03632"
FT                   /db_xref="GOA:C6S4S8"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4S8"
FT                   /protein_id="CBA03632.1"
FT                   /translation="MSVVLPLRGVTALSDFRVEKLLQKAAALGLPEVKLSSEFWYFAGS
FT                   EKALDAATVEKLQALLAAQSVEQTPKAREGLHLFLVTPRLGTISPWASKATNIAENCGL
FT                   AGIERIERGMAVWLEGALTDEQKRQWAALLHDRMTESVLPDFQTASKLFHHLESETFST
FT                   VDVLGGGKEALVKANTEMGLALSADEIDYLVENYQALQRNPSDVELMMFAQANSEHCRH
FT                   KIFNADFILNGEKQPKSLFGMIRDTHNAHPEGTVVAYKDNSSVIEGAKIERFYPNAAEN
FT                   QGYRFHEEDTHIIMKVETHNHPTAIAPFAGAATGAGGEIRDEGATGKGSRPKAGLTGFT
FT                   VSNLNIPGLKQPWEQDYGKPEHISSPLDIMIEGPIGGAAFNNEFGRPNLLGYFRTFEEK
FT                   FDGQVRGYHKPIMIAGGLGSIQAQQTHKDEIPEGALLIQLGGPGMLIGLGGGAASSMDT
FT                   GTNDASLDFNSVQRGNPEIERRAQEVIDRCWQLGGKNPIISIHDVGAGGLSNAFPELVN
FT                   DAGRGAVFKLREVPLEEHGLTPLQIWCNESQERYVLSILEKDLDTFRAICERERCPFAV
FT                   VGTATDDGHLKVRDDLFANNPVDLPLNVLLGKPPKTTRTDKTVTPSKKPFHADDIDITE
FT                   AAYRVLRLPAVAAKNFLITIGDRSVGGMTHRDQMVGKYQTPVADCAVTMMGFNTYRGEA
FT                   MSMGEKPTVALFDAPASGRMCVGEAITNIAAVNIGDIGNIKLSANWMAACGNEGEDEKL
FT                   YCTVEAVSKACQALDLSIPVGKDSLSMKTVWQDGEEKKSVVSPLSLIISAFAPVEDVRK
FT                   TVTPELKNVEDSVLLFVDLGFGKARMGGSAFGQAYNNMTGDAPDLDDTGRLKAFYNVVQ
FT                   QLVAEDKLLAYHDRSDGGLFAVLVEMAFAGRCGLDIDLNLLLAQTFITNHTALSQSLRT
FT                   EEVKALAEWQETIARTLFNEELGAVIQVRKQDVADIINLFYQQQLHHNVFEIGTLTDEN
FT                   TLIIRDGQTHLISDNLIKLQQTWQETSHQIQRLRDNPACADSEFALIGDNDRSALFADV
FT                   KFDVNEDIAAPFINSGAKPKIAILREQGVNGQIEMAAAFTRAGFDAYDVHMSDLMAGRF
FT                   RLADFKMLAACGGFSYGDVLGAGEGWAKSILFHPALRDQFAAFFADPDTLTLGVCNGCQ
FT                   MVSNLAEIIPGTAGWPKFKRNLSEQFEARLSMVHVPKSASLILNEMQGSSLPVVVSHGE
FT                   GRADFALHGGNISADLGIALQYVDGQNQVTQTYPLNPNGSPQGIAGITNADGRVTIMMP
FT                   HPERVYRAAQMSWKPEGWTELSGWYRLFAGARKALG"
FT   CDS_pept        178270..178608
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="NMO_0172"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /function="Nitrogen regulatory protein PII"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03634"
FT                   /db_xref="GOA:C6S4S9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4S9"
FT                   /protein_id="CBA03634.1"
FT                   /translation="MKKIEAIVKPFKLDDVREALTEIGITGMTVSEVKGFGRQKGHTEI
FT                   YRGAEYAVDFLPKVKIELVLADDAVERAIDVIVEVARSGKIGDGKIFVLPVEEAIRIRT
FT                   GERADAAV"
FT   CDS_pept        complement(178667..179425)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0173"
FT                   /product="iron(III) transport system ATP-binding protein"
FT                   /function="ABC-type enterochelin transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03636"
FT                   /db_xref="GOA:C6S4T0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4T0"
FT                   /protein_id="CBA03636.1"
FT                   /translation="MITIRNVSYRIGTRPILDNVSLDIPEGGITALVGPNGAGKSTLFS
FT                   FMARLRPLESGSIAYRGKNLAGTPTAELARTLSILTQENSIMSRITVRDLLMFGRYPYH
FT                   QGRPTAECRRIVNGAIEEFHLQDLSDRYLTELSGGQRQRAMIAMVFCQSTDYVLLDEPL
FT                   NNLDMYHARSLMQILQKLTREHKRTTVAVLHDINQAAAYADHVVAMKNGKAVLTGTPEE
FT                   VFTVHNIKELFDMDVDVLDYEGKKLIVHHI"
FT   CDS_pept        complement(179508..180134)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03638"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4T1"
FT                   /protein_id="CBA03638.1"
FT                   /translation="MTQERLPEFFDRAPTLTVQDPLAAFLGAAENGILTYRYADAVRLC
FT                   GHSCPTVAGAYLMVIKGLKALYGEELPERGGIEAAMQGARDEGTVGVTASVVQLLTGAA
FT                   PETGFGGIGMQGRFARRHLLSFGVGEINGTLTLRRKDNGKTVAVSLNAALKPFAPQMRD
FT                   IMPKAVSGSASTDELKHFGQLWQARVKAFLTESADDPQFVIVREV"
FT   CDS_pept        complement(180179..181153)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0175"
FT                   /product="iron(III) transport system permease protein"
FT                   /function="ABC-type enterochelin transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03640"
FT                   /db_xref="GOA:C6S4T2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4T2"
FT                   /protein_id="CBA03640.1"
FT                   /translation="MPSENKIAFMQGSPRPLWAAFALLLICCGLFLTLNVKGDWDFVLQ
FT                   LRLTKLAALLMVAYAVGVSTQLFQTLTNNPILTPSILGFDSLYVFLQTLLVFTFGGVGY
FT                   ASLPLTGKFGFELAVMMGGSLLLFYTLIRQGGRDLPRMILIGVIFGILFRSLSSLLSRM
FT                   IDPEEFTAAQANMFAGFNTVHSELLGIGALILLVSAAVVWRERYRLDVHLLGRDQAVNL
FT                   GISYTRNTLWILLWIAALVATATAVVGPVSFFGLLAASLANHFSPSVRHSVRLPMTVCV
FT                   GGILLVGGQTVFEHFLGMKAVLSVVVEFAGGLVFLYLVLKHKK"
FT   CDS_pept        complement(181143..182111)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0176"
FT                   /product="iron(III) transport system permease protein"
FT                   /function="ABC-type enterochelin transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03642"
FT                   /db_xref="GOA:C6S4T3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4T3"
FT                   /protein_id="CBA03642.1"
FT                   /translation="MTAKPFSLNLTNLLLLAVLFAVSLSVGVADFRWSDVFSLSDSTEL
FT                   MLVSRLPRTFAIVLTGASMAVAGMIMQILMRNRFVEPSMAGAGQSAALGLLLMSLLLPA
FT                   APLPVKMSVAAVAALIGMLVFMLLIRRLPPTAQLMVPLVGIIFGGVVEAVATFIAYENE
FT                   MLQMLGVWQQGDFSSVLLGRYELLWITGGLAVFAYLIADRLTILGLGETVSVNLGLNRT
FT                   AVLWSGLIIVALITSLVIVTVGNIPFVGLVVPNIISRLIGDRLRQSLPAVALLGASLVL
FT                   LCDILGRVIVFPFEIPVSTVFGVLGTALFLWLLLRKPAHAV"
FT   CDS_pept        complement(182275..182445)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03644"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4T4"
FT                   /protein_id="CBA03644.1"
FT                   /translation="MKRRHSMPSETRMQTASCVSDGIARYGRYSGLNLNQYGVASPCRT
FT                   ICTVCGFVALS"
FT   CDS_pept        complement(182484..183449)
FT                   /transl_table=11
FT                   /gene="fetB"
FT                   /locus_tag="NMO_0178"
FT                   /product="ferric enterobactin periplasmic binding protein"
FT                   /function="ABC-type enterochelin transport system
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03646"
FT                   /db_xref="GOA:C6S4T5"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4T5"
FT                   /protein_id="CBA03646.1"
FT                   /translation="MLRLTALAVCTALALGACSPQNSDSAPQAKEQAVSAAQTEGASLT
FT                   VKTARGDVQIPQNPERIAVYDLGMLDTLSKLGVKTGLSVDKNRLPYLEEYFKTTKPAGT
FT                   LFEPDYETLNAYKPQLIIIGSRAAKAFDKLNEIAPTIEMTADTANLKESAKERIDALAQ
FT                   IFGKQAEADKLKAEIDASFEAAKTAAQGKGKGLVILVNGGKMSAFGPSSRLGGWLHKDI
FT                   GVPAVDESIKEGSHGQPISFEYLKEKNPDWLFVLDRSAAIGEEGQAAKDVLDNPLVAET
FT                   TAWKKGQVVYLVPETYLAAGGAQELLNASKQVADAFNAAK"
FT   CDS_pept        complement(184147..186318)
FT                   /transl_table=11
FT                   /gene="fetA"
FT                   /locus_tag="NMO_0179"
FT                   /product="iron-regulated outer membrane protein"
FT                   /function="Outer membrane receptor proteins mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03648"
FT                   /db_xref="GOA:C6S4T6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4T6"
FT                   /protein_id="CBA03648.1"
FT                   /translation="MNAPFFRLSLLSLTLAAGFAHAAENNANVALDTVTVKGDRQGSKI
FT                   RTNIVTLQQKDESTATDMRELLKEEPSIDFGGGNGTSQFLTLRGMGQNSVDIKVDNAYS
FT                   DSQILYHQGRFIVDPALVKVVSVQKGAGSASAGIGATNGAIIAKTVDAQDLLKGLDKNW
FT                   GVRLNSGFASNEGVSYGASVFGKEGNFDGLFSYNRNDEKDYEAGKGFRNVNGGKTVPYS
FT                   ALDKRSYLAKIGTTFGGDDHRIVLSHMKDQHRGIRTVREEFAVGDTKSRINIKRQAPAY
FT                   RETTQSNTNLAYTGKDLGFVEKLDANAYVLEKKRYSADDKDNGYAGNVKGPNHTQITTR
FT                   GMNFNFDSRLAEQTLLKYGINYRHQEIKPQAFLNGKFKISDKKPDPNDPTKEIDKDAAE
FT                   KAKDKKDMDLVHSYKLSNPTKTDTGAYIEAIHEIDGFTLTGGLRYDRFKVKTHDGKTVS
FT                   SSNLNPSFGVIWQPHEHWSFSASHNYASRSPRLYDALQTHGKRGIISIADGTKAERARN
FT                   TEIGFNYNDGTFAANGSYFWQTIKDALANPQNRHDSVAVREAVNAGYIKNHGYELGASY
FT                   RTGGLTAKVGVSHSKPRFYDTHPKKLLSANPEFGAQVGRTWTASLAYRFKNPNLEIGWR
FT                   GRYVQKAEGSILVSGQKDRQGKLENVVRKGFGVNDIFANWKPLGKDTLNVNLSVNNVFN
FT                   TFYYPHSQRWTNTLPGVGRDVRLGVNYKF"
FT   mobile_element  188057..189064
FT                   /mobile_element_type="other:ISNme1"
FT                   /locus_tag="NMO_0180"
FT   CDS_pept        complement(189544..191178)
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="NMO_0181"
FT                   /product="60 kDa chaperonin"
FT                   /function="Chaperonin GroEL (HSP60 family)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03650"
FT                   /db_xref="GOA:C6S4T7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4T7"
FT                   /protein_id="CBA03650.1"
FT                   /translation="MAAKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFG
FT                   GPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGM
FT                   KYVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIA
FT                   EAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAALDNPFVLL
FT                   FDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGF
FT                   GDRRKAMLQDIAILTGGTVIAEEVGLSLEKATLDDLGQAKRIEIGKENTTIIDGFGDAA
FT                   QIEARVAEIRQQIETATSEYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDA
FT                   LHATRAAVEEGVVAGGGVALLRARAALENLHTGNADQDAGVQIVLRAVESPLRQIVANA
FT                   GGEPSVVVNKVLEGKGNYGYNAGSGEYGDMIEMGVLDPAKVTRSALQHAASIAGLMLTT
FT                   DCMIAEIPEEKPAMPDMGGMGGMGGMM"
FT   CDS_pept        complement(191271..191561)
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="NMO_0182"
FT                   /product="10 kDa chaperonin"
FT                   /function="Co-chaperonin GroES (HSP10)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03652"
FT                   /db_xref="GOA:C6S4T8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4T8"
FT                   /protein_id="CBA03652.1"
FT                   /translation="MTIRPLHDRVVVKRLEAEEKTASGIVLPGAAAEKPDMGEVIAVGA
FT                   GKIGKDGARRPLDVKVGDKIIFGKYSGQTVKADGEELLVMREEDIFGIVEK"
FT   mobile_element  191790..192443
FT                   /mobile_element_type="other:IS1016C"
FT                   /locus_tag="NMO_0183"
FT   CDS_pept        192656..194191
FT                   /transl_table=11
FT                   /locus_tag="NMO_0184"
FT                   /product="sodium-dependent symporter family protein"
FT                   /function="Na+-dependent transporters of the SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03654"
FT                   /db_xref="GOA:C6S4T9"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4T9"
FT                   /protein_id="CBA03654.1"
FT                   /translation="MSDSKTKERATFGTRRAFMIAAIGSAVGLGNIWRFPYIAFENGGG
FT                   AFILPYLVALLTAGIPLLLLDYAIGHRYRGSAPLAFRRLGRWFEPVGWWNVMTNIVICI
FT                   YYAVIIGWAASYTYYSVNAAWGADPQGFFFKDFLQMAGPEALGLDFVGKVAGPLAGVWV
FT                   FTAAIMALGVQKGVARASSFFMPLLLVMFLIMVGISLTLPGAAKGLDALFTPDWSKLAD
FT                   SKVWVAAYGQIFFSLSICFGIMVTYSSYLKKKTDLGGTGLVVGFANSSFELLAGIGVFA
FT                   ALGFMAQAGGKAVNEVASGGIGLAFIAFPTIINQAPMGWLIGILFFGSLVFAGVTSMIS
FT                   ILEVIVAAIQDKLNIGRVNATLLVCIPMGIVSTLLFGTATGLPVLDVMDKFVNTYGIVA
FT                   AGFVYVAAIIISGRLPELRKHLNALSSIRIGGLWTVCVVVTVVMLGYMLFKDTSGLMEK
FT                   NYEGYPDGFLSIFGWGMSAALVVFGLLLSLLPWKHGQDFNVKDEHEHEQGEEK"
FT   CDS_pept        complement(194340..195560)
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="NMO_0185"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03656"
FT                   /db_xref="GOA:C6S4U0"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4U0"
FT                   /protein_id="CBA03656.1"
FT                   /translation="MTLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAALNP
FT                   LVCYAVKANGNLSIIKHFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIE
FT                   FALNAGVKCFNMESIPEIDRIQKVAARLGKTASVSLRVNPDVDAKTHPYISTGLKANKF
FT                   GIAYADALEAYRHAAQQPNLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIV
FT                   LEHLDLGGGVGIVYQNEKVPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGALLTRV
FT                   EFVKYGEEKNFVMVDAAMNDLMRPALYDAYHHIEAVETKDIEPLTANIVGPICETGDFL
FT                   GKDRTIACEEGDLLLIRSAGAYGASMASNYNARNRAAEVLVDGNEYRLIRLRETLEQQM
FT                   ANELACL"
FT   CDS_pept        complement(195571..195762)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0186"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03658"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4U1"
FT                   /protein_id="CBA03658.1"
FT                   /translation="MIKKVLLMKYGVFFAAATALLLSACGYKGDLYLPKEGDKARFGVI
FT                   QTGLQLQSKPQSASQTQK"
FT   CDS_pept        195813..196136
FT                   /transl_table=11
FT                   /locus_tag="NMO_0187"
FT                   /product="CyaY protein"
FT                   /function="Protein implicated in iron transport frataxin
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03660"
FT                   /db_xref="GOA:C6S4U2"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4U2"
FT                   /protein_id="CBA03660.1"
FT                   /translation="MMTESEFIRASEALFEHIEDQIDENGWDFDCRFAGNVLTIEAENG
FT                   TQIIVNRHTPNQELWIAAKSGGYHFAEQNGKWLATRDGRDFYDVLNEVLSAASGEAVKI
FT                   AEL"
FT   CDS_pept        196163..197178
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0188"
FT   CDS_pept        197204..197623
FT                   /transl_table=11
FT                   /locus_tag="NMO_0189"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03663"
FT                   /db_xref="InterPro:IPR014449"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4U3"
FT                   /protein_id="CBA03663.1"
FT                   /translation="MAQLPLYLTSEIKDFTVGTPKVLESFSKHIPYGVVFEDDGDTGYF
FT                   YAASQDGILDALHIYNVEDVSDKHIPNHVLILWDDACTIAALSINDYIHAVYDFVEQAG
FT                   YCRNGFPETGGEWVKVENRVLDDELLDKILSRKST"
FT   CDS_pept        197645..198151
FT                   /transl_table=11
FT                   /locus_tag="NMO_0190"
FT                   /product="autoinducer-2 production protein"
FT                   /function="LuxS protein involved in autoinducer AI2
FT                   synthesis"
FT                   /EC_number="4.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03665"
FT                   /db_xref="GOA:C6S4U4"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4U4"
FT                   /protein_id="CBA03665.1"
FT                   /translation="MPLLDSFKVDHTRMHAPAVRVAKTMTTPKGDTITVFDLRFCIPNK
FT                   EILPEKGIHTLEHLFAGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGTPSEQQVADAW
FT                   LASMQDVGNVKDQSKIPELNEYQCGTYQMHSLAEAQQIAQNVLARKVAVNKNEELTLDE
FT                   GLLNA"
FT   CDS_pept        198297..201110
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="NMO_0191"
FT                   /product="DNA polymerase I"
FT                   /function="DNA polymerase I - 3-5 exonuclease and
FT                   polymerase domains"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03667"
FT                   /db_xref="GOA:C6S4U5"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4U5"
FT                   /protein_id="CBA03667.1"
FT                   /translation="MSNRPTLLLVDGSSYLYRAYHAMGQNLTAPDGAPTGALYGVLNML
FT                   RRLRSEYPHDYCAVVFDAKGKNFRHQMFEEYKATRPPMPDDLRPQAEALPDLVRLTGWP
FT                   VLVIGQVEADDVIGTLAKQGAEHGLRVIVSTGDKDMAQLVDERVTLVNTMSGETLDIEG
FT                   VKAKFGVRPDQIRDYLALMGDKVDNVPGVEKCGPKTAVKWLEAYGSLQGVIEHASEIKG
FT                   KVGENLRAALPRLPLSYDLVTIKTDVDLHAELSDGIESLRCTTPKWAQLVVDFKRWGFR
FT                   TWLKEAESNMNTGSTDDLFGSDSIGEQAALNAEMPFEKQAEKATAPERLDYQAVTTEAQ
FT                   FAALLDKLSRADTIGIDTETTSLDAMNASLVGISIAFQAGEAVYIPVGHSLTAAPEQLD
FT                   LQDVLGRLKPHLGNPALKKIGQNLKYDQHVFANYGIALNGIAGDAMLASYIIESHLGHG
FT                   LDELSERWLGLETITYESLCGKGAKQISFADVAIGQATEYAAQDADFALRLEAHLRAQM
FT                   DAKQLEMYEKMELPVAQVLFEMERNGVQIDRAELARQSAELGAELMKLEQEAYAAAGQP
FT                   FNLNSPKQLQEILFDKMGIPTKGLKKTAKGGISTNEAVLEQLAPDYPLPKIILQNRSLA
FT                   KLKSTYTDKLPEMISPRDNRVHTTYAQAVAITGRLASNNPNLQNIPIRTAEGRRVRRAF
FT                   TAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSPE
FT                   QRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKNFIDRYFARYPGVAEYMQRTKEQAAA
FT                   QGFVETLFGRRLYLPDIRNKNANARAGAERAAINAPMQGTASDLIKRAMIDVSRWLSEC
FT                   EASLWDCLKSKLIMQVHDELVLEVPEAELDFVKEKLPQIMAKVDGGLLDVPLVAEVGVG
FT                   ENWEEAH"
FT   CDS_pept        202457..203179
FT                   /transl_table=11
FT                   /locus_tag="NMO_0192"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03669"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4U6"
FT                   /protein_id="CBA03669.1"
FT                   /translation="MFPDKYKLSLKENIFLAKKVLVAQIHNLSRFENCQTTLLQTEQII
FT                   HGKNVASASLEDIQTILNLKRAYQYVISHISNGEPVDISLLKKINNIVAKDDSLAPGDF
FT                   RTGSVGVTLLDGSRHAPNPVKEIEVARVLQNIGLQSGSTTEAAVRFMLYCMRQQVFWDG
FT                   NKRTATLFANGLMMAGGCGILEISEMQMPQFNEKLSAFYRSGDDTDISKFVYQNCISGI
FT                   DYFGTDEDIDFPDPPNMG"
FT   CDS_pept        complement(203289..207653)
FT                   /transl_table=11
FT                   /gene="iga2"
FT                   /locus_tag="NMO_0193"
FT                   /product="IgA-specific serine endopeptidase"
FT                   /function="Type V secretory pathway adhesin AidA"
FT                   /EC_number="3.4.21.72"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03671"
FT                   /db_xref="GOA:C6S4U7"
FT                   /db_xref="InterPro:IPR000710"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR030396"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4U7"
FT                   /protein_id="CBA03671.1"
FT                   /translation="MKTTDKRTTETHRKAPKTGRIRFSPAYLAICLSFGILPQAWAGHT
FT                   YFGINYQYYRDFAENKGKFAVGAKDIEVYNKKGELVGKSMTKAPMIDFSVVSRNGVAAL
FT                   VGDQYIVSVAHNGGYNNVDFGAEGSNPDQHRFTYKIVKRNNYKAGTKGHPYGGDYHMPR
FT                   LHKFVTDAEPVEMTSYMDGRKYIDQNNYPDRVRIGAGRQYWRSDEDEPNNRESSYHIAS
FT                   AYSWLVGGNTFAQNGSGGGTVNLGSEKIKHSPYGFLPTGGSFGDSGSPMFIYDAQKQKW
FT                   LINGVLQTGNPYIGKSNGFQLVRKDWFYDEIFAGDTHSVFYEPRQNGKYSFNDDNNGTG
FT                   KINAKHEHNSLPNRLKTRTVQLFNVSLSETAREPVYHAAGGVNSYRPRLNNGENISFID
FT                   EGKGELILTSNINQGAGGLYFQGDFTVSPENNETWQGAGVHISEDSTVTWKVNGVANDR
FT                   LSKIGKGTLHVQAKGENQGSISVGDGKVILDQQADENNKKQAFSEIGLVSGRGTVQLNA
FT                   DNQFNPDKLYFGFRGGRLDLNGHSLSFHRIQNTDEGAMIVNHNQDKESTVTITGNKDIA
FT                   TTGNNNSLDNKKEIAYNGWFGEKDTTKTNGRLNLNYQPTEADRTLLLSGGTNLNGNITQ
FT                   TNGKLFFSGRPTPHAYNHLNNHWSQKEGIPHGEIVWDNDWINRTFKAENFHIQGGQAVI
FT                   SRNVAKVEGDWHLSNHAQAVFGVAPHQSHTICTRSDWTGLTNCVEKTITDDKVIASLTK
FT                   TNISGNVSLADHAHLNLTGLATLNGNLSANGDTRYTVSHNATQSGNLSLVGNAQATFNQ
FT                   ATLNGNTSASGNASFNLSNNAVQNGSLTLSDNAKANVSHSALNGNVSLADKAVFHFENS
FT                   RLTGQISGGKDTALHLKDSEWTLPSGTELGNLNLDNATITLNSAYRHDAAGAQTGSATD
FT                   APRRRSRRSLLSVTPPTSAESRFNTLTVNGKLNGQGTFRFMSELFGYRSDKLKLAESSE
FT                   GTYTLAVNNTGNEPASLEQLTVVEGKDNKPLSENLNFTLQNEHVDAGAWRYQLIRKDGE
FT                   FRLHNPVKEQELSDKLGKAEAKKQAGKDNAQSLDALIAAGRDAVEKTESVAEPARQAGG
FT                   ENVGIMQAEEEKKRVQADKDSALAKQREAETRPATTAFPRARRARRDLPQPQPQPQPQP
FT                   QRDLISRYANSGLSEFSATLNSVFAVQDELDRVFAEDRRNAVWTSGIRDTKHYRSQDFR
FT                   AYRQQTDLRQIGMQKNLGSGRVGILFSHNRTENTFDDGIGNSARLAHGAVFGQYGIDRF
FT                   DIGISAGAGFSSGSLSDGIGSKIRRRVLHYGIQARYRAGFGGFGIEPHIGATRYFVQKA
FT                   DYRYENVNIATPGLAFNRYRAGIKADYSFKPAQHISITPYLSLSYTDAASGKVRTRVNT
FT                   AVLAQDFGKTRSAEWGVNAEIKGFTLSLHAAAAKGPQLEAQHSAGIKLGYRW"
FT   CDS_pept        complement(207788..208117)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0194"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03673"
FT                   /db_xref="GOA:C6S4U8"
FT                   /db_xref="InterPro:IPR019284"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4U8"
FT                   /protein_id="CBA03673.1"
FT                   /translation="MIARRFHSGSLPPPSDLAQYNDIISNGADRIMAMAEKEQAVRHET
FT                   IRQDQTFNRRGQLYGFISVILILLFAVFLVWSGYPATAASLAGGTVFALACAFVIGRSR
FT                   DQGKN"
FT   CDS_pept        complement(208216..208371)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03675"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4U9"
FT                   /protein_id="CBA03675.1"
FT                   /translation="MEKRNTYAFLLGIGSLLGLFHPAKTAIRPNPADDLKNIGGDFQRA
FT                   IEKARK"
FT   CDS_pept        208502..209848
FT                   /transl_table=11
FT                   /gene="ThdF"
FT                   /locus_tag="NMO_0196"
FT                   /product="putative tRNA modification GTPase"
FT                   /function="Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03677"
FT                   /db_xref="GOA:C6S4V0"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4V0"
FT                   /protein_id="CBA03677.1"
FT                   /translation="MSDNVPTIAAVATAPGRGGVGVIRISGKNLLPMAQALCGKTPKPR
FT                   TATYADFTDADGQAIDSGLLLFFAAPASFTGEDVIELQGHGGPVVMDMLLNRCLELGAR
FT                   LAEPGEFTKRAFLNDKLDLAQAEGVADLIDASSRSAARLALRSLKGDFSRRIHGLVEDL
FT                   ITLRMLVEATLDFPEEDIDFLEAADARGKLDGLRRAVDDVLANAQQGAILREGLNVVLV
FT                   GAPNVGKSSLLNALAGDEVAIVTDIAGTTRDAVRERILIDGVPVHIVDTAGLRETDDVV
FT                   ERIGIERSRKAVSEADVALVLVDPREGVNDKTRAILDALPPELKRIEIHSKSDLHAHAA
FT                   GGFGTGAETVIALSAKTGDGLDALKRTLLREAGWQGESEGLFLARTRHVNALKAAQEEL
FT                   SLAALCGNHQIELLAEHLRLAQVACGEITGEFTADDLLGVIFSRFCIGK"
FT   CDS_pept        211987..213504
FT                   /transl_table=11
FT                   /locus_tag="NMO_0197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03679"
FT                   /db_xref="InterPro:IPR007655"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4V1"
FT                   /protein_id="CBA03679.1"
FT                   /translation="MLYFRYGFLVVWCAAGVSAAYGADAPAILDDKALLQVQRSVSDKW
FT                   AESDWKVENDAPRVVDGDFLLAHPKMLEHSLRDALNGNQADLIASLADLYAKLPDYDAV
FT                   LYGRARALLAKLAGRPAEAVARYRELHGENAADERILLDLAAAEFDDFRLKSAERHFAE
FT                   AAKLDLPAPVLENVGRFRKKTEGLTGWRFSGGISPAVNRNANNAAPQYCRQNGGRQICS
FT                   VSRAERAAGLNYEIEAEKLTALADNHYLLFRSNIGGTSYYFSKKSAYDDGFGRAYLGWQ
FT                   YKNARQTAGILPFYQVQLSGSDGFDAKTKRVNNRRLPPYMLAHGVGVQLSHTYRPNPGW
FT                   QFSVALEHYRQRYREQDRAEYNNGRQDGFYVSLAKRLGESATVFGGWQFVRFVPKRETV
FT                   GGAVNNAAYQRNGVYAGWAQEWRQLGGLNSRVSASYARRNYKGVAAFSTEAQRNREWNV
FT                   SLALSHDKLSYKGIVPALNYRFGRTESNVPYAKRRNSEVFVSADWRF"
FT   CDS_pept        complement(213563..215443)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0198"
FT                   /product="para-aminobenzoate synthase component I /
FT                   4-amino-4-deoxychorismate lyase, putative"
FT                   /function="Anthranilate/para-aminobenzoate synthases
FT                   component I"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03681"
FT                   /db_xref="GOA:C6S4V2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4V2"
FT                   /protein_id="CBA03681.1"
FT                   /translation="MPYFALFDDAVSGRAKRYQNHVESRFFGPEELDALDGALQKGWQK
FT                   GLHSVLFADYEFGLPLTGVESERGGNLALHWFADCADTDAASWLARHSDDLPAGISTPQ
FT                   SSVSETDYLDRIRQIHEAIRRGDTYQINYTTRLHLQAYGNPVSLYRRLRQPVPYAVLSH
FT                   LPDAEGQSAWTLCFSPELFLNIASDGTISTEPMKGTAPILGDGQDERRAAELQADPKNR
FT                   AENVMIVDLLRNDLGKIAQTGKVCVPEPFKVSRFGSVWQMTSTIQAQALPNTSFADILR
FT                   AAFPCGSITGAPKKMSMQIIESLETEARGLYTGSIGYLKPCAGGLGFEGIFNVVIRTLS
FT                   LKPVSASDGIVSGIGGPDSNAQARTAGQGGATPHPFDSNPPYRGVYGVGSGIVIDSDPA
FT                   AEYRECGWKARFLNELRPDFGIFETLRAENGRCTLLDRHLCRLKTSAQALNLPLPDGCE
FT                   NQIKQYIADLPDGAFRVKALLASDGISLSRAVLNRLTDKQRVIISPTILPAQNYLRRFK
FT                   TTCRTVFDQAWQTAETQGAFDSLFFNSDGILLEGGRSNVFVKHRGQWLTPSLDLDILNG
FT                   IMRQAVLDEPQKYLQTNQVIETHITQKTLQEAEEIRLSNALRGVFAAALA"
FT   CDS_pept        complement(216622..219483)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0199"
FT                   /product="putative autotransporter serine protease"
FT                   /function="Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03683"
FT                   /db_xref="GOA:C6S4V3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034061"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4V3"
FT                   /protein_id="CBA03683.1"
FT                   /translation="MINLKPAIEAGYTGRGVEVGIVDTGESVGSISFPELYGRKEHGYN
FT                   ENYKNYTAYMRKEAPEDGGGKDIEASFDDEAVIETEAKPTDIRHVKEIGHIDVVSHIIG
FT                   GRSVDGRPAGGIAPDATLHIMNTHDGTKNEIMSAAIRNAWVKLGERGVRIVNNSFGTTS
FT                   RAGTADHFQIANSEEQYRQALLAYSGGDKTDEGIRLMQQSDYGNLSYHIRNKNMLFIFS
FT                   ASNDAQAQPNTLTLLPFYEKDAQKGIITVAGVDRSGEKFNGSNHCGITAMWCLSAPYEA
FT                   SVRFTRTNPIQIAGTSFSAPIVTGTAALLLQKYPWMSNDNLRTTLLTTAQDIGAVGVDS
FT                   KFGWGLLDAGKAMNGPASFPFGDFTADTKGTSDIAYSFRNDISGTGGLIKKGGSQLQLH
FT                   GNNTYTGKTIIEGGSLVLYGNNKSDMRVETKGALIYNGAASGGSLNSDGIVYLADTDRS
FT                   GANETVHIKGDLQLGGEGTLYTRLGKLLKVDGTAMTGGKLYMSARGKGAGYLNRTGQRV
FT                   PFLSAAKIGRDYSFFTNIETDGGLLASLDSVEKTAGSEGDTLSYYVRRGNAARTASAAA
FT                   HSAPAGLKHAVEQGGSNLENLMVELDASESSATPETVETAAADRTDMPGIRPYGATFRA
FT                   AAAVQHANAADGVRIFNSLAATVYADSTAAHADMQGRRLKAVSDGLDHNGTGLRVIAQT
FT                   QQDGGTWEQGGVEGKMRGSTQTVGIAAKTGENTTAAATLGMGRSTWSENSANAKTDSIS
FT                   LFAGIRHDAGDIGYLKGLFSYGRYKNSISRSTGADEHAEGSVNGTLMQLGALGGVNVPF
FT                   AATGDLTVEGGLRYDLLKQDAFAEKGSALGWSGNSLTEGTLVGLAGLKLSQPLSDKAVL
FT                   FATAGVERDLNGRDYTVTGGFTGATAATGKTGARNMPHTRLVAGLGADVEFGNGWNGLA
FT                   RYSYAGSKQYGNHSGRVGVGYRF"
FT   mobile_element  complement(220875..221840)
FT                   /mobile_element_type="other:IS1655"
FT                   /locus_tag="NMO_0200"
FT   CDS_pept        complement(221934..223376)
FT                   /transl_table=11
FT                   /gene="aldA"
FT                   /locus_tag="NMO_0201"
FT                   /product="aldehyde dehydrogenase A"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03685"
FT                   /db_xref="GOA:C6S4V4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4V4"
FT                   /protein_id="CBA03685.1"
FT                   /translation="MKQLAMYINGRFENDFNGEWRDVLNPSTEEAIAREPKGGRADVDR
FT                   AVAAARAAQPAWERLPAVERGAYLRKIAQGIRERADELTDTIVAEGGKTKDLARVEVMF
FT                   TADYLDYQAEWARRYEGEIIQSDRPRENILLFKRPLGVIAGILPWNFPFFLIARKMGPA
FT                   LVTGNTIVVKPSSVTPINCHIFAEIVDAVGLPAGVFNVVNGPGAEIGNALSAHPQVDMV
FT                   SLTGSVEAGRQVMEAASANITKVSLELGGKAPAIVLKDADLDLAVKSILASRVGNTGQI
FT                   CNCAERVYVHSSLKDAFIEKMTAAMKGVRYGNPAEAEAGALEMGPLIEERAVKAVAEKV
FT                   ERAVKQGAKLVCGGKRAEGRGYFFEPTLLTDTDNSMDIMKEETFGPVLPVSAFDTLDQV
FT                   IALANDCEFGLTSSVYTTNLNEAFYVTRRLQFGETYINRENFEAMQGFHAGWKKSGIGG
FT                   ADGKHGLEEYLQTQVVYLETDI"
FT   CDS_pept        complement(223411..223611)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03687"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4V5"
FT                   /protein_id="CBA03687.1"
FT                   /translation="MDTVGSLAIGYATGGNAGAFTGANADWNNRQLHSSEYKLAEQYAD
FT                   IVASRLNISKETCTVIYLGIN"
FT   CDS_pept        complement(223620..224009)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03689"
FT                   /db_xref="InterPro:IPR016767"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4V6"
FT                   /protein_id="CBA03689.1"
FT                   /translation="MLYKCKIKKLDNTIEEAVLIEINGYELHCFISYCPFKIFENQFYE
FT                   VELSYEIFNDYILDKSTSNIEFRKIDDSFKYEITAELKNNHLTLQNIQFEEDEYLINYS
FT                   YLDNCLVTLTVDRISVSFIREIQAA"
FT   CDS_pept        complement(224217..225134)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0204"
FT                   /product="transcriptional regulator, AraC family"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03691"
FT                   /db_xref="GOA:C6S4V7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4V7"
FT                   /protein_id="CBA03691.1"
FT                   /translation="MEKAEHLNSSRFVNLVKSGGGSYVEGSYRFDTLSNGISIHGGTVT
FT                   ARCDFCSSRLAEPYVSFVLLLEGSLNFGINRSRFQIDADGGKIVLIAVGEEVLFSRYLY
FT                   RGGKTVKMTIKGMEQWLLRPEYACFTPILYREPVRIWNLSPNLRGLAASCLQAVPKGHL
FT                   GETLRREADVLRLLSDLWDTVSDGIGPAAGQTAEADAMPSEDFSRTLNAAFADGAHQVN
FT                   RLADALNISERTLQRRMRDHFGITASEWLHHKQMQHALYLLQNGGKSIGETAYLCGYRH
FT                   VSSFTQAFRQYFGSTPAETKKENR"
FT   CDS_pept        225307..226107
FT                   /transl_table=11
FT                   /locus_tag="NMO_0205"
FT                   /product="putative ABC transport system ATP-binding
FT                   protein"
FT                   /function="ABC-type transport system involved in resistance
FT                   to organic solvents ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03693"
FT                   /db_xref="GOA:C6S4V8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4V8"
FT                   /protein_id="CBA03693.1"
FT                   /translation="MSPSPFIEMKDVAFAYGDRPILKNINFSIPQGNFAAVMGGSGSGK
FT                   TTLMRLITGQIRPQSGQVLIEGRDLAGFSADELYEHRRRMGVLFQHGALFTDLSVFDNI
FT                   AFPMRELTRLPEAVIRDLVLLKLNAVGLRGVENLMPSELSGGMSRRVALARTIALDPEI
FT                   MLYDEPFTGLDPISLGVIAHLISRVNKALRSTSVMVTHDIEKSLEIVDQVIFLAHGEIM
FT                   FSGSPQEMRELDSPWVRQFVGGLADGPVAYRYPAQTSLQQDLLG"
FT   CDS_pept        226155..226931
FT                   /transl_table=11
FT                   /locus_tag="NMO_0206"
FT                   /product="putative ABC transport system permease protein"
FT                   /function="ABC-type transport system involved in resistance
FT                   to organic solvents permease component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03695"
FT                   /db_xref="GOA:C6S4V9"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4V9"
FT                   /protein_id="CBA03695.1"
FT                   /translation="MNFIRSVGAKTLGLIQSLGSITLFLLNILAKSGTAFVRPRLSVRQ
FT                   VYFAGVLSVLIVAVSGLFVGMVLGLQGYTQLSKFKSADILGYMVAASLLRELGPVLAAI
FT                   LFASSAGGAMTSEIGLMKTTEQLEAMNVMAVNPVARVVAPRFWAGVFSMPLLASIFNVA
FT                   GIFGAYLVGVTWLGLDSGIFWSQMQNNITIHYDVINGLIKSAAFGVAVTLIAVHQGFHC
FT                   VPTSEGILRASTRTVVSSALTILAVDFILTAWMFTD"
FT   CDS_pept        226982..227479
FT                   /transl_table=11
FT                   /locus_tag="NMO_0207"
FT                   /product="probable outer membrane transport protein"
FT                   /function="ABC-type transport system involved in resistance
FT                   to organic solvents periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03697"
FT                   /db_xref="GOA:C6S4W0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4W0"
FT                   /protein_id="CBA03697.1"
FT                   /translation="MKKNILEFWVGLFVLIGAAAVGFLAFRVAGGAAFGGSDKTYAVYA
FT                   DFGDIGGLKVNAPVKSAGVLVGRVGAIGLDPKSYQARVRLDLDGKYQFSSDVSAQILTS
FT                   GLLGEQYIGLQQGGDTENLAAGDTISVTSSAMVLENLIGKFMTSFAEKNAAGGDDAAKA
FT                   TE"
FT   CDS_pept        227516..228106
FT                   /transl_table=11
FT                   /locus_tag="NMO_0208"
FT                   /product="putative periplasmic transport protein"
FT                   /function="ABC-type transport system involved in resistance
FT                   to organic solvents auxiliary component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03699"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4W1"
FT                   /protein_id="CBA03699.1"
FT                   /translation="MKKSSFISALGIGILSIGMAFAAPADAVNQIRQNATQVLSILKSG
FT                   DANTARQKAEAYAIPYFDFQRMTALAVGNPWRTASDAQKQALAKEFQTLLIRTYSGTML
FT                   KLKNANVNVKDNPIVNKGGKEIIVRAEVGVPGQKPVNMDFTTYQSGNKYRAYNVAIEGA
FT                   SLVTVYRNQFGEIIKAKGIDGLIAELKAKNGSK"
FT   CDS_pept        228139..228441
FT                   /transl_table=11
FT                   /locus_tag="NMO_0209"
FT                   /product="NTP binding protein"
FT                   /function="Predicted NTP binding protein (contains STAS
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03701"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4W2"
FT                   /protein_id="CBA03701.1"
FT                   /translation="MDFFLPNTMHTELNNGTLHISGDVTVKTLTAAAFTRFRQQCRLKD
FT                   TRAVDLSGVGRADSACVSLLLEVLRGCKGSVRLTGIPESVRALSELYEIKDWLKS"
FT   CDS_pept        228438..229265
FT                   /transl_table=11
FT                   /locus_tag="NMO_0210"
FT                   /product="putative lipoprotein"
FT                   /function="Surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03703"
FT                   /db_xref="GOA:C6S4W3"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4W3"
FT                   /protein_id="CBA03703.1"
FT                   /translation="MKKTAYAFLLLIGFASAPAFAETRPADPYEGYNRAVFKFNDQADR
FT                   YIFAPAARGYRKVAPKPVRAGVSNFFNNLCDVVSFGSNILRLDIKRASEDLVRVGINTT
FT                   FGLGGLIDIAGAGGIPDNKNTLGDTFASWGWKNSNYFVLPVLGPSTVRDALGTGITSVY
FT                   SPKNIVFRTPVGRWGTTAVSAVSTREGLLDLTDSLDEAAIDKYSYTRDLYMKVRARQTG
FT                   ATPAEGTEDNIDIDELVESAETGAAETAVQEDSVSETQAEAAGEAETQPGTQP"
FT   CDS_pept        229270..229752
FT                   /transl_table=11
FT                   /locus_tag="NMO_0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03705"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4W4"
FT                   /protein_id="CBA03705.1"
FT                   /translation="MPSENPCSDGIPFCRNGQSETTDWAIISFLRIPRDSKGKTMYEVN
FT                   RSVFVLIPLEPFWNWLQTLPGNHLDGLTLEDIQADANSYLVRPCETADEVWDEIEARFE
FT                   DIFAAELADWCEDEREWPALDADIFNEWFDIQLSTVITDLEHEPLAREAFQPINLN"
FT   CDS_pept        229958..230620
FT                   /transl_table=11
FT                   /locus_tag="NMO_0212"
FT                   /product="putative thioredoxin"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03707"
FT                   /db_xref="GOA:C6S4W5"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4W5"
FT                   /protein_id="CBA03707.1"
FT                   /translation="MPPENPRHAPYCADPDDYTAKRQNRRRSRHHPDARPRRHTTHRQP
FT                   ARHPCPRIGSLVRMKKILTAAVVALIGILLAIVLIPDSKTAPAFSLPDLHGKTVSNADL
FT                   QGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQYVKDYG
FT                   LPFTVMYDADKAVGQAFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTALAQ"
FT   CDS_pept        complement(230702..231210)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0213"
FT   CDS_pept        231421..231663
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="NMO_0214"
FT                   /product="50S ribosomal protein L31"
FT                   /function="Ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03710"
FT                   /db_xref="GOA:C6S4W6"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4W6"
FT                   /protein_id="CBA03710.1"
FT                   /translation="MPAFLKGNQMKQGIHPNYHEVNVTCSCGNKFATKSAMEKENFNIE
FT                   VCSLCHPFYTGTQKIVDTTGRVDKFNNKFGNLFKR"
FT   CDS_pept        231966..232607
FT                   /transl_table=11
FT                   /gene="cad"
FT                   /locus_tag="NMO_0215"
FT                   /product="putative cadmium resistance protein"
FT                   /function="Predicted permease cadmium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03713"
FT                   /db_xref="GOA:C6S4W7"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4W7"
FT                   /protein_id="CBA03713.1"
FT                   /translation="MRCFMIQNVVTSIILYSGTAVDLLIILMLFFAKRKSRKDIINIYL
FT                   GQFLGSVSLILLSLLFAFVLDYIPSKEILGLLGLIPIFLGIKVLLLGDSDGEAIAKEGL
FT                   RKDNKNLIFLVAMITFASCGADNIGVFVPYFTTLNSANLIVALLTFLVMIYLLVFSAQK
FT                   LAQVPSVGETLEKYSRWFVAVVYLGLGVYILIENNSFDMLWTVSGQEKIL"
FT   CDS_pept        232672..234429
FT                   /transl_table=11
FT                   /locus_tag="NMO_0216"
FT                   /product="putative membrane protein"
FT                   /function="4-amino-4-deoxy-L-arabinose transferase and
FT                   related glycosyltransferases of PMT family"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03715"
FT                   /db_xref="GOA:C6S4W8"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4W8"
FT                   /protein_id="CBA03715.1"
FT                   /translation="MPSEAVSARPLCEYLLHLAIRPFFLTLMLTYTPPDARPPAKTHEK
FT                   PWLLLLMAFAWLWPGVFSHDLWNPAEPAVYTAVEALAGSPTPLVAHLFGHADFGIPPVY
FT                   LWVAAAFKHLLSPWAADPYDAARFAGVFFAVVGLTSCGFAGFNFLGRHHGRSVVLILIG
FT                   CIGLIPTVHFLNPAAAAFAAAGLVLHGYSLARRRVIAASFLLGTGWTLMSLAAAYPAAF
FT                   ALMLPLPVLMFFRPWQSRRLMLTAVASLAFALPLMTVYPLLLAKTQPALFAQWLDDHVF
FT                   GTFGGVRHVQTAFSLFYYLKNLLWFALPALPLAVWTVCRTRLFSTDWGILGVVWMLAVL
FT                   VLLAVNPQRFQDNLVWLLPPLALFGAAQLDSLRRGAAAFVNWFGIMAFGLFAVFLWTGF
FT                   FAMNYGWPAKLAERAAYFSPYYVPDIDPIPMAVAVLFTPLWLWAITRKNIRGRQAVTNW
FT                   AAGVTLTWALLMTLFLPWLDAAKSHAPVVRSMEASLSPELKRELSDGIECIDIGGGDLH
FT                   TRIVWTQYGTLPHRVGDVQCRYRIVRLPQNADASQGWQTVWQGARPRNKDSKFALIRKI
FT                   GENILKTTD"
FT   CDS_pept        234531..235136
FT                   /transl_table=11
FT                   /gene="regF"
FT                   /locus_tag="NMO_0217"
FT                   /product="stringent starvation protein A"
FT                   /function="Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03717"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4W9"
FT                   /protein_id="CBA03717.1"
FT                   /translation="MMTLYSGITCPFSHRCRFVLYEKGMDFEIKDVDIYNKPEDLAVMN
FT                   PYNQVPVLVERDLVLHESNIINEYIDERFPHPQLMPGDPVMRGRGRLVLYRMEKELFNH
FT                   VQVLENPAATNKEQAKAREAIGNGLTMLAPSFSKSKYILGEDFSMIDVALAPLLWRLDH
FT                   YDVKLGKSAAPLLKYAERIFQREAFIEALTPAEKAMRK"
FT   CDS_pept        235208..235600
FT                   /transl_table=11
FT                   /gene="regG"
FT                   /locus_tag="NMO_0218"
FT                   /product="Stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03719"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4X0"
FT                   /protein_id="CBA03719.1"
FT                   /translation="MPTSTKPYILRALCEWCSDNSLTPHILVWVNEHTRVPMQYVRDNE
FT                   IMLNIGATATQNLQIDNDWISFSARFGGQAHDIWIPVGHVLSLFARETGEGMGFELEAY
FT                   RPDTPPENTSAETAPRPAKKGLKLVK"
FT   CDS_pept        235605..235847
FT                   /transl_table=11
FT                   /locus_tag="NMO_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03721"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4X1"
FT                   /protein_id="CBA03721.1"
FT                   /translation="MPSERNRVSDGILSDGAQTESVYRQNPFRCIETVLPLPIRYWDVI
FT                   ASALECNYGAANQAIERQRQRAAAVAVHERVAKFL"
FT   CDS_pept        complement(235925..236467)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0220"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03723"
FT                   /db_xref="GOA:C6S4X2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4X2"
FT                   /protein_id="CBA03723.1"
FT                   /translation="MRTHRKTCSAVCFAFQTASKPAVSIRHPSEDIMSLKIRLTEDMKT
FT                   AMRAKDQVSLGTIRLINAAVKQFEVDERTEADDAKITAILTKMVKQRKDSAKIYTEAGR
FT                   QDLADKENAEIEVLHRYLPQMLSAGEIRTAVDAAVAETGAAGMADMGKVMGVLKTRLAG
FT                   KADMGEVNKILKAVLTA"
FT   CDS_pept        complement(236503..236715)
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="NMO_0221"
FT                   /product="30S ribosomal protein S21"
FT                   /function="Ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03725"
FT                   /db_xref="GOA:C6S4X3"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4X3"
FT                   /protein_id="CBA03725.1"
FT                   /translation="MPAIRVKENEPFEVAMRRFKRAVEKTGLLTELRAREAYEKPTTER
FT                   KRKKAAAVKRLQKRLRSQQLPPKMY"
FT   CDS_pept        complement(237004..238851)
FT                   /transl_table=11
FT                   /gene="MltE"
FT                   /locus_tag="NMO_0222"
FT                   /product="lytic murein transglycosylase"
FT                   /function="Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03726"
FT                   /db_xref="GOA:C6S4X4"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4X4"
FT                   /protein_id="CBA03726.1"
FT                   /translation="MYLPSMKHSLPLLAALVLAACSSTHAPSSKTLADNIETAGLSASV
FT                   PTRPAEPEGKTLADYSSYPSALDAVKQKNDAAVAAYLENAGDSAMAENVRNEWLKSLGA
FT                   RKQWTLFAQEYAKLEPAGRAQEVECYADSSRNGYTRAAELVKNTGKLPSGCTKLLEQAA
FT                   ASGLLDGNNAWRRVRGLLAGRQTTDARNLAAALGSPFDGGTQGSREYALLNVIGKEARK
FT                   SPNAAALLSEMESGLSLEQRSFAWGVLGHYQSQSLNVPAALDYYGKVADRRQLTDDQIE
FT                   WYARAALRARRWDELASVISHMPEKLQKSPTWLYWLARSRAATGNTQEAEKLYKQAAAT
FT                   GRNFYAVLAGEELGRKIDTRNNVPDAGKNSVLRMAEDGAIKRALVLFRNSRTAGDAKMR
FT                   RQAQAEWRFATRGFDEDKLLTAAQTAFDHGFYDMAVNSAERTDRKLNYTLRYISPFKDT
FT                   VIRHAQNVNVDPAWVYGLIRQESRFVMGAQSGVGAQGLMQVMPATAREIAGKIGMDAAQ
FT                   LYTADGNIRMGTWYMADTKRRLQNNEVLATAGYNAGPGRARRWQADIPLEGAVYAETIP
FT                   FSETRDYVKKVMTNAAYYASLFGAPHIPLKQRMGIVPAR"
FT   CDS_pept        239381..240118
FT                   /transl_table=11
FT                   /locus_tag="NMO_0223"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="ABC-type metal ion transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03729"
FT                   /db_xref="GOA:C6S4X5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4X5"
FT                   /protein_id="CBA03729.1"
FT                   /translation="MIILDKVSKHYQTRDKTRFAAVEPTSLEIRDGEIFGLMGYSGAGK
FT                   STLLRLINLLERPDSGKVNVCGQELTALDAAALRQARQNIGMVFQQFNLLNNRTVAGNV
FT                   AFPLEIAGWPSEKIKARVAECLEIVGLTERAGHYPAQLSGGQKQRVGIARALAPKPQVI
FT                   LADEPTSALDPATTRSVLECLEDINKRFNVTIVIVTHEMSVIRRLCDRAALLDKGKVVE
FT                   IVEVRGNQIHARSDIGRELIRED"
FT   CDS_pept        240530..240808
FT                   /transl_table=11
FT                   /locus_tag="NMO_0224"
FT                   /product="ABC transporter integral membrane protein"
FT                   /function="ABC-type metal ion transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03731"
FT                   /db_xref="GOA:C6S4X6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4X6"
FT                   /protein_id="CBA03731.1"
FT                   /translation="MGAPPVAIVRKVLLNEARAGMVSSITVLAIGLLSYSAAAGMIGGG
FT                   GLGDLAIRYGYYRYQTEVIVFIVALLVLLVILIQSTGNALARKLDKR"
FT   CDS_pept        240967..241830
FT                   /transl_table=11
FT                   /locus_tag="NMO_0225"
FT                   /product="putative lipoprotein"
FT                   /function="ABC-type metal ion transport system periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03733"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4X7"
FT                   /protein_id="CBA03733.1"
FT                   /translation="MKTFFKTLSAAALALILAACGGQKDSAPAASASAAADNGAEKKEI
FT                   VFGTTVGDFGDMVKEHIQPELEKKGYTVKLVEFTDYVRPNLALAEGELDINVFQHKPYL
FT                   DDFKKEHNLDITEVFQVPTAPLGLYPGKLKSLEEVKDGSTVSAPNDPSNFARVLVMLDE
FT                   LGWIKLKDGINPLTASKADIAENLKNIKIVELEAAQLPRSRADVDFAVVNGNYAISSGM
FT                   KLTEALFQEPSFAYVNWSAVKTADKDSQWLKDVTEAYNSDAFKAYAHKRFEGYKSPAAW
FT                   NEGAAK"
FT   CDS_pept        complement(241892..242464)
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="NMO_0226"
FT                   /product="3-polyprenyl-4-hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03735"
FT                   /db_xref="GOA:C6S4X8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4X8"
FT                   /protein_id="CBA03735.1"
FT                   /translation="MMVRRLIIGISGASGFQYGVKALELLRAQDIETHLVVSKGAEMAR
FT                   ASETAYARDEVYALADFVHPIGNIGACIASGTFKTDGMLVAPCSMRTLASVAHGFGDNL
FT                   LTRAADVVLKERRRLVLMVRETPLNLAHLDNMKRVTEMGGVVFPPVPAMYRKPQTADDI
FT                   VAHSVAHALSLFGIDTPDSAEWQGMAD"
FT   CDS_pept        242619..243479
FT                   /transl_table=11
FT                   /locus_tag="NMO_0227"
FT                   /product="chromosome partitioning protein"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03737"
FT                   /db_xref="GOA:C6S4X9"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4X9"
FT                   /protein_id="CBA03737.1"
FT                   /translation="MAKVKGGLGRGLDSLLANGADNSSGDRLTTVAVKDIRPGRYQARV
FT                   QIDDEALQELADSIKAQGVIQPVIVREHGLSRYELIAGERRWRAAQIAGLTEIPAVIKT
FT                   ISDETALAMGLIENLQRENLNPIEEAQGLKRLADEFGLTHETIAQAVGKSRSAISNSLR
FT                   LLSLPEPVQEMLYQRRLEMGHARALLTLPVVEQLELAQKAVKNGWSVREVERRSQAALQ
FT                   NKRPEPKKTAAADIGRLNDLLTEKLGVNAEIKTANHKKGKIILHFDTLETFDHILKQLG
FT                   IDYRP"
FT   CDS_pept        243614..243952
FT                   /transl_table=11
FT                   /locus_tag="NMO_0228"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03739"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Y0"
FT                   /protein_id="CBA03739.1"
FT                   /translation="MNTRIIVSAAFVALALAGCGSINNVTVSDQKLQERAAFALGVSPN
FT                   AVKISNRNNEGIRINFTATVGKRVSQCYVTSVISTIGVTTSDAICLGGGTHKGKSQCNA
FT                   LLKAAGRC"
FT   CDS_pept        244320..244673
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="NMO_0229"
FT                   /product="putative inner membrane ATP synthase protein"
FT                   /function="F0F1-type ATP synthase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03740"
FT                   /db_xref="GOA:C6S4Y1"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Y1"
FT                   /protein_id="CBA03740.1"
FT                   /translation="MKQIIILQSAVLSICAAVAFAVWGFAGFLSAVGGGLSYLLPTFVA
FT                   VLLLKLFRGNPFLQSRMFVFGEILKVVLSLLSMLAVFAVWHQSLVFAPFLMGLLGVSHL
FT                   VFLVLLRVKDYGR"
FT   CDS_pept        244663..245529
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="NMO_0230"
FT                   /product="ATP synthase A chain"
FT                   /function="F0F1-type ATP synthase subunit a"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03742"
FT                   /db_xref="GOA:C6S4Y2"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Y2"
FT                   /protein_id="CBA03742.1"
FT                   /translation="MAGETITAADYIKHHLQSLTSLSDVTQGQGLKNIADFSFINLDAV
FT                   FFAVLLGVIGSFLLWRGAKKATAGVPGRFQAAVEILFEFVDDMCKSIIHNEKSRKAVAP
FT                   LGLTLFVWIFLMNAMDMLPVDLLPMVWQGITGNHHALLRVVPTADLNTTLALAVGVLLI
FT                   CIYYNIKIKGLGGWFHELFSAPFGAKLAPANFLLNLVEFLSKTVSHGMRLFGNMYAGEL
FT                   VFLLIALLGGAWAASGSVEVMDPILFVFHIIAGLAWAIFHILVITLQAFIFMALAFVYI
FT                   GQAHDAH"
FT   CDS_pept        245586..245822
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="NMO_0231"
FT                   /product="ATP synthase C chain"
FT                   /function="F0F1-type ATP synthase subunit
FT                   c/Archaeal/vacuolar-type H+-ATPase subunit K"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03744"
FT                   /db_xref="GOA:C6S4Y3"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Y3"
FT                   /protein_id="CBA03744.1"
FT                   /translation="MGLIAIACGLIVALGALGASIGIAMVGSKYLESSARQPELIGPLQ
FT                   TKLFLIAGLIDAAFLIGVAIALLFAFVNPFAGA"
FT   CDS_pept        245893..246363
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="NMO_0232"
FT                   /product="ATP synthase B chain"
FT                   /function="F0F1-type ATP synthase subunit b"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03746"
FT                   /db_xref="GOA:C6S4Y4"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Y4"
FT                   /protein_id="CBA03746.1"
FT                   /translation="MNINATLFAQIIVFFGLVWFTMKFVWPPIAKALDERAAKVAEGLA
FT                   AAERGKSDFEQAEKKVAELLAEGRNQVSEMVANAEKRAAKIVEEAKEQASSEAARIAAQ
FT                   AKADVEQELFRARESLREQVAVLAVKGAESILRSEVDASKHAKLLDTLKQEL"
FT   CDS_pept        246368..246901
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="NMO_0233"
FT                   /product="ATP synthase delta chain"
FT                   /function="F0F1-type ATP synthase delta subunit
FT                   (mitochondrial oligomycin sensitivity protein)"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03748"
FT                   /db_xref="GOA:C6S4Y5"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Y5"
FT                   /protein_id="CBA03748.1"
FT                   /translation="MAEFATIARPYAKALFGLAQEKNQIESWLGGLEKLAAVVQEGKVA
FT                   SLIDRPETNASEKADILIDLVGLKDKELKNFVIVLAGQKRLSILPEVYAQYQDLTLSFN
FT                   HIKSAVIYSAYPLTDKQVGELAQMLNKRFDSELKISVEIEPELIGGIKVEVGDQVLDLS
FT                   VQGKLSALYTTMTN"
FT   CDS_pept        246912..248459
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="NMO_0234"
FT                   /product="ATP synthase alpha chain"
FT                   /function="F0F1-type ATP synthase alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03750"
FT                   /db_xref="GOA:C6S4Y6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Y6"
FT                   /protein_id="CBA03750.1"
FT                   /translation="MQLNPAEISDLIKAKIENLSVNAEVRTRGTVISVTDGIVRIHGLS
FT                   DAMQGEMLEFPGNTFGLAMNLERDSVGAVVLGEYEHIKEGDTVTCTGRILEVPVGRELV
FT                   GRVVDALGRPIDGKGPINTTLTAPIEKIAPGVIARKSVDQPMQTGLKAIDSMVPVGRGQ
FT                   RELIIGDRQTGKTAVALDAIVNQKGTGVICIYVAIGQKASSIANVVRKLEEHGAMEHTI
FT                   VVAATASEAAALQYIAPYSGCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVNEHEVEKLTNGEVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLETDLFNAGIRPAINAGISVSRVGGAAQTKVIKKLGGGIRLALAQ
FT                   YRELAAFSQFASDLDEATRKQLEHGEVVTELMKQKQFSTLNTAEMALTLWAINNGSYSD
FT                   VPVAKALAFESEFLSFVRTQHPEVLEAVNASGAMSDESEKTLEAAMKSFKSSYAYQA"
FT   CDS_pept        248484..249359
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="NMO_0235"
FT                   /product="ATP synthase gamma chain"
FT                   /function="F0F1-type ATP synthase gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03753"
FT                   /db_xref="GOA:C6S4Y7"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Y7"
FT                   /protein_id="CBA03753.1"
FT                   /translation="MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMRLARPY
FT                   AEKVRMVMSHLAQTNTDHGIPLLESHREIRRVGFILITSDKGLCGGLNANVLKKFLAQV
FT                   QEYRNQGIEEEIVCLGSKGLMACQSIGLNVVASAVNLGDTPKMEMLLGPLTELFQRYEK
FT                   HEIDRIHLVYSGFVNTMRQEPRMEVLLPIGENVIGDSAPKSPFSWEYRYEPTALAVLEY
FT                   LVRRYLESVVYQALSDNMASEQAARMVAMKAATDNAGNAIKELRLVYNKSRQAAITTEL
FT                   SEIVAGAAAV"
FT   CDS_pept        249397..250794
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="NMO_0236"
FT                   /product="ATP synthase beta chain"
FT                   /function="F0F1-type ATP synthase beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03755"
FT                   /db_xref="GOA:C6S4Y8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Y8"
FT                   /protein_id="CBA03755.1"
FT                   /translation="MSQGKIVQIIGAVVDVEFPRDMIPRVYDALKLDENGLTLEVQQLL
FT                   GDGVVRTIAMGSSDGLKRGMTVNNTGAPITVPVGKGTLGRIVDVLGTPVDEAGPIDTDK
FT                   SRAIHQAAPKFDELSSTTELLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELIN
FT                   NIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTG
FT                   LTMAEYFRDEKDENGKGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMG
FT                   RLQERITSTQTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVD
FT                   PLDSTSRQLDPMVLGQEHYDVARGVQSTLQKYKELRDIIAILGMDELSDEDKLTVMRAR
FT                   KIQRFLSQPFHVAEVFTGSPGKYVALRDTIAGFKAILNGEYDHLPEQAFYMVGSIEEAV
FT                   EKAKTLN"
FT   CDS_pept        250805..251227
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="NMO_0237"
FT                   /product="ATP synthase epsilon chain"
FT                   /function="F0F1-type ATP synthase epsilon subunit
FT                   (mitochondrial delta subunit)"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03756"
FT                   /db_xref="GOA:C6S4Y9"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Y9"
FT                   /protein_id="CBA03756.1"
FT                   /translation="MSIMQVEVVSSEQNIYSGEASFVVVPTVQGELGIYPRHEPIMSLV
FT                   RPGALRLTVPGEDKEVLVAVSGGVLEVQPDKVTVLADVAVRSAEMDQARAEEAKKAAEA
FT                   GISQAKDDKALAEAHKALAAAIAQLKTLDYIRSHKK"
FT   CDS_pept        251632..252537
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="NMO_0238"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /function="Glycyl-tRNA synthetase alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03759"
FT                   /db_xref="GOA:C6S4Z0"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Z0"
FT                   /protein_id="CBA03759.1"
FT                   /translation="MLTFQQIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALG
FT                   PEPWFAAYVQPSRRPKDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDP
FT                   KVHDIRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIE
FT                   RLAMYLQGVENVYDLVWAKTLDGNTVTYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDY
FT                   EAQAKRLLAEENASLALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRAVA
FT                   QKYVESREKLGFPLMKANAA"
FT   CDS_pept        252614..253024
FT                   /transl_table=11
FT                   /locus_tag="NMO_0239"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03761"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Z1"
FT                   /protein_id="CBA03761.1"
FT                   /translation="MPVYFRTPSRKRLHKMNRRQHKKLHLGEFQTLIFGVQGSLHQAAD
FT                   DAEAFGRFMDELIAYLVVNGLEMAGGGDCGDFSCLFQKSGARSLGEIEKKAIISWLAGR
FT                   EDVATLYATPLVDGFYGDDGWENYSETYKQAD"
FT   CDS_pept        253045..255108
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="NMO_0240"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /function="Glycyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03763"
FT                   /db_xref="GOA:C6S4Z2"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Z2"
FT                   /protein_id="CBA03763.1"
FT                   /translation="MMTQTLLIELLTEELPPKALNNLGNHFAAAVAEGLEKAQLVDGTA
FT                   EFTAYASPRRLAVQVKNVKAVQADQKIVKKGPAVANAMKDGAPTKALEGFARGAGAKIE
FT                   DLTIVHDGKQDVYAYEYVQTGKPLGGLLEDIINAAVKKLPIPKVMRWGSSTFTFVRPVH
FT                   GLIVLHGGDIVNVSVLGLQSGNKTLGHRFLSNGEITIENADSYAEQMREQGKVEASFAE
FT                   RKAAIQTALEGQARRLNATVAADEALLDEVTALVEWPVVLEAGFEEHFLAVPQECLILT
FT                   MQQNQKYFPLLDQNGKLMNRFLLVSNLQTEDPSHIIRGNERVLRARLSDAEFFYKQDQK
FT                   ATLESRLPKLSSVVYHNKIGSQAERIERLQSIAAHIAKALGADAAAAERAARLAKADLV
FT                   TEMVGEFPELQGTMGKYYARLDGETEEIAEAVEQHYQPRFAGDKLPESKVATAVALADK
FT                   LETLVGIWGIGLIPTGDKDPYALRRAALGILRMLMQYGLDVNELIQTAFDSFPKGLLNE
FT                   QTPSETADFMQARLAVLLQNDYPQDIVAAVLAKQPRRLDDVVAKLQAVAAFKQLPEAAA
FT                   LAAANKRVQNLLKKADAELGAVNESLLQQDEEKALFAAAQGLQPKIAAAVAEGNFQTAL
FT                   SELASVKPQVDAFFDGVMVMAEDAAVKQNRLNLLNRLAEQMNAVADIALLGE"
FT   CDS_pept        255125..256171
FT                   /transl_table=11
FT                   /gene="lgtA"
FT                   /locus_tag="NMO_0241"
FT                   /product="lacto-N-neotetraose biosynthesis glycosyl
FT                   transferase"
FT                   /function="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03764"
FT                   /db_xref="GOA:C6S4Z3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Z3"
FT                   /protein_id="CBA03764.1"
FT                   /translation="MPSEAFRRHRAYRENKLQPLVSVLICAYNAEKYFAQSLAAVVNQT
FT                   WRNLEILIVDDGSTDGTLAIAKDFQKWDSRIKILAQAQNSGLIPSLNIGLDELAKSGMG
FT                   EYIARTDADDIAAPDWIEKIVGEMEKDRSIIAMGAWLEVLSEEKDGNRLARHHRHGKIW
FT                   KKPTRHEDIADFFPFGNPIHNNTMIMRRSVIDGGLRYNTERDWAEDYQFWYDVSKLGRL
FT                   AYYPEALVKYRLHANQVSSKYSIRQHEIAQGIQKTARNDFLQSMGFKTRFDSLEYRQIK
FT                   AVAYELLEKHLPEEDFERARRFLYQCFKRTDTLPADAWLDFAADGRMRRLFTLRQYFGI
FT                   LHRLLKNR"
FT   CDS_pept        256213..257052
FT                   /transl_table=11
FT                   /gene="lgtB"
FT                   /locus_tag="NMO_0242"
FT                   /product="lacto-N-neotetraose biosynthesis glycosyl
FT                   tranferase"
FT                   /function="Glycosyltransferase involved in LPS
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03766"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Z4"
FT                   /protein_id="CBA03766.1"
FT                   /translation="MQNHVISLASAAERRAHIADTFGRHGIPFQFFDALMPSERLEQVM
FT                   AELVPGLSAHPYLSGVEKACFMSHAVLWKQALDEGLPYIAVFEDDVLLGEGAEKFLAED
FT                   AWLQERFDPDSAFIVRLETMFMHVLTSPSGVADYCGRAFPLLESEHWGTAGYIISRKAM
FT                   RFFLQHFVMLQPEQIKPIDLMMFSDFFDKEGMPVYQVSPALCAQELHYAKFHDQNSALG
FT                   SLIEHDRLLNRKQQRRDSPANTFKHRLIRALTKISREREKRRQRREQLIGKIIVPFQ"
FT   CDS_pept        257201..258007
FT                   /transl_table=11
FT                   /gene="lgtB2"
FT                   /locus_tag="NMO_0243"
FT                   /product="lacto-N-neotetraose biosynthesis glycosyl
FT                   tranferase"
FT                   /function="Glycosyltransferase involved in LPS
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03768"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Z5"
FT                   /protein_id="CBA03768.1"
FT                   /translation="MQNHVISLASAAERRAHIADTFGRHGIPFQFFDALMPSERLEQVM
FT                   AELVPGLSAHPYLSGVEKACFMSHAVLWKQALDEGLPYIAVFEDDVLLGEGAEKFLAED
FT                   AWLQERFDPDSAFIVRLETMFMHVLTSPSGVADYCGRAFPLLESEHWGTAGYIISRKAM
FT                   RFFLDRFAVLPSERLKAVDWMLFSSFLDKGGMTVCQLTPALCVQSETLPSQLKNGRQES
FT                   YRNRRSPKVLLKRALGKIGREIERARERKRQKKLEKHLGRHVVPFE"
FT   CDS_pept        complement(260548..261273)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0244"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03770"
FT                   /db_xref="GOA:C6S4Z6"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Z6"
FT                   /protein_id="CBA03770.1"
FT                   /translation="MPRFYLPENLSVGQTVALPDNIVRHLNVLRVRPNENITLFDGKGK
FT                   AHAAQLTVLEKRRAEAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAI
FT                   QPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSE
FT                   STKLIMSINRARKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGFQAVTLGKRILRT
FT                   ETAPLAAIAAMQTLWGDFA"
FT   CDS_pept        261482..262276
FT                   /transl_table=11
FT                   /locus_tag="NMO_0245"
FT                   /product="myo-inositol-1(or 4)-monophosphatase"
FT                   /function="Archaeal fructose-16-bisphosphatase and related
FT                   enzymes of inositol monophosphatase family"
FT                   /EC_number="3.1.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03772"
FT                   /db_xref="GOA:C6S4Z7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Z7"
FT                   /protein_id="CBA03772.1"
FT                   /translation="MLHRLQKVVRHIAQTEIMPRFLNTPSHRKEDGSMLSEADIAAQTA
FT                   FAAALPLLIDSPMLGEEMSRQEQSALWEQYSGEKGLWIVDPIDGTNNFVNGLPHFAVSV
FT                   AFVRNGRAELGVIYNPVSGECFYAERGQGAFLNGTRLPLRLVDKKLNEAIAGVEIKYLR
FT                   SGKLSSRMSTLAPFGTIRSMGSSTLDWCYLACGRYDVYVHGGQKLWDYAAGALIFEEAG
FT                   GRLTTLEGDGFWSGEHVFKRSVVAALEPKLFERWVGWIRENQ"
FT   CDS_pept        complement(262494..262889)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0246"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03774"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Z8"
FT                   /protein_id="CBA03774.1"
FT                   /translation="MPYYLYCLRLRRLVLIFVNPLYIIATTVPAQQAFLDAAELMQWSI
FT                   ETEWLGLNVIAHRNFGKQHAQVEFEAYFRDGQHRSAHHELSGFVNIGGQWYFIDPTVPH
FT                   PAMKQPCICGSGKKFKACCGKYLKPVA"
FT   mobile_element  complement(263187..264439)
FT                   /mobile_element_type="other:ISNme1"
FT                   /locus_tag="NMO_0247"
FT   CDS_pept        complement(264501..265172)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03776"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:C6S4Z9"
FT                   /protein_id="CBA03776.1"
FT                   /translation="MFPDKYKLSLEENIFLAKKVLVAQIHNLSRFENCQTTLLQTEQII
FT                   HGKNVASASLEDIQTILNLKRAYQYVISHISNGEPVDISLLKKINNIVAKDDSLAPGDF
FT                   RTGSVGVTLLDGSRHAPNPVKEIEVARVLQNIGLQSGSTTEAAVRFMLYCMRQQVFWDG
FT                   NKRTATLFANGLMMAGGCGILEISEMQMPQFNEKLSAFYRSGDDTDISKFVYQNCISGI
FT                   D"
FT   mobile_element  265457..266464
FT                   /mobile_element_type="other:ISNme1"
FT                   /locus_tag="NMO_0249"
FT   CDS_pept        complement(266726..267574)
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="NMO_0250"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03778"
FT                   /db_xref="GOA:C6S500"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S500"
FT                   /protein_id="CBA03778.1"
FT                   /translation="MSAANRLPRLNGNNQQTGLHRPAQSFDYWKKGKNMSTQDLSGKIA
FT                   LVTGASRGIGAAIADTLAAAGAKVIGTATSESGAAAISERLAQWGGEGRVLNSAEPETV
FT                   ENLIADIEKTFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFRASKAVLRGM
FT                   MKQRAGRIINITSVVGVMGNAGQTNYAAAKAGLIGFSKSMAREVGSRGITVNCVAPGFI
FT                   DTDMTRALPEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLHVNGGMLM
FT                   P"
FT   CDS_pept        complement(267534..269099)
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="NMO_0251"
FT                   /product="GMP synthase"
FT                   /function="GMP synthase PP-ATPase domain/subunit"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03780"
FT                   /db_xref="GOA:C6S501"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6S501"
FT                   /protein_id="CBA03780.1"
FT                   /translation="MTQDKILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAF
FT                   NPKGIILSGGPNSVYESDYQADTGIFDLGIPVLGICYGMQFMAHHLGGEVQPGNQREFG
FT                   YAQVKTIDSELTRGIQDGEPNTLDVWMSHGDKVSKLPDGFAVIGNTPSCPIAMMENAEK
FT                   QFYGIQFHPEVTHTKQGRALLNRFVLDICGAQPGWTMPNYIEEAVAKIREQVGSDEVIL
FT                   GLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLNEGKMVMDMFARNLGVKVIHVDAE
FT                   GQFMAKLAGVTDPEKKRKIIGAEFIEVFDVEEKKLTNAKWLAQGTIYPDVIESAGAKTK
FT                   KAHAIKSHHNVGGLPENMKLKLLEPLRDLFKDEVRELGVALGLPREMVYRHPFPGPGLG
FT                   VRILGEVKKEYADLLRQADDIFIQELRNTTDENGTSWYDLTSQAFAVFLPVKSVGVMGD
FT                   GRTYDYVVALRAVITSDFMTAHWAELPYSLLGRVSNRIINEVKGINRVVYDVSGKPPAT
FT                   IEWE"
FT   CDS_pept        complement(269199..271064)
FT                   /transl_table=11
FT                   /gene="msbA"
FT                   /locus_tag="NMO_0252"
FT                   /product="putative lipid A export ATP-binding/permease
FT                   protein"
FT                   /function="ABC-type multidrug transport system ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03782"
FT                   /db_xref="GOA:C6S502"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C6S502"
FT                   /protein_id="CBA03782.1"
FT                   /translation="MIEKLTFGLFKKEDARSFMRLMAYVRPYKIRIVAALIAIFGVAAT
FT                   ESYLAAFIAPLINHGFSAPAAPPELSAAAGIISTLQNWREQFTYMVWGTENKIWTVPLF
FT                   LIILVVIRGICRFTSTYLMTWVSVMTISKIRKDMFAKMLTLSSRYHQETPSGTVLMNML
FT                   NLTEQSVSNASDIFTVLTRDTMIVTGLTIVLLYLNWQLSLIVVLMFPLLSLLSRYYRDR
FT                   LKHVISDSQKSIGTMNNVIAETHQGHRVVKLFNGQAQAANRFDAVNRTIVRLSKKITQA
FT                   TAAHSPFSELIASIALAVVIFIALWQSQNGYTTIGEFMAFIVAMLQMYAPIKSLANISI
FT                   PMQTMFLAADGVCAFLDTPPEQDKGTLAPQRVEGRISFRNVDVEYRSDGIKALDNFNLD
FT                   IRQGERVALVGRSGSGKSTVVNLLPRFVEPSAGNICIDGIDIADIKLDCLRAQFALVSQ
FT                   DVFLFDDTLFENVRYSRPDAGEAEVLSALQAANLQSLIDASPLGLHQPIGSNGSNLSGG
FT                   QRQRVAIARAILKDAPILLLDEATSALDNESERLVQQALERLMENRTGIIVAHRLTTIE
FT                   GADRIIVMDDGKIIEQGTHEQLMSQNGYYTMLRNISNKDAAVRTA"
FT   CDS_pept        complement(271203..272129)
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="NMO_0253"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /function="(acyl-carrier-protein) S-malonyltransferase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03784"
FT                   /db_xref="GOA:C6S503"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:C6S503"
FT                   /protein_id="CBA03784.1"
FT                   /translation="MSFAFFFPGQGSQSLGMMNGFAEHAIVKNTFAEASAILGQDLWAM
FT                   INGSDAEIIGQTVNTQPIMLAAGIATYRAYLEAGGKAPSVVAGHSLGEYTALVAAGSLD
FT                   FADAVKLVRLRAELMQSAVPQGVGAMAAILGLEDEQVKAICAEAAQGEVVEAVNFNSPG
FT                   QVVIAGNTAAVERAMLAAKEAGAKRALPLPVSVPSHCSLMKPAADKLAEALKTVEIKQP
FT                   QIRVIHNADVAAYDDADKIKDALVRQLYSPVRWTETVNALVSDGIAESAECGPGKVLAG
FT                   LAKRINKAAACSALTDAGQVAAFIEAH"
FT   CDS_pept        complement(272315..272680)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0254"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03786"
FT                   /db_xref="GOA:C6S504"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="UniProtKB/TrEMBL:C6S504"
FT                   /protein_id="CBA03786.1"
FT                   /translation="MKRQAFFKLMACAAFLSAVSLRLPVLGACYAILSLYAFALYGIDK
FT                   RRAVRGKRRIPEHRLLLPALFGGWAGAYLGSRIFRHKTAKKRFVVLFRLTVSGNVLATL
FT                   ILIYSGLNLNQYGVASP"
FT   CDS_pept        complement(272727..273689)
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="NMO_0255"
FT                   /product="3-oxoacyl-synthase III"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03788"
FT                   /db_xref="GOA:C6S505"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C6S505"
FT                   /protein_id="CBA03788.1"
FT                   /translation="MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHI
FT                   AAENEKTSDLAAEAARRALDAARLDSGEIDLIIVATATPDMQFPSTATIVQQKLGITNG
FT                   CPAFDVQAVCAGFMYALTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGA
FT                   GAVVLSASDTPGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKM
FT                   LSKIADDVIEEAGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAA
FT                   SIPLALDTGIRSGQIKRGQNLLLEGIGGGFAWGAVLLQY"
FT   CDS_pept        complement(274043..274270)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03790"
FT                   /db_xref="UniProtKB/TrEMBL:C6S506"
FT                   /protein_id="CBA03790.1"
FT                   /translation="MINMKTSTVVFGGFFMADNGERIQIPVLENPDIREINHFFSVSNF
FT                   EKKTGVLVFRIIPEPEFGNTELTVYFEKGY"
FT   CDS_pept        complement(274288..274482)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03792"
FT                   /db_xref="UniProtKB/TrEMBL:C6S507"
FT                   /protein_id="CBA03792.1"
FT                   /translation="MKAGLRLDARLIESALDYIHYSERFLAFEILCTYIEDFDVRLTEQ
FT                   ESREISFINKEFEIESTSD"
FT   CDS_pept        complement(274682..275737)
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="NMO_0258"
FT                   /product="putative fatty acid synthesis protein"
FT                   /function="Fatty acid/phospholipid biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03794"
FT                   /db_xref="GOA:C6S508"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:C6S508"
FT                   /protein_id="CBA03794.1"
FT                   /translation="MITLAVDAMGGDQGLAVTVPGATAFLQAHPDVRLIMTGDETQLRQ
FT                   ALTAAGAPMERIDICHTAQIVGMDEAPQSALKNKKDSSMRVAVNQVKEGKAQAAVSAGN
FT                   TGALMATARFVLKTIPGIERPAIAKFLPSDTDHVTLALDLGANVDCTPEQLAQFAVIGS
FT                   ELVHALHPQKGQPRVGLVNVGTEDIKGTDTVKQTYKLLQNSKLNFIGNIESNSILYGEA
FT                   DVVVADGFVGNVMLKTIEGAVKFMSGAIRREFQSNLFNKLAAVAALPALKGLKNKLDPR
FT                   KFNGAILLGLRGIVIKSHGGTDETGFRYALEEAYHEAKSAGLSKIEQGVAEQLAALETA
FT                   KAVQNENVGGL"
FT   CDS_pept        complement(275825..276352)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0259"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted phosphoribosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03796"
FT                   /db_xref="GOA:C6S509"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6S509"
FT                   /protein_id="CBA03796.1"
FT                   /translation="MKQKIWYTYDDIHRVIKALAEKIRNADIKYDAMIAIGGGGFIPAR
FT                   MLRCFLEIPIYAVTTAYYDSDNEGQVTEEVKKVQWLDPVPEALRGKNVLVVDEVDDSRV
FT                   TMEFCLTELLKEDFGTIGVAVLHEKIKAKAGKIPEGIPYFSGITVEDWWINYPWDALDI
FT                   DEHNRLAESSRG"
FT   CDS_pept        complement(276680..276859)
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="NMO_0260"
FT                   /product="50S ribosomal protein L32"
FT                   /function="Ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03798"
FT                   /db_xref="GOA:C6S510"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:C6S510"
FT                   /protein_id="CBA03798.1"
FT                   /translation="MAVQQNKKSPSKRGMHRSHDALTAPALSVDSTTGEVHRPHHISPN
FT                   GMYRGRKVVKVKGE"
FT   CDS_pept        complement(276893..277834)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0261"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted metal-binding possibly nucleic acid-
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03800"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="InterPro:IPR039255"
FT                   /db_xref="UniProtKB/TrEMBL:C6S511"
FT                   /protein_id="CBA03800.1"
FT                   /translation="MHQHLVRISKVHRLAPLPAVAPRHLVRTDNQRLWETPGQRPRLTL
FT                   GKAQCRLRGGFPQHRRFVKIGGRRLKGNAEPFHLFAAENRTRTQNQRQFQTHPILLTVE
FT                   NTPEGAVKSSHAPKHGYPPSAYRNIFLKNIDVRTSKLYHISFMSDPNLIDPEIFAAEGQ
FT                   NLQGSFLLEELDERVSLHDYPADRQTKISFTLTGGRDRLQRLFLDLNVKADMPLICQRC
FT                   IKPMPFMLDESSRIVLFSNEESLDESMLADEELEGMLLEKELDLRTLVEDQILMSLPFS
FT                   PRHEDCGDNGTLEEVNRDKPNPFAVLAGLKSS"
FT   CDS_pept        278196..278906
FT                   /transl_table=11
FT                   /locus_tag="NMO_0262"
FT                   /product="predicted methyltransferase"
FT                   /function="Predicted methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03802"
FT                   /db_xref="GOA:C6S512"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C6S512"
FT                   /protein_id="CBA03802.1"
FT                   /translation="MSPVLYLIPTPLGTPDTPCLLPHEQQAIVGLTDFVVEAEKTARAH
FT                   LKHLGVTMPIRELNLQTLNEHTDLKTLPELLKPLQEGRSMGIVSEAGCPAVADPGANLV
FT                   ALAHKHGFEVRPLVGPSSLLLALMASGANGQSFAFKGYLPSEKNERIQSLKALEQRSRQ
FT                   QNETQLFIETPYRNDALLADAVENLHSETRLCVAADLTLPTQEIISQTVVQWRKRKEMP
FT                   NLKKRPTIFVMYAG"
FT   CDS_pept        complement(278987..280624)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0263"
FT                   /product="inner membrane protein OxaA"
FT                   /function="Preprotein translocase subunit YidC"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03804"
FT                   /db_xref="GOA:C6S513"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:C6S513"
FT                   /protein_id="CBA03804.1"
FT                   /translation="MDFKRLTAFFAIALVIMIGWEKMFPTPKPVPAPQQAAQQQAVTAS
FT                   AEAALAPATPITVTTDTVQAVIDEKSGDLRRLTLLKYKATGDENKPFILFGDGKEYTYV
FT                   AQSELLDAQGNNILKGIGFSAPKKQYSLEGDKVEVRLSAPETRGLKIDKVYTFTKGSYL
FT                   VNVRFDIANGSGQTANLSADYRIVRDHSEPEGQGYFTHSYVGPVVYTPEGNFQKVSFSD
FT                   LDDDAKSGKSEAEYIRKTPTGWLGMIEHHFMSTWILQPKGGQSVCAAGECSIDIKRRND
FT                   KLYSASVSVPLAAIPAGAKAETAVNLYAGPQTTSVIANIADNLQLAKDYGKVHWFASPL
FT                   FWLLNQLHNIIGNWGWAIIVLTIIVKAVLYPLTNASYRSMAKMRAAAPKLQAIKEKYGD
FT                   DRMAQQQAMMQLYTDEKINPLGGCLPMLLQIPVFIGLYWALFASVELRQAPWLGWITDL
FT                   SRADPYYILPIIMAATMFAQTYLNPPPTDPMQAKMMKIMPLVFSVMFFFFPAGLVLYWV
FT                   VNNLLTIAQQWHINRSIEKQRAQGEVVS"
FT   CDS_pept        complement(280796..281017)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0264"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03806"
FT                   /db_xref="GOA:C6S514"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:C6S514"
FT                   /protein_id="CBA03806.1"
FT                   /translation="MNFLLSKLLLGLIRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKY
FT                   GAFKGGRLAIKRIARCHPFGGHGHDPVP"
FT   CDS_pept        complement(281082..281447)
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="NMO_0265"
FT                   /product="rnpA ribonuclease P"
FT                   /function="RNase P Protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03808"
FT                   /db_xref="GOA:C6S515"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C6S515"
FT                   /protein_id="CBA03808.1"
FT                   /translation="MDYRFGRQYRLLKTDDFSSVFAFRNRRSRDLLQVSRSNGNGLDHP
FT                   RIGLVVGKKTAKRANERNYMKRVIRDWFRLNKNRLPPQDFVVRVRRKFDRATAKQARAE
FT                   LAQLMFGNPATGCRKQA"
FT   CDS_pept        complement(281450..281584)
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="NMO_0266"
FT                   /product="50S ribosomal protein L34"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03810"
FT                   /db_xref="GOA:C6S516"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:C6S516"
FT                   /protein_id="CBA03810.1"
FT                   /translation="MKRTYQPSVTKRKRIHGFLVRSKTRGGRAVLAARRAKGRKRLAV"
FT   CDS_pept        281876..283432
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="NMO_0267"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /function="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03812"
FT                   /db_xref="GOA:C6S517"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C6S517"
FT                   /protein_id="CBA03812.1"
FT                   /translation="MTLAEFWPLCLRRLHDMLPQGQFAQWIAPLTVGEEGGVWVVYGKN
FT                   QFACNMLKSQFAGKIEAVREELAAGRSAFVFKPGEGVRYEMAAVEGAVEPAEPSLHAVS
FT                   EGMPVQEVLLDELPSEEPVKPAASKTAADILAERMKNLPHEPRHTAGSASRPESEVLAK
FT                   ARTDAQRDAEEARYEQTNLSPDYTFDTLVEGKGNRLAAAAAQAIAESPGQSYNPFFLYG
FT                   STGLGKTHLVQAVGNELLKNRPDAKVRYMHSDDYIRSFMKAVRNNTYDVFKQQYKQYDL
FT                   LIIDDIQFIKGKDRTMEEFFYLYNHFHNEKKQLILTCDVLPAKIEGMDDRLKSRFSWGL
FT                   TLELEPPELEMRIAILQKKAEAAGISIEDEAALFIANLIRSNVRELEGAFNRVGASSRF
FT                   MNRPVIDIDLARTALQDIIAEKHKVITADIIIDAVAKYYRIKISDVLGKKRTRNIARPR
FT                   QVAMSLTKELTTLSLPSIGDSFGGRDHTTVMHGIRAVAKLREEDPELAQDYEKLLILIQ
FT                   N"
FT   CDS_pept        283667..284770
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="NMO_0268"
FT                   /product="DNA polymerase III, beta chain"
FT                   /function="DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03814"
FT                   /db_xref="GOA:C6S518"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C6S518"
FT                   /protein_id="CBA03814.1"
FT                   /translation="MLILQAERDSLLKPLQAVTGIVERRHTLPILSNVLIEGKGGQTKL
FT                   LATDLEIQIDTAGPEGGAGDFRITTNAKKFQDILRALPAGALVSLDWDDSRLTLKAGKS
FT                   RFALQTLPAADFPMMNVGEDISATFSLEQERFKTMLSQVQYSMAVQDIRYYLNGLLMQV
FT                   EGSQLRLVATDGHRLAYAACAIDADLPHAEVILPRKTVLELFKLLNNPDDPIQIELLDK
FT                   QVRFQCNGTTIVSKVIDGKFPDFNRVIPLDNDKIFVLSRAELLGALERVSILANEKFRG
FT                   ARLFLQPGLLSVVCSNNEQEEAREEIEIAYQGGELEVGFNIGYLMDVLRNIHSDDMQLA
FT                   FGDANRSTLFTVPNNPNFKYIVMPMRI"
FT   mobile_element  complement(285007..285549)
FT                   /mobile_element_type="other:IS1016C"
FT                   /locus_tag="NMO_0269"
FT   CDS_pept        complement(285782..287839)
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="NMO_0270"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03816"
FT                   /db_xref="GOA:C6S519"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:C6S519"
FT                   /protein_id="CBA03816.1"
FT                   /translation="MPEQNRILCRELSLLAFNRRVLAQAEDKNVPLLERLRFLCIVSSN
FT                   LDEFFEVRMAWLKRENKLHPRRRLDNGKMPSETIADVTEAARSLIRHQYDLFNNVLQPE
FT                   LARESIHFYRRRNWTGAQKKWIEDYFDRELLPILTPIGLDPSHPFPRPLNKSLNFAVEL
FT                   DGTDAFGRPSGMAIVQAPRILPRVVPLPSELCGGGHGFVFLSSILHAHVGKLFPGMNVK
FT                   GCHQFRLTRDSDLTVDEEDLQNLRAAIQNELHDREYGDGVRLEVADTCPAYIRDFLLAQ
FT                   FKLTAAELYQVKGPVNLVRLNAVPDLVNRPDLKFPTHTPGRLKALGKTASIFDLVRQSP
FT                   ILLHHPYQSFDPVVEMMREAAADPDVLAVKMTIYRTGTRSELVRALMKAALAGKQVTVV
FT                   VELMARFDEANNVNWAKQLEEAGAHVVYGVFGYKVHAKMALVIRREDGVLKRYAHLGTG
FT                   NYHQGTSRIYTDFGIITADEQITADVNTLFMEITGLGKPGRLNKLYQSPFTLHKMVIDR
FT                   IARETEHAKAGKPARITAKMNSLIEPTVIEALYRASAAGVQIDLIVRGMCTLRPGVKGL
FT                   SENIRVRSIIGRQLEHARVYCFHNNGADDTFISSADWMGRNFFRRIETAAPITAPELKK
FT                   RVIREGLEMALADNTHAWLMQPDGGYIRAAPAEGESEADLQNDLWTLLGG"
FT   CDS_pept        complement(288008..288451)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0271"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03818"
FT                   /db_xref="UniProtKB/TrEMBL:C6S520"
FT                   /protein_id="CBA03818.1"
FT                   /translation="MPLRLLLGILCCLPIFAPAHAQGQPDTVGDFIQKKKVIVDTSKAE
FT                   LCFADDRQCHPVLIGVATPKGTFGLTLNSTDKPGYGGEVIGFKQEGDFLFALHRVWNQI
FT                   PSERRNERIASPSVSDRIMTNGCINVSDAVYEKLRHYFVLEVI"
FT   CDS_pept        complement(288458..288973)
FT                   /transl_table=11
FT                   /gene="mlp"
FT                   /locus_tag="NMO_0272"
FT                   /product="lipoprotein"
FT                   /function="Small protein A (tmRNA-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03820"
FT                   /db_xref="GOA:C6S521"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:C6S521"
FT                   /protein_id="CBA03820.1"
FT                   /translation="MKIKQIVKPGLAVLAAGVLSACATKSNVKADGTTDNPVFPKPYSV
FT                   TLDNKRGTFPTYDELDQMRPGLTKDDIYKILGRPHYDEGMYGVHEWDYLFHFHTPGVGI
FT                   DPENTSGVEGVTTCQYKVIFDKDKFARSFYWNPVFPKDAACPPPAPKAEPQVIIREIVP
FT                   AKPKRIRQ"
FT   CDS_pept        289237..291873
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="NMO_0273"
FT                   /product="Leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03822"
FT                   /db_xref="GOA:C6S522"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:C6S522"
FT                   /protein_id="CBA03822.1"
FT                   /translation="MTMQEQYQPAAIEPAAQKKWDDARIFNVSEDASKPKYYCLSMFPY
FT                   PSGKLHMGHVRNYTIGDVLSRFKLLNGFNVMQPMGWDAFGMPAENAAMKNNVAPAAWTY
FT                   DNIEYMKTQLKSLGFAIDWEREVATCKPEYYRWEQWLFTKLFEKGIVYRKNGTVNWDPV
FT                   DQTVLANEQVIDGRGWRSGALIEKREIPMYYFKITDYAEELLNDLDKLEHWPEQVKTMQ
FT                   RNWIGKSRGMTVRFAVSDDSKQGLEGDYANFLQVYTTRPDTLMGATYVAVAAEHPLATA
FT                   AAADKPELQAFIAECKAGSVAEADMATMEKKGVPTGRYVVNPLNGDKLEVWIANYVLWG
FT                   YGDGAVMAVPAHDERDFEFATKYNLPKKQVIAVGDNAFDENQWQEWYGDKENGVLVNSG
FT                   DLDGLDFQTAFDAVAAKLQNQGAGEPKTQYRLRDWGISRQRYWGCPIPIVHCEQCGDVP
FT                   VPADQLPVVLPENVVPDGMGSPLAKMPEFYETACPCCGGAAKRETDTMDTFMESSWYFF
FT                   RYMSPKFSDGMVDPAAAKYWGAVDQYIGGIEHAILHLLYARFFTKLMRDEGLVNVDEPF
FT                   ERLLTQGMVVCETYYRENDKGGKDWINPADVELTFDDKGRPISAVLKADGLPVVISGTE
FT                   KMSKSKNNGVDPQELINAYGADTARLFMMFAAPPEQSLEWSDSGVEGAHRFLRRLWRTV
FT                   YEYLKQGEAVKAFAGSQDGLSKELKDLRHKLHSTIAKVSDDYGRRQQFNTAIAAVMELL
FT                   NQYDKTDTGGEQGRAVAQEVLETAVRLLWPIVPHICETLWSELNGAKLWEAGWPTVDEA
FT                   ALVKSEIEVMVQVNGKLRGKITVAADASKADLEAAALATEGAVKFMEGKPAKKIIVVPG
FT                   RLVNIVV"
FT   CDS_pept        291954..292922
FT                   /transl_table=11
FT                   /locus_tag="NMO_0274"
FT                   /product="putative type II DNA modification methylase"
FT                   /function="Site-specific DNA methylase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03824"
FT                   /db_xref="GOA:C6S523"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6S523"
FT                   /protein_id="CBA03824.1"
FT                   /translation="MELISPITYWNGKVLLDLDSLYTRPQNINPLYSSRCFGTIPSQST
FT                   TLILCILMASKPFLKWAGGKHKLVPFIEHNLPTPTRKRLIEPFCGSAALSLALDFEHYL
FT                   LNDINADLIGLFRILKEEKSGFIDYARSFFISENNSDSRFYELREQFNFSKNLHERSAL
FT                   FIYLNRHAFNGLCRYNSKGVFNVPFGRYKSPYFPQQEMEGFIQKSDRVELMCGDFQMIL
FT                   SQTDNTDTVYCDPPYAPLSPTASFTTYAKESFNLDNQIRLAQSAQQIAPDSQGVLISNH
FT                   DTEFTRDIYSFAILKTIEVQRNIAAKGSSRKKVGELLAIYD"
FT   CDS_pept        292915..293713
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0275"
FT   CDS_pept        293710..294164
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_PS74"
FT   CDS_pept        complement(295139..295450)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0277"
FT                   /product="putative DNA-binding protein"
FT                   /function="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03828"
FT                   /db_xref="GOA:C6S524"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6S524"
FT                   /protein_id="CBA03828.1"
FT                   /translation="MKYKSEALAAIHEMMEGAYNIGAIDKKTMRGFDKSCLTEIKPLSG
FT                   GDIKAIREKEALSQAAFAIYLNVGKNHVSAWERGVKKPSGAALKLLTIVKNKGIEAIA"
FT   CDS_pept        complement(295512..295814)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0278"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03830"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:C6S525"
FT                   /protein_id="CBA03830.1"
FT                   /translation="MRIFKNQWIVKFAKKHKINDSELLEAVERADNGLIDADLGGGVIK
FT                   QRIARQGQGRSGGYRSLILFKQADRAFSFTPLPRTTGKTFRIKNWTFTEKPPHII"
FT   CDS_pept        296063..296269
FT                   /transl_table=11
FT                   /locus_tag="NMO_0279"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03832"
FT                   /db_xref="GOA:C6S526"
FT                   /db_xref="UniProtKB/TrEMBL:C6S526"
FT                   /protein_id="CBA03832.1"
FT                   /translation="MRFGFSFRYAPTAKTVKNRKTPKVVTDSLPFVTAFVTAFVTAFVT
FT                   AFVTAFVTAFVTNFLSFSYFIVN"
FT   tRNA            complement(296676..296761)
FT                   /locus_tag="NMO_tRNA08"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:296725..296727,aa:Leu)"
FT   CDS_pept        complement(296775..297125)
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="NMO_0280"
FT                   /product="preprotein translocase SecG subunit"
FT                   /function="Preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03834"
FT                   /db_xref="GOA:C6S527"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:C6S527"
FT                   /protein_id="CBA03834.1"
FT                   /translation="MEAFKTLIWIVNIISALAVIVLVLLQHGKGADAGATFGSGSGSAQ
FT                   GVFGSAGNANFLSRSTAVAATFFFATCMAMVYIHTHTTKHGLDFSNVQQTQQAPKPVSN
FT                   TEPSAPVPQQQK"
FT   CDS_pept        complement(297132..297905)
FT                   /transl_table=11
FT                   /gene="tpi"
FT                   /locus_tag="NMO_0281"
FT                   /product="Triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03836"
FT                   /db_xref="GOA:C6S528"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:C6S528"
FT                   /protein_id="CBA03836.1"
FT                   /translation="MYHQIGMWDQKWVIGNWKMNGRLQNNNSLMHRFRILPTAERVLIG
FT                   LAAPTVYLLQLHNAMQIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIG
FT                   HSERSLYFGEKNEIQRRKMENVLNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGL
FT                   DTKNIAVAYEPVWAIGTGKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADN
FT                   AADIFAVPYVDGALVGGASLSYDSFTAIISAAQNA"
FT   CDS_pept        298089..298592
FT                   /transl_table=11
FT                   /locus_tag="NMO_0282"
FT                   /product="GAF-domain containing protein"
FT                   /function="GAF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03838"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C6S529"
FT                   /protein_id="CBA03838.1"
FT                   /translation="MHALHFSASDKAALYREVLPQIESVVADETDWVSNLANTAAVLKE
FT                   AFGWFWVGFYLVDTRSDELVLAPFQGPLACTRIPFGRGVCGQAWAKGGTVVVGDVNAYP
FT                   DHIACSSLSRSEIVVPLFSDGRCIGVLDADSEHLAQFDETDALYLGELAKILEKRFEAS
FT                   RQAV"
FT   CDS_pept        298695..299351
FT                   /transl_table=11
FT                   /gene="pcm"
FT                   /locus_tag="NMO_0283"
FT                   /product="putative protein-L-isoaspartate
FT                   O-methyltransferase"
FT                   /function="Protein-L-isoaspartatecarboxylmethyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03840"
FT                   /db_xref="GOA:C6S530"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6S530"
FT                   /protein_id="CBA03840.1"
FT                   /translation="MDFEKARFNMVEQQIRPWDVLDFDVLDALAEIPRELFVDEDLQGL
FT                   AYADMELPLANGHKMLEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGRVVS
FT                   DDIDAEQQNRAKAVLDGLGLDNIDYVQNNGLTELSAGAPFDAVYVGGAVNIVPDVLKQQ
FT                   LKDGGRMVVIVGRKPVQRALLITRKGDVFEEKVLFDTLVAHLDDKDTDPFGGFDF"
FT   CDS_pept        299431..299754
FT                   /transl_table=11
FT                   /locus_tag="NMO_0284"
FT                   /product="Rhodanese-related sulfur transferase"
FT                   /function="Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03842"
FT                   /db_xref="GOA:C6S531"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C6S531"
FT                   /protein_id="CBA03842.1"
FT                   /translation="MDIVQLGPAELKAWMDEGRMFCLLDVRTDEETAVCSLPNALHIPM
FT                   NLIPLRQNELPDDVPLVVYCHHGIRSLHTAMYLADAGFENLYNLQGGIDAWAAEIDGNM
FT                   MRY"
FT   CDS_pept        complement(300170..302347)
FT                   /transl_table=11
FT                   /gene="tonB1"
FT                   /locus_tag="NMO_0285"
FT                   /product="putative TonB-dependent receptor protein, iron
FT                   related"
FT                   /function="Outer membrane receptor for ferric coprogen and
FT                   ferric-rhodotorulic acid"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03844"
FT                   /db_xref="GOA:C6S532"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:C6S532"
FT                   /protein_id="CBA03844.1"
FT                   /translation="MTRFKYSLLFAALLPVYAQADVSVSDDPKPQKSTELPTITVTADR
FT                   TASSNDGYTVSGTHTPLGLPMTLREIPQSVSVITSQQMRDQNIKTLDRALLQATGTSRQ
FT                   IYGSDRAGYNYLFARGSRIANYQINGIPVADALADTGNANTAAYERVEVVRGVAGLLDG
FT                   TGEPSATVNLVRKRPTRKPLFEVRAEAGNRKHFGLGADVSGSLNTEGTLRGRLVSTFGR
FT                   GDSWRQRERSRDAELYGILEYDIAPQTRVHAGMDYQQAKETADAPLSYAVYDSQGYATA
FT                   FGPKDNPATNWANSRHRALNLFAGIEHRFNQDWKLKAEYDYTRSRFRQPYGVAGVLSID
FT                   HNTAATDLIPGYWHADPRTHSASVSLIGKYRLFGREHDLIAGINGYKYASNKYGERSII
FT                   PNAIPNAYEFSRTGAYPQPSSFAQTIPQYGTRRQIGGYLATRFRAADNLSLILGGRYSR
FT                   YRTGSYDSRTQGMTYVSANRFTPYTGIVFDLTGNLSLYGSYSSLFVPQSQKDEHGSYLK
FT                   PVTGNNLEAGIKGEWLEGRLNASAAVYRARKNNLATAAGRDPSGNTYYRAANQAKTHGW
FT                   EIEVGGRITPEWQIQAGYSQSKTRDQDGSRLNPDSVPERSFKLFTAYHFAPEAPSGWTI
FT                   GAGVRWQGETHTDPATLRIPNPAAKARAADNSRQKAYAVADIMARYRFNPRAELSLNVD
FT                   NLFNKHYRTQPDRHSYGALRTVNAAFTYRFK"
FT   CDS_pept        complement(302461..302784)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0286"
FT                   /product="conserved hypothetical protein"
FT                   /function="Mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03847"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6S533"
FT                   /protein_id="CBA03847.1"
FT                   /translation="MQNETINLKQHLAAIKEYWQPEIINRHGFQFRLVKLLGDYGWHTH
FT                   GYSDKVLFAVEGDMAVDFADGGSMTIREGEMAVVPKSVSHRPRSENGCSLVLIELSDPS
FT                   EAV"
FT   CDS_pept        complement(303767..304732)
FT                   /transl_table=11
FT                   /gene="fetB2"
FT                   /locus_tag="NMO_0287"
FT                   /product="periplasmic binding protein, ABC transporter"
FT                   /function="ABC-type enterochelin transport system
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03850"
FT                   /db_xref="GOA:C6S534"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:C6S534"
FT                   /protein_id="CBA03850.1"
FT                   /translation="MKPRFYWAACAVLLTACSPEPAAEKTVSAASASAATLTVPTARGD
FT                   AVVPKNPERVAVYDWAALDTLTELGVNVGATTAPVRVDYLQPAFDKAATVGTLFEPDYE
FT                   ALHRYNPQLVITGGPGAEAYEQLAKNATTIDLTVDNGNIRTSGEKQMETLARIFGKEAR
FT                   AAELKAQIDALFAQTREAAKGKGRGLVLSVTGNKVSAFGTQSRLASWIHGDIGLPPVDE
FT                   SLRNEGHGQPVSFEYIKEKNPDWIFIIDRTAAIGQEGPAAVEVLDNALVRGTNAWKRKQ
FT                   IIVMPAANYIVAGGSRQLIQAAEQLKAAFEKAEPVAAGKE"
FT   CDS_pept        304968..305924
FT                   /transl_table=11
FT                   /locus_tag="NMO_0288"
FT                   /product="AraC family transcriptional regulatory protein"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03853"
FT                   /db_xref="GOA:C6S535"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C6S535"
FT                   /protein_id="CBA03853.1"
FT                   /translation="MNTAAIYRQYQTYVRSDKSGWALDGCSDSALIAQAKQPGLHLEMC
FT                   INRFDSGITLSRMRGGGTGAFPTEIHNFSHNCALFVMVSGQNRLQMGGREYRPSAGEIW
FT                   LVRGELADVSETLLPDNSGMCALHLDFSLEKLRRWHDEGLLDERLFSPQTIGRFALQRL
FT                   AQNAAALTAAACPLLQRPFESDGFGLLADEAAALELSARLLRFTFRRHDNGYRRRRIDE
FT                   AADILQHEFARPLTIAEIARRVGLNECYLKRYFKAQTGETVAGCLRRLRLEHALALIES
FT                   GSTVQAAMHFCGYRHAGRFNEAFRRHYGFLPSDVKKC"
FT   CDS_pept        complement(306038..308053)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0289"
FT                   /product="prolyl oligopeptidase family protein"
FT                   /function="Serine proteases of the peptidase family S9A"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03856"
FT                   /db_xref="GOA:C6S536"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6S536"
FT                   /protein_id="CBA03856.1"
FT                   /translation="MKSYPDPYRHFENLDSAETQNFAAEVNAETRARFLNNDKARALSD
FT                   GILNQMQDTRQIPFCQEHRARMYHFHQDTEYPKGVYRVCTAATYRSGYPEWKILFSVAD
FT                   FDELLGDDVYLGGVSHLVEQPDRALLTLSKSGGDTAYTLEVDLEAGELVEGGFHFPAGK
FT                   NHVSWRDENSVWVCPAWDERQLTESGYPREVWLVERGKSFEESLPVYQIAEDGMMVNAW
FT                   RYLDPQGSPIDLIEASDGFYTKTYLQVSVEGEAKPLNLPADCDVAGYLAGHLLLTLRKD
FT                   WHRANQSYPSGALVAVKLNRGEIGAAQLLFAPDETQALESVETTKRFVVASLLENVQGR
FT                   LKAWRFADGKWQEVELLRLPSGALEMTDQPWGGDVVYLAASDFTTPLTLFALDLNVMEL
FT                   TVMRRQPQQFVSDGIEVRQFWAVSSDGERIPYFHVGKNAAPDTPTLVYAYGGFGVPELP
FT                   HYLGSIGKYWLEEGNAFVLANIRGGGEFGPRWHQAAQGISKHKSVDDLLAVVRDLSERG
FT                   MSSPQHIGLQGGSNGGLITAAAFVREPQSIGALVCEVPLTDMIRYPLLSAGSSWTDEYG
FT                   NPQKYEVCKCRLGELSPYHNLSDGIDYPPALITTSLSDDRVHPAHALKFYAKLRETSAQ
FT                   SWLYSPDGGGHTGNGTQRESADELACVLLFLKEFLG"
FT   CDS_pept        complement(308254..309564)
FT                   /transl_table=11
FT                   /gene="argA"
FT                   /locus_tag="NMO_0290"
FT                   /product="N-acetylglutamate synthase"
FT                   /function="Acetylglutamate kinase"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03859"
FT                   /db_xref="GOA:C6S537"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C6S537"
FT                   /protein_id="CBA03859.1"
FT                   /translation="MIVPDLFVAHFREAAPYIRQMLGKTLVAGIDDRLLEGDTLNKLAA
FT                   DIGLLSQLGIRLVLIHGARHFLDRHAAAQGRTPHYCRGLRVTDETSLEQAQQFAGTVRS
FT                   RFEAALCGSVSGFARAPSVPLVSGNFLTARPIGVIDGTDMEYAGVIRKTDTAAIRFQLD
FT                   AGNIVWLPPLGHSYGGKTLHLDMLQTAASAAVSLQAEKLVYLTLSDGIARPDGTLAETL
FT                   SAQEAQSLAEHAGGETQRLISSAVAALEGGVHRVQILNGASDGSLLQELFTRNGIGTSI
FT                   AKEAFVSIRQAHSGDIPHIAALIRPLEEQGILLHRSREYLENHISEFSILEHDGNLYGC
FT                   AALKTFTEADCGEIACLAVSPQAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWF
FT                   AERGFQTASEDELPETRRKAYRSNGRNSHILVRRLHR"
FT   CDS_pept        complement(309561..309995)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0291"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03862"
FT                   /db_xref="GOA:C6S538"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:C6S538"
FT                   /protein_id="CBA03862.1"
FT                   /translation="MPACFCPHCKTRLWVKETQLNVAQGFVVCQKCEGLFKAKDHLAST
FT                   KEPIFNDLPEAVSDVKLVHRIGTRAIGKKQISRDEIAGILNGGTTQPDIPPATAATPAA
FT                   APQVTVPPAAPARQDGFNWTIATLFALIVLIMQLSYLVIL"
FT   CDS_pept        complement(310069..310710)
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="NMO_0292"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03865"
FT                   /db_xref="GOA:C6S539"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6S539"
FT                   /protein_id="CBA03865.1"
FT                   /translation="MTDFRQDFLKFSLAQNVLKFGEFTTKAGRQSPYFFNAGLFNDGLS
FT                   TLQLAKFYAQSIIESGIRFDMLFGPAYKGIILAAATAMMLAEKGVNVPFAYNRKEAKDH
FT                   GEGGVLVGAPLKGRVLIIDDVISAGTSVRESIKLIEAEGATPAGVAIALDRMEKGTGEL
FT                   SAVQEVEKQYGLPVAPIASLNDLFILLQNNPEFGQFLEPVRAYRRQYGVE"
FT   CDS_pept        complement(310772..311509)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0293"
FT                   /product="putative uracil-DNA glycosylase"
FT                   /function="Uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03868"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C6S540"
FT                   /protein_id="CBA03868.1"
FT                   /translation="MLSARYLHLHEALGLGPMWLKQAAAVLPPKNTPAPSAQARPQTVR
FT                   AAPIRPSQPHNGQARLETMKALETAAVPTRKPAPETETPLPGLSDGIAPVPAASGITKL
FT                   AVVSLCPPIEDAVYGQLFHGKAGILLDNILKAVGLDAAYVHKTCWVKTAAVGNPMPSEQ
FT                   AVANALGQIARELDGCRAPAVLFLGQAFVQPERQTMIETLCGSRPFFIIDHPARLLRQP
FT                   ELKARAWQVLKQLKRALRQGGGS"
FT   CDS_pept        complement(311503..311943)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0294"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /function="Acetyltransferases"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03871"
FT                   /db_xref="GOA:C6S541"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:C6S541"
FT                   /protein_id="CBA03871.1"
FT                   /translation="MNIRRASPSDCAALAALDAVCNPSAWTQRQFESALVSPSEQVFLA
FT                   EKDGGIAAFIVWQNLPDESELHLIATAPECRRQGIASALLEYWFTHLPEDTQRLLLEVR
FT                   AGNTAAQALYTAHGFSITGRRKNYYRTADGKTEDAVLMEKIC"
FT   CDS_pept        complement(311940..312617)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0295"
FT                   /product="conserved hypothetical protein"
FT                   /function="Inactive homolog of metal-dependent proteases
FT                   putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03874"
FT                   /db_xref="GOA:C6S542"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C6S542"
FT                   /protein_id="CBA03874.1"
FT                   /translation="MQADFNRPVLAVDTGTSYLSLALRADGETRLFHQEAGSRQSELIL
FT                   PEIRTLFRNAGITAADLGAIVYTKGPGAFTGLRIGIGVAQGLATPFDTPLIGIPSLDAA
FT                   ASMPPPQSCILAAADARMGEVFYAWFDTLNRRRLSDYQVGRAADIRLPEGCAFSDGIGS
FT                   AFALEETPPFSGKPDMPTAADFLNLAAEGGFPAVAAAHSELLYVRNKIALTAKEQAERK
FT                   ART"
FT   CDS_pept        complement(312756..313715)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03877"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR014902"
FT                   /db_xref="UniProtKB/TrEMBL:C6S543"
FT                   /protein_id="CBA03877.1"
FT                   /translation="MPSEPLFGRHLIFASLTCLIDAACKKRYRNQNVYILSILCMTRSK
FT                   PVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADALTAPLDHKDKSLQSLTLDQS
FT                   VRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQI
FT                   YKQDHSAVVALQIEKINNPDKTDSLINQRSFLVSGLGGEHTAFNQLPGGKAEYHGKAFS
FT                   SDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELAAAELKADEKSHAVILGDTRYGSE
FT                   EKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQ"
FT   CDS_pept        complement(313735..314799)
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="NMO_0297"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /function="Fructose/tagatose bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03880"
FT                   /db_xref="GOA:C6S544"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6S544"
FT                   /protein_id="CBA03880.1"
FT                   /translation="MALVSMRQLLDHAAENSYGLPAFNVNNLEQMRAIMEAADQVNAPV
FT                   IVQASAGARKYAGAPFLRHLILAAVEEFPHIPVVMHQDHGASPDVCQRSIQLGFSSVMM
FT                   DGSLMEDGKTPSSYEYNVNATRTVVNFSHACGVSVEGEIGVLGNLETGEAGEEDGVGAV
FT                   GKLSHDQMLTSVEDAVRFVKDTGVDALAIAVGTSHGAYKFTRPPTGDVLRIDRIKEIHQ
FT                   ALPNTHIVMHGSSSVPQEWLKVINEYGGNIGETYGVPVEEIVEGIKHGVRKVNIDTDLR
FT                   LASTGAVRRYLAENPSDFDPRKYLSKTIEAMKQICLDRYLAFGCEGQAGKIKPVSLEKM
FT                   ANRYAKGELNQIVK"
FT   CDS_pept        314993..315910
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="NMO_0298"
FT                   /product="site-specific recombinase"
FT                   /function="Site-specific recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03883"
FT                   /db_xref="GOA:C6S545"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:C6S545"
FT                   /protein_id="CBA03883.1"
FT                   /translation="MVLDGFAAHFDAYLENIVREGKSEHTVAAYRRDLEELFALLAQMP
FT                   SEDAGGVPQDLSRRDFTAALRRLSQRGLNARTLARKLSSWRQYCVWLVERGLLHTDPTA
FT                   DIKPPKQPERVPKALPQEWLNRMLDLPVDGGDPLAVRDHALFELMYGSGLRVSEIHGLN
FT                   ADDVYLDEAWVHVTGKGRKQRQVPLVGKSVEALKNYLPLRQTASDGKALFTGRNGTRLS
FT                   QRQIQKRLAQWAAQNGDGRHVSPHMMRHSYAGHLLQASRDIRAVQELLGHSSLSTTQIY
FT                   TKLDFDHIARLYDEAHPRAKRQDE"
FT   CDS_pept        315995..317908
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="NMO_0299"
FT                   /product="1-deoxy-D-xylulose 5-phosphate synthase"
FT                   /function="Deoxyxylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03886"
FT                   /db_xref="GOA:C6S546"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C6S546"
FT                   /protein_id="CBA03886.1"
FT                   /translation="MNPSPLLDLIDSPQDLRRLDKKQLPRLAGELRAFLLESVGQTGGH
FT                   FASNLGAVELTVALHYVYNTPEDKLVWDVGHQSYPHKILTGRKNQMHTMRQYGGLAGFP
FT                   KRCESEYDAFGVGHSSTSIGAALGMAAADKQLGSDRCSVAIIGDGAMTAGQAFEALNCA
FT                   GDMDVDLLVVLNDNEMSISPNVGALPKYLASNVVRDMHGLLSTVKAQTGKVLDKIPGAM
FT                   EFAQKVEHKIKTLAEEAEHAKQSLSLFENFGFRYTGPVDGHNVENLVDVLEDLRGRKGP
FT                   QLLHVITKKGNGYKLAENDPVKYHAVANLPKESAAQMPSEKEPKPAAKPTYTQVFGKWL
FT                   CDRAAADSRLVAITPAMREGSGLVEFEQRFPDRYFDVGIAEQHAVTFAGGLACEGMKPV
FT                   VAIYSTFLQRAYDQLVHDIALQNLPVLFAVDRAGIVGADGPTHAGLYDLSFLRCIPNMI
FT                   VAAPSDENECRLLLSTCYQADAPAAVRYPRGTGTGAPVSDGMETVEIGKGIIRREGGKT
FT                   AFIAFGSMVAPALAVAEKLNATVADMRFVKPIDEELIVRLARSHDRIVTLEENAEQGGA
FT                   GSAVLEVLAKHGICKPVLLLGVADTVTGHGDPKKLLDDLGLSAEAVERRVRAWLSDRDA
FT                   AN"
FT   CDS_pept        complement(317993..319321)
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="NMO_0300"
FT                   /product="putative 2-methylthioadenine synthetase"
FT                   /function="2-methylthioadenine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03889"
FT                   /db_xref="GOA:C6S547"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C6S547"
FT                   /protein_id="CBA03889.1"
FT                   /translation="MKKVFIRTFGCQMNEYDSDKMLAVLAEEHGGIEQVTQADEADIIL
FT                   FNTCSVREKAQEKVFSDLGRVRPLKEKNPGLIIGVAGCVASQEGENIIKRAPYVDVVFG
FT                   PQTLHRLPKMIVDKETSGLSQVDISFPEIEKFDHLPPARVEGGAAFVSIMEGCSKYCSF
FT                   CVVPYTRGEEFSRPLNDVLTEIANLAQQGVKEINLLGQNVNAYRGEMDDGEICDFATLL
FT                   RIVHEIPGIERMRFTTSHPREFTDSIIECYRDLPKLVSHLHLPIQSGSDRVLSAMKRGY
FT                   TALEYKSIIRKLRAIRPDLCLSSDFIVGFPGETEREFEQTLKLVKDIAFDLSFVFIYSP
FT                   RPGTPAANLPDDTPHEEKVRRLEALNEVIEAETARINQTMIGTVQRCLVEGISKKDPDQ
FT                   LQARTANNRVVNFTGTPDMINQMIDLEITEAYTFSLRGKVVEA"
FT   CDS_pept        319524..319937
FT                   /transl_table=11
FT                   /locus_tag="NMO_0301"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03892"
FT                   /db_xref="UniProtKB/TrEMBL:C6S548"
FT                   /protein_id="CBA03892.1"
FT                   /translation="MKPAVWAALLLCACTSNFGDREHQFLRDQTEEGIAQTVVKGKTTR
FT                   AEVEARFGRQNPFGCYAYHEVSLPLYNFLPTNFIYMKSERRHWEWCVDYDGEGVVRDYR
FT                   FTHKVEKDERSVIRDAVGVIRKEAGKSLAKPEK"
FT   CDS_pept        320000..321283
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="NMO_0302"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /function="Glutamate-1-semialdehyde aminotransferase"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03895"
FT                   /db_xref="GOA:C6S549"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6S549"
FT                   /protein_id="CBA03895.1"
FT                   /translation="MNRNEILFDRAKAIIPGGVNSPVRAFGSVGGVPRFIKKAEGAYVW
FT                   DENGTRYTDYVGSWGPAIVGHAHPEVIEAVREAALGGLSFGAPTEGEIAIAEQIAKIMP
FT                   SVERLRLVSSGTEATMTAIRLARGFTGRDKIIKFEGCYHGHSDSLLVKAGSGLLTFGNP
FT                   SSAGVPADFTKHTLVLEYNNIAQLEEAFAQSGNDIACVILEPFVGNMNLVRPTEAFVKA
FT                   LRELTEKHGAVLIYDEVMTGFRVALGGAQSLHGITPDLTTMGKVIGGGMPLAAFGGRKD
FT                   IMECISPLGGVYQAGTLSGNPIAVAAGLKTLEIIQREGFYENLTALTQRLANGIADAAK
FT                   AHGVEFTADSVGGMFGLYFAAHAPRNYADMARSNIEGFKQFFHGMLDRNVAFGPSAYEA
FT                   GFVSAAHTPELIDETVAVAVEVFKAMAA"
FT   CDS_pept        complement(321933..322580)
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="NMO_0303"
FT                   /product="oligoribonuclease"
FT                   /function="Oligoribonuclease (3->5 exoribonuclease)"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03898"
FT                   /db_xref="GOA:C6S550"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6S550"
FT                   /protein_id="CBA03898.1"
FT                   /translation="MVRSRPGGNRRRLGALERDKTLTSKGNIMQDKNNLCWLDMEMTGL
FT                   NPETNRIIEVAMIITDSDLNVLAQSEVYAVHQSDELLDNMDEWNTATHGRTGLTQRVRE
FT                   SSHTEAEVEQKLLDFMSEWVPGRATPMCGNSIHQDRRFMVKYMPKLENYFHYRNLDVST
FT                   LKELAKRWNPSVAKSVVKRGSHKALDDILESIEEMRHYREHFLISAPRAEAQ"
FT   CDS_pept        complement(322514..323506)
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="NMO_0304"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /function="Ribosomal protein L11 methylase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03901"
FT                   /db_xref="GOA:C6S551"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6S551"
FT                   /protein_id="CBA03901.1"
FT                   /translation="MPSETVCPFSDGISVTHPSPYTVRPYSEGLLRKPAMPYQQITINV
FT                   NDAVAERLADTLMEYGALSAAIEDAYAGTENEQAIFGEPGMPAEQIWQQSKVIALFGEH
FT                   DEAAAIIQTAAQECGLKDLAYTGETLEDQDWVRLTQAQFDPIRISDRLWITPSWHEAPE
FT                   GTAVNLRLDPGLAFGTGSHPTTRLCLKWLDTQLKNGESVLDYGCGSGILTIAALKLGAG
FT                   SAVGVDIDEQAVRAGRDNAEQNNVDAQFFLPDGLPQGQFDVVVANILANPLRMLGEMLA
FT                   ARTKQGGRIVLSGLLDEQIEELGGIYSQWFDLDPAETEEGWARLSGTKR"
FT   CDS_pept        complement(323519..324880)
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="NMO_0305"
FT                   /product="Biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03904"
FT                   /db_xref="GOA:C6S552"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6S552"
FT                   /protein_id="CBA03904.1"
FT                   /translation="MLKKVLIANRGEIALRVLRACREMGIATVAVHSEADKDSLHVKLA
FT                   DESVCIGPAASAQSYLNVPAIIAAAEVSCADAVHPGYGFLAENADFAEQVEQSGFTFIG
FT                   PKPDTIRLMGDKVSAKHAMIAAGVPCVPGSDGALPDDGEEILKIADKVGYPVIIKASGG
FT                   GGGRGMRVVEKKEDLLQSVEMTKAEAGAAFGNPMVYMERYLQRPRHVEIQVIADEHGNA
FT                   IYLAERDCSLQRRHQKVIEEAPAPFITEKERAKIGNACADACKRIGYRGAGTFEFLYED
FT                   GEFFFIEMNTRVQVEHPVTELITGVDIVQEQLRIAAGLPLQYKQKDIQVEGHAFECRIN
FT                   AEDPYNFIPSPGPIESCHLPGGFGIRVDSHIYQGYRIPPYYDSLIGKICVHGKTREQAM
FT                   AKMRVALAELAVTGIKTNTPLHRDLFADAGFQKGGVSIHYLEHWLEDRKAKQDK"
FT   CDS_pept        complement(324993..325454)
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="NMO_0306"
FT                   /product="biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /function="Biotin carboxyl carrier protein"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03907"
FT                   /db_xref="GOA:C6S553"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C6S553"
FT                   /protein_id="CBA03907.1"
FT                   /translation="MDLRKLKKLIDLVEESGIAEIEVTEGEEKVRITRTIAAAAAPVYA
FT                   APVPAAAPAVTPAAAPVAASAPAAAPAARDLSDAQKSPMVGTFYRAPGPNAAPFVEVGQ
FT                   QVKAGDTLCIIEAMKLMNEIEAEKSGTVKEILVENGTPVEFGEPLFIIG"
FT   CDS_pept        complement(325436..325693)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03910"
FT                   /db_xref="UniProtKB/TrEMBL:C6S554"
FT                   /protein_id="CBA03910.1"
FT                   /translation="MRKIKLPAHFPQKPPFCDILLDIYRQLRENKHILTVVFHHRKTVS
FT                   EHHSARFAPLPQAGCFLKNQRNNPPEHRQPLKEQKWICAN"
FT   CDS_pept        325780..326850
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="NMO_0308"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /function="S-adenosylmethionine:tRNA-ribosyltransferase-
FT                   isomerase (queuine synthetase)"
FT                   /EC_number="5.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03913"
FT                   /db_xref="GOA:C6S555"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:C6S555"
FT                   /protein_id="CBA03913.1"
FT                   /translation="MAACPNESVKMDISDFDFTLPEKLIAQHPPEVRGSSRLLVALPDM
FT                   PLQDRVFGDLPDYVEAGDVLVFNNTKVMKARLFGQKDSGGRIEALIERVLDNHTALAHI
FT                   RSSKSPKPGMGLVFEGGIRAVMVGREGELFCLSFEGGETVYELLEQNGHLPLPPYIERA
FT                   ADADDDSRYQTVYAKYQGAVAAPTAGLHFTEELLHRLKDKGAVTAEVTLHVGAGTFQPV
FT                   RVDKIEEHKMHSEWFEVPSETAAAVEAAKARGNKVWAVGTTSMRALESAARATGRLKAG
FT                   QGDTDIFITPGYRFNVADRLVTNFHLPKSTLLMLVSAFSGMGHIRAAYRYAVEREYRFF
FT                   SYGDAMVLGRNEGVVR"
FT   CDS_pept        complement(327337..327915)
FT                   /transl_table=11
FT                   /gene="mdaB"
FT                   /locus_tag="NMO_0309"
FT                   /product="modulator of drug activity B"
FT                   /function="Putative NADPH-quinone reductase (modulator of
FT                   drug activity B)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03916"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6S556"
FT                   /protein_id="CBA03916.1"
FT                   /translation="MNILLLDGGKAFGHSHGGLNRTLHKKAKEVLTALGHNVQETVIDA
FT                   GYDVEAEIEKFVWMDAVIWQMPGWWMHEPWTVKKYIDEVLTAGHGKLYQSDGRHRVNPT
FT                   EGYGTGGLLQGKKHMLSLTWNAPIEAFTREGDFFEGKGVDVLYMHFHKANEFLGMTRLP
FT                   TFLCNDVVKNPQVEKYLADYQAHLEKVFG"
FT   CDS_pept        328154..329053
FT                   /transl_table=11
FT                   /locus_tag="NMO_0310"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03919"
FT                   /db_xref="GOA:C6S557"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6S557"
FT                   /protein_id="CBA03919.1"
FT                   /translation="MKTNSEELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKL
FT                   GVNLLNRTTRQLSLTEEGAQYFRRAQRILQEMAAAETEMLAVHEIPQGVLRVDSAMPMV
FT                   LHLLAPLATKFNERYPHIRLSLVSSEGYINLIERKVDIALRAGELDDSGLRARHLFDSR
FT                   FRVIASPEYLAKHGTPQSTEELAGHQCLGFTEPGSLNTWAVLDAQGNPYKISPHFTASS
FT                   GEILRSLCLSGCGIACLSDFLVDNDIAEGKLIPLLAEQTSDKTHPFNAVYYSDKAVNLR
FT                   LRVFLDFLVEELGNNLCG"
FT   CDS_pept        complement(329275..332490)
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="NMO_0311"
FT                   /product="carbamoyl-phosphate synthase large chain"
FT                   /function="Carbamoylphosphate synthase large subunit (split
FT                   gene in MJ)"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03922"
FT                   /db_xref="GOA:C6S558"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C6S558"
FT                   /protein_id="CBA03922.1"
FT                   /translation="MPKRTDLKSILIIGAGPIVIGQACEFDYSGAQACKALREEGYKVI
FT                   LVNSNPATIMTDPEMADVTYIEPIMWQTVEKIIAKERPDAILPTMGGQTALNCALDLAR
FT                   NGVLAKYNVELIGATEDAIDKAEDRGRFKEAMEKIGLSCPKSFVCHTMNEALAAQEQVG
FT                   FPTLIRPSFTMGGSGGGIAYNKDEFLAICERGFDASPTHELLIEQSVLGWKEYEMEVVR
FT                   DKNDNCIIICSIENFDPMGVHTGDSITVAPAQTLTDKEYQIMRNASLAVLREIGVDTGG
FT                   SNVQFAVNPENGEMIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGFTLDELRNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFAFEKFPAADDRLTTQMKSVGEVMAMGRTIQESFQKAL
FT                   RGLETGLCGFNPRSSDKAEIRRELANPGPERMLFVADAFRAGFTLEEIHEICAIDPWFL
FT                   AQIEDLMKEEKAVSDGILSDLDFAALRRLKRKGFSDKRIAQLLGVKEKEVREHRYALKL
FT                   HPVYKRVDTCAAEFATETAYLYSTYEEECEARPSDRKKVMILGGGPNRIGQGIEFDYCC
FT                   VHAALALRESGFETIMVNCNPETVSTDFDTSDRLYFEPLTLEDVLEIVRTENPWGVIVH
FT                   YGGQTPLKLANALVENGVNIIGTSADSIDAAEDRERFQKVLNDLGLRQPPNRIAHNEEE
FT                   ALVKAEEIGYPLVVRPSYVLGGRAMQIVHSAEQLQKYMREAVQVSEDSPVLLDFFLNNA
FT                   IEIDVDCVSDGKDVVIGGIMQHVEQAGIHSGDSGCSLPPYSLSEEIQDEIRRQTKAMAY
FT                   ALGVVGLMNVQFAVQDGVVFVLEVNPRASRTVPFVSKATGVPLAKVGARCMAGISLKEQ
FT                   GVEKEVVPDFYAVKEAVFPFIKFPGVDTILGPEMRSTGEVMGVGASFGEAYYKAQLGAG
FT                   ERLNPTGKIFLSVREEDKERVIKTAKNFQVLGYGICATRGTAQYLTEQGLIVQTINKVP
FT                   EGRPHIGDALKNGEIALVVNTVSSDPQSVSDSHIIRQSALQQRVPQYTTTAGGEAMSEG
FT                   AKSRDHLGVYSVQELHGRLKNRS"
FT   CDS_pept        complement(332519..333160)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03925"
FT                   /db_xref="UniProtKB/TrEMBL:C6S559"
FT                   /protein_id="CBA03925.1"
FT                   /translation="MSIPINFNNLKYLLNDMRNKNRIIEAFPFNYNQRQYAVILTRYKP
FT                   DEPRPDDYAQAKLEFFNLNSENSIFAYADFYEVHFKSATDFINFFKINVQAGAAKIREI
FT                   FQSFSNLFADFIPTQTKKDLDIIYKKIVATRLEPNSPNTIYCYDVRRNGKDKAGKPNRR
FT                   SVENSEKAKILRPELYEKFKADSNYSFFFSDNPSDEKTDAEIIREVTNRQ"
FT   CDS_pept        complement(333410..333859)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03928"
FT                   /db_xref="UniProtKB/TrEMBL:C6S560"
FT                   /protein_id="CBA03928.1"
FT                   /translation="MPSPQPSPTGEGVGFSRFCGCRRFEKRLGFTVDFRSSEKQKATCT
FT                   TCFLAEPLALQPLRPLSRGRELERGQQATRLVFRWLSCWERLPKFGECPLPNPPPRGRG
FT                   QVAADFAVAGGLRKNARNINSGNFSGSLYRKADGTNAASVFSDDL"
FT   CDS_pept        complement(334101..334490)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0314"
FT                   /product="putative endonuclease"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03931"
FT                   /db_xref="GOA:C6S561"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C6S561"
FT                   /protein_id="CBA03931.1"
FT                   /translation="MNPHEKLLTTDNPILRQRAKAMRQEMSGAEAKLWQHLRAGRLNGY
FT                   KFRRQQPMGNYIVDFMCVTPKLIVEADGGQHTEQAAYDHARTAYLNSLGFTVLRFWNHE
FT                   ILQQTNDVLTEILLVLQELEKQAAR"
FT   CDS_pept        complement(335051..335188)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0315"
FT                   /product="putative lactoylglutathione-related protein"
FT                   /function="Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03933"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6S562"
FT                   /protein_id="CBA03933.1"
FT                   /translation="MKISALDHLVLTVADIDRTIAFYTQVLGMEEVSFGNNRKACILED
FT                   "
FT   CDS_pept        complement(335242..336375)
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="NMO_0316"
FT                   /product="carbamoyl-phosphate synthase small chain"
FT                   /function="Carbamoylphosphate synthase small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03937"
FT                   /db_xref="GOA:C6S563"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:C6S563"
FT                   /protein_id="CBA03937.1"
FT                   /translation="MSTPALLVLADGSVFHGTSIGYEGSTSGEVVFNTSMTGYQEILTD
FT                   PSYCKQIVTLTYPHIGNTGTNAEDEESRSVYASGLIIRDLPLLHSNFRASESLHDYLVR
FT                   NQTVAIADIDTRRLTTLLREKGAQGGAILTGADATIEKAQELIAAFGSMVGKDLAKEVS
FT                   CTETYEWTEGEWALGKGFVTPDEQPYHVVAYDFGVKTNILRMLASRGCRLTVVPAQTSA
FT                   QDVLALNPDGVFLSNGPGDPEPCTYAIEAVQKLMESGKPIFGICLGHQLISLAIGAKTL
FT                   KMRFSHHGANHPVQDLDSGKVVITSQNHGFAVDADTLPANARITHKSLFDNTLQGIELT
FT                   DKPVFCFQGHPEASPGPQDVGYLFDKFIGNMKAAKRA"
FT   CDS_pept        complement(337944..339071)
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="NMO_0317"
FT                   /product="ATPase involved in chromosome partitioning"
FT                   /function="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03940"
FT                   /db_xref="GOA:C6S564"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C6S564"
FT                   /protein_id="CBA03940.1"
FT                   /translation="MYTFRPFPKLHTETHIMNIQNIRTLLDTVAVPNTARTLGGEKAVR
FT                   SVEQHSDGIHIALHFGFPVAHIAAAIADSVQETLMPETGDTHIHLSMDTEIGTHKVQPG
FT                   VTTIKGVKNIIAVASGKGGVGKSTTTANLAAAMARMGARVGVLDADLYGPSQPTMLGVH
FT                   DRKPDQKNQKLIPVESSDGIQVMSIGFLVDTGQAVVWRGPMVSQALQQLMFQSEWDEVD
FT                   YLFIDLPPGTGDIQLTLSQRIPVTGSVIVTTPQDIALIDARKAVDMFRKVNIPILGVLE
FT                   NMSVHICSNCGHSEALFGTDGGKDLAARLNVPLLGQLPLSLPVREAMDGGTPAQLFDEH
FT                   PAIAKIYTDAAFQIALSIADKGKDFSSRFPKIVVE"
FT   tRNA            339234..339309
FT                   /locus_tag="NMO_tRNA09"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:339267..339269,aa:Lys)"
FT   CDS_pept        339388..339897
FT                   /transl_table=11
FT                   /locus_tag="NMO_0318"
FT                   /product="thioredoxin"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03943"
FT                   /db_xref="GOA:C6S565"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6S565"
FT                   /protein_id="CBA03943.1"
FT                   /translation="MKKKLLSGIKFAVQTALVFLLVSLFLDWVRKPEEPAGAAGRPLTL
FT                   LSGQRLTLGQFSRDKAVLVYFWGSWCGVCRYQSPIIDDLAADGVPVVGVAVRSGSASEV
FT                   AAYMAKRGLGFPTVNDEDGGLARSWRIVATPAVVLVKNGKMVHYTTGISSYWGLRARIF
FT                   QADVFG"
FT   CDS_pept        340240..340680
FT                   /transl_table=11
FT                   /locus_tag="NMO_0319"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03946"
FT                   /db_xref="GOA:C6S566"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012712"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6S566"
FT                   /protein_id="CBA03946.1"
FT                   /translation="MPTQSKHASINISLIQAREALMTQFRPILNQANITDQQWRIIRLL
FT                   AENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLKPSNDQRRVFLKLTAEGEKLY
FT                   EEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIEDALNS"
FT   CDS_pept        340795..341295
FT                   /transl_table=11
FT                   /locus_tag="NMO_0320"
FT                   /product="4-hydroxyphenylacetate 3-monooxygenase coupling
FT                   protein"
FT                   /function="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases DIM6/NTAB family"
FT                   /EC_number="4.2.1.120"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03948"
FT                   /db_xref="GOA:C6S567"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR011982"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C6S567"
FT                   /protein_id="CBA03948.1"
FT                   /translation="MADLQKTFQTSFRDAMASCAAGVHVITTDGAAGRYGITMTAVTPV
FT                   TDEPPTVMLCINRSARIIPILSENGSLCINTLADEHQDVAEHFAGLTGLSPEERFAYHI
FT                   WHYGKTGQPEIEGALAHLHGHIVGQHEIGTHFVFYVRLDEIKNCVGKRPALLYFRRQFR
FT                   FLD"
FT   CDS_pept        341311..342006
FT                   /transl_table=11
FT                   /locus_tag="NMO_0321"
FT                   /product="putative nucleotidyl transferase"
FT                   /function="Nucleoside-diphosphate-sugar pyrophosphorylase
FT                   involved in lipopolysaccharide biosynthesis/translation
FT                   initiation factor 2B gamma/epsilon subunits (eIF-
FT                   2Bgamma/eIF-2Bepsilon)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03951"
FT                   /db_xref="GOA:C6S568"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6S568"
FT                   /protein_id="CBA03951.1"
FT                   /translation="MKAMILAAGRGERMRPLTDTTPKPLLDVAGKPLIGWHLCRLKQAG
FT                   FTEIVINHAWLGRQIEEALGDGSAYGVNIAYSPEPAGGLETAGGIAQALPLLGDAPFLV
FT                   VNGDVLTDIDFTAAFQAASSLPEHISAHLWLADNPPHNPDGDFSLLPDGSVRPEVNGGN
FT                   GLTFSGVGIYRPEMFDGIEAGSVAKLAPVLRGEMRQNRVSGQKHTGLWLDVGTVCRLKE
FT                   AQALAGAWK"
FT   CDS_pept        complement(342252..342683)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0322"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03954"
FT                   /db_xref="GOA:C6S569"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6S569"
FT                   /protein_id="CBA03954.1"
FT                   /translation="MSSNAWLFWALASAGFASLTAIFAKMGLQGIDSDFATFIRTLVIL
FT                   AALLLFLTYTGKWQGVNGFTGHNWTFLILSGLATGASWLAYFKALQLGNASQVAPVDKF
FT                   SLVLVALMAVVFLNERPSTQEWIGLGLVTAGVLVLALKR"
FT   CDS_pept        342858..344534
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="NMO_0323"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /function="Formyltetrahydrofolate synthetase"
FT                   /EC_number="6.3.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03958"
FT                   /db_xref="GOA:C6S570"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S570"
FT                   /protein_id="CBA03958.1"
FT                   /translation="MSFKTDAEIAQSSTMRPIGEIAAKLGLNADNIEPYGHYKAKINPA
FT                   EAFKLPQKQGRLILVTAINPTPAGEGKTTVTIGLADALRHIGKDAVIALREPSLGPVFG
FT                   VKGGAAGGGYAQVLPMEDINLHFTSDFHAIGAANNLLAAMLDNHIYQGNELNIDPKRVL
FT                   WRRVVDMNDRQLRNIIDGMGKPVDGVMRPDGFDITVASEVMAVFCLAKDIGDLKERLGN
FT                   ILVAYAKDGSPVYAKDLKAHGAMAALLKDAIKPNLVQTIEGTPAFVHGGPFANIAHGCN
FT                   SVTATRLAKHLADYAVTEAGFGADLGAEKFCDIKCRLADLKPDAAVVVATVRALKYNGG
FT                   VERANLGEENLEALAKGLPNLLKHISNLKNVFGLPVVVALNRFVSDSDAELAMIEKACA
FT                   EHGVEVSLTEVWGKGGAGGADLARKVVNAIESQTNNFGFAYDVELGIKDKIRVIAQKVY
FT                   GAEDVDFSAEASAEIASLEKLGLDKMPICMAKTQYSLSDNAKLLGCPEGFRIAVRGITV
FT                   SAGAGFIVALCGNMMKMPGLPKVPAAEKIDVDEHGVIHGLF"
FT   CDS_pept        344648..345739
FT                   /transl_table=11
FT                   /locus_tag="NMO_0324"
FT                   /product="predicted GTPase translation factor"
FT                   /function="Predicted GTPase probable translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03961"
FT                   /db_xref="GOA:C6S571"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C6S571"
FT                   /protein_id="CBA03961.1"
FT                   /translation="MSLKCGIVGLPNVGKSTLFNALTQSGIEAANYPFCTIEPNVGIVE
FT                   VPDPRMAELAKIVNPQKMQPAIVEFVDIAGLVAGASKGEGLGNQFLANIRETDAIVNVV
FT                   RCFDDDNIVHVSGKVDPIADIETIGTELALADLASVEKAIVREEKRARSGDKDAQKLVD
FT                   LCKKLLPHLDEGKPVRSFGLDAEERAMLKPLFLLTAKPAMYVGNVAEDGFENNPHLDRL
FT                   KELAAKENAPVVAVCAAMESEIAELEDDEKAEFLAEMGLEEPGLNRLIRAGYDLLGLQT
FT                   YFTAGVKEVRAWTIHKGDTAPQAAGVIHTDFERGFIRAQVIAYDDFVSLGGEAKAKEAG
FT                   KMRVEGKEYVVQDGDVMHFLFNV"
FT   CDS_pept        345806..347566
FT                   /transl_table=11
FT                   /locus_tag="NMO_0325"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /function="Predicted ATP-dependent endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03964"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:C6S572"
FT                   /protein_id="CBA03964.1"
FT                   /translation="MILRKFQIKNFRSLINVNVKFIDNLPIVISGENNIGKTNFLRALN
FT                   VYFNHIHDKNLYHAETDIPHHIYYGSRGGRTKTELIGEFENHGKIIKLLVRFDAKGNSS
FT                   YKLDSKDINDNKAFEFLSEFKFIFIESHNIHLPSLIGAILEKDGLLALDKKRTKQSRPL
FT                   EKLEEFIDLSRQAITDIENDINHCFKELTDFDGILKEAKILINFAEFDRLRDVIRTMTS
FT                   ITLQDGNNHEIESKGSGAQRAVFLSLMKYISKNIKNKKIIWAIDEPEAFLQPKLQRKVF
FT                   ETLQSMCKEDKQTIILTTHSQHFINLRNIDTVNLFIGNSEPKEYERRPGKIFYEINTQN
FT                   IAFTSTSEKIKAIKEHLGINNNDGWELLPFNVLVEGEEDKKYLEKLMEAVDIEIPNIIC
FT                   AGGATKIAGYLQYYNDFAKDNPFPEKPKILCIFDNDKKGRESKSKINPKKLTSLEIQSI
FT                   LIPRHDYTILDDNPRNFSGQSQNWAIEDFLSPVLIIETANNLLRKDKYKIIGKKQINVR
FT                   NQVAHRNKIILEYLSECTSQNNPDKDDYLWGSDGRKIALCKSFCDNQTPEKILEHLNQN
FT                   QRDFLNKLKG"
FT   CDS_pept        347569..348867
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="NMO_0326"
FT                   /product="Tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03967"
FT                   /db_xref="GOA:C6S573"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6S573"
FT                   /protein_id="CBA03967.1"
FT                   /translation="MKSVIQDLQSRDLIAQTTDIEALDALLNEQKIALYCGFDPTADSL
FT                   HIGHLLPVLALRRFQQAGHTPIALVGGATGMIGDPSFKAAERSLNSAETVAGWVESIRN
FT                   QLTPFLSFEGGNAAIMANNADWFGKMNCLDFLRDIGKHFSVNAMLNKESVKQRIDRDGA
FT                   GISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGNITAGIDLTRRLNQKQVFGLTL
FT                   PLVTKSDGTKFGKTEGGAVWLNAKKTSPYQFYQFWLKVADADVYKFLKYFTFLSIEEID
FT                   AVEAKDQASGSKPEAQRILAEEMTRLIHGEEALAAAQRISESLFAEDQSSLTESDFEQL
FT                   ALDGLPAFEVSDGINVVEALVKTGLASSNKEARGFVNSKAVLLNGKPAEANNPNHAAER
FT                   PDDACLLNGEHKRFGKYTILRRGKRNHALLVWK"
FT   CDS_pept        349359..350315
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="NMO_0327"
FT                   /product="riboflavin kinase/FMN adenylyltransferase"
FT                   /function="FAD synthase"
FT                   /EC_number="2.7.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03970"
FT                   /db_xref="GOA:C6S574"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C6S574"
FT                   /protein_id="CBA03970.1"
FT                   /translation="MTACFTTYPNITMRIRLGRHNAPDFPHGAAVTIGNFDGVHLGHKH
FT                   ILQKLRLEADTRGLPVVTVVFEPQPKEFFALRTGRMPPCRISPLRTKLELLEGTGCVDA
FT                   VWVLRFDQNFSEISAQGFIDRLLRQTLNTRYLLVGDDFRFGAGREGCFELLAQQPDMQT
FT                   ERTPSVIVEDIRTSSTAVRQALSDGNLAYAKKLLGHDYVLSGRVVHGRKLGRTLNAPTA
FT                   NIRLPRHRYALGGVFVVEADGAFGTRRGVASFGFNPTVDSDCFQKLEVHLFDFQGDLYG
FT                   QRLNVRFLHKLRDEEKFDGMEELKRQIEADMEAAKCW"
FT   CDS_pept        350456..353245
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="NMO_0328"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03973"
FT                   /db_xref="GOA:C6S575"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:C6S575"
FT                   /protein_id="CBA03973.1"
FT                   /translation="MTDYSKTVNLLESPFPMRGNLAKREPAWLKSWYEQKRYQKLREIA
FT                   KGRPKFILHDGPPYANGDIHIGHAVNKILKDIIIRSKTQAGFDAPYVPGWDCHGLPIEV
FT                   MVEKLHGKDMPKARFRELCREYAAEQVARQKKDFIRLGVLGDWDKPYLTMDFKTEADTV
FT                   RMLGEIYKSGYLYRGAKPVQFCLDCGSSLAEAEVEYKDKISPAIDVAYLFKDTAALAAA
FT                   FGLASIEGKAFAVIWTTTPWTLPASQAVSAGADVVYQLIDTPKGKLVLAKDLAEDALKR
FT                   YGFSDGIAILAETTGDKLENLHMNHPFLERDIPMLNGEHVTTDAGTGLVHTAPAHGLED
FT                   YAVCNKYGIELYNPVNAEGKYIGETPRVAGMRVWEANPVILQWLEETGNLLASSKIEHS
FT                   YAHCWRHKTPLIYRATGQWFVGMDKAGADGKTLRDKAIKAVDDTEFFPSWGRARLEAMI
FT                   EGRPDWVVSRQRYWGTPMTFFVHKETGELHPNSAELLEKVALKIEEKGIEAWFSLDKSE
FT                   LLSAEDCENYDKLSDTMDVWFDSGSTHYSVVKQREELEWPADLYLEGSDQHRGWFQSSM
FT                   LTGCASSMGRAPYKQLLTHGFVVDGEGKKMSKSIGNVVAPQEVYNEFGADILRLWAAST
FT                   DYSGELAISKEILKRVTESYRRIRNTLSFLFANLSDFNPIEDAVQQADMVEIDRYALVL
FT                   ARRLQERLAGDYYPRYAFHFAVKDIVSFCSEDLGAFYLDILKDRLYTTKADSHARRSAQ
FT                   TALYHITRSLVLLIAPILCFTGEEAWDIIGGGEEDSVLFHTWHEFPTINEKTEAELVKK
FT                   WTAIREAREAVTAAIEPLRADKTVGSSLQAEAEITAPEEMAGYLNALGEELRFALLVSK
FT                   AEVKVGDELAVAAKASDGEKCERCWHYTRDVGAVAGHETVCKRCAENVSGEGETRHYA"
FT   CDS_pept        354263..354790
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="NMO_0329"
FT                   /product="Lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03975"
FT                   /db_xref="GOA:C6S576"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:C6S576"
FT                   /protein_id="CBA03975.1"
FT                   /translation="MVLFYRLLKNMSSSVSSKTRYWVLALAAIVLDQWSKWAVLSSFQY
FT                   RERVNVIPSFFDLTLVYNPGAAFSFLADQGGWQKYFFLVLAVAVSAYLVRAILRDEFAT
FT                   LGKTGAAMIIGGALGNVIDRLIHGHVVDFLLFYWQNWFYPAFNIADSFICVGAVLAVLD
FT                   NIVHRKTQEEKY"
FT   CDS_pept        354819..355787
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="NMO_0330"
FT                   /product="lytB protein"
FT                   /function="Penicillin tolerance protein"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03978"
FT                   /db_xref="GOA:C6S577"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:C6S577"
FT                   /protein_id="CBA03978.1"
FT                   /translation="MNEKTIILANPRGFCAGVDRAISIVERALEEFGAPIYVRHEVVHN
FT                   KFVVDNLREKGAVFIEDLAEVPPGATLVYSAHGVSKAVRQEAAERGFRVFDATCPLVTK
FT                   VHKEVARLDAQDCEIIMIGHKGHVEVEGTMGQLAPGKMLLVETVGDVAKLEVRNPDKLA
FT                   YVSQTTLSVDETKDIIAALNARFPNIRNPHKEDICYATTNRQTAVKELAEQCDIVIVVG
FT                   SPNSSNSNRLREVAASRGIDAYMVDNAGYLQRAWFEGKNKVGVTAGASAPEVLVQEVLA
FT                   TIRGWGHETVREGEGAEESIVFVLPKELRREGETKPDLCKR"
FT   CDS_pept        complement(355875..356534)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0331"
FT                   /product="probable hydrolase"
FT                   /function="Predicted phosphatases"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03982"
FT                   /db_xref="GOA:C6S578"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6S578"
FT                   /protein_id="CBA03982.1"
FT                   /translation="MTPPKLIIFDWDGTLADTTQPIIDTMRRSFAECGFPPPEAERVRS
FT                   LIGYSLPEIIRTLLEMPSETAVADIARTYSAHYLNPNNRNMTLFPDALPCLDKLKAQGY
FT                   WLAVATGKGRAGLDNAISQTATGSYWLATACVGEYPSKPSPEMVFGLCGELGLDPKEAL
FT                   VVGDTAHDLHMAANAGAAAVGVATGAHSREQLLGAPHLAVLDGLSELPGFLAQHYA"
FT   CDS_pept        356694..358850
FT                   /transl_table=11
FT                   /locus_tag="NMO_0332"
FT                   /product="outer membrane ferric siderophore receptor"
FT                   /function="Outer membrane receptor for ferric coprogen and
FT                   ferric-rhodotorulic acid"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03984"
FT                   /db_xref="GOA:C6S579"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:C6S579"
FT                   /protein_id="CBA03984.1"
FT                   /translation="MSVFRINMTAATVLAALSSSVFAAQTADLETVHIKGQRSYNAIAT
FT                   EKNGDYSSFAATVGTKIPASLREIPQSVSIITNQQVKDRDVDTFDQLARKTPGLRVLSN
FT                   DDGRSSVYARGYEYSEYNIDGLPAQMQSINGTLPNLFAFDRVEVMRGPSGLFDSSGEMG
FT                   GIVNLVRKRPTKAFQGHAAAGFGTHKQYKAEADVSGSLNADGSVRGRVMAQTVGASPRP
FT                   AEKNNRHETFYAAADWDINPDTVLGAGYLYQQRHLAPYNGLPADADGKLPSLPQHAFVG
FT                   ADWNKFKMHSHDVFADLKHYFGNGGYGKVGMRYSDRDADSNYAFAGSKLGMKTPAGRPG
FT                   CNTADDKACAVGLGTEIKQKALAFDASYSRPFRLGNTANEFVIGADYNRFRSTNEQGRT
FT                   TLYARGGLALNEFRSIPQVDLIANARKGVRGYSHTVATENLDEFGIYGKSTFHPADGLS
FT                   LIGGGRLGHYKIESGDGKTLHKASRTKFTGYAGAVYDIDGSNSLYASASQLYTPQTNLD
FT                   ADGKLLKPRQGNQFEVGYKGSHMDDRLNTRVSLYRLKDKNAAAPLNPKDRNTRYAALGE
FT                   RVMEGVETEISGVVTPKWQIHAGYSYLHSQIKTAANSRDDGIFLLMPKHSANLWTTYQV
FT                   TPELTIGGGVNAMSGITSSAGMHAGGYATFDAMAAYRFTPKLKLQINADNIFNRHYYAR
FT                   VGGTNTFNIPGSERSLTANLRYSF"
FT   CDS_pept        358920..359852
FT                   /transl_table=11
FT                   /locus_tag="NMO_0333"
FT                   /product="putative esterase"
FT                   /function="Predicted hydrolase of the alpha/beta
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03987"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6S580"
FT                   /protein_id="CBA03987.1"
FT                   /translation="MLSQLEYGIAKENRPNRQADRFAGSVLPLAASLTHKPNIMKPIPT
FT                   DTFQPAILPQAFETEIKSTCTGRIYRIQTATLGEMPSEGYPVLFVLDGEAFFPSLFNIM
FT                   QSLMPNPVTRSNAPCLIVGIGYTTGSVRDLTQRAADYTPPLGDNATADERQQFGQADRF
FT                   AAFIDSELTAFLESKYRLDKNETAVFGHSFGALFGLYSLLSHRRFRRHWLVSPSIWWHN
FT                   RRILDFMPSENRLNGIDVCLNIGALERGSGCKRREERDMAGLSERMAAELDRHGAAVFF
FT                   REYPNADHGNVSFYSLTDCVEYLRKAWQR"
FT   CDS_pept        360247..360582
FT                   /transl_table=11
FT                   /locus_tag="NMO_0334"
FT                   /product="putative initiator RepB protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03991"
FT                   /db_xref="GOA:C6S581"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6S581"
FT                   /protein_id="CBA03991.1"
FT                   /translation="MEIEKRFTVYEIEQVAQLSSGYAMRLYEFFMQYFDKQTGKGWLEV
FT                   SLVDLRFRFGLLPNEYARIGNFKTRVIDYSINEINKKTDLTATYEQRKNGRVITGFRFE
FT                   FTRKQQQ"
FT   CDS_pept        360938..361429
FT                   /transl_table=11
FT                   /locus_tag="NMO_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03994"
FT                   /db_xref="UniProtKB/TrEMBL:C6S582"
FT                   /protein_id="CBA03994.1"
FT                   /translation="MAKQQEKAKIEKAERERKKAEEQAEQARKEKEKQKLEEQRQFLIE
FT                   QFEVLSPKQQENVINEIFEQVGKGAFKQIFQTARQQGTVHIDARFVKNFYNYFQQEERA
FT                   KRARKRVDLPIQYTEEDIEQEVPKEKGTIFFGNDWNEYVYKQLIMYRDFKSMMNDDAIK
FT                   "
FT   CDS_pept        361644..362387
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0336"
FT   CDS_pept        362417..362776
FT                   /transl_table=11
FT                   /locus_tag="NMO_0337"
FT                   /product="putative cupin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CBA03998"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:C6S583"
FT                   /protein_id="CBA03998.1"
FT                   /translation="MMNNPKNYQAFMQDFLGNQRTNTAFNMDLFGNAHNQTLPEHCFLR
FT                   LNSNDCSTLSQGYFIANGIKVNIDEISMKFLTILVNKHIIPLTEMLSLFNTNEQESINK
FT                   LVWQLGELDIIEIIR"
FT   CDS_pept        363006..363341
FT                   /transl_table=11
FT                   /locus_tag="NMO_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04001"
FT                   /db_xref="UniProtKB/TrEMBL:C6S584"
FT                   /protein_id="CBA04001.1"
FT                   /translation="MKELNISDLEIVSGGSEPKYFSPLDVIGVTSAATGGWRAVSATAT
FT                   GDMIARSAARGGLIGLAGIAGWNTGTYLYHETPLGDWLSSGVDKLTGLDQNFNDASGND
FT                   YGDGTGY"
FT   CDS_pept        363521..363940
FT                   /transl_table=11
FT                   /locus_tag="NMO_0339"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04004"
FT                   /db_xref="GOA:C6S585"
FT                   /db_xref="UniProtKB/TrEMBL:C6S585"
FT                   /protein_id="CBA04004.1"
FT                   /translation="MGVLLNNTKILINISSISFILLNVYIIYSKVRFNLSTIPFVNHIS
FT                   ILIAFSFIISTLLLIYKMVIFARGINKNQNKIEFVKIFTFYFMVILYIALITLFRQENF
FT                   YFNMNIYSIIFIVILFCLTHFFFIIKFYFEVNKNV"
FT   CDS_pept        363933..364268
FT                   /transl_table=11
FT                   /locus_tag="NMO_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04006"
FT                   /db_xref="UniProtKB/TrEMBL:C6S586"
FT                   /protein_id="CBA04006.1"
FT                   /translation="MYELSIVELELVSGAGPIADFTTGVGGAIGGGAGYIAGKAGGGTI
FT                   GGILGSPFGPGGTIVGVAAGQQYGGKVGSVIGAGAGSAIGGVIGRGIESILDNDRSGND
FT                   YGDGTGY"
FT   CDS_pept        364596..364808
FT                   /transl_table=11
FT                   /locus_tag="NMO_0341"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04009"
FT                   /db_xref="GOA:C6S587"
FT                   /db_xref="UniProtKB/TrEMBL:C6S587"
FT                   /protein_id="CBA04009.1"
FT                   /translation="MFNFLNKNIFIKAIKVIVMGCFYSFLVFGLFVSGKEFGYPYAPNM
FT                   DAGGLAFLSVYIGFFLSVALHIYDI"
FT   CDS_pept        364832..365167
FT                   /transl_table=11
FT                   /locus_tag="NMO_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04012"
FT                   /db_xref="UniProtKB/TrEMBL:C6S588"
FT                   /protein_id="CBA04012.1"
FT                   /translation="MKELTIQDLTLVSGGFEVGRDYIGVGSAVTTAGSVAGSIRAATMT
FT                   GDAAAIVTRSGLTAVRAGTVAIPVIAYNATVWVNNNTTLQDKLGSLIDKVTGLDQSGND
FT                   YGDGTSY"
FT   CDS_pept        365203..365808
FT                   /transl_table=11
FT                   /locus_tag="NMO_0343"
FT                   /product="putative bacteriocin processing protease"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04015"
FT                   /db_xref="GOA:C6S589"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR033838"
FT                   /db_xref="UniProtKB/TrEMBL:C6S589"
FT                   /protein_id="CBA04015.1"
FT                   /translation="MPTYLSRLSFSFSRRLPVILQTEAAECGLACLVSVLGFHGFYTDL
FT                   RHLRARFSLSLKGATLADLVRFANSMNLTARAVRLDLDELANLRVPCILHWDLNHFVVL
FT                   HEVHRNHIMIMNPASGWQKVRMEEVSRCFTGVALELFPNTQFEEKHETRKIRVLPMLRG
FT                   VVGLKRSETFAKFLSLPTAETQTQVFGCFQLFSPQIPP"
FT   mobile_element  complement(365850..366857)
FT                   /mobile_element_type="other:ISNme1"
FT                   /locus_tag="NMO_0344"
FT   CDS_pept        367195..367545
FT                   /transl_table=11
FT                   /locus_tag="NMO_0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04019"
FT                   /db_xref="GOA:C6S590"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6S590"
FT                   /protein_id="CBA04019.1"
FT                   /translation="MLDGVFTVGALMAFMSYKSQFESKAGSLIDQFVQIKMLGLHAERL
FT                   ADIVLEETENEQNNDFRLPENLEHFDIQIENVSFRYAENEPYILQDFSLIIKQGTAKIP
FT                   AATGIFVRLSPV"
FT   CDS_pept        complement(368248..368556)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0346"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04022"
FT                   /db_xref="GOA:C6S591"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:C6S591"
FT                   /protein_id="CBA04022.1"
FT                   /translation="MRIIVFFDLPVITAAKRKAANQFRQFLLKDGYQMLQLSVYSRIVK
FT                   GRDSLQKHHNRLCANLPQEGSIRCLEITEKQYAAMKLLLGELKTQEKKVNSDQLLLF"
FT   CDS_pept        complement(368567..369481)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0347"
FT                   /product="putative DNA-repair protein"
FT                   /function="Uncharacterized protein predicted to be involved
FT                   in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04025"
FT                   /db_xref="GOA:C6S592"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="UniProtKB/TrEMBL:C6S592"
FT                   /protein_id="CBA04025.1"
FT                   /translation="MTWRSLLIQNGGKLSLQRRQLLIQQSGESHTVLLEDIAVIIIENR
FT                   ETLITAPLLSALAEHGATLLTCDEQFLPCGQWLPYAQYHRQLKILKLQLNISEPLKKQL
FT                   WQHIVRQKILNQAFVADETGNDLAAKRLRTLASEVRSGDTGNREAQAAALYFQALFGEK
FT                   FTRNDNNAVNAALNYTYAVLRAAVARTLTLYGWLPALGLFHRSELNPFNLADDFIEPLR
FT                   PLADLTVIHLYEQGRLKTELTPGIKQHLIKTLHYQISIERQHFSTLAAIDKMISSFQAG
FT                   VTDKNAKQLKLPEILPLKAYQYE"
FT   CDS_pept        complement(369547..372795)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0348"
FT                   /product="putative CRISPR-associated protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04028"
FT                   /db_xref="GOA:C6S593"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR028629"
FT                   /db_xref="InterPro:IPR033114"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR041383"
FT                   /db_xref="UniProtKB/TrEMBL:C6S593"
FT                   /protein_id="CBA04028.1"
FT                   /translation="MAAFKPNPINYILGLDIGIASVGWAMVEIDEEENPIRLIDLGVRV
FT                   FERAEVPKTGDSLAMVRRLARSVRRLTRRRAHRLLRARRLLKREGVLQAADFDENGLIK
FT                   SLPNTPWQLRAAALDRKLTPLEWSAVLLHLIKHRGYLSQRKNEGETADKELGALLKGVA
FT                   DNAHALQTGDFRTPAELALNKFEKESGHIRNQRGDYSHTFSRKDLQAELILLFEKQKEF
FT                   GNPHISGGLKEGIETLLMTQRPALSGDAVQKMLGHCTFEPAEPKAAKNTYTAERFIWLT
FT                   KLNNLRILEQGSERPLTDTERATLMDEPYRKSKLTYAQARKLLGLEDTAFFKGLRYGKD
FT                   NAEASTLMEMKAYHAISRALEKEGLKDKKSPLNLSPELQDEIGTAFSLFKTDEDITGRL
FT                   KDRIQPEILEALLKHISFDKFVQISLKALRRIVPLMEQGKRYDEACAEIYGDHYGKKNT
FT                   EEKIYLPPIPADEIRNPVVLRALSQARKVINGVVRRYGSPARIHIETAREVGKSFKDRK
FT                   EIEKRQEENRKDREKAAAKFREYFPNFVGEPKSKDILKLRLYEQQHGKCLYSGKEINLG
FT                   RLNEKGYVEIDHALPFSRTWDDSFNNKVLVLGSENQNKGNQTPYEYFNGKDNSREWQEF
FT                   KARVETSRFPRSKKQRILLQKFDEDGFKERNLNDTRYVNRFLCQFVADRMRLTGKGKKR
FT                   VFASNGQITNLLRGFWGLRKVRAENDRHHALDAVVVACSTVAMQQKITRFVRYKEMNAF
FT                   DGKTIDKETGEVLHQKTHFPQPWEFFAQEVMIRVFGKPDGKPEFEEADTPEKLRTLLAE
FT                   KLSSRPEAVHEYVTPLFVSRAPNRKMSGQGHMETVKSAKRLDEGVSVLRVPLTQLKLKD
FT                   LEKMVNREREPKLYEALKARLEAHKDDPAKAFAEPFYKYDKAGNRTQQVKAVRVEQVQK
FT                   TGVWVRNHNGIADNATMVRVDVFEKGDKYYLVPIYSWQVAKGILPDRAVVQGKDEEDWQ
FT                   LIDDSFNFKFSLHPNDLVEVITKKARMFGYFASCHRGTGNINIRIHDLDHKIGKNGILE
FT                   GIGVKTALSFQKYQIDELGKEIRPCRLKKRPPVR"
FT   CDS_pept        complement(373073..376507)
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="NMO_0349"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04031"
FT                   /db_xref="GOA:C6S594"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:C6S594"
FT                   /protein_id="CBA04031.1"
FT                   /translation="MTEPTYIPLRLHTEFSITDGMVRIKKLIAKAQEYGLPALGISDLM
FT                   NEFGLVKFYKACRGAGIKPIGAADVWIGNPNAPDKPFRAMLIIRNDAGYLRLSELLTEA
FT                   YVGKDRNVHHAELNPEWLENGDNSGLICLSGAHYGEVGMNLLNGNEDAARAAALKYAAW
FT                   FPDAFYLELQRLPERPEWEACVSGSVKLAEELGLPVVATHPTQFMSRDDFNAHEARVCI
FT                   AGGWVLTDKKRPRDFTPSQFFIPPETMAERFADLPEALENTVEIAKRCNLHITLGKNFL
FT                   PLFPTPDGLSLDDYLIKLSNEGLQERMVQLYPDEAERAEKMPEYQERLDFELNIIIQMK
FT                   FPGYFLIVQDFINWAKTHGCPVGPGRGSGAGSLVAYSLKITDLDPLKYALLFERFLNPE
FT                   RVSMPDFDVDFCQANRGRVIEYVREKYGAEAVSQIVTFGTMSSKAVIRDVGRVLELPFM
FT                   LCDKLSKLIPLEANKPLGLDDAMKAEPQIQELIEAEEADELITLAKKLEDLTRGLGMHA
FT                   GGVLIAPGKISDYSPVYQADESASPVSMYDKGDVEDVGLVKFDFLGLRNLTIIEMAQNN
FT                   IKNTTGDIIDVGKIPLDDQVAYQIFRDANTTAVFQFESTGMKKMLKTAHTTKFEELIAF
FT                   VSLYRPGPMDNIPDFVARMKGQEFQYIHPLLEGILAPTYGIMVYQEQVMQAAQIIGGYS
FT                   LGGADLLRRAMGKKKPEEMVKHREIFAEGAAKQGISREKSDEIFNYMEKFAGYGFNKSH
FT                   AAAYALISYQTAWLKAHYPAEFMAATMSSELDNTDQLKHFYDDCRANGIEFLPPDINES
FT                   DYRFTPYPNMKIRYALGAIKGTGEAAVESITAARQSGGKFTGLLDFCERVGKEHMNRRT
FT                   LEALIRGGAFDSIEPNRAMLLANIDLAMDNADQKAANANQGGLFDMMEDAIEPVRLIDA
FT                   PMWSESEKLAEEKTVIGFYLSGHPFGPYAQEVRQIAPQKLSKLKPQDSVRLAGFVTAVR
FT                   TMMGKRGKIAFVSLEDLSGQVEIMVGGQTLENCADCLKADQVLIIESKVSRDDYGGGDG
FT                   LRILANQVMTLQTARERYARSLSLALAPHHDIGGLVQLLAAHQLPDTPRIPLQLSYANE
FT                   KASGRLQVPPKWTVTPSSALFGELETLLGSRSVRVNW"
FT   CDS_pept        complement(376748..376846)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04034"
FT                   /db_xref="UniProtKB/TrEMBL:C6S595"
FT                   /protein_id="CBA04034.1"
FT                   /translation="MTLMHILKRELPDTPAIGIKTKSKTCLNVKLI"
FT   CDS_pept        377039..377272
FT                   /transl_table=11
FT                   /locus_tag="NMO_0351"
FT                   /product="putative RNA-binding protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04037"
FT                   /db_xref="GOA:C6S596"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6S596"
FT                   /protein_id="CBA04037.1"
FT                   /translation="MEAIVYLEDNEYIALCDLLKLVGLAESGGQAKAFIAEGLVLRNGE
FT                   TETRKTAKIRGGEVIEFDGARLEIADGYDPEA"
FT   CDS_pept        377250..377453
FT                   /transl_table=11
FT                   /locus_tag="NMO_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04040"
FT                   /db_xref="UniProtKB/TrEMBL:C6S597"
FT                   /protein_id="CBA04040.1"
FT                   /translation="MDMTLKHKAEALLGEPLLDEPVRPESWECCGSDCGEACIQTIYWA
FT                   DKARYDAQRRKLKEAGWSDDAV"
FT   CDS_pept        377898..378734
FT                   /transl_table=11
FT                   /locus_tag="NMO_0353"
FT                   /product="putative metal-dependent phosphoesterase"
FT                   /function="Predicted metal-dependent phosphoesterases (PHP
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04043"
FT                   /db_xref="GOA:C6S598"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C6S598"
FT                   /protein_id="CBA04043.1"
FT                   /translation="MIDLHCHSTVSDGMLSPAEVVRLAHQNGCTLLALTDHDHTGGIAE
FT                   ARAEADRLGLRLINGVEISVTWRGRTIHVVGLDFDEQDENLQNLLAQVRQGRLKRLEAI
FT                   AAKLEKKGIGGAYDGALALAANKEMVSRTHVAEFLIKNGYVKNKQQAFTKYLGDGKSCA
FT                   VRHEWATLEDCVSAVNGAGGMAVIAHPMRYDLSATAKRNLFEEFKNLGGAGIEVHSGNC
FT                   CKNDRLNYALLAERFGMLASAGSDFHRLNDFSGGILGACPELPENCRPVWAHFSRH"
FT   CDS_pept        complement(378786..380144)
FT                   /transl_table=11
FT                   /gene="avtA"
FT                   /locus_tag="NMO_0354"
FT                   /product="valine--pyruvate aminotransferase"
FT                   /function="Alanine-alpha-ketoisovalerate (or valine-
FT                   pyruvate) aminotransferase"
FT                   /EC_number="2.6.1.66"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04046"
FT                   /db_xref="GOA:C6S599"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6S599"
FT                   /protein_id="CBA04046.1"
FT                   /translation="MPSEPSDGITYKPTYLTHTEFDMQFSAFGEKFTQHSGILQLMDDL
FT                   GDALKSDKPVNMLGGGNPARIPEIDRAFADIFSKLAAEHAVENIGNYSNPQGDAALIDA
FT                   LTAFLNREYGWNLTADNIALTNGSQNAFFYLFNLFGGKFNLSDGTSAEKAILLPLAPEY
FT                   IGYADVHIEGQHFVSVKPKIENVEHEGEAGFFKYRVDFDALENLPELKEGKIGTICCSR
FT                   PTNPTGNVLTDGEMARLDALAREHGIPLIIDNAYGMPFPNIIYSDVTLNWHENIILCFS
FT                   LSKVGLPGVRTGIIVAAPEVVKAVSSLNAIVNLSPTRFGAAIAAPLLNDGRLKQLADQV
FT                   IQPFYRQQAQTAVSLLKRELGAYPLKIHKPEGAIFLWLWFENLPVSSQTLYEMLKAEGT
FT                   LIIPGEHFFVGIDTQDYPHAHECIRMSIAQDAETLEKGIAAIGKTVRKLYDNV"
FT   CDS_pept        complement(380134..382044)
FT                   /transl_table=11
FT                   /gene="pglD"
FT                   /locus_tag="NMO_0355"
FT                   /product="pilin glycosylation protein"
FT                   /function="Predicted nucleoside-diphosphate sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04049"
FT                   /db_xref="GOA:C6S5A0"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5A0"
FT                   /protein_id="CBA04049.1"
FT                   /translation="MNLETLIALPRNIKKICFLIHDFLMIFIAFWFTQSLKADYSDEWF
FT                   DFANWQSFLLTALLTITLFIRMGLYHAVTRFVSFRILTTVLAGSLASAVLFFLNTLIFE
FT                   ERLRLALPIVYFLLLFVSVTGSRMVLRGLLSEHPKKQMIPVIIYGAGRSGRQLLEAVKQ
FT                   MREYSAAAFVDDDPKLWHTVIYDLAVYQPDAIAFLIERYGVEKILLAIPGATQEQRRRI
FT                   INKLEAYPCEVLTIPGMKDLMDGKISIGTLKKISVSDLLGRDSVAPDDRLMSADIEGKT
FT                   VMVTGAGGSIGSELCRQIIRRRPEKLLLFELSEFALYAIEKELRETCIQKRLDTEILPF
FT                   LGSVQNRTLLEHVMTAFSVATVYHAAAYKHVPMVEFNTVEGIRNNIFGTLECALAATTS
FT                   GIRTFVLISTDKAVRPTNTMGASKRMAELCLQALAAEPGQKTRFSMVRFGNVLGSSGSV
FT                   VPLFEKQIAQGGPLTLTHPEITRYFMTIPEAAQLVIQAGAMGTGGDVFVLDMGESVKII
FT                   DLARQMITLSGLKPNTPEQPDGDIEILITGLRPGEKLYEELLIGDNVRKTSHPRIMTAN
FT                   ETMLPWHELSALLNRIRAACDRYDQQAIRTLLINAPTGFAPSDGICDLLWVRETHRKNA
FT                   V"
FT   CDS_pept        complement(382092..383306)
FT                   /transl_table=11
FT                   /gene="pglC"
FT                   /locus_tag="NMO_0356"
FT                   /product="pilin glycosylation protein"
FT                   /function="Predicted pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04052"
FT                   /db_xref="GOA:C6S5A1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5A1"
FT                   /protein_id="CBA04052.1"
FT                   /translation="MRKCRLKTDGPNTMLNTFLSPWPCFTQEEADAVSKVLLSNKVNYW
FT                   TGSECREFEKEFAAFSGTRYAVALSNGTLALDVALKAIGIGVGDDVIVTSRTFLASASC
FT                   IVNAGANPVFADVDLNSQNISAETVKAALTPTTKAVIVVHLAGMPAEMDGIMALAKEHN
FT                   LWVIEDCAQAHGAKYKGKSVGSIGHVGAWSFCQDKIMTTGGEGGMVTTNDKTLWEKMWS
FT                   YKDHGKSYDAVYHREHAPGFRWLHESFGTNWRMMEMQAAIGRIQLKRLPEWTACRQAHA
FT                   AKLAESLGKFKSIRLVEVADYIGHAQYKFYAFVKPEHLKDGWTRDRIVGELNARKVPCY
FT                   QGSCSEVYLEKAFDNTPWRPKERLTNAVELGDTSLMFLVHPTLTDDEIAFCKKHIEAVL
FT                   TEAAR"
FT   CDS_pept        complement(383345..384586)
FT                   /transl_table=11
FT                   /gene="pglB"
FT                   /locus_tag="NMO_0357"
FT                   /product="pilin glycosylation protein"
FT                   /function="Acetyltransferase (isoleucine patch
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04055"
FT                   /db_xref="GOA:C6S5A2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5A2"
FT                   /protein_id="CBA04055.1"
FT                   /translation="MSKFFKRLFDIVASASGLIFLSPVFLILIYLIRKNLGSPVFFFQE
FT                   RPGKDGKPFKMVKFRSMHDALDSDGILLPDGERLTPFGKKLRAASLDELPELWNVLKGD
FT                   MSLVGPRPLLMQYLPLYDNFQNRRHEMKPGITGWAQVNGRNALSWDERFACDIWYIDHF
FT                   SLCLDIKILLLTVKKVLIKEGISAQGEATMPPFTGKRKLAVVGAGGHGKVVAELAAALG
FT                   TYGEIVFLDDRVQGSVNGFPVIGTTLLLENSLSPEQFDIAVAVGNNRIRRQIAEKAAAL
FT                   GFALPVLIHPDSTVSPSATVGQGGVVMAKAVVQADSVLKDGVIVNTAATVDHDCLLDAF
FT                   VHISPGAHLSGNTRIGEESWIGTGACSRQQIRIGSRATIGAGAVVVRDVSDGMTVAGNP
FT                   AKPLAGKNTETLRS"
FT   CDS_pept        complement(384579..385652)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0358"
FT                   /product="putative gycosyltransferase"
FT                   /function="Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04058"
FT                   /db_xref="GOA:C6S5A3"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5A3"
FT                   /protein_id="CBA04058.1"
FT                   /translation="MNITIVAPYCSLPSEPYFNRFWYLAERLSQSHDVLLITSRFRHYD
FT                   KSFRRHEDAAATSNGRLHSPQAAEQDIVYSAYPLIATNLLLGKHKARLGYKLIVDVQDV
FT                   WPESFSSVVPFLKKVPHKLLPFASRANQAYRYADALVAVSQTYLDRAKETNPNVPGEVI
FT                   YIGADFPKLDAAPAKDFGDDKTRFFYLGTLSYSYDVETVCKGVRKLLDDGENVELHIMG
FT                   GGPDLDRLKQYACEGIKFYGYIPYAEMMSVAKGCDISVNAIHSYSMASITNKLSDYMAL
FT                   QKPILNSQVNDEVAEVLTLLPHADYRSGDVDSFIQAAKDILARKNDPVQSDEIVRRFKR
FT                   DVAYQKIVSLIERLAHE"
FT   CDS_pept        complement(385672..386744)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0359"
FT   CDS_pept        complement(386741..388162)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0360"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /function="Membrane protein involved in the export of O-
FT                   antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04062"
FT                   /db_xref="GOA:C6S5A4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5A4"
FT                   /protein_id="CBA04062.1"
FT                   /translation="MDTKEILGYAAGSIGSAVLAVIILPLLSWYFPADDIGRIVLMQTA
FT                   AGLTVSVLCLGLDQAYVREYYAAADKDTLFKTLFLPPLLSAAAIAALLLSHPSLPSEIL
FT                   FSLDDAAAGIGLVLFELSFLPIRFLLLVLRMEGRALAFSSAQLVPKLAILLLLPLTVGL
FT                   LHFPANTAVLTAVYALANLAAAAFLLFQNRCRLKAVRRAPFSSAVLHRGLRYGIPIALS
FT                   SIAYWGLASADRLFLKKYAGLEQLGVYSMGISFGGAALLFQSIFSTVWTPYIFRAIEEN
FT                   APPARLSATAESAAALLASALCLTGIFSPLASLLLPENYAAVRFIVVSCMLPPLFCTLV
FT                   EISGIGLNVVRKTRPIALATLGALAANLLLLGLAVPSGGARGAAVACAASFWLFFVFKT
FT                   ESSCRLWQPLKRLPLYMHTLFCLASSAAYTCFGTPANYPLFAGVWAAYLAGCILRHRKD
FT                   LHKLFHYLKKQGFPL"
FT   CDS_pept        complement(388357..389466)
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="NMO_0361"
FT                   /product="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase / phosphoribosylamino uracil reductase"
FT                   /function="Pyrimidine reductase riboflavin biosynthesis"
FT                   /EC_number="1.1.1.193"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04065"
FT                   /db_xref="GOA:C6S5A5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5A5"
FT                   /protein_id="CBA04065.1"
FT                   /translation="MFSDTDISMMETALRLAALGRFSTSPNPRVGCVIAHGSQVVGQGF
FT                   HVKAGEPHAEVHALHQAGEMAQGATAFVTLEPCSHYGRTPPCAEALVRAGVSRVVAAMR
FT                   DPNPLVAGKGLALLEAAGIKTECGLLEHQARELNRGFLSRIERRRPFVRLKCAVSLDGK
FT                   TALSDGSSFWITGEDARADVQVLRAESCAVLTGIGTVLADNPRLNVRAFPTLRQPARIV
FT                   LDSRLRLPLDSHLLTDGQSPTYIATLERDEDKLRPYRKHAHVRILMPSETAGGKIDLNS
FT                   LMRLLADEGIGELIVEAGSELTSAFLAEDLADEIVLYRSPKILGSGKDLFSLPENRAAL
FT                   SAPPLWTPVSSEILGHDIKTVFRKNGNAF"
FT   CDS_pept        complement(389499..389963)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0362"
FT                   /product="ATP-cone domain protein"
FT                   /function="Predicted transcriptional regulator consists of
FT                   a Zn-ribbon and ATP-cone domains"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04068"
FT                   /db_xref="GOA:C6S5A6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5A6"
FT                   /protein_id="CBA04068.1"
FT                   /translation="MKCPFCAHPDTRVADSRLMEERNAVRRRRHCPSCGKRFGTLETAE
FT                   LKMPAVIGPDKKRSPFNAQRLRNDLTAAARKSALTPEQIDETVRLTEHRLYTSGQRDIP
FT                   SAALADMVLKELLRQDTEAAVRFAALHKRFDNPADFASWLAQAVKTDRKA"
FT   CDS_pept        complement(389992..390834)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0363"
FT                   /product="putative glutamine amidotransferase"
FT                   /function="Predicted glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04071"
FT                   /db_xref="GOA:C6S5A7"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5A7"
FT                   /protein_id="CBA04071.1"
FT                   /translation="MCQLLGMNCNTPTDIMFSFEGFRRRGGITDHHADGFGIGFFEGKG
FT                   VRLFHDDKPSANSPVADLVRAYQIKSENVVAHIRKASQGQTSLANTHPFMREMWGGYWL
FT                   FAHNGHLIDFFPEQGEFFHPVGTTDSERAFCHILNRLRTRFAARPDDDTLFDAIAGLTH
FT                   EIRKFGLFNFMLSDGIALFAHASTLLHYIVRQAPFGKARLLDDDVMVDFAEVTTPSDRV
FT                   AVIATLPLTRDESWSQLAVDELVMFREGNIVRHDRPENPVYMSAEEGLEIARAAGVSV"
FT   CDS_pept        complement(391802..392881)
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="NMO_0364"
FT                   /product="3-dehydroquinate synthase"
FT                   /function="3-dehydroquinate synthetase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04074"
FT                   /db_xref="GOA:C6S5A8"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5A8"
FT                   /protein_id="CBA04074.1"
FT                   /translation="MKTLTVHTPSHSYPIFIGNGLLPQAGSLLKPHLGKRAAIITNETV
FT                   APLYLGTLQTALDAAGVSHFSIILPDGEAHKNWQTLNLIFDGLMQNRAERKTTLIALGG
FT                   GVIGDMTGFAAATYQRGAPFVQIPTTLLSQVDSSVGGKTAINHPLGKNMIGAFYQPQAV
FT                   LADLDTLHTLPVRELSAGMAEVIKYGALGDIGFFEWLEQNISGLMMLDREKLAQAVYRC
FT                   CQMKADIVAQDETEQGIRAWLNLGHTFGHAIETEMGYGTWLHGEAVAAGCVLAVRLSEQ
FT                   LGKTSAADTARLAALFEAAGLPSAPPVFPFEKWLEHMSHDKKVSGGIMRFIGLNRLGEA
FT                   NITEITDTDILRRTLQPYL"
FT   CDS_pept        complement(392961..393473)
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="NMO_0365"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04077"
FT                   /db_xref="GOA:C6S5A9"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5A9"
FT                   /protein_id="CBA04077.1"
FT                   /translation="MKNFNGKLILIGLMGAGKTTLGRQMAQRLDYRFYDSDHEIAAAAG
FT                   VPIPTIFEMEGEQGFRSRETAILKKLVILPHIVLSTGGGAVLKEENRALIRKSGTVVYL
FT                   HAPPETLLERTRCDNSRPLLQVADPLAKLRELYAARDPVYRQTADFTVESANCRETVQT
FT                   LLKRLSR"
FT   CDS_pept        complement(394549..396834)
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="NMO_0366"
FT                   /product="fimbrial assembly protein; pilus secretin"
FT                   /function="Type II secretory pathway component HofQ"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04080"
FT                   /db_xref="GOA:C6S5B0"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5B0"
FT                   /protein_id="CBA04080.1"
FT                   /translation="MNTKLTKIISGLFVATAAFQTASAGNITDIKVSSLPNKQKIVKVS
FT                   FDKEIVNPTGFVTSSPARIALDFEQTGISMDQQVLEYADPLLSKISAAQNSSRARLVLN
FT                   LNKPGQYNTEVRGNKVWIFINESDDTVSAPARPAVKAAPAAPAKQQAAAPSTKSAVSVS
FT                   KPFTPAKQQAAAPFTESVVSVSAPFSPAKQQAAASAKQQTAAPAKQQAAAPAKQTNIDF
FT                   RKDGKNAGIIELAALGFAGQPDISQQHDHIIVTLKNHTLPTTLQRSLDVADFKTPVQKV
FT                   TLKRLNNDTQLIITTAGNWELVNKSAAPGYFTFQVLPKKQNLESGGVNNAPKTFTGRKI
FT                   SLDFQDVEIRTILQILAKESGMNIVASDSVNGKMTLSLKDVPWDQALDLVMQARNLDMR
FT                   QQGNIVNIAPRDELLAKDKAFLQAEKDIADLGALYSQNFQLKYKNVEEFRSILRLDNAD
FT                   TTGNRNTLVSGRGSVLIDPATNTLIVTDTRSVIEKFRKLIDELDVPAQQVMIEARIVEA
FT                   ADGFSRDLGVKFGATGKKKLKNDTSAFGWGVNSGFGGDDKWGAETKINLPITAAANSIS
FT                   LVRAISSGALNLELSASESLSKTKTLANPRVLTQNRKEAKIESGYEIPFTVTSIANGGS
FT                   STNTELKKAVLGLTVTPNITPDGQIIMTVKINKDSPAQCASGNQTILCISTKNLNTQAM
FT                   VENGGTLIVGGIYEEDNGNTLTKVPLLGDIPVIGNLFKTRGKKTDRRELLIFITPRIMG
FT                   TAGNSLRY"
FT   CDS_pept        complement(396853..397398)
FT                   /transl_table=11
FT                   /gene="pilP"
FT                   /locus_tag="NMO_0367"
FT                   /product="type IV pilus biogenesis protein PilP"
FT                   /function="Tfp pilus assembly protein PilP"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04083"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5B1"
FT                   /protein_id="CBA04083.1"
FT                   /translation="MKHYALLISFLALSACSQGSEDLNEWMAQTRREAKAEIIPFQAPT
FT                   LPVAPVYSPPQLTGPNAFDFRRMETDKKGENAPDTKRIKETLEKFSLENMRYVGILKSG
FT                   QKVSGFIEAEGYVYTVGVGNYLGQNYGRIESITDDSIVLNELIEDSTGNWVSRKAELLL
FT                   NSSDKNTEQAAAPAAEQN"
FT   CDS_pept        complement(397416..398063)
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="NMO_0368"
FT                   /product="fimbrial assembly membrane protein"
FT                   /function="Tfp pilus assembly protein PilO"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04086"
FT                   /db_xref="GOA:C6S5B2"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5B2"
FT                   /protein_id="CBA04086.1"
FT                   /translation="MASKSSKTNLDLNNLHLLNLPARLFIALLAVAAVLGLGYAGLFKS
FT                   QMESLEEYEAKETELKNTYKQKSIDAASLNNLRDELASIRSAFDIMLKQLPTDAEIPNL
FT                   VQELHQAGSSNGLRLDSVMPQPPVDDGPIKRLPYSISITGNYEQISQFTRDVGSLSRII
FT                   TLESLKIAQSPENGGNPDGKSSILNLSAIATTYQAKSVEELAAEAAQNAEQK"
FT   CDS_pept        complement(398064..398663)
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="NMO_0369"
FT                   /product="fimbrial assembly membrane protein"
FT                   /function="Tfp pilus assembly protein PilN"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04089"
FT                   /db_xref="GOA:C6S5B3"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5B3"
FT                   /protein_id="CBA04089.1"
FT                   /translation="MNNLIKINLLPYREEMNKRKQQQFKTLMYGAVLTGVAAVAATYLF
FT                   IDNMINNQSERNTLLETSIAHLDTELSEIQKLKQEKDAFLIKKNKIEELQLKRLQAAKI
FT                   LDSLNEAVPGSTYLTSLDAVTADSYRLSGRTSSDNRVAAMMRAMPNTGIFKQPELLSIK
FT                   KNNSHQEFTLQATLQPIVKAAESKENPASGNAQEAN"
FT   CDS_pept        complement(398666..399781)
FT                   /transl_table=11
FT                   /gene="pilM"
FT                   /locus_tag="NMO_0370"
FT                   /product="fimbrial assembly membrane protein"
FT                   /function="Tfp pilus assembly protein ATPase PilM"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04092"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5B4"
FT                   /protein_id="CBA04092.1"
FT                   /translation="MRLFKSLKNPKKTDAKLPKKSSGLNNRAAIGIDIDQHSIKMVQLS
FT                   GRSLNQIQLEKYVIAKLPKNIIQGNKVQNYDQLVTYLQQAYAKLGTSCKNIIASVPQNL
FT                   ATIEQLTYTDKDAELDLQGFVESSISEVSSISLEEANYDYQVLSQSAAGEAVLAVASRK
FT                   DEIEPLIDAFNAAGMKLSALDVDIFGQYNAYALWINHFAPELAAEKVAIFGVYAAQTYA
FT                   LVIQDGKILYKQETSVSEEQLNQLIQRTYQVTEEKAEEIINSPQKPSDYQESVANYFNQ
FT                   QITQEIQRVLQFYYTTQTADDMTDIKHILLTGEAVRQEGIAQTVASQTNADVQCVHPAR
FT                   YFADNLKTDKQQFELDAPTLTRAFGLAVRGL"
FT   CDS_pept        399912..402329
FT                   /transl_table=11
FT                   /gene="ponA"
FT                   /locus_tag="NMO_0371"
FT                   /product="penicillin-binding protein 1A"
FT                   /function="Membrane carboxypeptidase/penicillin-binding
FT                   protein"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04095"
FT                   /db_xref="GOA:C6S5B5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5B5"
FT                   /protein_id="CBA04095.1"
FT                   /translation="MVNYYSAMIKKILTTCFGLVFGFCVFGVGLVAIAILVTYPKLPSL
FT                   DSLQHYQPKMPLTIYSADGEVIGMYGEQRREFTKIGDFPEVLRNAVIAAEDKRFYRHWG
FT                   VDVWGVARAAVGNVVSGSVQSGASTITQQVAKNFYLSSEKTFTRKFNEVLLAYKIEQSL
FT                   SKDKILELYFNQIYLGQRAYGFASAAQIYFNKNVRDLTLAEAAMLAGLPKAPSAYNPIV
FT                   NPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQEL
FT                   YEKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDV
FT                   EETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEK
FT                   MGEDRIRRGAVIRVKNNGGRWAVVQEPLLQGALVSLDAKTGAVRALVGGYDFHSKTFNR
FT                   AVQAMRQPGSTFKPFVYSAALSKGMTASTVVNDAPISLPGKGPNGSVWTPKNSDGRYSG
FT                   YITLRQALTASKNMVSIRILMSIGVGYAQQYIRRFGFRSSELPASLSMALGTGETTPLK
FT                   VAEAYSVFANGGYRVSSHVIDKIYDRDGRLRAQMQPLVAGQNAPQAIDPRNAYIMYKIM
FT                   QDVVRVGTARGAAALGRTDIAGKTGTTNDNKDAWFVGFNPDVVTAVYIGFDKPKSMGRV
FT                   GYGGTIAVPVWVDYMRFALKGKQGKGMKMPEGVVSSNGEYYMKERMVTDPGLTLDNSGI
FT                   APQPSRRAKEDDGGAAEGGRQAADDEVRQDMQETPVLPSNTGSKQQQLDSLF"
FT   CDS_pept        complement(402414..403079)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0372"
FT                   /product="GTP-binding protein"
FT                   /function="Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04098"
FT                   /db_xref="GOA:C6S5B6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5B6"
FT                   /protein_id="CBA04098.1"
FT                   /translation="MNLFQNAKFFTTVNHLKDLPDTPLEIAFVGRSNAGKSSAINTLTN
FT                   HVRLAYVSKTPGRTQHINFFELQNGNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLQQRK
FT                   QLIGLVLIMDARHPLKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLL
FT                   KPYSDRQNISVQLFSSLKKQGIDEANRTVGSWFDAADAAASSPKENLPQLYGNRISPT"
FT   CDS_pept        403285..403908
FT                   /transl_table=11
FT                   /gene="cyc"
FT                   /locus_tag="NMO_0373"
FT                   /product="cytochrome C"
FT                   /function="Cytochrome c553"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04101"
FT                   /db_xref="GOA:C6S5B7"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5B7"
FT                   /protein_id="CBA04101.1"
FT                   /translation="MKRLTLLAFVLAAGAVSASPKADVEKGKQVAATVCAACHAADGNS
FT                   GIAMYPRLAAQHTAYIYHQTIGIRDGKRTHGSAAVMKPVVMNLSDQDILNVSVFYAKQQ
FT                   PKSGEANPKENPELGAKIYRGGLSDKKVPACMSCHGPSGAGMPGGGSEIQAYPRLGGQH
FT                   QAYIVEQMNAYKSGQRKNTIMEDIANRMSEEDLKAVANFIQGLR"
FT   CDS_pept        404122..406137
FT                   /transl_table=11
FT                   /locus_tag="NMO_0374"
FT                   /product="cytochrome c-type biogenesis protein, putative"
FT                   /function="ResB protein required for cytochrome c
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04104"
FT                   /db_xref="GOA:C6S5B8"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5B8"
FT                   /protein_id="CBA04104.1"
FT                   /translation="MSKSRRSPPLLSRPWFAFFSSMRFAVALLSLLGIASVIGTVLQQN
FT                   QPQTDYLVKFGSFWAQIFGFLGLYDVYASAWFVVIMMFLVVSTSLCLIRNVPPFWREMK
FT                   SFREKVKEKSLAAMRHSSLLDVKIAPEVAKRYLEVQGFQGKTINREDGSVLIAAKKGTM
FT                   NKWGYIFAHVALIVICLGGLIDSNLLLKLGMLTGRIVPDNQAVYAKDFKPESILGASNL
FT                   SFRGNVNISEGQSADVVFLNADNGILVQDLPFEVKLKKFHIDFYNTGMPRDFASDIEVT
FT                   DKATGEKLERTIRVNHPLTLHGITIYQASFADGGSDLTFKAWNLGDASREPVVLKATSI
FT                   HQFPLEIGKHKYRLEFDQFTSMNVEDMSEGAEREKSLKSTLNDVRAVTQEGKKYTNIGP
FT                   SIVYRIRDAAGQAVEYKNYMLPVLQEQDYFWITGTRSGLQQQYRWLRIPLDKQLKADTF
FT                   MALREFLKDGEGRKRLVADATKGAPAEIREQFMLAAENTLNIFAQKGYLGLDEFITSNI
FT                   PKEQQDKMQGYFYEMLYGVMNAALDETIRRYGLPEWQQDEARNRFLLHSMDAYTGLTEY
FT                   PAPMLLQLDGFSEVRSSGLQMTRSPGALLVYLGSVLLVLGTVLMFYVREKRAWVLFSDG
FT                   KIRFAMSSARSERDLQKEFPKHVESLQRLGKDLNHD"
FT   CDS_pept        406130..407317
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="NMO_0375"
FT                   /product="putative cytochrome c asssembly protein"
FT                   /function="ABC-type transport system involved in cytochrome
FT                   c biogenesis permease component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04107"
FT                   /db_xref="GOA:C6S5B9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5B9"
FT                   /protein_id="CBA04107.1"
FT                   /translation="MTEHYKTLPEHELLIQKSLISNLNLWDWVFAVLVFAATVFVQTRS
FT                   GMHMDIYETVMLWASAGIAVFLGWFFKPMRWFVPLSVLLAYAAVGLYGGNIKSAEIFLL
FT                   RYFLSSQSAIMWQCAFVFFALFAYISGAVLASVKNVPTNTLLGMGTVFAWVSAVAGFTG
FT                   LLVRWHESYLLRPDAGHIPVSNLYEVFILFLVITALMYLYYEGKFAIQKLGGFVFGFMA
FT                   VVVGFVLWYSVSREAHTIQPLIPALQSWWMKIHVPANFIGYGAFCISAMLGIAELVSLR
FT                   AEGKGGKLWLPPSALIDEVMYKAIAVGFLFFTIATILGALWAADAWGRYWSWDPKETWA
FT                   FIVWLNYAVWLHLRLVAGWRGKVLAWWAIIGLFVTAFAFIGVNMFLSGLHSYGTL"
FT   CDS_pept        407434..408498
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="NMO_0376"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /function="Metal-dependent proteases with possible
FT                   chaperone activity"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04110"
FT                   /db_xref="GOA:C6S5C0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5C0"
FT                   /protein_id="CBA04110.1"
FT                   /translation="MLVLGIESSCDETGVALYDTERGLRAHCLHTQMAMHAEYGGVVPE
FT                   LASRDHIRRLVPLTEGCLAQAGVSYGDIDAVAFTQGPGLGGALLAGSSYANALALALGK
FT                   PIIPVHHLEGHLLSPLLAEEKPDFPFVALLVSGGHTQIMAVRGIGDYALLGESVDDAAG
FT                   EAFDKTAKLLGLPYPGGAKLSELAESGRPEAFVFPRPMIHSDDLQMSFSGLKTAVLTAV
FT                   EKVRAENGADDIPEQTRNDICRAFQDAVVDVLAAKVKKALLQTGFRTVVVAGGVGANRK
FT                   LRETFGNMTVQIPTPKGKPKHPSEKVSVFFPPTAYCTDNGAMIAFAGAMHLGKGREVGA
FT                   FNVRPRWPLSEIVR"
FT   CDS_pept        complement(408542..409438)
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="NMO_0377"
FT                   /product="putative acyltransferase"
FT                   /function="Lauroyl/myristoyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04113"
FT                   /db_xref="GOA:C6S5C1"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5C1"
FT                   /protein_id="CBA04113.1"
FT                   /translation="MFRLQFGLFPPLRTAMHILLTALLKCLSLLPLSCLHTLGNRLGHL
FT                   AFYLLKEDRARIVANMRQAGMNPDPKTVKAVFAETAKGGLELAPAFFRKPEDIETMFKA
FT                   VHGWEHVQQALDKHEGLLFITPHIGSYDLGGRYISQQLPFPLTAMYKPPKIKAIDKIMQ
FT                   AGRVRGKGKSAPTSIQGVKQIIKALRSGEATIVLPDHVPSPQEGGEGVWVDFFGKPAYT
FT                   MTLAAKLANVKGVKTLFFCCERLPDGQGFDLHIRPVQGELNGDKAHDAAVFNRNAEYWI
FT                   RRFPTQYLFMYNRYKMP"
FT   CDS_pept        409784..410953
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="NMO_0378"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04116"
FT                   /db_xref="GOA:C6S5C2"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5C2"
FT                   /protein_id="CBA04116.1"
FT                   /translation="MSEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETL
FT                   VNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIA
FT                   QGVNEGEGIDLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWL
FT                   RPDAKAQLTVVYDSESGKVKRIDTVVLSTQHDPEIGYEELKNAVIEQIIKPVLPSELLT
FT                   DETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAY
FT                   ACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVREHFDL
FT                   RPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAAALRAAAGL"
FT   mobile_element  411202..411844
FT                   /mobile_element_type="other:ISHpa1"
FT                   /locus_tag="NMO_0379"
FT   CDS_pept        complement(411920..413446)
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="NMO_0380"
FT                   /product="probable D-alanyl-D-alanine carboxypeptidase"
FT                   /function="D-alanyl-D-alanine carboxypeptidase (penicillin-
FT                   binding protein 4)"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04118"
FT                   /db_xref="GOA:C6S5C3"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5C3"
FT                   /protein_id="CBA04118.1"
FT                   /translation="MIAIIIYVISPANKPARRHSVPTYPALPYNCFFYVTDLPMNFPKT
FT                   AASLLLLLASLAAHALDTGRIPQNEIAVYVQELDSGKVIIDHRSDVPVNPASTMKLVTA
FT                   FAAFKTFGSNYRWATEFKSNGTVNDGTLDGNLYWAGSGDPVFNQENLLAVQRQLREQGI
FT                   RNITGHLMLDHSLWGEVGSPDDFEADSGSPFMTPPNPTMLSAGMVMVRAERNAADSTDI
FT                   LTDPPLPHIFAQNNLKITASQAACPSIKKLMRASFSDNTLKLRGNIPESCLGKPVGVRM
FT                   FALDELIRQSFTNHWLLGGGRISDGIGIADTPEGAQTLAVAHSKPMKEILTDMNKRSDN
FT                   LIARSVFLKLGGNGKLPAVSEQAASAVRRELAVSGIDVADLVLENGSGLSRKERVTARM
FT                   MAQMLETAYFSPFAQDFIDTLPIAGTDGTLRNRFKQSGGLLRLKTGTLNNVRALAGYWL
FT                   GDKPMAVVVIINSGRAVSLLPDLDNFVANNIISGGDGWLDAKLMCKERRA"
FT   CDS_pept        413494..414060
FT                   /transl_table=11
FT                   /locus_tag="NMO_0381"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /function="Predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04121"
FT                   /db_xref="GOA:C6S5C4"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5C4"
FT                   /protein_id="CBA04121.1"
FT                   /translation="MAKKISILVGSLRRASFARKVALNAAEMFPEGWQAEIVEIGHLPL
FT                   YNFDYDDPAVEDVPLPESYTVFRETIKASDGILFVTSENNRTIPACLKNAVDIGSKPNA
FT                   DVAWKNKPAGIISHSVGKMGGYSSQKNLRLALSYFDMPVTGQPEVFLGNSPTLFDENGK
FT                   LIDSARDFVQSYINQFVGLIERNAK"
FT   CDS_pept        414629..415942
FT                   /transl_table=11
FT                   /gene="citM"
FT                   /locus_tag="NMO_0382"
FT                   /product="putative transporter protein"
FT                   /function="H+/citrate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04124"
FT                   /db_xref="GOA:C6S5C5"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5C5"
FT                   /protein_id="CBA04124.1"
FT                   /translation="MLTFIGLLIIGVIVWLLLTEKVSPIIALILVPLFGALLAGFDVSQ
FT                   LKEFYSGGTKSVMQIVIMFMFSILFFGIMNDVGLFRPMIGGLIKLTRGNIVAVSVGTVL
FT                   VSVVAQLDGAGATTFLLVVPALLPLYKRLHMNPYLLFLLLTSSAGLINLLPWGGPTGRV
FT                   ASVLGADVGELYKPLLTVQIIGVVFILALSLLLGVREKRRIVRELGALPAVADLIKPVP
FT                   LSEEEQKLARPKLFWWNVLLFLAAMSLLFSGIFPPGYVFMLAATAALLLNYRSPQEQME
FT                   RIYAHAGGAVMMASIILAAGTFLGILKGAGMLDAISKDLVHILPDALLPYLHIAIGVLG
FT                   IPLELVLSTDAYYFGLFPIVEQITSQAGVAPEAAGYAMLIGSIVGTFVTPLSPALWMGL
FT                   GLAKLSMGKHIRYSFFWAWGLSLAILASSIAAGIVPLP"
FT   CDS_pept        416165..416296
FT                   /transl_table=11
FT                   /locus_tag="NMO_0383"
FT                   /product="putative response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04127"
FT                   /db_xref="GOA:C6S5C6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5C6"
FT                   /protein_id="CBA04127.1"
FT                   /translation="MRVLLVEDDAMIAEAVSASLKDGGYAVDWVKNGARLPLPSLMT"
FT   CDS_pept        416336..417586
FT                   /transl_table=11
FT                   /locus_tag="NMO_0384"
FT                   /product="putative two-component system histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04130"
FT                   /db_xref="GOA:C6S5C7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5C7"
FT                   /protein_id="CBA04130.1"
FT                   /translation="MFVPLAMLAGMFSYYETFHETEALQDDLLRQAALYVAPDSKPETL
FT                   PEGDGDTRILVQMPQQEDPVVSLPAHLADGLHTLQADGDDDYYRVYIRTTEQGRIAVMQ
FT                   ENEYREDLAADAARQSVLPLLAALPLMILLTVWITHKAMRPVRKLSQSLEQRRINDLSA
FT                   LSVDNIPSEIRGFVTAINLLLKRADEDIRHRQRFVADAAHELRTPMTALSLQAERLNNM
FT                   SLPPDAARQPAVLQQSIRRNKHLLEQLLALARSQSDETPLTKTTFGLQSRFRQVLQELM
FT                   PLALEKRQDIGVAVRGDVEVSADETEIYTLIKTFADNAVRYTPPEGRIDLGFTDEGKYL
FT                   AVWVEDNGNGIPESERARVLDPFYRILGMEQQGTGLGLSIADTLATEYGRYLELSDSRR
FT                   FGRGLLIRALLDKESLK"
FT   CDS_pept        complement(417620..419113)
FT                   /transl_table=11
FT                   /gene="cafA"
FT                   /locus_tag="NMO_0385"
FT                   /product="ribonuclease G"
FT                   /function="Ribonucleases G and E"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04134"
FT                   /db_xref="GOA:C6S5C8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5C8"
FT                   /protein_id="CBA04134.1"
FT                   /translation="MLSGLPIPKDIARPPETILVNITPQETRVAVLEENNICELHIERN
FT                   SEHSLVGNIYLGVVRRVLPGMQSAFIDIGLERAAFLHIVDVLEQRRNPEETQRIEHMLF
FT                   EGQSVLVQVIKDPINTKGARLSTQISLAGRFLVHLPQEDHIGVSQRIEDDAERSSLRER
FT                   LDKLLPENACRGYIIRTNAENATDEQLQSDIDYLTKVWEHIQEQAKIRPPETLLYQDLP
FT                   LSLRVLRDMVGCDTQKILVDSTVNHGRMTRFAEQYVHGALGRIELFKGERPLFETHNVE
FT                   QEISRALQPRVNLNFGSYLIIESTEAMTTIDVNTGGFVGARNFDETIFRTNLEACHTIA
FT                   RELRLRNLGGIIIIDFIDMAQESHREAVLQELAKALAFDRTRVTLHGFTSLGLVELTRK
FT                   RSRENLNQVLCEPCPSCQGRGRLKTPQTVCYEIQREIVREARRYDAESFRILAAPNVID
FT                   LFLDEESQSLAMLIDFIGKPISLAVETAYTQEQYDIVLM"
FT   CDS_pept        419326..419583
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="NMO_0386"
FT                   /product="glutaredoxin"
FT                   /function="Glutaredoxin and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04137"
FT                   /db_xref="GOA:C6S5C9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5C9"
FT                   /protein_id="CBA04137.1"
FT                   /translation="MQTVTMYTGPFCPYCAMAKRLLHAAGVGHIDEIRVDASPEAFAEM
FT                   QQLSGQRSVPQIFIGETHVGGFTDLYRLQQEGGLDGLLNP"
FT   CDS_pept        419604..420047
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="NMO_0387"
FT                   /product="protein-export protein"
FT                   /function="Preprotein translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04140"
FT                   /db_xref="GOA:C6S5D0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5D0"
FT                   /protein_id="CBA04140.1"
FT                   /translation="MSEELQPVFSIERLYVKDLSLEVPHAPQIFLEQGEPEVDMRVSTG
FT                   SQKLEDGYYNVDVTVTVTAKLDNERTMFLNEVTQSGIFRLENIPEEDVQLLLGVACPNI
FT                   LFPYAREAVSSTVTRAGFPPVLLAPINFEAIYQQQQEAEAAGA"
FT   CDS_pept        420133..422175
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="NMO_0388"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="RecG-like helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04143"
FT                   /db_xref="GOA:C6S5D1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5D1"
FT                   /protein_id="CBA04143.1"
FT                   /translation="MMSPETRKQLKITDVSAKKLEKLNLHTAWDLVLHLPLRYEDETHI
FT                   MPIKDAPIGVPCQVEGEVIHQEVTFKPRKQLIVQIADGSGSVLFLRFIHFYASHQKQTA
FT                   IGKRIRAVGEIKHGFYGDEMIHPKIRDAEGGGLAESLTPVYPTVNGLNQPTLRRIIQTA
FT                   LDVTPLHDTLPDALLCRLKLPHLAESLRLLHSPPPSFTIHQLSDGTLPSWQRLKFDELL
FT                   AQQLSMRLARQKRIGGSATALSGDGTLTQALRHALPFALTDAQKKVVSEICRDMAQTYP
FT                   MHRLLQGDVGSGKTIVAALSALTAIESGAQVAVMAPTEILAEQHFIKFKQWLEPLGLEV
FT                   VWLSGSQRKKAKDEAKAKLADGSVKIAVGTHALFSDGVAFHNLGLSIVDEQHRFGVAQR
FT                   LALKNKGCDVHQLMMSATPIPRTLAMSFFADLDVSVIDELPPGRTPIKTRLVNNVRRAE
FT                   VEGFVLNICRKGQQAYWVCPLIEESETLQLQTAAETLARLQTALPELNIGLVHGRMKAA
FT                   EKAEVMARFSSGGLNVLVATTVIEVGVDVPNAALMVIEHAERMGLAQLHQLRGRVGRGA
FT                   AESVCVLLFAEPLGELAKARLKVIYEHTDGFEIARQDLNIRGPGEFLGARQSGVPMLRF
FT                   AKLEEDLHLLEQARETAPMLIEQNPEIVEAHLARWLSGREGYLGV"
FT   CDS_pept        complement(423287..424330)
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="NMO_0389"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /function="Acetylglutamate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04146"
FT                   /db_xref="GOA:C6S5D2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5D2"
FT                   /protein_id="CBA04146.1"
FT                   /translation="MSKKIKVGIVGATGYTGVELLRLLAAHPDVEVAAVTSRSEAGTAV
FT                   ADYFPSLRGVYGLAFQTPDEAGLEQCDIVFFATPNGIAMKDAPRLIEQGVRVIDLSADF
FT                   RIRDIPTWEHWYGMTHAAPDLVSQAVYGLSELNREAVAQARLVANPGCYPTCVSLPLVP
FT                   LLRQCRLKPGMPLIADCKSGVSGAGRKGNVGSLLCEAGDNFKAYGIAGHRHLPEIRQTI
FT                   AGLQDGIAEGFVFTPHLAPMIRGMHATVYLHLSNGICPETVLRDYYRDSLFVDILPAGS
FT                   TPETRSVRGANLCRISIQQAAQSDVWVVLSVIDNLVKGAAGQAVQNMNIMFGLKETHGL
FT                   DAIPLLP"
FT   CDS_pept        complement(424327..424608)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0390"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04149"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5D3"
FT                   /protein_id="CBA04149.1"
FT                   /translation="MKTLVLLLLSFSTTTAFAAYGLGLGQAPKYPAGFRAYGYVYSGRQ
FT                   GWVLKTEADAIKLDTLFKRFVYRPSAANQNPVGQRSDGIPANHTKEKP"
FT   CDS_pept        424790..425599
FT                   /transl_table=11
FT                   /locus_tag="NMO_0391"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04152"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5D4"
FT                   /protein_id="CBA04152.1"
FT                   /translation="MPRLAGAHTIVSGYLAFGSDESYKNHWDIRDVYAIQLFGKKRWQL
FT                   TAPDFPMPLYMQQTKDTDISIPEHIDMDIILEAGDVLYIPRGWWHRPIPLGCETFHLAV
FT                   GTFPPNGYNYLEWLMKKFPTIESLRHSFSDWEQDRTRINDTAAQIAAMIADPVNYEAFS
FT                   EDFLGKERTDTAFHLEQFANPNATLLSDDVRLRLNANNLDTLEKGYLIGNGMKISVDEL
FT                   GKKVLEHIGKNEPLLLKNLLVNFNQGKHEEVRKLIYQLIELDFLELL"
FT   CDS_pept        425608..425835
FT                   /transl_table=11
FT                   /locus_tag="NMO_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04155"
FT                   /db_xref="GOA:C6S5D5"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5D5"
FT                   /protein_id="CBA04155.1"
FT                   /translation="MKNWKQFTFFVILVIACYQLLYFLSDMFLLDYINKYSWNLNFIQG
FT                   TLNFFSIYLPYVFVSRIFRNTNQEKEYKND"
FT   CDS_pept        425774..426181
FT                   /transl_table=11
FT                   /locus_tag="NMO_0393"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04158"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5D6"
FT                   /protein_id="CBA04158.1"
FT                   /translation="MFLLAEFLGILTKKRSIKMIELQLHELKLVSGGGPVTDNIAGNVA
FT                   NVATTKGGPTWGDLVAIPAAAAAVYYLPKNAYGAAGANGVYNVTRNWVNDAVNAPPYNG
FT                   RPIFEIEHGLTAPATKADKSGNGYTDGTDYC"
FT   CDS_pept        426242..427020
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0394"
FT   CDS_pept        427334..427636
FT                   /transl_table=11
FT                   /locus_tag="NMO_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04162"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5D7"
FT                   /protein_id="CBA04162.1"
FT                   /translation="MTWVGGSGNAQQSSYYCEICESAGLNDTGNPDKSLGLPNNTFSNP
FT                   PGWGATIGALAGSRIGMPEFGTFASHAIENFDWSWYRRYREIAETIEREYSGGLP"
FT   CDS_pept        427651..427821
FT                   /transl_table=11
FT                   /locus_tag="NMO_0396"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04164"
FT                   /db_xref="GOA:C6S5D8"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5D8"
FT                   /protein_id="CBA04164.1"
FT                   /translation="MMFAKHYQFIALGIMLLLYMLILYTTDFSNLTYWMLFFICFITGK
FT                   ILARLLEKSFK"
FT   CDS_pept        428220..429962
FT                   /transl_table=11
FT                   /gene="fhaC"
FT                   /locus_tag="NMO_0397"
FT                   /product="hemolysin activation protein"
FT                   /function="Hemolysin activation/secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04168"
FT                   /db_xref="GOA:C6S5D9"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5D9"
FT                   /protein_id="CBA04168.1"
FT                   /translation="MKFFPAPCLLVILAVIPLKTLAADENDAELIRSMQRQQHIDAELL
FT                   TDANVRFEQPLEKNNYVLSEDETPCTRVNYISLDDKTARKFSFLPSVLMKETAFKTGMC
FT                   LGSNNLSRLQKAAQQILIVRGYLTSQAIIQPQNMDSGILKLRVSAGEIGDIRYEEKRDG
FT                   KSAEGSISAFNNKFPLYRNKILNLRDVEQGLENLRRLSSVKTDIQIIPSEEEGKSDLQI
FT                   KWQQNKPIRFSIGIDDAGGKTTGKYQGNVALSFDNPLGLSDLFYVSYGRGLVHKTDLTD
FT                   ATGTETESGSRSYSVHYSVPVKKWLFSFNHNGHRYHEATEGYSVNYDYNGKQYQSSLAA
FT                   ERMLWRNRLHKTSVGMKLWTRQTYKYIDDAEIEVQRRRSAGWEAELRHRAYLNRWQLDG
FT                   KLSYKRGTGMRQSMPAPEENGGGTIPGTSRMKIITAGLDAAAPFMLGKQQFSYETAIHA
FT                   QWNKTPLVAQDKLSIGSRYTVRGFDGEQSLSGERGFYWQNTLGWHFHPRHQFYLGADYG
FT                   RVSGESAQYVSGKQLMGAVVGFRGGHKVGGMFAYDLFAGKPLHKPKGFQTTNTVYGFNL
FT                   NYSF"
FT   CDS_pept        430071..436022
FT                   /transl_table=11
FT                   /gene="fhaB"
FT                   /locus_tag="NMO_0398"
FT                   /product="hemagglutinin/hemolysin-related protein"
FT                   /function="Large exoproteins involved in heme utilization
FT                   or adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04170"
FT                   /db_xref="InterPro:IPR006914"
FT                   /db_xref="InterPro:IPR006915"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5E0"
FT                   /protein_id="CBA04170.1"
FT                   /translation="MNKGLHRIIFSKKHSTMVAVAETANSQGKGKQAGSSVSVSLKTSG
FT                   DLCGKLKTTLKTLVCSLVSLSMVLPAHAQITTDKSAPKNQQVVILKTNTGAPLVNIQTP
FT                   NGRGLSHNRYTQFDVDNKGAVLNNDRNNNPFLVKGGAQLILNEVRGTASKLNGIVTVGG
FT                   QKADVIIANPNGITVNGGGFKNVGRGILTTGAPQIGKDGALTGFDVRQGTLTVGAAGWN
FT                   DKGGADYTEILARAVALQGKLQGKNLAVSTGPQKVDYASGEISAGTAAGTKPTIALDTA
FT                   ALGGMYADSITLIANEKGVGVKNAGTLEAAKQLIVTSSGRIENSGRIATTADSTEASPT
FT                   YLSIETTETGAAGAFISNGGRIESKGLLVIETGEDISLRNGAVVQNNGSRPATTVLNAG
FT                   HNLVIESKTNVNNAKGPATLSAGGRTTINDATIQAGSSVYSSTKGDTELGENTRIIAEN
FT                   VTVLSNGSISSAAVIEAQDTAHIESGKPLSLETSTVASNIRLNNGNIKGGKQVVLMADG
FT                   DIQAKASNLNASGNLYIHAGKDLDLNADKDLSTQSISLRADNTALISSNGNTLTAEKNL
FT                   DIQAGSLSVRQSNLQSSGGNVQMSATKGNISLNQSWINASQNIDTAALQGNIISDGLTA
FT                   VAEVGRVSLLANGNVDFNGLNTLIAEGDINAGSVGKGRLKMDNTDIYASAGDVKLVAGG
FT                   QLDLGNGTVNGGHISLDSNKGSMVVQNVHLNARASLKVDADQTLTINNSKLNSGHNTQI
FT                   NTNHGHMTLNQLDAHSHRHMSISAQGKGKGKDSGQILQNDQQNSKSTLAADGVLSLNSS
FT                   ALQVLDNTTLRGGAINIKAGGGIIKRGHIDWETQDTATMRSAELKPLSGMMSIESGGNN
FT                   PLTVEPGNRIVSAGDLAVKHNGTFQISARAGNNGNPSAQTASVSAKGNIGIVAGEVDID
FT                   AANIAAGKDLALVATKGNISLNSIRNTFSNYQLKTDKHNITQQLTDVEQELSKLTSDPK
FT                   YRKAQDLPQMLRRKYKRRDKVFGDSEARLRGLRAEINAADEAWAELQSPVKALLERKQL
FT                   LQQALLTVSQPGSGHENQGSTLSGQNIKLLAAGGIRIQGSKVAATQQANIQAAGFLPAP
FT                   AAEELQEGRLQSAIDISGVFDTFEYGQQGSDKYGYAIFSRPSEISGKTGVTLSAPNANE
FT                   NSRISLSAANIEAENGKIKIQSYGDQYYYARQSELYTFERRSYKTGKWYNRKHITEVKE
FT                   HKNAKPDAVNLSASQGIDIKSGGSIDAYATAFDAPKGSINIEAGRKLTLYAVEELNYDK
FT                   LDSQKRRRFLGISYSKAHDTTTQVMKTALPSRVVAESANLQSGWDTKLQGTQFETTLGG
FT                   ATIRAGVGEQARADAKIILEGIKTTIHNETVSSSKSALWQKQAGRGSNIETLQLPSFTG
FT                   PVAPVLSAPGGYIVDIPKGNLKTQIETLTKQPEYAYLKQLQVAKNINWNQVQLAYDKWD
FT                   YKQEGLTEAGAAIIALAVTVVTSGAGTGAVLGLNGAAAAATDAAFASLASQASVSFINN
FT                   KGDVGKTLKELGRSSTVKNLVVAAATAGVADKIGASALNNVSDKQWINNLTVNLANAGS
FT                   AALINTAVNGGSLKDNLEANILAALVNTAHGEAASKIKQLDQHYIAHKIAHAVAGCAAA
FT                   AANKGKCQDGAIGAAVGEIVGEALVKNTDFSRMSATEIEKAKAKITAYSKLAAGTATAV
FT                   AGGDVNAAANAAQIAVENNTLYPKCIGAKCDEFQKEQQKWIRENPEEYREVLLLQTGFI
FT                   PIIGDIQSFVQAQTAADHLFALLGVVPGIGESIQAYKVAKAAKNLQGMKKALDKAATVA
FT                   TAQGYVSKTKIKIGQTELRVTAATDKQLLKAIGEGRDTTGKMTEQLFDSLAKQNGFRVL
FT                   SGGKYGGNNGFDHVWQAADGSVVLIVESKQIRNGTVQLNPNGAGGYTQMSEDWIKQVAN
FT                   SLPDGSPAKAAVFKAEREGKLKTAIAGVDRQTGKAVILSVKVPSKTNIRR"
FT   CDS_pept        436025..436960
FT                   /transl_table=11
FT                   /locus_tag="NMO_0399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04173"
FT                   /db_xref="InterPro:IPR029074"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5E1"
FT                   /protein_id="CBA04173.1"
FT                   /translation="MGHNMMTTQKWYEHITNVIIGNTANFNSGCPEAIDYVDERKGVPL
FT                   AAMRHILMYTEAAASHAYLFEHDLNKFKQYAYVAGKLGILRSVNSTDPEPFFFPCDMLN
FT                   IQDPMFLMLMSDSPQLREFLVRNIDNIANDTEAFVNRYDLNRHMIYNTLLMVEGKQLDR
FT                   LKQRSEKVLVHPTPSKWLQKRLYDYRFFLAFAEQDAEAMKAALEPLFDKKTARMAAKET
FT                   LSYFDFYLQPQIVTYAKIASMHGFDLGIDHEIAPRDLIVYDPLPADEYQDIFDFMKQYD
FT                   LSYPYEYLQDWIDYYTFKTDKLVFGNAKRE"
FT   CDS_pept        437349..437699
FT                   /transl_table=11
FT                   /locus_tag="NMO_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04176"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5E2"
FT                   /protein_id="CBA04176.1"
FT                   /translation="MALRTHFVISNVPSTPNLLRGRQLEGKLILEVPAQVNPIPQSVLR
FT                   AAQEENVIIRDTTGRIYNRWWFSIRWLCRCTSCKKRIIDTNRENRGRCVSNCKCKHWIS
FT                   MDCQFVRAKRRS"
FT   CDS_pept        437706..437885
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_PS75"
FT   CDS_pept        438266..438724
FT                   /transl_table=11
FT                   /locus_tag="NMO_0402"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04181"
FT                   /db_xref="GOA:C6S5E3"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5E3"
FT                   /protein_id="CBA04181.1"
FT                   /translation="MLTKLKILLFLFLFVFVLAINLLFFFFSSDIESFGNYQFEYVYDK
FT                   GWPANYILVMKDGNEGNFDKIISGLVLEYYKEDDNIYFSYIDGQGFASDSCYYKPEILY
FT                   GKIILNKNHIININSMEKNNFLSEDKIMKGTRNWLADPKNKCNIQTLD"
FT   mobile_element  438732..438857
FT                   /mobile_element_type="other:IS1016C"
FT                   /locus_tag="NMO_0403"
FT   CDS_pept        438936..439217
FT                   /transl_table=11
FT                   /locus_tag="NMO_0404"
FT                   /product="ABC transporter related"
FT                   /function="ABC-type bacteriocin/lantibiotic exporters
FT                   contain an N-terminal double-glycine peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04184"
FT                   /db_xref="GOA:C6S5E4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5E4"
FT                   /protein_id="CBA04184.1"
FT                   /translation="MIHEEISAMPMGYETLIGDMGSALSGGQKQRIVLARALYCEPKIL
FT                   FLDAATSHLDIANEKAVNANLNGLSIIKIMAAHRKETVESADRKMSLG"
FT   CDS_pept        complement(439238..440494)
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="NMO_0405"
FT                   /product="putative ribonuclease BN"
FT                   /function="Predicted membrane protein"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04187"
FT                   /db_xref="GOA:C6S5E5"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5E5"
FT                   /protein_id="CBA04187.1"
FT                   /translation="MPNLLTGQEIMTFLQRLQGLADNKICAFAWFVVRRFDEERVPQAA
FT                   ASMTFTTLLALVPVLTVMVAVASIFPVFDRWSDSFVSFVNQTIVPQGADMVFDYINAFR
FT                   EQANRLTAIGSVMLVVTSLMLIRTIDNTFNRIWRVNSQRPWMMQFLVYWALLTFGPLSL
FT                   GVGISFMVGSVQDAALASGAPQWSGALRTAATLTFMTLLLWGLYRFVPNRFVPARQAFV
FT                   GALATAFCLETARSLFTWYMGNFDGYRSIYGAFAAVPFFLLWLNLLWTLVLGGAVLTSS
FT                   LSYWQGEAFRRGFDSRGRFDDVLKILLLLDAAQKEGKALPVQEFRRHINMGYDELGELL
FT                   EKLARYGYIYSGRQGWVLKTGADSIELSELFKLFVYRPLPVERDHVNQAVDAVMMPCLQ
FT                   TLNMTLAEFDAQAKKQQQS"
FT   CDS_pept        complement(440479..441034)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0406"
FT   CDS_pept        441009..441668
FT                   /transl_table=11
FT                   /locus_tag="NMO_0407"
FT                   /product="putative aluminum resistance protein"
FT                   /function="Predicted PP-loop superfamily ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04189"
FT                   /db_xref="GOA:C6S5E6"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5E6"
FT                   /protein_id="CBA04189.1"
FT                   /translation="MSNQKALVIFSGGQDSTTCLIQAIQIYGRENVQAITFQYGQRHAV
FT                   ELERASWIAQDLGVKQTVLDLSLMRQITHNALMDDTAAIETAENGVPNTFVDGRNALFL
FT                   LYAAIYAKGQGIRHIIAGVCETDFSGYPDCRDVFVKSMNVTLNLAMDYDFQIHTPLMYL
FT                   TKAQTWALADEMGVLDYIREQTHTCYNGIVGGCRECPSCILRERGLAEYLESKKAV"
FT   CDS_pept        441696..442214
FT                   /transl_table=11
FT                   /locus_tag="NMO_0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04194"
FT                   /db_xref="InterPro:IPR011440"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5E7"
FT                   /protein_id="CBA04194.1"
FT                   /translation="MPKLHMFYLGGNAGRSNIEVHDIQFAVCDDYREAVPALKAAWFGD
FT                   ADKIHIDGWQIVEWADGYDIAVSETPKTKMPSEHAPRLYFANVGGYRAGQLAEAHAFGL
FT                   FAAATPAEAKQKALQTLLTDSYVQQHKDNLKDVDNLLALDRIGNFHIRLTPNPHGKPAE
FT                   IGFQGYLPI"
FT   CDS_pept        442221..442643
FT                   /transl_table=11
FT                   /locus_tag="NMO_0409"
FT                   /product="6-pyruvoyl-tetrahydropterin synthase"
FT                   /EC_number="4.2.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04197"
FT                   /db_xref="GOA:C6S5E8"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5E8"
FT                   /protein_id="CBA04197.1"
FT                   /translation="MKITKIFTFDSSHMLDGHDGKCQNLHGHTYKLEITVSDGIIKGGA
FT                   KDGMVMDFTDLKAIVKQHITDPFDHAFIYHGGNSRECQIAALLEGWNMKTLRLPCRTTA
FT                   ENMAVEMYGRLKNAGLNVCRVKLWETPTSCAEYEGE"
FT   CDS_pept        442912..443283
FT                   /transl_table=11
FT                   /locus_tag="NMO_0410"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04199"
FT                   /db_xref="GOA:C6S5E9"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5E9"
FT                   /protein_id="CBA04199.1"
FT                   /translation="MKLLFILLVLFVAVEHFYIAWLEMTQIPSEKAAETFKLPYEFMEQ
FT                   KRVQTLFSNQGLYNGFLGIGLVWSRFAAPDNAVYGATILFLGFVLIAAAWGAFSSGNKG
FT                   ILVKQGLPAFLAAAAVLAV"
FT   CDS_pept        443280..443918
FT                   /transl_table=11
FT                   /locus_tag="NMO_0411"
FT                   /product="conserved hypothetical protein"
FT                   /function="Organic radical activating enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04204"
FT                   /db_xref="GOA:C6S5F0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5F0"
FT                   /protein_id="CBA04204.1"
FT                   /translation="MKKINVAPENPQYRIVEIFESLQGEGWNTGMPAVFVRLGKCNLAC
FT                   GWCDTDYLTFGMMSLSDILGCLKTYAARNIIITGGEPTIQPHLDMLLDMLKAEGYFLCI
FT                   ETNGLNPAPPQIDYVATSPKACYAAKYEKSCIETADEVRIVADGDVVAFCENMERKIRA
FT                   HHYYLSPCEQNGAMNIYDTIRQIGILNSRPDAPVHWQLSVQTHKWAGIE"
FT   tRNA            complement(444439..444515)
FT                   /locus_tag="NMO_tRNA10"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:444479..444481,aa:Pro)"
FT   CDS_pept        complement(444596..445681)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0412"
FT                   /product="putative beta-hexosaminidase"
FT                   /function="Beta-glucosidase-related glycosidases"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04207"
FT                   /db_xref="GOA:C6S5F1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR022956"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5F1"
FT                   /protein_id="CBA04207.1"
FT                   /translation="MTVPHIPRGPVMADIAAFRLTGEEKQRLLDPAVGGIILFRRNFQN
FT                   IEQLKTLTAEIKALRTPELIIAVDHEGGRVQRFIEGFTRLPAMSTLGEIWDKDGASAAE
FT                   TAAGQVGRVLATELSACGIDLSFTPVLDLDWGNCPVIGNRSFHSNPEAVTRLALALQKG
FT                   LAKGGMKSCGKHFPGHGFVEGDSHLVLPEDGRSLDELEAADLIPFRIMSREGMAAVMPA
FT                   HVVYPQVDTKPAGFSEIWLKQILRRDIGFKGVIFSDDLTMEGACGAGGIKERARISFEA
FT                   GCDIVLVCNRPDLVDELREDFRIPDNPALAQRWQYMANTLGSAAAQAVIQTADFQAAQA
FT                   FVAGLASPQDTAGGVKVGEAF"
FT   CDS_pept        complement(445738..447429)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0413"
FT                   /product="conserved hypothetical protein"
FT                   /function="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04210"
FT                   /db_xref="GOA:C6S5F2"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5F2"
FT                   /protein_id="CBA04210.1"
FT                   /translation="MIKCPSIPINGHFTKISWLILNKYFLRQKIFPPILPTKPKPEADR
FT                   YAPIRTLNTPITMQLIDYSHSFFSVVPPFLALALAVITRRVLLSLGIGILVGVAFLVGG
FT                   NPVDGLTHLKDMVVGLAWSDGDWSLGKPKILVFLILLGIFTSLLTYSGSNQAFADWAKR
FT                   HIKNRRGAKMLTACLVFVTFIDDYFHSLAVGAIARPVTDKFKVSRAKLAYILDSTAAPM
FT                   CVLMPVSSWGASIIATLAGLLVTYKITEYTPMGTFVAMSLMNYYALFALIMVFVVAWFS
FT                   FDIGSMARFEQAALNETHDETAVSDGSRGRVYALIIPVLALIASTVSAMIYTGAQASET
FT                   FSILGAFENTDVNTSLVFGGTCGVLAVVLCTLGTIKTADYPKAVWQGAKSMFGAIAILI
FT                   LAWLISTVVGEMHTGDYLSTLVAGNIHPGFLPVILFLLASVMAFATGTSWGTFGIMLPI
FT                   AAAMAVKVDPALIIPCMSAVMAGAVCGDHCSPISDTTILSSTGARCNHIDHVTSQLPYA
FT                   LTVAAAAASGYLALGLTKSALLGFGTTGIVLAVLIFLLKDKKLANA"
FT   CDS_pept        complement(447460..448959)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0414"
FT                   /product="periplasmic serine protease"
FT                   /function="Trypsin-like serine proteases typically
FT                   periplasmic contain C-terminal PDZ domain"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04213"
FT                   /db_xref="GOA:C6S5F3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5F3"
FT                   /protein_id="CBA04213.1"
FT                   /translation="MFKKYQYLALAALCAASLAGCDKAGSFFGADKKEASFVERIEHTK
FT                   DDGSVSMLLPDFVQLVQSEGPAVVNIQAAPAPRTQNGSSNAETDSDPLADSDPFYEFFK
FT                   RLVPNMPEIPQEEADDGGLNFGSGFIISKDGYILTNTHVVTGMGSIKVLLNDKREYTAK
FT                   LIGSDVQSDVALLKIDATEELPVVKIGNPKDLKPGEWVAAIGAPFGFDNSVTAGIVSAK
FT                   GRSLPNESYTPFIQTDVAINPGNSGGPLFNLKGQVVGINSQIYSRSGGFMGISFAIPID
FT                   VAMNVAEQLKNTGKVQRGQLGVIIQEVSYGLAQSFGLDKAGGALIAKILPGSPAERAGL
FT                   RAGDIVLSLDGGEIRSSGDLPVMVGAITPGKEVSLGVWRKDEEITIKVKLGNAAEHIGA
FT                   SSKTDEAPYTEQQSGTFSVESAGITLQTHTDSSGGHLVVVRVSDAAERAGLRRGDEILA
FT                   VGQVPVNDEAGFRKAMDKAGKNVPLLIMRRGNTLFIALNLQ"
FT   CDS_pept        complement(449097..449726)
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="NMO_0415"
FT                   /product="endonuclease III"
FT                   /function="Predicted EndoIII-related endonuclease"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04215"
FT                   /db_xref="GOA:C6S5F4"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5F4"
FT                   /protein_id="CBA04215.1"
FT                   /translation="MNRQIRQEIFERFRAANPHPTTELNFNSPFELLIAVLLSAQATDV
FT                   GVNKATAKLFPVADTPQAMLDLGLDGVMEYTKTIGLYKTKSKHIMQTCRILLEKYKGEV
FT                   PEDREALESLPGVGRKTANVVLNTAFGHPVMAVDTHIFRVSNRTKIAPGKDVREVEDKL
FT                   MRFIPKEFLMDAHHWLILHGRYTCKALKPQCQTCIINDLCEYPAKA"
FT   CDS_pept        complement(449772..450185)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0416"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04218"
FT                   /db_xref="GOA:C6S5F5"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5F5"
FT                   /protein_id="CBA04218.1"
FT                   /translation="MMPAYAYAALAFSAFTSATLLPGTSEAAFALFVHRFPEHAYGALL
FT                   CAGLANGLGSMVSYWMGRLLPSRKMPSEKTLNLMRRFGIWLLAFAWLPVVGDALPLAAG
FT                   WLRLNPWTSGLMLVIGKTARYAFILWGMQYYAA"
FT   CDS_pept        450718..451998
FT                   /transl_table=11
FT                   /locus_tag="NMO_0417"
FT                   /product="transmembrane hexose transporter"
FT                   /function="Fucose permease"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04221"
FT                   /db_xref="GOA:C6S5F6"
FT                   /db_xref="InterPro:IPR005964"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5F6"
FT                   /protein_id="CBA04221.1"
FT                   /translation="MSISIFLKRVIFRHHERQIMSAQSQNNHTSPLVVLTTLFFMMGFI
FT                   TCMNDILIPHLKEIFDLSYVQAMLIQFCFFTAYAVMSIPMGAFVGKVGYKNGVIGGFLL
FT                   TAVGCLLFYPAAGSHSYAVFLGALFILASGVTLLQVAGNPYVTLLAKPGKESATLTLVQ
FT                   AFNALGTTIAPQIGAFLILADATQTVSKAEQISSVQIPYLGLAGLLIILAVFVKMIRLP
FT                   DARKIAAEESAHNHDGKTSVWQYKHLVFGTAGIFCYVGAEVSIGSLMVNVLGYLKGLDH
FT                   ASAAHYLSFYWGGAMVGRFLGSAVMAKFAPNRYLAFNASAAVVLLAVAMATGSGNADVA
FT                   MWSLLAIGFFNSIMFPTIFSLATKGLGKFTNAASGVLCTAIVGGAVVPVVQGWVADTYT
FT                   LMSSFVVSVICYLYIVFFAVYGYRADK"
FT   CDS_pept        452289..453668
FT                   /transl_table=11
FT                   /gene="nhaC"
FT                   /locus_tag="NMO_0418"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /function="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04224"
FT                   /db_xref="GOA:C6S5F7"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5F7"
FT                   /protein_id="CBA04224.1"
FT                   /translation="MFAFKSLLDMPRGEALAVVVALIAAMGYTIISLEWLPHMSIIAAI
FT                   VVLILYGLARGLKYNDMQQGMIGALNQGMGAIYLFFFIGLMVSALMMSGAIPTLMYYGF
FT                   GLISPTYFYFSAFALCSVIGVSIGSSLTTCATVGVAFMGMAAAFHADMAMTAGAIVSGA
FT                   FFGDKMSPLSDTTGISASIVGIDLFEHIKNMMYTTIPAWLISAALMLWLLPNVAAYDMG
FT                   SVESFRSQLEATGLVHGYSLIPFALLVILALMRVNAVVAMLFTVMVAVAVTYLHSTPDL
FT                   RQLGAWFYGGYKLEGEAFKDVVKLISRGGLESMFFTQTIVILGMSLGGLLFALGAIPSL
FT                   LDAVRSFLTNAGRATFSVAMTSVGVNFLIGEQYLSILLSGETFKPVYDKLGLHSRNLSR
FT                   TLEDAGTVINPLVPWSVCGVFISHALGVPVWEYLPYAFFCYLSLALTLLFGWTGLTLSK
FT                   K"
FT   CDS_pept        complement(453797..454621)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0419"
FT                   /product="Putative Mg2+ and Co2+ transporter CorC"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04226"
FT                   /db_xref="GOA:C6S5F8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5F8"
FT                   /protein_id="CBA04226.1"
FT                   /translation="MDGTQSKPKFFERLISRLAGEPDSAEDVLTLLRQAHEQEVFDADT
FT                   LLRLEKVLDFSDLEVRDAMITRSRMNVLKENDSIERITAYVIDTAHSRFPVIGEDKDEV
FT                   LGILHAKDLLKYMFNPEQFHLKSVLRPAVFVPEGKSLTALLKEFREQRNHMAIVIDEYG
FT                   GTSGLVTFEDIIEQIVGEIEDEFDEDDSADNIHAVSSERWRIHAATEIEDINTFFGTEY
FT                   SSEEADTIGGLVIQELGHLPVRGEKVLIGGLQFTVARADNRRLHTLMATRVK"
FT   CDS_pept        complement(454623..455378)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0420"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04232"
FT                   /db_xref="GOA:C6S5G0"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5G0"
FT                   /protein_id="CBA04232.1"
FT                   /translation="MPKISTSQSGYRAFRRPWICFACHIASRLSRLAITSFFGFMFNTF
FT                   KEWKRRGVYHILNVSSDGTVRSMLYLRPQNTKPATMKRAKQYPFLTLQRQRFHLNFENA
FT                   SSAAGIPAERDFYRWAWSALKNEYRRADISLILLDEEEARAYNRDYRGKDYATNVLSFA
FT                   LNEGEILPCQVSEKLYGDLIICPQVVLKEAAEQGKTPERHFAHLTIHGTLHLMGYDHIE
FT                   DDEAEIMEAEEIRLMLAAGFPNPYQEDEY"
FT   CDS_pept        455257..456192
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="NMO_0421"
FT                   /product="Porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04229"
FT                   /db_xref="GOA:C6S5F9"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5F9"
FT                   /protein_id="CBA04229.1"
FT                   /translation="MNPKKLVIASRESLLAMWQAKHIQGRLKALYPDCEVEILGMTTRG
FT                   DQILDKTLSKVGGKGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANP
FT                   FDAFVSNQYARLEEMPKGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGE
FT                   YDAIILAAAGLQRLKLDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHD
FT                   TTHACVTAERALARALGGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVVLQADAQASAE
FT                   YADALGRAVAKKLADDGARELIGAVLNTEN"
FT   CDS_pept        complement(456596..457789)
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="NMO_0422"
FT                   /product="aspartate aminotransferase"
FT                   /function="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04235"
FT                   /db_xref="GOA:C6S5G1"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5G1"
FT                   /protein_id="CBA04235.1"
FT                   /translation="MFFKHIEAAPADPILGLGEAFKAETRPEKVNLGIGVYKDASGATP
FT                   LVKAVKEAEKRLLESETTKNYLTIDGVADYNAQTQILLFGKDHEIIASRRAKTAQSLGG
FT                   TGALRIAAEFAKRQLNAQTIWISNPTWPNHNAIAKAVGIQDKPYRYYDAAKHGLDWDGM
FT                   IEDLSQAQKGDIVLLHGCCHNPTGIDPTPEQWETLAKLSAEKGWLPLFDFAYQGFGNGL
FT                   EEDAYGLRVFLKHNTELLIASSYSKNFGMYNERVGAFTLVAEDEETAARAHSQVKTIIR
FT                   TLYSNPASHGANTIALVLKNDDLKAQWIAELDEMRGRIKAMRQKFVGLLKAKGASQNFD
FT                   FIIKQNGMFSFSGLTPEQVDRLKNEFAIYAVRSGRINVAGITDDNIDYLCESIVKVL"
FT   CDS_pept        complement(457871..458368)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04238"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5G2"
FT                   /protein_id="CBA04238.1"
FT                   /translation="MTALTLPEDIRQQEPSALLYTLVSAYLEHTAQTGDESLSCLSDDQ
FT                   HTLTAFCYLDSQVEEGGFVQLIASGYGEYIFRNPLADSLRRWKIKAVPKVLDKAKALYE
FT                   QHGETIETLADGGADIESLRKQFPDFEEWDGAYYEAAEQDLPLLAEHIQSNWETFAHIG
FT                   QA"
FT   CDS_pept        458484..458687
FT                   /transl_table=11
FT                   /locus_tag="NMO_0424"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04241"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5G3"
FT                   /protein_id="CBA04241.1"
FT                   /translation="MDNLNLQEISVLPENLPLYCSGPDNEQWNGHPRVFLPLCEGESGS
FT                   VACPYCGTRYRLDGKMPHHHYA"
FT   CDS_pept        complement(458856..460442)
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="NMO_0425"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04244"
FT                   /db_xref="GOA:C6S5G4"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5G4"
FT                   /protein_id="CBA04244.1"
FT                   /translation="MALFLSIFPIVLLIWLMVKKNSMPSYVALPITAVLIYAIKLFYFG
FT                   DAGMLLNATAASGLVKTLTPITVIFGAIMFNRMMETTGCIDVIRKWLATISPNPVAQLM
FT                   IIGWAFAFMIEGASGFGTPAAIAAPILMSLGFNPLKVAIFTLVMNSVPVSFGAVGTPTW
FT                   FGFAPLNLSAEDILAIGRQTGVMHFFAGFVIPVIGLGFIVPWSEIRKNLGFVAIAVFSC
FT                   TIPYVALAMVNEEFPSLVAGAIGLMVSVFAANQGWGLSKDHAKDPNAEKVPFAQVAKAL
FT                   APLGMLIGMLVVTRIKQLGIKGILTSKEEWFSFQLPFDLSKITVSDSLTITFGNIFGQD
FT                   VSASYQTLYVPAWIPFVLTVWICILLYKTKFKDAWTIYSVTFNQTKKPLLALMGALIMV
FT                   QLMLVGGDNSMVKIIGKEFAAMAGEHWVYFSPYLGAIGAFFSGSNTVSNLTFGPIQQQI
FT                   ALDTGLSVTLILALQSVGGAMGNMVCLNNIIAVCTVLDVKNSEGAIIKKTVIPMAIYGV
FT                   IAVVAAMIFFL"
FT   CDS_pept        complement(460711..461433)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0426"
FT                   /product="UDP-2,3-diacylglucosamine hydrolase"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04247"
FT                   /db_xref="GOA:C6S5G5"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5G5"
FT                   /protein_id="CBA04247.1"
FT                   /translation="MKPAYFISDLHLSEKHPELTALLLRFLRSSAAGQARAVYILGDLF
FT                   DFWVGDDEVSELNTSVAREIRKLSDKGVAVFFVRGNRDFLIGQDFCRQAGMTLLPDYSV
FT                   LDLFGCKTLICHGDTLCTDDRAYQRFRKIVHRKRLQKLFLMLPLKWRTRLAAKIRRVSK
FT                   MEKQVKPADIMDVNAAFTARQVRAFNAERLIHGHTHREHIHHENGFTRIVLGDWHNDYA
FT                   SILRVDGDGAVFVPLEKC"
FT   CDS_pept        461683..465168
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="NMO_0427"
FT                   /product="chromosome segregation protein"
FT                   /function="Chromosome segregation ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04250"
FT                   /db_xref="GOA:C6S5G6"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5G6"
FT                   /protein_id="CBA04250.1"
FT                   /translation="MRLTHIKLSGFKSFTDPTTIHVPGQLVAVIGPNGCGKSNVIDAVR
FT                   WVLGEASAKQLRGESMQDVIFNGAATRRPAPRASVELVFDNSDHSLQGAWGQYAEVSIK
FT                   RQLTRQGESTYFINNQTVRRRDITDLFLGTGVGARGYAVIEQGMISRIIEARPEELRAY
FT                   IEEAAGVSKYKERRKETEGCLKDTREHLQRLGDLQNELARQVEKLEKQAETAERYKSLT
FT                   AQLNQQQDLLDYAQWQQSLAAADKATAQHQSLQAQQDETAAQVQALNDEVHALQTAEQS
FT                   QQQAVHELGNKRGVLREQIARLEEQIRHQQNLHQRIERDKQAAQAQLQRIHQEQQQIRV
FT                   QLEENELQVEEKQTELAEWAMQVAEHEERLPELEEAQATLNAAFQTQQDEANRIRRELA
FT                   LKQQQLAHAEQTVAKHEERKGRLKQENQALNLPDEAETAAAQEAAALLQSQQEHYEEQI
FT                   IAAEEALHAAREAFQTASNRFQSLKQQHITLQAQQQALSQILSQQQEAADFWQVTGHAA
FT                   APQLWQHITAPAEWQHALSVILAERLHARAVPQGFVPPEPLPQGQAAWLSDGLSGGIKK
FT                   SLPVQALLNQIQAQPPFQTALHHWLDGVLCAPDLSYALAHQSDLGAHQIWLTPEGHQVD
FT                   KVSVLLYAKPAQESLIAQKARLDGIASELDNLAPELSADEAAFKQAEAAVRSSEVQHKN
FT                   LMQQQQQHTRQYSQAQQRAAELLARTNQGQIRREHIERELAQLAEEQTVLQHASDGLSD
FT                   DIATLQEAAAELEHQQQTTAHSRQEQQGRLKQAQLALLEANRQYGLAEVAVHKLNQQKQ
FT                   NYRQQIAQLEQQTLDWQERQQELALAYETEFQNDEQHIKLDELTEAVQTLDEEYIAVQE
FT                   KLAQIQAQGRGQYARVQTLQTQLPQLQAATQTALLQQQEALINAKRYHQNLTERAADLD
FT                   ALEALAKESPKVLNTSIGSLTRQIEALGAVNLAALQELEEARERDGYYRSQSEDVQAAI
FT                   TLLEEAIAQIDDKTKARFKETFDAVNSKVQTFFPTLFGGGEATLKMIGDDLLTAGVSIM
FT                   ARPPGKKNSTIHLLSGGEKALTAMSLVFALFSLNPAPFCLLDEVDAPLDDANTSRFCNL
FT                   VKEMSAQTQFLYISHNRLTMEMAEQLVGVTMQEKGVSRVVAVDIKQALEMAEAV"
FT   CDS_pept        complement(465519..466565)
FT                   /transl_table=11
FT                   /gene="adhA"
FT                   /locus_tag="NMO_0428"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /function="Zn-dependent alcohol dehydrogenases"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04253"
FT                   /db_xref="GOA:C6S5G7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5G7"
FT                   /protein_id="CBA04253.1"
FT                   /translation="MKMQAVVVNKNVAGDVEIVEREVRPLEYGEALVEVEYCGVCHTDL
FT                   HVAAGDYGEKPGRVLGHEGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRE
FT                   TLCRSVLNAGYTADGGMATYCIVSADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSSV
FT                   RPGQWIAIYGAGGLGNLGVQYAKKVFGAHVVAIDINDDKLAFAKETGADLVVNAAKEDA
FT                   AKVIQEKTGGAHAAVVTAVSAAAFNSAVNCVRAGGRVVAIGLPPESMDLSIPRLVLDGI
FT                   EVVGSLVGTRKDLEEAFQFGAEGLVVPKVQLRALDEAPAIFQEMREGKITGRMVIDMKK
FT                   ECGCGHHH"
FT   CDS_pept        complement(466848..467237)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0429"
FT                   /product="putative type IV pilin protein"
FT                   /function="Tfp pilus assembly protein PilE"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04256"
FT                   /db_xref="GOA:C6S5G8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5G8"
FT                   /protein_id="CBA04256.1"
FT                   /translation="MKNVQKGFTLLELMIAVAILGILTLITYPSYKTYIRRIRLSEVKS
FT                   TLLMNAQTMERYYRQKGTFENYDTNKLKQNKYFKITLSEVSPDHFTLQADPNPTTNDGE
FT                   TCVVTLNDGGTIAASGTNQSCPGFD"
FT   CDS_pept        467463..468641
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="NMO_0430"
FT                   /product="probable periplasmic protein"
FT                   /function="Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04259"
FT                   /db_xref="GOA:C6S5G9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5G9"
FT                   /protein_id="CBA04259.1"
FT                   /translation="MAKMMKWAAVAAVAAAAVWGGWSYLKPEPQAAYITETVRRGDISR
FT                   TVSATGEISPSNLVSVGAQASGQIKKLYVKLGQQVKKGDLIAEINSTSQTNTLNTEKSK
FT                   LETYQAKLVSAQIALGSAEKKYKRQAALWKDDATSKEDLESAQDAFAAAKANVAELKAL
FT                   IRQSKISINTAESELGYTRITATMDGTVVAILVEEGQTVNAAQSTPTIVQLANLDMMLN
FT                   KMQIAEGDITKVKAGQDISFTILSEPDTPIKAKLDSVDPGLTTMSSGGYNSSTDTASNA
FT                   VYYYARSFVPNPDGKLATGMTTQNTVEIDGVKNVLIIPSLTVKNRGGKAFVRVLGADGK
FT                   AAEREIRTGMRDSMNTEVKSGLKEGDKVVISEITAAEQQESGERALGGPPRR"
FT   CDS_pept        468707..470641
FT                   /transl_table=11
FT                   /locus_tag="NMO_0431"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /function="ABC-type antimicrobial peptide transport system
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04262"
FT                   /db_xref="GOA:C6S5H0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5H0"
FT                   /protein_id="CBA04262.1"
FT                   /translation="MSLIECKNINRYFGSGENRVHILKDISLSIEKGDFVAIIGQSGSG
FT                   KSTLMNILGCLDTAGSGSYRIDGIETAKMQPDELAALRRERFGFIFQRYNLLSSLTARD
FT                   NVALPAVYMGAGGKERSARADKLLQDLGLASKEGNKPGELSGGQQQRVSIARALMNGGE
FT                   IIFADEPTGALDTASGKNVMEIIHKLHEAGHTVIMVTHDPGIAANANRVIEIRDGEIIS
FT                   DTSKNPEIPASNVGRIREKASWSFYYDQFVEAFRMSVQAVLAHKMRSLLTMLGIIIGIA
FT                   SVVSVVALGNGSQKKILEDISSIGTNTISIFPGRGFGDRRSGRIKTLTIDDAKIIAKQS
FT                   YVASATPMTSSGGTLTYRNTDLTASLYGVGEQYFDVRGLKLETGRLFDENDVKEDAQVV
FT                   VIDQNVKDKLFADSDPLGKTILFRKRPLTVIGVMKKDENAFGNSDVLMLWSPYTTVMHQ
FT                   ITGESHTNSITVKIKDNANTQVAEKGLTDLLKARHGTEDFFMNNSDSIRQIVESTTGTM
FT                   KLLISSIALISLVVGGIGVMNIMLVSVTERTKEIGIRMAIGARRGNILQQFLIEAVLIC
FT                   VIGGLVGVGLSAAVSLVFNHFVTDFPMDISAASVIGAVACSTGIGIAFGFMPANKAAKL
FT                   NPIDALAQD"
FT   CDS_pept        complement(471054..471836)
FT                   /transl_table=11
FT                   /gene="dsbG"
FT                   /locus_tag="NMO_0432"
FT                   /product="Protein-disulfide isomerase"
FT                   /EC_number="5.3.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04265"
FT                   /db_xref="GOA:C6S5H1"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5H1"
FT                   /protein_id="CBA04265.1"
FT                   /translation="MKTKLIKILTPFTVLPLLACGQTPVSNANAEPAAKAESAGKSVAA
FT                   SLKARLEKTYSAQDLKVLSVSETPVKGIYEVVVSGRQIIYTDAEGGYMFVGELINIDTR
FT                   KNLTEERAADLNKIDFASLPLDKAIKEVRGNGKLKVAVFSDPDCPFCKRLEHEFEKMTD
FT                   VTVYSFMMPIAGLHPDAARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTS
FT                   LGEQFGFNGTPTLVFPNGRSQSGYSPMPQLEEIIRKNQ"
FT   CDS_pept        471975..474164
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="NMO_0433"
FT                   /product="putative primosomal protein"
FT                   /function="Primosomal protein N (replication factor Y) -
FT                   superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04268"
FT                   /db_xref="GOA:C6S5H2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5H2"
FT                   /protein_id="CBA04268.1"
FT                   /translation="MIYHRIAVNVPLSDGLLTYSHSDPLPPGTRVLVPFRNKTVVGMVW
FT                   ETDIAPDMDTARILSVRTAFSDEPLLPESWRDLLAFTSRYYHYPTGQAVFAALPQGLKE
FT                   TRAVEMPQPPLFYALNEAGRAQTPPPARFNKKAALWDALLSGEMTMAALKQVNAQAAKL
FT                   IEDWAVQGWIETTEAAKPVLRPYHGQASHSEFVLNANQQKASDAIQTVFGSFQPFLLYG
FT                   ITGSGKTEVYFDAMAKVLAQGRQVLFLLPEINLTPQLLKRVENRFADVPTAVLHSQMAA
FT                   GRRTQDYLRAMLGQAKLVIGTRLAVFTPMDDVGLIVVDEEHDGSFKQDNELRYHARDLA
FT                   VWRAKQGGCPIILGSATPSLESWHKAQSGAYRLLQLTERAHTAAQLPQVDILNVGRLKL
FT                   DNGFSPQALQLLKQNFEAGGMSLVYLNRRGFAPALFCGDCGHTFGCPNCSAKMVLHQRA
FT                   RQLRCHHCDHREPIPYKCPDCGNQDLTAVGHGTQRVEETLRAFLPKAAVVRVDRDSTAH
FT                   KNDWADLYRRIADNEIDILVGTQMLAKGHDFARLNLVIVLNADGSLYSADFRAPERLFA
FT                   ELMQVSGRAGRADKPGKVLIQTQLPEHPVFAAVKAQDYAVFAENELNERQMFAMPPFGF
FT                   QTAVRADAPRVADAMEFLNAAKETLAPLLPESVSQFGAAPMLMVRLAERERAQIFLEST
FT                   SRQDLHRAVSLWVQVLQQNRDGKIRWSVDVDPQEA"
FT   CDS_pept        complement(474211..475285)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="nnrS"
FT                   /locus_tag="NMO_0434"
FT   mobile_element  complement(475333..476288)
FT                   /mobile_element_type="other:ISNme5"
FT                   /locus_tag="NMO_0435"
FT   CDS_pept        complement(477322..479250)
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="NMO_0436"
FT                   /product="chaperone protein Hsp70"
FT                   /function="Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04272"
FT                   /db_xref="GOA:C6S5H3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5H3"
FT                   /protein_id="CBA04272.1"
FT                   /translation="MAKVIGIDLGTTNSCLAISENGQTKVIENAEGARTTPSVIAYLDG
FT                   GEILVGAPAKRQAVTNAKNTIYAAKRLIGHKFEDKEVQRDIESMPFEIIKANNGDAWVK
FT                   AQGKELSPPQISAEVLRKMKEAAEAYLGEKVTEAVITVPAYFNDSQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAFGMDKGDNKDRKVAVYDLGGGTFDISIIEIANLDGDKQFEVLAT
FT                   NGDTFLGGEDFDQRLIDYIIDEFKKEQGIDLKQDVMALQRLKEAAEKAKIELSSGQQTE
FT                   INLPYITMDATGPKHLAMKITRAKFESLVEDLIQRSIEPCKVALKDAGLSTSDIDDVIL
FT                   VGGQSRMPKVQEAVKAFFGKEPRKDVNPDEAVAVGAAIQGEVLSGGRSDVLLLDVTPLS
FT                   LGIETMGGVMTKLIQKNTTIPTKASQVFSTAEDNQSAVTIHVLQGERERASANKSLGQF
FT                   NLGDIAPAPRGMPQIEVTFDIDANGILHVSAKDKGTGKAANITIQGSSGLSEEEIERMV
FT                   KDAEANAEEDKKLTELVASRNQAEALIHSVKKSLADYGDKLDAAEKEKIEAALKEAEEA
FT                   VKGDDKAAIDAKAEALGAASQKLGEMVYAQAQAEAQAGESAQTNASAKKDDDVVDADFE
FT                   EVKDDKK"
FT   CDS_pept        complement(479458..479730)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0437"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04275"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5H4"
FT                   /protein_id="CBA04275.1"
FT                   /translation="MKKTGKYLIYTAAFTAFCFAFQENRSEAKQPDITLSASLCEQFNI
FT                   LNAKDMDAEQVSLSKECDIIESSHDWEKEYGNLNEQEMLAGIVYE"
FT   CDS_pept        479918..480604
FT                   /transl_table=11
FT                   /locus_tag="NMO_0438"
FT                   /product="putative transcriptional regulator"
FT                   /function="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04278"
FT                   /db_xref="GOA:C6S5H5"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5H5"
FT                   /protein_id="CBA04278.1"
FT                   /translation="METFKDRLVFLWKSEAKQAKIASDIEMTIAGFSRIWNEGGLPKSE
FT                   TLKKIKQLKGCSIDWLLTGEGNPFPDEAPKKSLAYDTLGNEVDTDEFVFVPRYDIRAAA
FT                   GYGQFVDHEEPVFTMAFRRHWIENYVTRDTKNLSVISVKGDSMEGVLNDGDSILVNHGE
FT                   NTPRDGLYVLRINENLLVKRLQIVPGGIINVISANEAYPAFEINLNDLTDDVEIIGRVE
FT                   WFGRTI"
FT   CDS_pept        480736..481074
FT                   /transl_table=11
FT                   /locus_tag="NMO_0439"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04281"
FT                   /db_xref="GOA:C6S5H6"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5H6"
FT                   /protein_id="CBA04281.1"
FT                   /translation="MSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGGCSGFQY
FT                   GFTFDEIKNDDDFEIEKNGLVFLVDPMSYQYLVGAEIDYTENLQGSQFVIRNPNAETTC
FT                   GCGSSFSV"
FT   CDS_pept        481234..481548
FT                   /transl_table=11
FT                   /locus_tag="NMO_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04284"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5H7"
FT                   /protein_id="CBA04284.1"
FT                   /translation="MIEMSKDYRNDLYDVYVSYPPQVDRGLIRECLRENLGEEKAEGLI
FT                   ESLDSKPQVLVEEKCTWAKREELHDYFSYLGLDIITRRYSGLTKTSTALSRLSSKRTIL
FT                   "
FT   CDS_pept        481639..481851
FT                   /transl_table=11
FT                   /locus_tag="NMO_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04287"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5H8"
FT                   /protein_id="CBA04287.1"
FT                   /translation="MELETVVPPEEGEGEGEGADGEMPEYLELHGGREDDISAPSQPEP
FT                   PTRNIKPLLFGLLIAFLGYLLGKIF"
FT   CDS_pept        481886..483397
FT                   /transl_table=11
FT                   /gene="aarF"
FT                   /locus_tag="NMO_0442"
FT                   /product="putative ubiquinone biosynthesis protein"
FT                   /function="Predicted unusual protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04290"
FT                   /db_xref="GOA:C6S5H9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5H9"
FT                   /protein_id="CBA04290.1"
FT                   /translation="MKWLKRLTVIVGTFYRYRLAGLCASLMGSGWICALLKMMPQSSKL
FT                   KNEPPAVRLRLALESLGPIFIKFGQVLSTRPDLIPHDYAVELAKLQDKVPPFDARLSRE
FT                   QIEKSLGQPIEKLYAEFETEPVASASIAQVHKARLHSGERVAVKVLRPNLLPLIEQDLS
FT                   LMRFGAAWVERLFADGRRLKPREVVAEFDKYLHDELDLMREAANAGQLGRNFQNSDMLI
FT                   VPKVFYDYCTSDVLTIEWMDGTPVSDIAKLKADGIDLHKLADYGVEIFFTQVFRDGFFH
FT                   ADMHPGNILVAADNRYIALDFGIVGTLTDYDKRYLAINFLAFFNRDYRRVATAHIESGW
FT                   VPADTRAEELEAAVRAVCEPVFNKPISQISFGLVLMRLFEVSRRFNVEIQPQLVLLQKT
FT                   LLNIEGLGRQLDPDLDLWKTAKPFLVKWMNGQVGPKALWRNLKNEAPDWAQIIPSLPRK
FT                   INALVDEARRQEMRDAYIHLVKVQQRQSLWLAVIAVVLLLILLLK"
FT   CDS_pept        complement(483754..484572)
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="NMO_0443"
FT                   /product="Serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04293"
FT                   /db_xref="GOA:C6S5I0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5I0"
FT                   /protein_id="CBA04293.1"
FT                   /translation="MKKDHLNTTGFDLWHTIREETAAAAAAEPMLASFLHQTVLRHESL
FT                   GSVLAYHLSSKLGSPIMDVRALFEIYQQALGSDTQIGKCVEADLKAIYERDPACDEYSL
FT                   PLLYFKGFHAIQAHRINHRLYLDGRKTLAYFLQNRMSEVFGVDIHPAARFGYGLMLDHA
FT                   TGFVAGETAVLGNNISILHGVTLGGSGKEGGDRHPKIGDGVMIGANASILGNIRIGSNA
FT                   KIGAGSVVVSDVPPSITVVGVPAKPVARSLKTPSADMDQNIQFTEIDFMI"
FT   CDS_pept        484756..485334
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="NMO_0444"
FT                   /product="heat shock protein GrpE"
FT                   /function="Molecular chaperone GrpE (heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04296"
FT                   /db_xref="GOA:C6S5I1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5I1"
FT                   /protein_id="CBA04296.1"
FT                   /translation="MSEQTQQQNSEEAVENVEAVETVETVGNADGVQEQAAAEPAYEDL
FT                   QARIAELEAQLKDEQLRALANEQNLRRRHQQEIADTHKFAGQKFAVEMLPVKDYLEMAL
FT                   LDQSGNFDALKMGVQMTLNELQKAFDATQIKEINPKAGDKLDPNIHQAMQAVASEQEPN
FT                   TVVGVMKKGYTLSDRVLRPAMVTVAQKEA"
FT   CDS_pept        complement(485458..485673)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0445"
FT                   /product="conserved membrane protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04299"
FT                   /db_xref="InterPro:IPR007495"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5I2"
FT                   /protein_id="CBA04299.1"
FT                   /translation="MKTLLLTFGIFLTVIIGMAVGYIFSKRSIKGSCGGITALGMKKMC
FT                   DCDIPCDTLQKKLDEEKQAGGIRVDR"
FT   CDS_pept        complement(485699..486754)
FT                   /transl_table=11
FT                   /gene="apbE"
FT                   /locus_tag="NMO_0446"
FT                   /product="thiamin biosynthesis lipoprotein ApbE"
FT                   /function="Membrane-associated lipoprotein involved in
FT                   thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04302"
FT                   /db_xref="GOA:C6S5I3"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5I3"
FT                   /protein_id="CBA04302.1"
FT                   /translation="MPSETRLPNFIRVLIFALGFIFLNACSEQTAQTVTLQGETMGTTY
FT                   TVKYLSNNRDKLPSPAEIQKRIDDALKEVNRQMSTYQPDSEISRFNQHTAGKPLRISSD
FT                   FAHVTAEAVRLNRLTHGALDVTVGPLVNLWGFGPDKSVTREPSPEQIKQAASYTGIDKI
FT                   ILKQGKDYASLSKTHPKAYLDLSSIAKGFGVDKVAGELEKYGIQNYLVEIGGELHGKGK
FT                   NARGEPWRIGIEQPNIVQGGNTQIIVPLNNRSLATSGDYRIFHVDKNGKRLSHIINPNN
FT                   KRPISHNLASISVVADSAMTADGLSTGLFVLGETEALKLAEREKLAVFLIVRDKGGYRT
FT                   AMSSEFEKLLR"
FT   CDS_pept        complement(486906..488123)
FT                   /transl_table=11
FT                   /gene="nqrF"
FT                   /locus_tag="NMO_0447"
FT                   /product="Na+-transporting NADH:ubiquinone oxidoreductase,
FT                   subunit NqrF"
FT                   /function="Na+-transporting NADH:ubiquinone oxidoreductase
FT                   subunit NqrF"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04305"
FT                   /db_xref="GOA:C6S5I4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR010205"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5I4"
FT                   /protein_id="CBA04305.1"
FT                   /translation="MEIILGIVMFTVIVLVLALMILFAKSKLVSEGDITIKVNGEKELT
FT                   MPAGGKLLGALANEGIFIPSACGGGGSCGQCRVVVKSGGGDILPTELSHISKREAREGC
FT                   RLSCQVNVKTDMDIEVPEEVFGVKKWECTVISNDNKATFIKELKLAIPEGEEVPFRAGG
FT                   YIQIEAPPHTVAYKDFDIPEEYHEDWDKYNLWQYVSKVDEPILRAYSMASYPEEKGIIM
FT                   LNVRIATPPPRVPDAPPGQMSSYIWSLKPGDKVTISGPFGEFFAKDTDAEMVFIGGGAG
FT                   MAPMRSHIFDQLKRLNSKRKITFWYGARSKREMFYVEDFDQLAAEFPNFTWHVALSDPL
FT                   PEDNWDGYTGFIHNVVYENHLKNHEAPEDCEFYMCGPPIMNQSVIKMLKDLGVEDENIL
FT                   LDDFGG"
FT   CDS_pept        complement(488137..488730)
FT                   /transl_table=11
FT                   /gene="nqrE"
FT                   /locus_tag="NMO_0448"
FT                   /product="Na+-transporting NADH:ubiquinone oxidoreductase,
FT                   subunit NqrE"
FT                   /function="Na+-transporting NADH:ubiquinone oxidoreductase
FT                   subunit NqrE"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04308"
FT                   /db_xref="GOA:C6S5I5"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5I5"
FT                   /protein_id="CBA04308.1"
FT                   /translation="MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAV
FT                   IFVLGLSVPVNQLVYSLLKDGAIVEGVDLTFLKFITFIGVIAALVQILEMFLDKFVPAL
FT                   YNALGIYLPLITVNCAIFGAVSFMAQREYNFGESVVYGFGAGLGWMLAIVALAGITEKM
FT                   KYSDAPKGLKGLGITFIAAGLMAMAFMSFSGIQL"
FT   CDS_pept        complement(488734..489360)
FT                   /transl_table=11
FT                   /gene="nqrD"
FT                   /locus_tag="NMO_0449"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit D"
FT                   /function="Na+-transporting NADH:ubiquinone oxidoreductase
FT                   subunit NqrD"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04311"
FT                   /db_xref="GOA:C6S5I6"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5I6"
FT                   /protein_id="CBA04311.1"
FT                   /translation="MADMKRLKHLMFSPFIDNNPIALQVLGICSALAVTTKLQTAIVMG
FT                   ISVALVTGFSSFFISLVRNYIPNSIRIIVQMAIIASLVTLVDQLLQAFAYELSKQLSVF
FT                   VGLIITNCIVMGRAEAFAMKEPPLESLIDGIGNGAGYGIMLLVVATVRELIGSGKLLGY
FT                   TVFQTVQDGGWYQTNGLFLLAPSAFFIIGFLIWGLRTWKPEQAEE"
FT   CDS_pept        complement(489360..490136)
FT                   /transl_table=11
FT                   /gene="nqrC"
FT                   /locus_tag="NMO_0450"
FT                   /product="Na+-translocating NADH-quinone reductase subunit
FT                   C"
FT                   /function="Na+-transporting NADH:ubiquinone oxidoreductase
FT                   subunit NqrC"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04314"
FT                   /db_xref="GOA:C6S5I7"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5I7"
FT                   /protein_id="CBA04314.1"
FT                   /translation="MAKKFDKDSFSGTLIVVLAVSLICSVIVAGAVVGLKPIQEKQKLQ
FT                   DKQGYILSVAGLMDKDTDIGKTFAERIEQRVVDLATGEYVKDAPKDFSARVAAKDPAQS
FT                   IQIKPEDDLAGIKSRAKYTEVYLVKGEDGKIGQIILPMHGNGLWSVMYGFVAIQPDGNT
FT                   INGITYYEQGETPGLGGEIGNPLWQQKFVGKKLFDGQGKLALHVGKGAGSDKEHGVDAL
FT                   SGASLTSKGVQGSFAYWFGENGYIPYLNKLKSAGAQ"
FT   CDS_pept        complement(490129..491361)
FT                   /transl_table=11
FT                   /gene="nqrB"
FT                   /locus_tag="NMO_0451"
FT                   /product="NADH-ubiquinone oxidoreductase subunit B"
FT                   /function="Na+-transporting NADH:ubiquinone oxidoreductase
FT                   subunit NqrB"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04317"
FT                   /db_xref="GOA:C6S5I8"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5I8"
FT                   /protein_id="CBA04317.1"
FT                   /translation="MGLKHFLEKIEPHFLPGGKHEKWYALYEAAATIFYTSGAVTRKAA
FT                   HVRDALDSKRMMILVWLALFPAMFYGMYNVGAQAFGALTPDLLQQSIANDWHYAFADAL
FT                   GINMSSEAGVLGKMLFGAIYFLPIYATVFAVGGFWEVLFATVRKHEINEGFFVTSILFA
FT                   LIVPPTLPLWQAALGISFGVVVAKEVFGGTGKNFMNPALAGRAFLFFAYPANLSGDAVW
FT                   TAVDGYSGATALAQWAAHGADGLKNAVTGQTITWMDAFIGKLPGSIGEVSTLALLIGGA
FT                   FIVFARIASWRIIAGVMIGMIAMSSLFNFIGSDTNAMFAMPWYWHLVVGGFAIGMLFMA
FT                   TDPVSASFTNVGKWWYGALIGVMCVLIRVVNPAYPEGMMLAILFANLFAPIFDYFVAQA
FT                   NIKRRKARSNG"
FT   CDS_pept        complement(491364..492707)
FT                   /transl_table=11
FT                   /gene="nqrA"
FT                   /locus_tag="NMO_0452"
FT                   /product="NADH-ubiquinone oxidoreductase subunit A"
FT                   /function="Na+-transporting NADH:ubiquinone oxidoreductase
FT                   subunit NqrA"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04320"
FT                   /db_xref="GOA:C6S5I9"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5I9"
FT                   /protein_id="CBA04320.1"
FT                   /translation="MIKIKKGLNLPIAGRPEQVIYDGPAITEVALLGEEYAGMRPSMKV
FT                   KEGDAVKKGQVLFEDKKNPGVVFTAPASGKIAAIHRGEKRVLQSVVIAVEGNDEIEFDR
FT                   YAPDALAKLSGKEVRRNLIQSGLWTALRTRPFSKIPAVDAEPFAIFVNAMDTNPLAADP
FT                   TVIIKEAAEDFRRGLLVLSRLTERKIHVCKAAGADVPSENAANIETHEFGGPHPAGLSG
FT                   THIHFIEPVGANKTVWTINYQDVIAIGRLFATGRLNTERVIALGGSQVNKPRLLRTVLG
FT                   AKVSQITAGELVDADNRVISGSVLNGAITQGAHDYLGRYHNQISVIEEGRSKELFGWVA
FT                   PQPDKYSITRTTLGHFLKNKLFKFTTAVNGGDRAMVPIGTYERVMPLDILPTLLLRDLI
FT                   VGDTDSAQALGCLELDEEDLALCSFVCPGKYEYGPLLRKVLETIEKEG"
FT   CDS_pept        complement(493055..494476)
FT                   /transl_table=11
FT                   /gene="nhaD"
FT                   /locus_tag="NMO_0453"
FT                   /product="putative anion permease"
FT                   /function="Na+/H+ antiporter NhaD and related arsenite
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04323"
FT                   /db_xref="GOA:C6S5J0"
FT                   /db_xref="InterPro:IPR031566"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5J0"
FT                   /protein_id="CBA04323.1"
FT                   /translation="MRHLPLFSLMLFPASVYAADLDGANLNLLWSLPFALILLSIALGP
FT                   LFFSHTWHHHYGKITAFWTLLFLIPFSLVFGASAGIHTVAHALVEEYIPFILLLLALYT
FT                   ISGGILVWGDLNGTPKLNTALLAVGTALASIMGTTGAAMLMIRPLLKANQNRTRRVHIV
FT                   IFFIFLVANIGGGLTPLGDPPLFLGFLKGVDFMWTVKHMFAPVLISTAVLLTAFYFIDN
FT                   RFFKQESIAQDTPAQQEKPEKIAIFGKWNFLLLSGVVGAVLMSGLWKPEHPGFEILGSR
FT                   YALQNLVRDVILIALTAVSMAITPKQVRAGNEFNFEPIAEVGKLFLGIFITIFPVLSIL
FT                   KAGEAGALGGVVSLVHDTAGHPINVMYFWMSGILSAFLDNAPTYLVFFNMAGGDAQALM
FT                   TGSLFHSLLAVSMGSVFMGALTYIGNAPNFMVKAIAEQRGVPMPTFFGYMMWSVAFLTP
FT                   VFIVHTLIFFVFKLL"
FT   CDS_pept        complement(494836..495195)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0454"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04326"
FT                   /db_xref="GOA:C6S5J1"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5J1"
FT                   /protein_id="CBA04326.1"
FT                   /translation="MIRYLLIACGGISLLLGIIGIFLPLLPTTPFVLLSAACWAKASPR
FT                   FHRWLHRHRYFGPMVHNWEQNGAVPRKAKIFAISMMTASCLIMFWQFPQRWWVGAVSSV
FT                   FCSLVAIWMWRRPES"
FT   CDS_pept        complement(495192..495797)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0455"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04329"
FT                   /db_xref="InterPro:IPR009858"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5J2"
FT                   /protein_id="CBA04329.1"
FT                   /translation="MTIMNINTSENKDAVAEHTGQWLEKAVIGLNLCPFAKAPHVKNLV
FT                   RIAISEAKHLDGFLEDLDEELQRLGNTPATELETTLLVHPTLFPDFGVFNDMLDIADAA
FT                   VVENGLEGIVQIAPFHPDFQFEGTDSDDIGNYTNRSPYPTLHLIREDSIAKAAQAFPDA
FT                   SAIFERNIALLEKMGHEGWAKLGITSCPYPHNKKNISK"
FT   CDS_pept        complement(495844..496407)
FT                   /transl_table=11
FT                   /gene="lrp1"
FT                   /locus_tag="NMO_0456"
FT                   /product="leucine-responsive regulatory protein"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04332"
FT                   /db_xref="GOA:C6S5J3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5J3"
FT                   /protein_id="CBA04332.1"
FT                   /translation="MLIWSPSVRIAANIRTDNPNSLKRNANMPQLTLDKTDIKILQVLQ
FT                   ENGRLTNVELSERVALSPSPCLRRLKQLEDAGIVRQYAALLSPESVNLGLQAFIRVSIR
FT                   KAKDAREDFAASVRKWPEVLSCFALTGETDYLLQAFFTDMNAFSHFVLDTLLSHHGVQD
FT                   AQSSFVLKEIKHTTSLPLNHLLKE"
FT   CDS_pept        496838..497938
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="NMO_0457"
FT                   /product="glycine cleavage system T protein"
FT                   /function="Glycine cleavage system T protein
FT                   (aminomethyltransferase)"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04335"
FT                   /db_xref="GOA:C6S5J4"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5J4"
FT                   /protein_id="CBA04335.1"
FT                   /translation="MITLKTTPFHQAHQDAGAKLVDFAGWELPIHYGSQIAEHEAVRTD
FT                   AGMFDVSHMLVTDVAGANAKAFFRKLIANDVAKLAFVGKALYSALLNDNGGVIDDLIVY
FT                   RTNEAETQYRIVSNGATREKDTAQFHKVGQEFGVSFNPRYDLGMLAVQGPKAIEKLLTV
FT                   KPEWADVVHNLKPFQGADLGNDWFVARTGYTGEDGVEVILPGTEAVAFFKALQQAGVQP
FT                   CGLGARDTLRMEAGMNLYGNDMDDDTSPLEAGMGWTVDLKDESRDFVGKAALLALKEKG
FT                   VAVKQVGLLLDKGGILRAHMEVLTDKGKGETTSGVFSPSLKQSIAIARVPKDFDGDTAK
FT                   VLIRGKEADVRVLKLPFVRNGQKQFD"
FT   CDS_pept        498101..498487
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="NMO_0458"
FT                   /product="glycine cleavage system H protein"
FT                   /function="Glycine cleavage system H protein (lipoate-
FT                   binding)"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04338"
FT                   /db_xref="GOA:C6S5J5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5J5"
FT                   /protein_id="CBA04338.1"
FT                   /translation="MSNNIPAELKYVASHEWLRLEEDGTITVGITHHAQELLGDIVFVE
FT                   LPEVGANLAAEEQAGVVESVKAASDVYAPIAGEVVAVNEDLPSAPETANSDPYGAGWFF
FT                   KLKPANVADYDVLLTAEQYAGEVD"
FT   CDS_pept        498639..499886
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="NMO_0459"
FT                   /product="Glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04341"
FT                   /db_xref="GOA:C6S5J6"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5J6"
FT                   /protein_id="CBA04341.1"
FT                   /translation="MQLTAVGLNHQTAPLSIREKLAFAAACLPEAVRNLARSNAATEAV
FT                   ILSTCNRTELYCVGDSEEIIRWLADYHSLPIEEISPYLYTLGMQETVRHAFRVACGLDS
FT                   MVLGEPQILGQIKDAVRVAQEQESMGKKLNALFQKTFSVAKEVRTDTAVGENSVSMASA
FT                   SVKLAEQIFPDIGDLNVLFIGAGEMIELVATYFAAKSPRLMTVANRTLARAQELCDKLG
FT                   VNAEPCLLSDLPAILHDYDVVVSSTASQLPIVGKGMVERALKQRQSMPLFMLDLAVPRD
FT                   IEAEVGDLNDAYLYTVDDMVNIVQSGKEARQKAAAAAETLVSEKVAEFVRQQQGRQSVP
FT                   LIKALRDEGEKARKQVLENAMKQLAKGATAEEVLERLSVQLTNKLLHSPTQTLNKAGEE
FT                   DKDLVHAVAQIYHLDK"
FT   CDS_pept        500214..500735
FT                   /transl_table=11
FT                   /locus_tag="NMO_0460"
FT                   /product="regulatory protein"
FT                   /function="Regulator of nitric oxide reductase
FT                   transcription"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04344"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5J7"
FT                   /protein_id="CBA04344.1"
FT                   /translation="MSCFSIKRMSAFRARITAFFAAFVFLTAALPAYAERLPDFLAKIQ
FT                   PSEIFPGADRYGKPEGKPMVARVYKGDEQLGLVYITTDAVNTRGYSSKPIDTLMALAKD
FT                   GTIAGAKLVDHHESIMLIGIPHLPAPGRAIRSNWLPAYIKPNFTSTNRLRLKGLPTVPQ
FT                   PSKGTGAGVP"
FT   CDS_pept        500789..501823
FT                   /transl_table=11
FT                   /gene="nosD"
FT                   /locus_tag="NMO_0461"
FT                   /product="periplasmic copper-binding protein"
FT                   /function="Nitrous oxidase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04347"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5J8"
FT                   /protein_id="CBA04347.1"
FT                   /translation="MSLPAMDAGIYLEETAPRALIEHNNILDNSVGVYLHGSADAMVRE
FT                   NKIVGDATLRVNERGNGVTVWNAPGAQVVGNDISKGRDGIFSNTSTHNTYKNNRFSDLR
FT                   FAVHYMYTNDSEISGNISVGNNMGYVLMFSERLKVFDNIAVGSRDQGIMLNYVNYSDIH
FT                   DNIINKAGKCVFAYNANYDKLSANHFENCQIGIHFTAAIEGTSLHDNSFINNESQAKYV
FT                   STRFLDWSEGGHGNYWSDNSAFDLNGDGFGDSAYRPNGIIDQIIWRAPVSRLLMNSPAI
FT                   SIVKWAQAQFPAVLPGGVVDSKPLMKPYAPKIQTCYQAMKDELLKEAETRQSEWGRAEN
FT                   GSLN"
FT   CDS_pept        501881..502501
FT                   /transl_table=11
FT                   /locus_tag="NMO_0462"
FT                   /product="ABC-type multidrug transport system"
FT                   /function="ABC-type multidrug transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04350"
FT                   /db_xref="GOA:C6S5J9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5J9"
FT                   /protein_id="CBA04350.1"
FT                   /translation="MTTHHVELRKVTKRFGAQKAVNQVDLVLKAGESVGLAGHNGAGKS
FT                   TIMKLILGLITPTEGEVMLLGERTGSKAGARLRSQIGYLPETVALHPSLTGIETLDFYA
FT                   KLKKQPLTQNRGLLERVGISQAAHRRVGTYSKGMRQRLALAQALLGEPKVLLFDEPTTG
FT                   LDPASRQMFYEVVRELNGRGATVLLSTHALAELDGHADRIIVD"
FT   CDS_pept        502718..503212
FT                   /transl_table=11
FT                   /gene="nosL"
FT                   /locus_tag="NMO_0463"
FT                   /product="possible protein NosL"
FT                   /function="Predicted lipoprotein involved in nitrous oxide
FT                   reduction"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04353"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5K0"
FT                   /protein_id="CBA04353.1"
FT                   /translation="MKKTLLAIIAVFALSACRQAEEGPPPLPQQISDRSVGHYCSMNLT
FT                   EHNGPKAQIFLNGKPDQPVWFSTIKQMFGYTKLPEEPKGIRVIYVTDMGNVTDWTNPNA
FT                   DTEWMDAKKAFYVIDSGFIGGMGAEDALPFGNKEQAEKFAKDKGGKVVGFDDMPDTYIF
FT                   K"
FT   CDS_pept        complement(503451..505208)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0464"
FT                   /product="putative electron transfer
FT                   flavoprotein-ubiquinone oxidoreductase"
FT                   /function="Dehydrogenases (flavoproteins)"
FT                   /EC_number="1.5.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04356"
FT                   /db_xref="GOA:C6S5K1"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5K1"
FT                   /protein_id="CBA04356.1"
FT                   /translation="MVFRRPLLYLVTICSRCIITDLQFNNKYTGTAMTESITRDSMQYD
FT                   VVIVGAGPSGLSAAIKLKQLAEKNGREISVCVVEKGSEAGAHSLAGAVIDPIALNELIP
FT                   DWKEKGAPLTRAVTQDKVLFLTEKKAFNLPITPNFDNHGNYIVSLGEVVRWLAEQAENM
FT                   GVEIYPGFAAAEVLYHEDGSVKGIATGNMGIGKDGEPTDSFQPGMELWAQQTLFAEGCR
FT                   GSLSKQIIERFKLDQNSQPQTYGLGIKEVWEVPSEQHQPGLVVHSAGWPLDSKTYGGAF
FT                   VYHFDDNKVAVGFVVGLDYQNPYLSPFEEFQRFKTHPEIRKTFEGGRRIAYGARSLIEG
FT                   GLQSLPKLSFKGGILVGDAAGFLNMPRIKGIHTAMKSAMLAAEAVFPLLENLEEVEGFD
FT                   SGKEAADYQQRFEQSWLYQELYAARNVRPSFKWGVYLGSIYTGIDQMIFRGKAPWTLKH
FT                   HGKDNEQLKKAAACKPIDYPKPDGVLTFDRLSSVFLANLAHEENQPDHLVLNNPQTMID
FT                   VNYKEYASPETRYCPAGVYEIVEENGNPRLQINAANCVHCKTCDIKDPTQNITWICPEG
FT                   ASGPNYGGM"
FT   CDS_pept        complement(505242..505784)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0465"
FT                   /product="bacteriocin resistance protein, putative"
FT                   /function="Predicted double-glycine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04359"
FT                   /db_xref="GOA:C6S5K2"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5K2"
FT                   /protein_id="CBA04359.1"
FT                   /translation="MQSWKERRDFNIVKQDLDFSCGAASVVTLLNNFYGQKLTEEDVLK
FT                   KLDKEQMPASFEDMRRIMPDLGFEAKGYALSFEQLAQLQISVIVYLKYRKDDHFSVLRG
FT                   IDGNTVSLADPSLGHVSMSRAQFLDAWQTREGNLAGKILAVVPKGRDAGGDKAFFTRSP
FT                   KRQTEFAVGQVKWWRAY"
FT   mobile_element  complement(506857..507509)
FT                   /mobile_element_type="other:IS1016C"
FT                   /locus_tag="NMO_0466"
FT   CDS_pept        508179..508931
FT                   /transl_table=11
FT                   /locus_tag="NMO_0467"
FT                   /product="FrpC operon protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04362"
FT                   /db_xref="InterPro:IPR010692"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5K3"
FT                   /protein_id="CBA04362.1"
FT                   /translation="MTSCEPVNEKTDQKAVSAQQAKEQTSFNNPEPMTGFEHTVTFDFQ
FT                   GTKMVIPYGYLARYTQDNATKWLSDTPGQDAYSINLIEISVYYKKTDQGWVLEPYNQQN
FT                   KAHFIQFLRDGLDSVDDIVIRKDACSLSTTMGERLLTYGVKKMPSAYPEYEAYEDKRHI
FT                   PENPYFHKLYYIKKGENPAIITHRNNRINQTEEDNYSTGVGSCINGFPVRYYPFIREKQ
FT                   QLTQQELVGYHQQVEQLVQSFVNNPSKK"
FT   mobile_element  complement(508956..509621)
FT                   /mobile_element_type="other:ISHpa1"
FT                   /locus_tag="NMO_0468"
FT   CDS_pept        509767..510519
FT                   /transl_table=11
FT                   /locus_tag="NMO_0469"
FT                   /product="FrpC operon protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04365"
FT                   /db_xref="InterPro:IPR010692"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5K4"
FT                   /protein_id="CBA04365.1"
FT                   /translation="MTSCEPVNEKTDQKAVSAQQAKEQTSFNNPEPMTGFEHTVTFDFQ
FT                   GTKMVIPYGYLARYTQDNATKWLSDTPGQDAYSINLIEISVYYKKTDQGWVLEPYNQQN
FT                   KAHFIQFLRDGLDSVDDIVIRKDACSLSTTMGERLLTYGVKKMPSAYPEYEAYEDKRHI
FT                   PENPYFHEFYYIKKGENPAIITHWNNRVNQAEEDNYSTSVGSCINGFTVQYYPFIREKQ
FT                   QLTQQELVGYHQQVEQLVQSFVNNSSKK"
FT   CDS_pept        510536..516244
FT                   /transl_table=11
FT                   /gene="frpC1"
FT                   /locus_tag="NMO_0470"
FT                   /product="putative RTX-family exoprotein"
FT                   /function="RTX toxins and related Ca2+-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04368"
FT                   /db_xref="GOA:C6S5K5"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003995"
FT                   /db_xref="InterPro:IPR010566"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5K5"
FT                   /protein_id="CBA04368.1"
FT                   /translation="MNEGEVVLTPEQIQTLRGYASRGDTYGGWRYLANLGDRYADDAAA
FT                   IVGKDANLNGLNLWMKKGVENLWDDTVGKKTRLEKFDRVALQHFRQYARLINENNGRLP
FT                   NTSEIERSYYKAVTDNGVSSSAAIDLVINRSLPDMADGYWALGLGIEAERIHNEQAVNN
FT                   PNGSEWDNRKQLISALDKGFDGSFKEKPFTFLQSVIMDVTKLSVEYTIDGWQKIGGWGN
FT                   GIINDLYKSVAKREWTGIFEIVNNNIKQFRDLFPNPEGWIDDGHQCFAPWVKETKKRNG
FT                   KYHVYDPLALDLDGDGIETVATKGFAGSLFDHTNNGIRTATGWVSADDGLLVRDLNGNG
FT                   IIDNGAELFGDNTKLADGSFAKHGYAALAELDSNGDNIINAADAAFQTLRVWQDLNQDG
FT                   ISQANELRTLEELGIQSLDLAYKDVNKNLGNGNTLAQQGSYTKTDGTTAKMGDLLLAAD
FT                   NLHSRFKDKVELTAEQAKAANLAGIGRLRDLREAAALSGDLANMLKAYSAAETKEAQLA
FT                   LLDNLIHKWAETDSNWGKKSPMRLSTDWTQTANEGIALTPSQVAQLKKNALVSLSDKAK
FT                   AAIDTARDRIAVLDAYTGQDSSTLYYMSEEDALNIVKVTNDTYDHLAKNIYQNLLFQTR
FT                   LQPYLNQISFKMENDTFTLDFSGLVQAFNHVKETNPQKAFVDLAEMLAYGELRSWYEGR
FT                   RLMADYVEEAKKAGKFEDYQKVLGQETVALLAKTSGTQADDILQNVGFGHNKNVSLYGN
FT                   DGNDTLIGGAGNDYLEGGSGSDTYVFGKGFGQDTVYNYDYATGRKDIIRFTDGITADML
FT                   TFTREGNHLLIKAKDGSGQVTVQSYFQNDGSGAYRIDEIHFDNGKVLDVATVKELVQQS
FT                   TDGSDRLYAYQSGNTLNGGLGDDYLYGADGDDLLNGDAGNDSIYSGNGNDTLDGGEGND
FT                   ALYGYNGNDVLNGGEGNDHLNGEDGNDTLIGGAGNDYLEGGSGSDTYVFGEGFGQDTVY
FT                   NYDYATGRKDIIRFTDGITADMLTFTREGNHLLIKAKDDSGQVTVQSYFQNDGSGAYRI
FT                   DEIHFDNGKVLDVATVKKLVQQSTDGSDRLYAYQSGNTLNGGLGDDYLYGADGDDLLNG
FT                   DAGNDSIYSGNGNDTLDGGEGNDALYGYNGNDVLNGGEGNDHLNGEDGNDTLIGGAGND
FT                   YLEGGSGSDTYVFGEGFGQDTVYNYDYATGRKDIIRFTDGITADMLTFTREGNHLLIKA
FT                   KDDSGQVTVQSYFQNDGSGAYRIDEIHFDNGKVLDVATVKKLVQQSTDGSDRLYAYQSG
FT                   NTLNGGLGDDYLYGADGDDLLNGDAGNDSIYSGNGNDTLNGGEGNDALYGYNGNDVLNG
FT                   GEGNDHLNGEDGNDTLIGGAGNDYLEGGSGSDTYVFGKGFGQDTVYNYDYATGRKDIIR
FT                   FTDGITADMLTFTREGNHLLIKAKDDSGQVTVQSYFQNDGSGAYRIDEIHFDNGKVLDV
FT                   ATVKELVQQSTDGSDRLYAYQSGNTLNGGLGDDYLYGADGDDLLNGDAGNDSIYSGNGN
FT                   DTLNGGEGNDALYGYNGNDVLNGGEGNDHLNGEDGNDTLIGGAGNDYLEGGSGSDTYVF
FT                   GKGFGQDTVYNYDYATGRKDIIRFTDGITADMLTFTREGNHLLIKAKDGSGQVTVQSYF
FT                   QNDGSGAYRIDEIHFDNGKVLDVATVKELVQQSTDGSDRLYAYQSGNTLNGGLGDDYLY
FT                   GADGNDLLNGDAGNDSIYSGNGNDTLNGGEGNDALYGYNGNDALNGGEGNDHLNGEDGN
FT                   DTLIGGAGNDYLEGGSGSDTYVFGKGFGQDTVYNYHVDKNSDTMHFKGFKAADVHFIRS
FT                   GSDLVLSASEQDNVRISGFFYGENHRVDTFVFDDAAISNPDFAKYINAGNNLVQSMSVF
FT                   GSNTAATGGNVDANIQSVQQPLLVTPSA"
FT   CDS_pept        complement(516524..517438)
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="NMO_0471"
FT                   /product="putative periplasmic solute binding protein"
FT                   /function="ABC-type metal ion transport system periplasmic
FT                   component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04371"
FT                   /db_xref="GOA:C6S5K6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5K6"
FT                   /protein_id="CBA04371.1"
FT                   /translation="MKHLKLTLIAALLTTAATAAPLPVVTSFSILGDVAKQIGGERVSI
FT                   QSLVGANQDTHAYHMTSSDIKKIRSAKLVLLNGLGLEAADVQRAVKQSKVSYAEATKGI
FT                   QPLKAEEEGGHHHDHDHDHEGHHHDHGEFDPHVWNDPVLMSAYAQNVAEALIKADPEGK
FT                   VYYQQRLGNYQMQLKKLHSDAQAAFNAVPAAKRKVLTGHDAFSYMGKRYHIEFIAPQGV
FT                   SSEAEPSAKQVAAIIRQIKREGIKAVFTENIKDTRMVDRIAKETGVNVSGKLYSDALGN
FT                   APADTYIGMYRHNIKALINAMKQ"
FT   CDS_pept        complement(517515..518390)
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="NMO_0472"
FT                   /product="putative ABC transporter permease protein"
FT                   /function="ABC-type Mn2+/Zn2+ transport systems permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04374"
FT                   /db_xref="GOA:C6S5K7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5K7"
FT                   /protein_id="CBA04374.1"
FT                   /translation="MNLYDLLLAPFAEFDFMRYALASVFCLSLSAAPVGVFLVMRRMSL
FT                   IGDALSHAVLPGAAVGYMFAGLSLPAMGLGGVAAGMLMALLAGLVSRFTTLKEDANFAA
FT                   FYLSSLAIGVVLVSKNGSSVDLLHLLFGSVLAVDIPALQLIAAVSSLTLITLAVIYRPL
FT                   VLESIDPLFLKSVGGKGGLWHVLFLVLVVMNLVSGFQALGTLMSVGLMMLPAITARLWA
FT                   KHMGALILLSVLTALLCGLSGLLISYHIEIPSGPAIILCCSVLYLFSVILGKEGGILTK
FT                   WLKNHRHHTT"
FT   CDS_pept        complement(518425..519180)
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="NMO_0473"
FT                   /product="putative transport protein ATP-binding"
FT                   /function="ABC-type Mn/Zn transport systems ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04377"
FT                   /db_xref="GOA:C6S5K8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5K8"
FT                   /protein_id="CBA04377.1"
FT                   /translation="MGRLLLGSIRMSIIVENLTVSYRRRPAVHHVDITFEEHSMWAVFG
FT                   PNGAGKSTFLKSLMGLQPIDTGSIRLDGLSRQDIAYLPQQSDIDRSQPMTVFDLAAMGL
FT                   WYEIGFFKGINTAQKQRVHESLERVGMRQFAGRQIAHLSNGQFQRVLFARMLVQNAKFL
FT                   LLDEPFNAVDARTTYELLDVLQKCHCGGHAIIAVLHDYEQVRAYFPSTLLLAREKIAAG
FT                   ATETILTEPYLAQANAKMQQQESPDWCAS"
FT   CDS_pept        complement(519472..519837)
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="NMO_0474"
FT                   /product="50S ribosomal protein L19"
FT                   /function="Ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04380"
FT                   /db_xref="GOA:C6S5K9"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5K9"
FT                   /protein_id="CBA04380.1"
FT                   /translation="MNLIQQLEQEEIARLNKEIPEFAPGDTVVVSVRVVEGTRSRLQAY
FT                   EGVVIARRNRGLNSNFIVRKISSGEGVERTFQLYSPTVEKIEVKRRGDVRRAKLYYLRG
FT                   LTGKAARIKEKLPARKG"
FT   CDS_pept        complement(519853..520602)
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="NMO_0475"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /function="tRNA-(guanine-N1)-methyltransferase"
FT                   /EC_number="2.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04383"
FT                   /db_xref="GOA:C6S5L0"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5L0"
FT                   /protein_id="CBA04383.1"
FT                   /translation="MLIQAVTIFPEMFDSITRYGVTGRANRQGIWQFEAVNPRKFADNR
FT                   LGYIDDRPFGGGPGMIMMAPPLHAAIEHAKAQSSQAAKVIYLSPQGKPLTHPKAAELAE
FT                   LPHLILLCGRYEGIDERLLQTSVDEEISIGDFVVSGGELPAMMLMDAVLRLVPGVLGDM
FT                   QSAEQDSFSSGILDCPHYTKPLEFQGMAVPEVLRSGNHGLIAEWRLEQSLRRTLERRPD
FT                   LLEKRVLIPKESRLLETIRQEQREIQS"
FT   CDS_pept        complement(520602..521111)
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="NMO_0476"
FT                   /product="16S rRNA processing protein"
FT                   /function="RimM protein required for 16S rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04386"
FT                   /db_xref="GOA:C6S5L1"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5L1"
FT                   /protein_id="CBA04386.1"
FT                   /translation="MTDTQNRVAMGYIKGVFGIKGWLKIAANTEYSDSLLDYPEWHLVK
FT                   DGKTISVTLEAGKVVNGELQVKFEGINDRDLAFSLRGYTIEIPREAFAPTEEDEYYWTD
FT                   LVGMTVVNKDHTVLGKVSNLMETGANDVLMIDGEHGQILIPFVSQYIETVDTGSKIITA
FT                   DWGLDY"
FT   CDS_pept        complement(521127..521372)
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="NMO_0477"
FT                   /product="30S ribosomal protein S16"
FT                   /function="Ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04389"
FT                   /db_xref="GOA:C6S5L2"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5L2"
FT                   /protein_id="CBA04389.1"
FT                   /translation="MVVIRLARGGSKHRPFYNVIVTDSRSRRDGRFIERVGFYNPVANE
FT                   KQERVRLNADRLNHWIAQGAQVSDSVAKLIKEQKAA"
FT   CDS_pept        complement(521417..523843)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0478"
FT                   /product="putative N-acetyltransferase"
FT                   /function="Acyl-CoA synthetase (NDP forming)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04392"
FT                   /db_xref="GOA:C6S5L3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5L3"
FT                   /protein_id="CBA04392.1"
FT                   /translation="MSAQTDPGYFFMPNHIILIGASERPYSLGERVLSNLLSTPFQGKI
FT                   TPVNPRHHTIAGLPAYTSLNKIPGNADLIIAVTLPDSYDTLFKTCRKKQLRHIILIQDW
FT                   DSLSAAELHTAETAIRKHHGNGLNITACTTAGIQLPSLGLNISTQDGYAAGHTAILTGN
FT                   AAVSRQIDNILNKLRQGTSRHISLHPGISPITSADWLNRFGHSLHTKTAVLHHNPEEDQ
FT                   RKLFSAIRQFTRHTPLILHITCRTTETDRAVLHCLARHCNFLISFNADDLEAALRAQLS
FT                   DLPPLSRLDILSDTPAEWLNAHAPKTLALHFPNLPHHIRNGHLTGTPTPSICHDIASRQ
FT                   LARPDTQAVLTILSPSGHEDYKKTARALIRLSEQTAKPLLVSSPFSDGITHFDTPTQAI
FT                   RTLSYRNTAAALKQAQLDIAPPQPCRLKTPQPQNIKKALAAANPSLLAEALHLPPYRHT
FT                   THNAVQFQFGSHPIYGNILTVRYAGQTTAALPPFTTQDSLHIAQFAELEDPQTLNQFLH
FT                   ILTTLSDHNLHIGKITLNLNGGQYSSDFILKTPETHDTPKRKNTGKAAQTLEHAAAKMQ
FT                   SAAAYLKHKNPTAAEFLRHTSEAAAELLGSKTETGAAVPNVLAPYPAAHPKTLSLKNNT
FT                   TVTITPLLPEDAEAKQQFVRSLGPEARYTRFMTHTNELPAATLARLCNPDYHCEAAWTA
FT                   KDADSNIVAVVRHSRLNRNECEFGITLAEHMRGSGLAQKMMELIIQTAAQQGYRTMSAD
FT                   ILKTNTPMIKLAEKSGFTLKESDTEKNLYRAYLNLAADKTTEKTNKNLRTDHKIT"
FT   CDS_pept        complement(523961..525367)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0479"
FT                   /product="sensor histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04395"
FT                   /db_xref="GOA:C6S5L4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5L4"
FT                   /protein_id="CBA04395.1"
FT                   /translation="MKLFQRIFATFCAVIVCAIFVASFSFWLVQNTLAENQFNQRRTIE
FT                   TTLMGSIISAFRARGDAGAREILTEWKDSPVSSGVYVIQGDEKKDILNRYIDSYTIERA
FT                   RLFAAGHPHSNLVHIEYDRFGEEYLFFTKDWDKLQARRLPSPLLIPGLPLAPIWHELII
FT                   LSFIIIVGLLMAYILAGNIAKPIRILGNGMDRVANGELETRISQQVDDRDDELSHLAIQ
FT                   FDKMVEKLEKLVAKERHLLHHVSHEMRSPLARMQAIVGLIQAQPQKQEQYLKRLEGELT
FT                   RMDTLAGELLTLSRLETSNMALEKESLKLLPFLGNLVEDNQSIAQKNGQTVTLSADGKI
FT                   PENTTILANESYLYRAFDNVIRNAVNYSPEGSTILINIGQDHKHWIIDVTDNGPGVDEM
FT                   QLPHIFTAFYRADSSANKPGTGLGLALTQHIIEQHCGKIIAENIKPNGLRMRFILPKKK
FT                   TGSKTEKSAN"
FT   CDS_pept        complement(525381..526058)
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="NMO_0480"
FT                   /product="putative two-component system response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04398"
FT                   /db_xref="GOA:C6S5L5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5L5"
FT                   /protein_id="CBA04398.1"
FT                   /translation="MSRVLLVDDDALLTELLTEYLSAEGLNVRSVPDGEAGVQEILSGQ
FT                   YDVVVLDSMMPKMNGLDVLKNVRARSTVPIIMLTAKGDDIDRIIGLEMGADDYVPKPCT
FT                   PRELLARINAILRRAQHSGEQNNAPNSISVSDVVLYPAKRQASVKDMPLELTSTEFNLL
FT                   EVLMRHAGQVVSKETLSVEALDRKLAKFDRSIDVHISSIRHKLGDASLIQTVRGLGYLF
FT                   VKN"
FT   CDS_pept        complement(526248..528062)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0481"
FT                   /product="O-antigen polymerase family protein"
FT                   /function="Lipid A core - O-antigen ligase and related
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04401"
FT                   /db_xref="GOA:C6S5L6"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5L6"
FT                   /protein_id="CBA04401.1"
FT                   /translation="MPAETTVSGARPAAKLPIYILPCFLWIGIVPFTFALKLKPSPDFY
FT                   HDAAAAAGLIVLLFLTAGKKLFDVKIPAISFLLFAMAAFWYLQARLMNLIYPGMNDIVS
FT                   WIFILLAVSAWACKSLVAHFGQERIVTLFAWSLLIGSLLQSCIVVIQFAGWEDTPLLQN
FT                   IIVYSGQGVIGHIGQRNNLGHYLMWGILAAAYLNGQRKIPAALGAICLIMQTAVLGLVN
FT                   SRTILTYIAAIALILPFWYFRSDKSNRRTMLGIAAAVFLTALFQFSMNTILETFTGIRY
FT                   ETAVERVANGGFTDLPRQIEWNKALAAFQSAPIFGHGWNSFAQQTFLINAEQHNIYDNL
FT                   LSNLFTHSHNIVLQLLAEMGISGTLLVAATLLTGIAGLLKRPLTPASLFLICTLAVSMC
FT                   HSMLEYPLWYVYFLIPFGLMLFLSPAEASDGIAFKKAANLGILTASTAIFAGLLHLDWT
FT                   YTRLVNAFSPATDDSAKTLNRKINELRYISANSPMLSFYADFSLVNFALPEYPETQTWA
FT                   EEATLKSLKYRPHSATYRIALYLMRQGKVAEAKQWMRATQSYYPYLMPRYADEIRKLPV
FT                   WAPLLPELLKDCKAFAAAPGHPEAKPCK"
FT   CDS_pept        complement(528052..528405)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0482"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04404"
FT                   /db_xref="GOA:C6S5L7"
FT                   /db_xref="InterPro:IPR018643"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5L7"
FT                   /protein_id="CBA04404.1"
FT                   /translation="MNRQTAYLLTSFSLIALIILSLSWELWIAPLRPGGSWLALKALPL
FT                   CLPLSGILKKKIYTYQYSSMLVLIYFAEAVMRLFDAYPAEQICAALSAVFSIIFFISCL
FT                   SFVKQYKETNNAR"
FT   CDS_pept        complement(528414..528983)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0483"
FT                   /product="Maf-like protein"
FT                   /function="Nucleotide-binding protein implicated in
FT                   inhibition of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04407"
FT                   /db_xref="GOA:C6S5L8"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5L8"
FT                   /protein_id="CBA04407.1"
FT                   /translation="MEILTQLGYRVIQLPAGIDESVKADETPACYVQRMAAEKNQTALA
FT                   LFLETNGAMPDFPLITADTCVVSDGIILGKPRSQAEAIEFLNRLSGKQHTVLTAVCIHY
FT                   RGKTSSRVQTNRVVFKPLSSEEISAYVQSGEPMDKAGAYAVQGIGGIFIQSIEGSFSGI
FT                   MGLPVYETVSMLQDLGYRSPLSALKP"
FT   CDS_pept        complement(529075..529845)
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="NMO_0484"
FT                   /product="Sec-independent protein translocase protein TatC"
FT                   /function="Sec-independent protein secretion pathway
FT                   component TatC"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04410"
FT                   /db_xref="GOA:C6S5L9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5L9"
FT                   /protein_id="CBA04410.1"
FT                   /translation="MSETQNEQPVQPLVEHLIELRRRLMWTVVGILVCFFGLMPFAQQL
FT                   YTFIADPLMANLPKDTSMIATDVIAPFFVPVKVTLMAAFLISLPHTLYQIWAFVAPALY
FT                   QNEKRLITPLVLSSVSLFFIGMAFAYFLVFPVIFKFLAGVTPVGVNMATDIDKYLSFIL
FT                   GMFVAFGTTFEVPIVVILLTKIGVVTTGQLKYARPYVIVGAFVIAAIITPPDVISQTLL
FT                   AIPLILLYEAGIWFGRFFTPRSEQDGDIQPPATT"
FT   CDS_pept        complement(529859..530545)
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="NMO_0485"
FT                   /product="Sec-independent protein translocase protein"
FT                   /function="Sec-independent protein secretion pathway
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04413"
FT                   /db_xref="GOA:C6S5M0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5M0"
FT                   /protein_id="CBA04413.1"
FT                   /translation="MFDFGLGELVFVGIIALIVLGPERLPEAARTAGRLIGRLQRFVGS
FT                   VKQEFDTQIELEELRKAKQEFEAAAAQVRDSLKETGTDMEGNLHDISDGLKPWEKLPEQ
FT                   RTPADFGVDENGNPLPDAANTLSDGISDVMPSERSYASAETLGDSGQTGSTAEPAETDQ
FT                   DRAWREYLTASAAAPVVQTVEVSYIDTAVETPVPHTTSLRKQAISRKRDFRPKHRAKPK
FT                   LRVRKS"
FT   CDS_pept        complement(530549..530752)
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="NMO_0486"
FT                   /product="Sec-independent protein translocase protein"
FT                   /function="Sec-independent protein secretion pathway
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04416"
FT                   /db_xref="GOA:C6S5M1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5M1"
FT                   /protein_id="CBA04416.1"
FT                   /translation="MGSFSLTHWIIVLIIVVLIFGTKKLRNVGKDLGGAVHDFKQGLNE
FT                   GTDGKEAQKDDVIEHKKDEDKA"
FT   CDS_pept        complement(530799..531122)
FT                   /transl_table=11
FT                   /gene="hitA"
FT                   /locus_tag="NMO_0487"
FT                   /product="HIT family hydrolase"
FT                   /function="Diadenosine tetraphosphate (Ap4A) hydrolase and
FT                   other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04419"
FT                   /db_xref="GOA:C6S5M2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5M2"
FT                   /protein_id="CBA04419.1"
FT                   /translation="MDNCIFCKIAAKDIPAQTVYEDGEMVCFKDINPAAPVHLLLIPKV
FT                   HFDSLAHAAPEHQPLLGKMMLKVPEIAKAAGLADGFKTLINTGKGGGQEVFHLHIHIMG
FT                   TPV"
FT   CDS_pept        complement(531194..531517)
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="NMO_0488"
FT                   /product="Phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04422"
FT                   /db_xref="GOA:C6S5M3"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5M3"
FT                   /protein_id="CBA04422.1"
FT                   /translation="MGDSVLSAIQQTITQRKSANPSESYVAQLLHKGEDKILKKVIEEA
FT                   GEVLMASKDKNPSHLVYEVADLWFHTMILLTHHDLKAEDVLDELARRQGLSGLAEKAAR
FT                   TES"
FT   CDS_pept        complement(531658..532722)
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="NMO_0489"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /function="Threonine dehydrogenase and related Zn-
FT                   dependent dehydrogenases"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04425"
FT                   /db_xref="GOA:C6S5M4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5M4"
FT                   /protein_id="CBA04425.1"
FT                   /translation="MKAARFYDKGDIRIEDIPEPTVAPGTVGINVAWCGICGTDLHEFM
FT                   EGPIFIPPCGHPHPISGESAPVTMGHEFSGVVYAVGEGVDDIKVGQHVVVEPYIIRDDV
FT                   PTGEGSNYHLSKDMNFIGLGGCGGGLSEKIAVKRRWVHPISDKIPLDQAALIEPLSVGH
FT                   HAYVRSGAKAGDVALVGGAGPIGLLLAAVLKAKGIKVIITELSKARKDKARESGVADYI
FT                   LDPSEVDVVEEVKKLTNGEGVDVAFECTSVNKVLDTLVEACKPAANLVIVSIWSHPATV
FT                   NVHSVVMKELDVRGTIAYCNDHAETIKLVEEGKINLEPFITQRIKLDELVSEGFERLIH
FT                   NNESAVKIIVSPNL"
FT   CDS_pept        complement(533085..534194)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0490"
FT                   /product="histone deacetylase family protein"
FT                   /function="Deacetylases including yeast histone deacetylase
FT                   and acetoin utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04428"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5M5"
FT                   /protein_id="CBA04428.1"
FT                   /translation="MSLTRLILKFYALLRLFLGKNARTAWISHPACAGHEPGANHPDSP
FT                   DRILCIEQALRRAGIWQHLQTIEAEEISDTRLALVHSSKYLNRLESCQPQKGKIFRLDD
FT                   DTAISTGSLSAARFAAGSAVQAVDMVMNRKAWHAFCAARPPGHHAGSGKAGGFCLLNNV
FT                   AAGVMHAIAEYRLKRIAVIDFDVHYGDGTAEIFKDDPRILFFNLFETDLFPFPENNDMP
FT                   DGGNMVHLPLPPGTGSRTFREAVRRQWLPRLATFKPELVLLSAGFDAHRLDESGRLNLH
FT                   EADFAWLTHKIIQTASGCPGKIVSVLEGGYTLEPLAQSAAEHIRVLAGLGKSDAATAYQ
FT                   KTLDPTKKRFAKPKTGQVRQPTQSDRYDI"
FT   CDS_pept        534322..534588
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="NMO_0491"
FT                   /product="preprotein translocase YajC subunit"
FT                   /function="Preprotein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04431"
FT                   /db_xref="GOA:C6S5M6"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5M6"
FT                   /protein_id="CBA04431.1"
FT                   /translation="MNQAVAQFAPLVLIMVVFYFLIMRPQQKKFKAHQAMLAALKVGDK
FT                   VVLAAGFKGKVTRVGEQFFTVDIGQGTKIEVEVERNAIAAKVD"
FT   CDS_pept        534800..536653
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="NMO_0492"
FT                   /product="protein-export membrane protein SecD"
FT                   /function="Preprotein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04434"
FT                   /db_xref="GOA:C6S5M7"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5M7"
FT                   /protein_id="CBA04434.1"
FT                   /translation="MNRYPLWKYLLIVFTIAVAAVYSLPNLFGETPAVQVSTNRQAIII
FT                   NEQTQFKVDAALKNAGIQTDGMFVVDNSLKVRFKDTETQLKARDVIENTLGEGYITALN
FT                   LLADSPEWMAKIKANPMFLGLDLRGGVHFTMQVDMKAAMQKTFERYSGDIRRELRREKI
FT                   RSGTVRQAGNSLTVPLQDAGDVQKALPQLRKLFPEATLNSDGSNIVLTLSEEAVNKVRS
FT                   DAVKQNITTLHNRVNELGVAEPVIQQSGADRIVVQLPGVQDTAKAKDIIGRTATLELRM
FT                   VEDDPAKLREALEGNVPSGYELLSSGGDRPETLLISKQVELTGDNINDAQPSFDQMGAP
FT                   AVSLSLDSAGGSIFGELTAANVGKRMAMVLIDQGKSEVVTAPVIRTAITGGRVEISGSM
FT                   TTAEANDTSLLLRAGSLAAPMQIVEERTIGPSLGKENIEKGFHSTLWGFAIVAAFMVVY
FT                   YRLMGFFSTIALSANILFLIGILSAMQATLTLPGMAALALTLGMAIDSNVLINERIREE
FT                   LRAGVPPQQAINLGFQHAWATIVDSNLTSLIAGIALLVFGSGPVRGFAVVHCLGILTSM
FT                   YSSVVVFRALVNLWYGRRRKLQNISIGAVWKPEAETAAGKE"
FT   CDS_pept        536657..537592
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="NMO_0493"
FT                   /product="protein-export membrane protein SecF"
FT                   /function="Preprotein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04437"
FT                   /db_xref="GOA:C6S5M8"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5M8"
FT                   /protein_id="CBA04437.1"
FT                   /translation="MELFKIKRDIPFMSYGKLTTFISLVTFIAAVFFLVTRGLNFSVEF
FT                   TGGTVMEVQYQQGADVNKMRERLDTLKIGDVQVQALGTNKHIMIRLPNKEGVTSAQLSN
FT                   QVMDLLKKDSPDVTLRQVEFIGPQVGEELVSNGLMALGFVVIGIIIYLSMRFEWRFAVS
FT                   AIIANMHDIVIILGCFAFFQWEFSLTVLAGILAVLGYSVNESVVVFDRIRENFRKPAMR
FT                   GHAVPEVIDNAITATMSRTIITHGSTEAMVVSMLVFGGAALHGFSMALTIGIVFGIYSS
FT                   VLVASPLLLMFGLSRDNIGKEPKKKEEIVV"
FT   CDS_pept        537815..538084
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="NMO_0494"
FT                   /product="30S ribosomal protein S15"
FT                   /function="Ribosomal protein S15P/S13E"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04440"
FT                   /db_xref="GOA:C6S5M9"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5M9"
FT                   /protein_id="CBA04440.1"
FT                   /translation="MALTVEQKAQIVKDFQRKEGDTGSSEVQVALLTFRINDLTPHFKA
FT                   NPKDHHSRRGLLKMVSQRRRLLAYLRRTQPDTYRALITRLGLRK"
FT   CDS_pept        538112..538288
FT                   /transl_table=11
FT                   /locus_tag="NMO_0495"
FT                   /product="hypothetical protein"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04443"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5N0"
FT                   /protein_id="CBA04443.1"
FT                   /translation="MGGVFFSVAFRQAQIHIYSGLNLNQDKATKPQTVQIVRQGKATLY
FT                   WFKFNPLYCPKTA"
FT   CDS_pept        538465..539589
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="NMO_0496"
FT                   /product="putative polyamine transport ATP-binding protein"
FT                   /function="ABC-type spermidine/putrescine transport systems
FT                   ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04446"
FT                   /db_xref="GOA:C6S5N1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5N1"
FT                   /protein_id="CBA04446.1"
FT                   /translation="MTATTASSTKPYLQIQGLVKKFGDNYAVDNIDLDIYQHEIFALLG
FT                   SSGSGKSTLLRMLAGMESPNQGKIILDGQDITKLAPYDRPINMMFQSYALFPHMSVEQN
FT                   IAFGLKQDKMPKGEIAARVEEMLRLVQMTKFAKRKPHQLSGGQQQRIALARSLAKRPKI
FT                   LLLDEPLGALDKKLRQQTQLELVNTLEQVGVTCIMVTHDQEEAMTMATRIAIMSDGQLQ
FT                   QVGTPSDVYDYPNSRFTAEFIGETNIFDGVVIEDHADYAVIECEGLENHVRIDHGLGGP
FT                   SEQDLWVSIRPEDIDLYKEKPEYLGDYNWAKGTVKEIAYLGSFAIYHIKLGNGRVVKSQ
FT                   VPAPYWYVRNITPPTWDETVYISWPENQPTPLFR"
FT   CDS_pept        539605..540570
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="NMO_0497"
FT                   /product="putrescine transport system permease protein"
FT                   /function="ABC-type spermidine/putrescine transport system
FT                   permease component I"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04449"
FT                   /db_xref="GOA:C6S5N2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5N2"
FT                   /protein_id="CBA04449.1"
FT                   /translation="MNLNKLKNKLFRRPGQRAVIAVPYIWLLVLFLIPFAIVLKISFAE
FT                   QEIAIPPFTPLTSIDEDLGRLNIAISYQNYADIFQNFWHTLNPFGDSENSNIYLMTYWS
FT                   SIKTALMTTVICLLVGYPTAYAISRANPSVRNGLLLAIMLPFWTSFLLRVYAWMGLLGH
FT                   NGIVNNLLIKMGIISEPLDLFYNAFSLNLVMVYAYLPFMILPLYTQLVKLDNRLLEAAS
FT                   DLGAGPVKSFLTITLPLSKTGIIAGSMLVFVPAVGEFVIPELVGGSENLMIGKVLWQAF
FT                   FDQNNWPLASAVAVVMVALLVVPIALFQHYENRELEEGAK"
FT   CDS_pept        540570..541457
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="NMO_0498"
FT                   /product="putrescine transport system permease protein"
FT                   /function="ABC-type spermidine/putrescine transport system
FT                   permease component II"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04452"
FT                   /db_xref="GOA:C6S5N3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5N3"
FT                   /protein_id="CBA04452.1"
FT                   /translation="MQKSKLSWFLKLMLALSLAFLYIPLVVLVIYSFNESKLVTVWGGF
FT                   STKWYGALLENDTILEAAWLSLRIAVVSSLAAVVLGTLAGYAMARIKRFRGSTLFAGMI
FT                   SAPMVMPDVITGLSMLLLIIQVQIFLQGSEWLQHLYFDRGFFTIFLGHTTLCMAYITVV
FT                   IRSRLVELDQSLEEAAMDLGARPLKIFFVITLPLIAPAIASGFLLGITLSLDDLVITSF
FT                   LSGPGSSTLPQVIFSKIKLGLDPQMNVLATILIGIIGTLVIIVNYWMMRQATKRDREAA
FT                   EAYRQEKLAAEKAH"
FT   CDS_pept        541547..542878
FT                   /transl_table=11
FT                   /locus_tag="NMO_0499"
FT                   /product="putative amino acid oxidase"
FT                   /function="Glycine/D-amino acid oxidases (deaminating)"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04455"
FT                   /db_xref="GOA:C6S5N4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5N4"
FT                   /protein_id="CBA04455.1"
FT                   /translation="MPSENTPDKVNIMIRPDFQEYLPSYYFSSVNPHTVYPKLQCRLKT
FT                   DTCIIGGGLSGLCTALPLAEQGHETVVLEAARIGFGASGRSGGQVISDYACGMEEIEKQ
FT                   VGLERAQWFWQQSLQAVELVDERVRKHAVDCDWQRGYATVAVRPQHWEELQQWHEHAQR
FT                   HYGASHYQLWDKAELKQQLDSDMYQGAQFDPLSGHLHPLNYTLGIARAAAEAGAQIFEQ
FT                   SPMTRIEPHQNGWLVYTPEGSVECKNLVYAVNTYAGLSPIFKPLERKAIAVSTFIIATE
FT                   PLGARAKGLIRNNMAVCDNRHILDYYRLSADGRLLFGGKDHEFIDDPARMTELVRQDML
FT                   KVFPQLADVRIEYSWGGECDITANLVPHFGRLAANVFYAQGYSGHGMAITGIAGLAVAE
FT                   AILGDECRLKPFERLRQPNIILQPFLRKLGSFLGSKYYQWKDSR"
FT   CDS_pept        complement(543123..544580)
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="NMO_0500"
FT                   /product="ammonium transporter"
FT                   /function="Ammonia permease"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04458"
FT                   /db_xref="GOA:C6S5N5"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5N5"
FT                   /protein_id="CBA04458.1"
FT                   /translation="MRYFHIQTRDWRHIGKIPAPPRSSRACVPPGQAPTPPFRKTGSTI
FT                   KETLIKMKKHIWAASLLPASLSAEPLNWWKPYSAVNSGDTAWVMTAAALVLLMTLPGLA
FT                   LFYGGMVRKKNLLSTMMHSFSIATLVGILWVAVGYSLAFTPGNAFIGGLGRVFLSGMQI
FT                   DAAAQMLTVSPNAPTVPEPVFMFFQMTFAIISTAIITGAFAERMKYSAMMLFSGIWFLL
FT                   VYVPGAHWVWGGGFMSKGGVLDYAGGTVVHINAGIAGLVAALVLGRRIGYGREAMPPHN
FT                   MAMTLIGAAMLWFGWFGFNAGSALAADAAAGMAMAVTQVSAVFGAAGWLACEKIAGHKP
FT                   SALGLASGAVSGLVGITPAAGFTGPSGAAAIGILTAAACFVSVTVVKHKLRYDDSLDAF
FT                   GIHGFGGLVGGILTGIFFDNRIFGGDAAVWQQLWIQVKDGFVMVAYSGLMSWAILKVVG
FT                   KICGGLRVGKDVEREGLDLNIHGERVE"
FT   mobile_element  complement(545554..546087)
FT                   /mobile_element_type="other:ISNme1"
FT                   /locus_tag="NMO_0501"
FT   mobile_element  complement(546115..546519)
FT                   /mobile_element_type="other:ISHpa1"
FT                   /locus_tag="NMO_0502"
FT   CDS_pept        complement(546825..548084)
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="NMO_0503"
FT                   /product="transcription termination factor Rho"
FT                   /function="Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04461"
FT                   /db_xref="GOA:C6S5N6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5N6"
FT                   /protein_id="CBA04461.1"
FT                   /translation="MHVSELQTLHISKLLELAEEHGIENANRFRKQDLVFAIVRQMMKK
FT                   GEGFTCSGTLEILPDGFGFLRSADTSYLAGPDDIYVSPTQIRRFNLHTGDTIEGSVRVP
FT                   KDNERYFALVRLDTINGDHPEVCRHKILFENLTPLFPTEQLKLERDLKSEENLTGRAID
FT                   LISPIGKGQRALLVAPPKSGKTVMLQNIAHAITANYPEVELIVLLIDERPEEVTEMSRS
FT                   VRGEVVSSTFDEPAQRHVQVAEMVLEKAKRMVEHKKDVVILLDSITRLARAYNTVVPTS
FT                   GKILTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVETGSRMDDVIYEEFKGTGN
FT                   MELHLDRRMAEKRLFPAININKSGTRREELLVPNDQLQRMWLLRKFLHPMDEIEAAEFL
FT                   IGKIKASKNNDDFFELMRGK"
FT   CDS_pept        complement(548304..550688)
FT                   /transl_table=11
FT                   /gene="ppsA"
FT                   /locus_tag="NMO_0504"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /function="Phosphoenolpyruvate synthase/pyruvate phosphate
FT                   dikinase"
FT                   /EC_number="2.7.9.2"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04464"
FT                   /db_xref="GOA:C6S5N7"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5N7"
FT                   /protein_id="CBA04464.1"
FT                   /translation="MADNYVIWFENLRMTDVERVGGKNASLGEMISQLTEKGVRVPGGF
FT                   ATTADAYRAFLAHNGLSERISAALAKLDVEDVAELARVGKEIRQWILDTPFPEQLDAEI
FT                   EAAWNKMVADAGGADISVAVRSSATAEDLPDASFAGQQETFLNINGLENVKEAMHHVFA
FT                   SLYNDRAISYRVHKGFEHDIVALSAGVQRMVRSDSGASGVMFTLDTESGYDQVVFVTSS
FT                   YGLGENVVQGAVNPDEFYVFKPTLKAGKPAILRKTMGSKHIKMIFTDKAEAGKSVTNVD
FT                   VPEEDRNRFSITDEEITELAHYALTIEKHYGRPMDIEWGRDGLDGKLYILQARPETVKS
FT                   QEEGSRNLRRFAINGDKTVLCEGRAIGQKVGQGKVRLIKDASEMDSVEAGDVLVTDMTD
FT                   PDWEPVMKRASAIVTNRGGRTCHAAIIARELGIPAVVGCGNATELLKNGQEVTVSCAEG
FT                   DTGFIYAGLLDVQITDVALDNMPKAPVKVMMNVGNPELAFSFANLPSEGIGLARMEFII
FT                   NRQIGIHPKALLEFDKQDDELKAEITRRIAGYASPVDFYVDKIAEGVATLAASVYPRKT
FT                   IVRMSDFKSNEYANLVGGNVYEPHEENPMLGFRGAARYVADNFKDCFALECKALKRVRD
FT                   EMGLTNVEIMIPFVRTLGEAEAVVKALKENGLERGKNGLRLIMMCELPSNAVLAEQFLQ
FT                   YFDGFSIGSNDMTQLTLGLDRDSGLVSESFDERNPAVKVMLHLAISACRKQNKYVGICG
FT                   QGPSDHPDFAKWLVEEGIESVSLNPDTVIETWLYLANELNK"
FT   CDS_pept        551099..551920
FT                   /transl_table=11
FT                   /locus_tag="NMO_0505"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04467"
FT                   /db_xref="GOA:C6S5N8"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5N8"
FT                   /protein_id="CBA04467.1"
FT                   /translation="MSSPRHVFYISDRTGLTAENIGEALLNQFGNLSFKRHTHPFVDTP
FT                   EKARAVVEKVNRSRQENGQRPIAFVSVVDDEIRRIIKGADAFQINFFETFLGLLEKELN
FT                   TEATASEQGHHSIGNTKRYDARMEAVNFSLNHDDGVSDKNLQEADVILMGVSRSGKTPT
FT                   CLYLALQYGIRAANYPLIPDDLESADLPRMVKPYRDKLFGLTIQPERLQAIRQERRPNS
FT                   TYAKIDTCRSEVADAQSMFRRHGIPFANTTDKSVEELAVHILQACKLKRRF"
FT   CDS_pept        complement(552159..552821)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0506"
FT                   /product="phosphoglycolate phosphatase"
FT                   /function="Predicted phosphatases"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04470"
FT                   /db_xref="GOA:C6S5N9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5N9"
FT                   /protein_id="CBA04470.1"
FT                   /translation="MIQAVLFDLDGTLADTALDLGGALNTVLRRHNLPEKSIAEIRPYA
FT                   GHGAAGLLKLGAGITPDHPDYARWRTEYLDEYDRRYAQDTALFDGVDELIAELGRRGIK
FT                   WGIITNKPARFTDKLVPKLGFAVPPAVVVSGDTCGEPKPSVKPMLYACGQIHAEPQHTV
FT                   YVGDAERDIQAGRNAGMKTVLAEWGYISDEDDTDSWQADFHIRTPLDLLECLDKIQP"
FT   CDS_pept        complement(552875..553834)
FT                   /transl_table=11
FT                   /gene="czcD"
FT                   /locus_tag="NMO_0507"
FT                   /product="cation-efflux system"
FT                   /function="Co/Zn/Cd efflux system component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04473"
FT                   /db_xref="GOA:C6S5P0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5P0"
FT                   /protein_id="CBA04473.1"
FT                   /translation="MSHHHEHHHHAHAHTHTANKKVLRVSFIIIAAFMLLEAFGGWLTH
FT                   SLALLSDAGHMFSDAFSLGVALWAFKLGEKETTLQKTFGYKRFEILTAMFNGLSLVVIA
FT                   VLIFYEAVKRLLYPPEIATLGMLVISVVGLLVNIGVAVYMLKNSDTEANVNMRGAYLHV
FT                   LSDLLGSIGAIAAAVLMMAFGWKWADPLASVFVAALVGRSGWSLLKQTLHILMEGAPEN
FT                   IHTDDLLAVIRNTEGVKSVHDLHVWTITSNINVLSCHIVVDGSMTVAESEQIAYRIEHE
FT                   LSHKNIGHCTIQIESERHPHKNEILCSPYAEAHHSHSH"
FT   CDS_pept        complement(553880..554707)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0508"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04476"
FT                   /db_xref="InterPro:IPR007402"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011197"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5P1"
FT                   /protein_id="CBA04476.1"
FT                   /translation="MKLDIYALLERALLSGDPDEKGRLTDEAFAAVQNADGAEANAPPA
FT                   DFPRAGRPDKPVLVAPSQLTPRKMNTTEGYAAMLHAIAHIEFNAVNLALDAAYRFRTLP
FT                   FQFVRDWVKVAKEEVYHFRLMRDRLRAFGFDYGSFEAHNHLWDMAYKTAYDPLLRMALV
FT                   PRVLEARGLDVTPGIRAKVEQRGDSETCGVLDIIYRDEVGHVAIGNHWYQHLCRERGLE
FT                   PVALFRSLIARYDMFIFRGYVNIEAREKAGFSRFELDMLEDFEQGLKQGKKVV"
FT   CDS_pept        555134..555757
FT                   /transl_table=11
FT                   /gene="lolA"
FT                   /locus_tag="NMO_0509"
FT                   /product="outer membrane lipoprotein carrier protein"
FT                   /function="Outer membrane lipoprotein-sorting protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04479"
FT                   /db_xref="GOA:C6S5P2"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR018323"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5P2"
FT                   /protein_id="CBA04479.1"
FT                   /translation="MMKPHNLFQFLAVCSLTVSVASAQAGAVDALKQFNNDADGISGSF
FT                   TQTVQSKKKTQTAHGTFKILRPGLFKWEYTSPYKQTIVGDGQTVWLYDVDLAQVTKSSQ
FT                   DQAIGGSPAAILSNKTALESSYTLKEDGSSNGIDYVLATPKRNNAGYQYIRIGFKGGNL
FT                   AAMQLKDSFGNQTSISFGGLNTNPQLSRGAFKFTPPKGVDVLSN"
FT   CDS_pept        556030..557169
FT                   /transl_table=11
FT                   /locus_tag="NMO_0510"
FT                   /product="putative spermidine/putrescine transport system
FT                   substrate-binding protein"
FT                   /function="Spermidine/putrescine-binding periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04482"
FT                   /db_xref="GOA:C6S5P3"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5P3"
FT                   /protein_id="CBA04482.1"
FT                   /translation="MKKTLVAAAILSLALTACGGGSDTAAQAPSAKPEAEQSGKLNIYN
FT                   WSDYVDPETVAAFEKETGIKTRSDYYDSNETLEAKVLTGKSGYDLTAPSIANVGRQIKA
FT                   GAYQKIDKAQIPHYGNIDKDLLKMMEAVDPGNEYAVPYFWGINTLAINTRQVQKALGTD
FT                   KLPENEWDLVFNPEYTAKLKSCGISYFDSAIEQIPLALHYLGKDPNSENPEDIKAAVDM
FT                   MKAVRGDVKRFSSSGYIDDMAAGNLCAAIGYGGDLNIAKTRAEEAANGVEIKVLTPKTG
FT                   VGVWVDSFMIPRDAQNVANAHRYIDYTLRPEVAAKNGSFVTYAPASRPARELMDEKYTS
FT                   DASIFPNKELMEKSFIVSPKSAESAKLGVKLWQGLKAGK"
FT   CDS_pept        557723..558358
FT                   /transl_table=11
FT                   /locus_tag="NMO_0511"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04485"
FT                   /db_xref="GOA:C6S5P4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5P4"
FT                   /protein_id="CBA04485.1"
FT                   /translation="MPDVVFLNAVKYDKGSVSHFGEDYQPEKILNQSKVEVLKGLCRFR
FT                   KFPGSACNKIIKRELIIKEKLFFEKEVYAEDIEWSMRLFNAATTFSYLDGCYYYYRQGR
FT                   KDSKTGTVSEKSIKSLLYILEKNAEMEFDRDISSYLYSFLSYEYLVLLFIMTSKNIECD
FT                   ADIKRRAYHLRFMLLKSNKLIYKLIFPIITLFGVDITGRILKAIRGNI"
FT   CDS_pept        558399..558929
FT                   /transl_table=11
FT                   /locus_tag="NMO_0512"
FT                   /product="putative transferase"
FT                   /function="Carbonic anhydrases/acetyltransferases
FT                   isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04488"
FT                   /db_xref="GOA:C6S5P5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5P5"
FT                   /protein_id="CBA04488.1"
FT                   /translation="MNAIRTFQNRTPEIHESCMIDEACVVIGEVSLAEDVSVWPCAVLR
FT                   GDVNSITVGARSNIQDGSVLHVSHKTAAKPEGSPLVIGEDVTVGHKVMLHGCRIGNRVL
FT                   VGMGTTVLDDAVIEDEVMIGAGSLVPPRKRLEGGYLYVGSPVRQVRVLTDEEKAFLKYS
FT                   AAHYVKLSKQYGM"
FT   CDS_pept        complement(559294..560889)
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="NMO_0513"
FT                   /product="Peptide chain release factor RF-3"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04491"
FT                   /db_xref="GOA:C6S5P6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5P6"
FT                   /protein_id="CBA04491.1"
FT                   /translation="MSQEILDQVRRRRTFAIISHPDAGKTTLTEKLLLFSGAIQSAGTV
FT                   KGKKTGKFATSDWMDIEKQRGISVASSVMQFDYKDHTVNLLDTPGHQDFSEDTYRVLTA
FT                   VDSALMVIDAAKGVEAQTIKLLNVCRLRNTPIVTFMNKYDREVRDSLELLDEVENILQI
FT                   RCAPVTWPIGMGKNFKGVYHILNDEIYLFEAGGERLPHEFDIIKGIDNPELEQRFPLEI
FT                   QQLRDEIELVQAASNEFNLDEFLAGELTPVFFGSAINNFGIQEILNSLIDWAPAPKPRD
FT                   ATVRMVKPDEPKFSGFIFKIQANMDPKHRDRIAFLRVCSGKFERGMKMKHLRINREIAA
FT                   SSVVTFMSHDRELVEEAYAGDIIGIPNHGNIQIGDSFSEGEQLAFTGIPFFAPELFRSV
FT                   RIKNPLKIKQLQKGLQQLGEEGAVQVFKPMSGADLILGAVGVLQFEVVTSRLANEYGVE
FT                   AVFDSASIWSARWVSCDDKKKLAEFEKANAGNLAIDAGGNLAYLAPNRVNLGLTQERWP
FT                   DIVFHETREHSVKL"
FT   CDS_pept        complement(560996..561391)
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="NMO_0514"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04494"
FT                   /db_xref="GOA:C6S5P7"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5P7"
FT                   /protein_id="CBA04494.1"
FT                   /translation="MDKNLLEAVKFDEKGLVCAIAQDAETKRVLMVAWMNAEALQKTVE
FT                   TGFAHYYSRSRQKQWMKGEESGHTQKVRELRLDCDGDAIVMLIAQNGGIACHTGRESCF
FT                   YKVWRGGAWETADAVLKDEKEIYGSTH"
FT   CDS_pept        complement(561422..562189)
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="NMO_0515"
FT                   /product="cyclase hisF"
FT                   /function="Imidazoleglycerol-phosphate synthase"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04497"
FT                   /db_xref="GOA:C6S5P8"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5P8"
FT                   /protein_id="CBA04497.1"
FT                   /translation="MALAKRIIPCLDVKDGRVVKGVNFIGLRDAGDPVEAAKRYNGEGA
FT                   DELTFLDITASSDNRDTILHIIEEVAGQVFIPLTVGGGVRTVADIRRLLNAGADKVSIN
FT                   TAAVTRPDLIDEAAGFFGSQAIVAAVDAKAVNSENTRWEIFTHGGRNPTGLDAVEWAIE
FT                   MQKRGAGEILLTGMDRDGTKQGFNLPLTRAVAEAVDIPVIASGGVGNVRHLIEGITEGK
FT                   ADAVLAAGVFHFGEIAIREAKRAMREAGIEVRL"
FT   CDS_pept        complement(562202..562939)
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="NMO_0516"
FT                   /product="histidine biosynthesis protein"
FT                   /function="Phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribonucleotide (ProFAR) isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04500"
FT                   /db_xref="GOA:C6S5P9"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5P9"
FT                   /protein_id="CBA04500.1"
FT                   /translation="MLLIPAIDLKEGRCVRLRQGLMEEATVFSDSPAETALHWFEQGAR
FT                   RLHLVDLNGAFAGVPQNLPAIKDILAAVAKDIPVQLGGGIRDLKTIGQYLDLGLNDVII
FT                   GTAAVKNPDFVREACKAFPGRIIVGLDAKDGMAAIDGWATVTGHHVIDLAKRFEDDGVN
FT                   SIIYTDIGRDGMMSGVNIDATVKLAQAVRIPVIASGGLTGLDDIRALCAAEKHGVAGAI
FT                   TGRAIYEGSIDFAQAQQLADSLD"
FT   CDS_pept        complement(562972..563610)
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="NMO_0517"
FT                   /product="amidotransferase"
FT                   /function="Glutamine amidotransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04503"
FT                   /db_xref="GOA:C6S5Q0"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Q0"
FT                   /protein_id="CBA04503.1"
FT                   /translation="MQTAIIDYGMGNLHSVLKSVRTAGQLAGKNTEIFLSGDPERVSRA
FT                   DKVIFPGQGAMPDCMAALTRDGLDEAVKDALKNKPFFGICVGAQLLFDHSEEGNTDGLG
FT                   WFGGKVRRFARDLRDRQGCRLKVPHMGWNTVRQTQNHPLFQGIPQDTRFYFVHSYYFAP
FT                   ENPETILGESDYPSPFACIVGKDNVFATQFHTEKSHDAGLTMLKNFLNW"
FT   CDS_pept        complement(563741..565243)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0518"
FT                   /product="phosphate acetyltransferase"
FT                   /function="Phosphotransacetylase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04506"
FT                   /db_xref="GOA:C6S5Q1"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Q1"
FT                   /protein_id="CBA04506.1"
FT                   /translation="MAKVLIVPVSAGLDASAAAQAFAKALDAEIFQAVDATAETLLAQG
FT                   KSDDWFDALVGKVAALDAANLVIEGIAPDADKIYLAGKNVELALSLDAAAVFAVRSDNA
FT                   DADELANRLNLAKQFFAAAPGVLEGFVVDGAAASVAEAAAEKTGLTFFGSSDALKDVSV
FT                   LAGREAKRLSPAQFRYNLIDFARQADKRIVLPEGAEPRTVQAAAICHEKGIARCVLLAK
FT                   REEVEAVAKERGISLPDSLEIIDPASLVEQYVEPMCELRKSKGLTPEDARKQLQDTVVL
FT                   GTMMMAQNDVDGLVSGAVHTTANTIRPALQLIKTAPGASLVSSVFFMLLPNQVLVFGDC
FT                   AVNPNPTAQQLADIAIQSADSAKAFGIDPKVAMISYSTVNSGSGPDVDTVIEATKLARE
FT                   KRPDLAIDGPLQYDAATVPGVGKSKAPGSPVAGQATVLVFPDLNTGNCTYKAVQRSANV
FT                   LSVGPLLQGLRKPVNDLSRGALVEDIVFTIALTAVQAKQMEG"
FT   CDS_pept        complement(565428..566486)
FT                   /transl_table=11
FT                   /gene="fbpC"
FT                   /locus_tag="NMO_0519"
FT                   /product="iron transport system ATP-binding protein"
FT                   /function="ABC-type spermidine/putrescine transport systems
FT                   ATPase components"
FT                   /EC_number="3.6.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04509"
FT                   /db_xref="GOA:C6S5Q2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041230"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Q2"
FT                   /protein_id="CBA04509.1"
FT                   /translation="MTAALHIGHLSKSFQNTPVLNDISLSLDPGEILFIVGASGCGKTT
FT                   LLRCLAGFEQPDFGEISLSGRTIFSKNTNLPVRERRLGYVVQEGVLFPHLTVYRNTAYG
FT                   LGNGKGKTAQERQRIEAMLELTGISELAGRYPHELSGGQQQRVALARALAPDPELILLD
FT                   EPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTAS
FT                   PHELYRQPADLDAALFIGEGIVFPAALNADGTADCGLGRLPVQSGAPAGTRGTLLIRPE
FT                   QFSLHPHSAPTASIHAVVLKTTPKARHTEISLRVGQTVLTLNLPSAPTLSDGISAVLHL
FT                   DGPALFFPGNTL"
FT   CDS_pept        complement(566507..568024)
FT                   /transl_table=11
FT                   /gene="fbpB"
FT                   /locus_tag="NMO_0520"
FT                   /product="ABC-type Fe3+ transport system, permease
FT                   component"
FT                   /function="ABC-type Fe3+ transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04512"
FT                   /db_xref="GOA:C6S5Q3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Q3"
FT                   /protein_id="CBA04512.1"
FT                   /translation="MSPKKIPIWLTGLILLIALPLTLPFLYVAMRSWQVGINRAVELLF
FT                   RPRMWDLLSNTLTMMAGVTLISIVLGIACALLFQRYRFFGKTFFQTAITLPLCIPAFVS
FT                   CFTWISLTFRVEGFWGTVMIMSLSSFPLAYLPVEAALKRISLSYEEVSLSLGKSRLQTF
FT                   FSAILPQLKPAIGSSVLLIALHMLVEFGAVSILNYPTFTTAIFQEYEMSYNNNTAALLS
FT                   AVLMAVCGIVVFGESIFRGKAKIYHSGKGVARPYPVKTLKLPGQIGAIVFLSSLLTLGI
FT                   IIPFGVLIHWMMVGTSGTFALVSVFDAFIRSLSVSALGAILTILCALPLVWASVRYRNF
FT                   LTVWIDRLPFLLHAVPGLVIALSLVYFSINYTPAVYQTFIVVILAYFMLYLPMAQTTLR
FT                   TSLEQLPKGMEQVGATLGRGHFFIFRTLVLPSILPGITAAFALVFLKLMKELTATLLLT
FT                   TDDVHTLSTAVWEYTSDAQYAAATPYALMLVLFSGIPVFLLKKYAFK"
FT   CDS_pept        complement(568092..569087)
FT                   /transl_table=11
FT                   /gene="fbpA"
FT                   /locus_tag="NMO_0521"
FT                   /product="iron transport system substrate-binding protein"
FT                   /function="ABC-type Fe3+ transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04515"
FT                   /db_xref="GOA:C6S5Q4"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Q4"
FT                   /protein_id="CBA04515.1"
FT                   /translation="MKTSIRYALLAAALTAATPALADITVYNGQHKEAAQAVADAFTRA
FT                   TGIKVKLNSAKGDQLAGQIKEEGSRSPADVFYSEQIPALATLSAANLLEPLPASTINET
FT                   RGKGVPVAAKKDWVALSGRSRVVVYDTRKLSEKDLEKSVLNYATPKWKNRIGYAPTSGA
FT                   FLEQVVAIVKLKGEAAALKWLKGLKEYGKPYAKNSVALQAVENGEIDAALINNYYWHAF
FT                   AREKGVQNVHTRLNFVRHRDPGALVTYSGAAVLKSSQNKDEAKKFVAFLASKEGQRALT
FT                   AVRAEYPLNPHVVSTFNLEPIAKLEAPQVSATTVSEKEHATRLLEQAGMK"
FT   CDS_pept        complement(569420..569803)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04518"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Q5"
FT                   /protein_id="CBA04518.1"
FT                   /translation="MTDTDTQADRFEQMMWQAVDKLFEQHNGKLESMDGREQELVLIWR
FT                   AEADIGNGGILQFVCNWCFPAAEKTSSVLKKIGAIHSAMLIHRAADALDKEIRRLQSEG
FT                   KNLKEMWDITSRQQNRLTAEQSG"
FT   CDS_pept        complement(569860..571236)
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="NMO_0523"
FT                   /product="Argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04521"
FT                   /db_xref="GOA:C6S5Q6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Q6"
FT                   /protein_id="CBA04521.1"
FT                   /translation="MHDKTWSGRFNEPVSELVKQYTASIGFDRRLAEWDIQGSLAHAQM
FT                   LKETGVLDEGDLADIRRGMAEILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRL
FT                   HTGRSRNDQVATDIRLWLRDQITVIQSLIQNLQTALLDLAEQNAETVMPGFTHLQVAQP
FT                   VSFGHHMLAYVEMLGRDNERMADCRRRVNRMPLGAAALAGTTYPIQREITAELLGFEQI
FT                   CQNSLDAVSDRDFAVEFTAAASLVMVHLSRLSEELILWMSPRFGFIDIADRFCTGSSIM
FT                   PQKKNPDVPELVRGKSGRVIGHLIGLITLMKSQPLAYNKDNQEDKEPLFDTADTLIDTL
FT                   RIYADMMRGVTVKPDNMRAAVMQGFATATDLADYLVKKGMPFRDSHEVVAQAVRHADEA
FT                   GVDLSELPLEVLQGFSKLISDDVYGVLTPEGSLNARNHLGGTAPEQVRLQVKRWREVLA
FT                   "
FT   CDS_pept        complement(571255..572124)
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="NMO_0524"
FT                   /product="putative UTP--glucose-1-phosphate
FT                   uridylyltransferase"
FT                   /function="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04524"
FT                   /db_xref="GOA:C6S5Q7"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Q7"
FT                   /protein_id="CBA04524.1"
FT                   /translation="MKPIRKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEA
FT                   VEAGCTEMVFVTGRNKRSIEDHFDKAYELETELEMRHKDKLLEHVRNILPPNITCLYIR
FT                   QAEALGLGHAVLCARAAIGDEPFAVILADDLIDAPKGALKQMVEVYERSGNSILGVETV
FT                   EPSQTGSYGIVETEHLKQFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTGLPR
FT                   GAGNEIQLTDGIAKLLDHEFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETGEPFRR
FT                   LLEKYRTE"
FT   CDS_pept        complement(572152..572751)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0525"
FT                   /product="HAM1-like protein"
FT                   /function="Xanthosine triphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04527"
FT                   /db_xref="GOA:C6S5Q8"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Q8"
FT                   /protein_id="CBA04527.1"
FT                   /translation="MSEKPEKIVLASGNAGKLEEFGNLFKPYSITVLPQSTFGIPECPE
FT                   PYSTFVENALAKARHAAKYSGLPALADDSGICAAALNGAPGIHSARYAGSNPKSDTANN
FT                   LKLAAELAGKADKSCCYVCVLVFVLHKDDPRPIIAEGVWHGQWNGVPAGENGFGYDPYF
FT                   YLPGHGKTAAELDSEVKNRESHRAQALAELLRKLAL"
FT   CDS_pept        complement(572744..572977)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0526"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04530"
FT                   /db_xref="GOA:C6S5Q9"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Q9"
FT                   /protein_id="CBA04530.1"
FT                   /translation="MNRRKIYLLSVALFTLAFMLLVLLGAYLLTVGSKAFAVASFLFAF
FT                   GALFGQIGSLALYLRHKSLRAAQSAAKENRYV"
FT   CDS_pept        complement(573085..573618)
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="NMO_0527"
FT                   /product="Inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04533"
FT                   /db_xref="GOA:C6S5R0"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5R0"
FT                   /protein_id="CBA04533.1"
FT                   /translation="MADFNQILTPGDVDGGIINVVNEIPAGSNHKIEWNRKLAAFQLDR
FT                   VEPAIFAKPTNYGFIPQTLDEDGDELDVLLVTEQPLATGVFLEARVIGVMKFVDDGEVD
FT                   DKIVCVPADDRNNGNAYKTLSDLPQQLIKQIEFHFNHYKDLKKAGTTKVESWGDAEEAK
FT                   KVIKESIERWNKQA"
FT   CDS_pept        complement(573720..574178)
FT                   /transl_table=11
FT                   /gene="ntpA"
FT                   /locus_tag="NMO_0528"
FT                   /product="putative dATP pyrophosphohydrolase"
FT                   /function="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04536"
FT                   /db_xref="GOA:C6S5R1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5R1"
FT                   /protein_id="CBA04536.1"
FT                   /translation="MPMAKPLKYPVSALVVLYSGDGGILLIERTHPKGFWQSVTGSLEP
FT                   GETVAQTAKREVWEETGILLADEQLQDRHDSTVYEIYHHWRHRYPKGVFENREHLFSAE
FT                   IPRDTPIALQPEEHVSYGWFGLEEAAEKVFSPSNRRAILELGRFLGKR"
FT   tRNA            574389..574465
FT                   /locus_tag="NMO_tRNA11"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:574423..574425,aa:Pro)"
FT   CDS_pept        574680..576515
FT                   /transl_table=11
FT                   /gene="mafB3"
FT                   /locus_tag="NMO_0529"
FT                   /product="putative adhesin MafB"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04539"
FT                   /db_xref="InterPro:IPR008106"
FT                   /db_xref="InterPro:IPR029501"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5R2"
FT                   /protein_id="CBA04539.1"
FT                   /translation="MHAHASDLANDSFIRQVLDRQHFEPDGKYHLFGSRGELAERSGHI
FT                   GLGNIQSHQLGNLMIQQAAIKGNIGYIVRFSDHGHEVHSPFDNHASHSDSDEAGSPVDG
FT                   FSLYRIHWDGYEHHPADGYDGPQGGGYPAPKGARDIYSYDIKGVAQNIRLNLTDNRSTG
FT                   QRLADRFHNAGAMLTQGVGDGFKRATRYSPELDRSGNAAEAFNGTADIVKNIIGAAGEI
FT                   VGAGDAVQGISESSNIAVMHGLGLLSTENKMARINDLADMAQLKDYAAAAIRDWAVQNP
FT                   NAAQGIEAVSNIFTAVIPVKGIGAVRGKYGLGGITAHPVKRSQMGAIALPKGKSAVSDN
FT                   FADAAYAKYPSPYHSRNIRSNLEQRYGKENITSSTVPPSNGKNVKLADQRHPKTGVPFD
FT                   GKGFPNFEKHVKYDTKLDIQELSGGGIPKAKPVFDAKPRWEVDRKLNKLTTREQVEKNV
FT                   QETRRRSQSSQFKAHTQREWENKTGLDFNHFIGGDINKKGTVTGGHSLTRGDVRVIQQT
FT                   SAPDKHGVYQATVEIKKPDGSWEMKKGRGGKPMTNHSMFPKDWDEARIRAEVTSAWEKR
FT                   KELEGQKWRGTSKSGVEIEGFTEPNRTAYPLYNSK"
FT   CDS_pept        576542..576961
FT                   /transl_table=11
FT                   /locus_tag="NMO_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04542"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5R3"
FT                   /protein_id="CBA04542.1"
FT                   /translation="MYKIKCFYDQFSSGELFNYCQFLDNSSNQKINTRGTVYQYIIYVL
FT                   TGDLYLQKDIDENLEFIHQAENNPNEVYSGGGQGFCWDISAEKVVFYHNEFDEEDGWPD
FT                   LSCSLHTFKTALIAWNAFLQLPKSIHSVVETVIEE"
FT   CDS_pept        577119..577361
FT                   /transl_table=11
FT                   /locus_tag="NMO_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04545"
FT                   /db_xref="InterPro:IPR028200"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5R4"
FT                   /protein_id="CBA04545.1"
FT                   /translation="MTNLKLDFYSEVIIKDSCPNDLLENGETIKGKKGVVLGISEEDGI
FT                   IYGYTILLFDIKYCIYIDKKYIIPTGKKFSRDDFY"
FT   CDS_pept        577687..578073
FT                   /transl_table=11
FT                   /locus_tag="NMO_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04548"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5R5"
FT                   /protein_id="CBA04548.1"
FT                   /translation="MWKIYKENSTDLNFAIGSIYCQAINLTEFKMWVEKIIREVDLDEI
FT                   PNYFFDLIDFQSLYDLIDIIGFVPENNLSKNQDNALTGIAFLRGIDVYDPPVSKEKALK
FT                   ALEKHPEIYQRFQHFFPFVELPPL"
FT   CDS_pept        578175..578564
FT                   /transl_table=11
FT                   /locus_tag="NMO_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04551"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5R6"
FT                   /protein_id="CBA04551.1"
FT                   /translation="MWKIIKEDSDDLEFAIKCLFSQSIDLNEFKLWIEQVIRDMPIEDI
FT                   PFYIFDLADFDGGIADIDNIVGFVSSYSLSKSKKNALTGIAFLRGIDVYDPPISKEKAL
FT                   KALKKHPEIYQKFQHFFPFVELPPL"
FT   CDS_pept        578680..579129
FT                   /transl_table=11
FT                   /locus_tag="NMO_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04553"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5R7"
FT                   /protein_id="CBA04553.1"
FT                   /translation="MASSSRYRMYWLESDEQKKIIMWKIYKENSTDLNFALGSIYCQAI
FT                   NLTEFKMWVEKIIREMDLDEIPNYFFDLTDLQSLFHLIDIIGFVPENNLSKNQDNALTG
FT                   IAFLRGIDVYDSPISKEKALKALKKHPEIYQRFQHFFPFVELPPL"
FT   CDS_pept        579251..580192
FT                   /transl_table=11
FT                   /gene="mafA2-1"
FT                   /locus_tag="NMO_0535"
FT                   /product="putative adhesin MafA"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04555"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5R8"
FT                   /protein_id="CBA04555.1"
FT                   /translation="MKTLLLLIPLVLTACGTLTGIPAHGGGKRFAIEQELVAASSRAAV
FT                   KEMDLSALKGRKAALYVSVMGDQGSGNISGGRYSIDALIRGGYHNNPESATQYSYPAYD
FT                   TTATTKSDALSSVTTSTSLLNAPAAALTKNSGRKGERSAGLSVNGTGDYRNETLLANPR
FT                   DVSFLTNLIQTVFYLRGIEVVPPEYADTDVFVTVDVFGTVRSRTELHLYNAETLKAQTK
FT                   LEYFAVDRDSRKLLIAPKTAAYESQYQEQYALWMGPYSVGKTVKASDRLMVDFSDITPY
FT                   GDTTAQNRPDFKQNNGKNPDVGNEVIRRRKGG"
FT   CDS_pept        580196..581464
FT                   /transl_table=11
FT                   /gene="mafB11"
FT                   /locus_tag="NMO_0536"
FT                   /product="putative adhesin MafB"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04558"
FT                   /db_xref="InterPro:IPR008106"
FT                   /db_xref="InterPro:IPR029100"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5R9"
FT                   /protein_id="CBA04558.1"
FT                   /translation="MKPLRRLTNLLAACAVAAAALIQPALAADLAQDPFITDNAQRQHY
FT                   EPGGKYHLFGDPRGSVSDRTGQINVIQDYTHRMGNLLIQQANINGTIGYHTRFSGHGHE
FT                   EHAPFDNHASRSASKEQGNVDEGFTVYRLNWEGHEHHPADAYDGPKGGNYPKPTGARDE
FT                   YTYHVNGTARSIKLNPTDTRSIRQRISDNYSNLGSNFSDRADEANRKMFEHNAKLDRWG
FT                   NSMEFINGVAAGALNPFISAGEAVDQWMQENPNAAETVEALVNVLPFAKVKNLTKAAKP
FT                   GKAAVSGDFSDSYKHNTASRLSQSVDGEMFQTRNVDFKAKSIGTKIHDGAQGKHISGHR
FT                   NYIEGKSTLNQNINPQELLNGIHSGAYPVISKGARGNPVVDFGYPIGSDGKSGLSTNFG
FT                   TIHSGKNGVHIVPANPKTIKKVQ"
FT   CDS_pept        581467..581784
FT                   /transl_table=11
FT                   /locus_tag="NMO_0537"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04561"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5S0"
FT                   /protein_id="CBA04561.1"
FT                   /translation="MNILPSWLRVGMNIAMLGMIHSDIRLITVDYEEGRRFLKIKNYLS
FT                   REAITEDHEDMEYLITELWSMCGEYFDEADFECIYSNHSSMELNQINGAVFRRKELISQ
FT                   A"
FT   CDS_pept        581918..582400
FT                   /transl_table=11
FT                   /gene="mafB13"
FT                   /locus_tag="NMO_0538"
FT                   /product="putative MafB alternative C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04564"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5S1"
FT                   /protein_id="CBA04564.1"
FT                   /translation="MVKTADGYKAIAHIQAGDRVLSKDEASGVTGYKPVTAQYGNLYQE
FT                   TVYIKVSDGIGNSQTLISNKIHPFYSDGKWIKAEDLKTGNRLLSESGKTQTVRNIIVKP
FT                   TPLKAYNLTVADWHTYFVKGDKAETEGVWVHNECPPYKRPNNATRKCTRKTLRRMR"
FT   CDS_pept        582586..582939
FT                   /transl_table=11
FT                   /locus_tag="NMO_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04567"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5S2"
FT                   /protein_id="CBA04567.1"
FT                   /translation="MGIKNEQIIICKKYNTEIYPVSDVSKIGVAENVKQTDLYPINGLR
FT                   HRPKGDTNGWYIWAGENFSNDENFFLPLHTFHLQIWRPEIIPFLTLPPGYRFLIGENGY
FT                   EDVWFDELLLNDN"
FT   CDS_pept        583311..583538
FT                   /transl_table=11
FT                   /locus_tag="NMO_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04570"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5S3"
FT                   /protein_id="CBA04570.1"
FT                   /translation="MDIKFNTLGVILNGVNPEEKFIKIIDDQENTGGFLILLSSNDKFS
FT                   SFDSYDDWVENLEILKEYLQESHWIIKWVG"
FT   CDS_pept        583665..584208
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0541"
FT   CDS_pept        584343..584972
FT                   /transl_table=11
FT                   /gene="mafB15"
FT                   /locus_tag="NMO_0542"
FT                   /product="putative MafB alternative C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04574"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5S4"
FT                   /protein_id="CBA04574.1"
FT                   /translation="MVKTADGYKAIAHIQAGDRVLSKDEASGKTEYKPVTARYGNPYQE
FT                   TVYIEVSDGIGNSQTLVSNKIHPFYSQGKWIQADRLKKGDTLLSESGAKQTVQNITLKQ
FT                   QPLKAYNLTVADWHTYFVKGSQAETEGVWVHNACPPKRTGSSKNEKHGDGGRSQISAES
FT                   RIAELKNKIIPGMSKNERLKIERTIRNITKNANRKAKGEEHGRRGR"
FT   CDS_pept        584923..585409
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0543"
FT   CDS_pept        585478..585864
FT                   /transl_table=11
FT                   /locus_tag="NMO_0544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04578"
FT                   /db_xref="InterPro:IPR028959"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5S5"
FT                   /protein_id="CBA04578.1"
FT                   /translation="MCIMCELKNFRRNITCFEGYDENSFIGKWYDDGVWDDEEYWKLEN
FT                   DLIEVRKKYPYPMDIPRDIVIGISTIIDFLMVPNWELFEIKASPWLPDSVGIHERYERF
FT                   TTMLRYIFTEKDIVNVRFDYYNKK"
FT   mobile_element  complement(586192..587199)
FT                   /mobile_element_type="other:ISNme1"
FT                   /locus_tag="NMO_0545"
FT   CDS_pept        complement(587504..588961)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0546"
FT                   /product="Trk system potassium uptake protein"
FT                   /function="Trk-type K+ transport systems membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04581"
FT                   /db_xref="GOA:C6S5S6"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5S6"
FT                   /protein_id="CBA04581.1"
FT                   /translation="MHKILPIAHVLSRLGMLFSFILLIPAALSYAFSDGAYTAFATTAT
FT                   VTLSGSCIVRLATLRFRRELRPRDGFTLVLMLWLAFAAMAAMPMYLYFPNMGFTDAFFE
FT                   SMSGLTTTGATVIPHVDGLAPSVNFWRHMLNWLGGMGIIVLAVAILPMLGVGGTQLFKA
FT                   EIPGIDKESKMSPRISQVAKKLWFGYTLITILAAACLHFAGMGWFDAVCHAMATLSLGG
FT                   FSTHDASIAYYNSPLIEAVIIVFTIVGGINFANHFAALNSRSLKTYWKDEECRTMLLLL
FT                   SGSILAAALYLWHTGYYAGFTESLRYTAFNFVSIGLANGLANTDFAQWPLLISLWMFFL
FT                   ANILANSGSTGGGIKTIRALVLFKFSLREMMVLLHPKAVRTVKISGKAIPDRLALTVMS
FT                   FIFIYFMTVVLFSFLLMASGMEFTTAFTAVIACITNAGPGLGEVGPAGNYAGLDVMQKW
FT                   ICVTAMLLGRLEIFTVFILFTPAYWKK"
FT   CDS_pept        complement(588976..589866)
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="NMO_0547"
FT                   /product="putative bis(5'-nucleosyl)-tetraphosphatase"
FT                   /function="Diadenosine tetraphosphatase and related
FT                   serine/threonine protein phosphatases"
FT                   /EC_number="3.6.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04584"
FT                   /db_xref="GOA:C6S5S7"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5S7"
FT                   /protein_id="CBA04584.1"
FT                   /translation="MIFQNHAVRTATLSHFTTSAMAHYAIGDIQGCFDELTALLGKIGF
FT                   NHGTDTLWLTGDIVNRGPKSLETLQFCIRHENSVQIVLGNHDLHLLAVGCGEGAPKRSD
FT                   TIEPILKHPDGKKMLDWLRAQPLLIREGSRVMVHAGILPQWRIAKAESLAREAEAELRG
FT                   KKYVKFFSKMYGNKPAAWDEGLEGYARLRFIVNAFTRMRALTFKNELDFDYKSTVKKMP
FT                   PYLRPWFKAPDRQNLDRTIIFGHWSSLGYTNADNVISLDTGALWGGQLTAVNLETEEIT
FT                   QVQAAGGIDWKSFAK"
FT   CDS_pept        complement(589884..590273)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0548"
FT                   /product="translation initiation inhibitor"
FT                   /function="Putative translation initiation inhibitor yjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04587"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5S8"
FT                   /protein_id="CBA04587.1"
FT                   /translation="MSKTIIHTDKAPAAIGAYSQAVRAGDTVYMSGQIPLDPATMTVVG
FT                   NGDFRAEARQVFQNLQAVAEAAGGTLADIVKLNAYLTDLGNFAVFNEVMAEFIAEPFPA
FT                   RAAVGVASLPKGVQVEAEAVLVLNA"
FT   CDS_pept        complement(590409..590933)
FT                   /transl_table=11
FT                   /gene="nspA"
FT                   /locus_tag="NMO_0549"
FT                   /product="outer membran protein"
FT                   /function="Opacity protein and related surface antigens"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04590"
FT                   /db_xref="GOA:C6S5S9"
FT                   /db_xref="InterPro:IPR003394"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5S9"
FT                   /protein_id="CBA04590.1"
FT                   /translation="MKKALAALIALALPAAALAEGASGFYVQADAAHAKASSSLGSAKG
FT                   FSPRISAGYRINDLRFAVDYTRYKNYKAPSTDFKLYSIGASAIYDFDTQSPVKPYLGAR
FT                   LSLNRASVDLGGSDSFSQTSIGLGVLTGVSYAVTPNVDLDTGYRYNYIGKVNTVKNVRS
FT                   GELSAGVRVKF"
FT   CDS_pept        complement(591518..592693)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0550"
FT                   /product="putative porphyrin oxidoreductase"
FT                   /function="Coproporphyrinogen III oxidase and related Fe-S
FT                   oxidoreductases"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04593"
FT                   /db_xref="GOA:C6S5T0"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5T0"
FT                   /protein_id="CBA04593.1"
FT                   /translation="MHTISFPNRTRLTALPPLSLYIHIPWCIKKCPYCDFNSHSLKNGL
FT                   PEAAYIDALLTDLQLELPNIWGRPVETIFFGGGTPSLFQAESIDRLLSGVRSLLRLQPE
FT                   AEITLEANPGTFEIEKFQGFKDAGITRLSIGVQSFNDDMLSRLGRVHNGKEALTAIDTA
FT                   LKLFDKVNIDLMYALPNQTVQTALDDVQTAIATGATHISAYHLTMEPNTPFGHTPPKGL
FT                   PQDEAALDIEDAVHGALESAGFVHYETSAFAKPAMQCRHNLNYWQFGDYLGIGAGAHGK
FT                   ISYPDRIERTVRRRHPNDYLALMQNRPSEAVERKTVAAEDLPFEFMMNALRLTDGVPAA
FT                   MLQERTGVPSAKIMAQIETARQKGLLETDPAVFRPTEKGRLFLNDLLQCFL"
FT   CDS_pept        complement(592750..595275)
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="NMO_0551"
FT                   /product="DNA ligase"
FT                   /function="NAD-dependent DNA ligase (contains BRCT domain
FT                   type II)"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04596"
FT                   /db_xref="GOA:C6S5T1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5T1"
FT                   /protein_id="CBA04596.1"
FT                   /translation="MNPNSKHNTNFTNLLKPSDSDIKQFAAQHIRHLTDLLNRYAYEYY
FT                   TLDAPSVPDAEYDKLFRELEALERNHPELKLPDSPTQRVGGEPLAGFAEVRHEVPMLSL
FT                   TNAFSPQDENGVFDHAEMYAFDQRVRDGLDGGKPEYVIEPKFDGLAISLLYRDGVLVQA
FT                   ATRGDGTTGEDVTQNIKTVANIPLRLHGENTPELIEVRGEVLMQKADFAALNKRQAENG
FT                   QKPFANPRNAAAGSLRQLDSRITAQRKLHFFPYSVARQQGGFVAEEHIQELAYFQALGF
FT                   SLPNGNFGCFKNIDEVLAFYEQMQQKRPELPYEIDGMVVKVNSLAQQRELGFISRAPRW
FT                   AIAHKFPAEEALTIVEAIDVQIGRTGAVTPVARLQPVFVGGVTVTNATLHNQDEVSRKD
FT                   VRVGDTVVVRRAGDVIPEVVRVIFERRPMRETAVAVSDGIGHRQDDLFAETPSANQTQS
FT                   VPLHKPYRLPTHCPICRSEIEREEGEAVARCSGGMLCQAQRAQGLIHFASRKAMDIDGL
FT                   GEKQIEQLVAQDLVRHFADLYRLDIPTLQKMKEAADKTVAESDQMPSEDSSVGASGKHK
FT                   KPPTKWAENILAGIESGKTPELARFLFALGIRHVGERTAKTLAQAFGTLEHVRRAPEPV
FT                   LACLPDIGTVVARSIAHFFAQAEQQAMIDELLAAGVAPQTQAVTIPPARHAEPQRWIAR
FT                   LPDFKISENKAQALWELAGKNIEGLQNDKALPADWQAWRSEPQNAALLENLKTFFAQMP
FT                   SEDEAAQGSDGINEAVAGKTFVLTGTLPTLKRDQAQSLIEAAGGKVSGSVSKKTDYVVA
FT                   GEAAGSKLEKANALGVSVLSEAELLTLLG"
FT   CDS_pept        complement(595423..596709)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0552"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04599"
FT                   /db_xref="GOA:C6S5T2"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR036765"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5T2"
FT                   /protein_id="CBA04599.1"
FT                   /translation="MIYIVLFLAAVLAVVAYNMYQENQYRKKVRDQFGHSDKDALLNSK
FT                   TSHVRDGKPSGGSVMMPKPQPAVKKTAKPQDPAMRNLQEQDAVYIAKQKQAKASPFKTE
FT                   IETALEESGIIGNSAHTVSEPQTGHSAPKPADAPAKPAPVPQTPAKPLITLKELSKVEL
FT                   PWFDVRFDFISYIALTEAKELHALPRLSNRCRYQIVGCTMDDHFQIAEPIPGIRYQAFI
FT                   VGIQAVSRNGLASQEELSAFNRQVDAFAQSMGGQTLHTDLAAFIEVASALDAFCARVDQ
FT                   TIAIHLVSPTSISGVELRSAVTGVGFVLEDDGAFHYTDTSGSTMFSICSLNNEPFTNAL
FT                   LDNQSYKGFSMLLDIPHSPAGEKTFDDLFMDLAVRLSGQLNLNLVNDKMEEVSTQWLKD
FT                   VRTYVLARQSEMLKVGIEPGGKTALRLFS"
FT   CDS_pept        complement(596903..597475)
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="NMO_0553"
FT                   /product="AmpD protein"
FT                   /function="Negative regulator of beta-lactamase expression"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04602"
FT                   /db_xref="GOA:C6S5T3"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5T3"
FT                   /protein_id="CBA04602.1"
FT                   /translation="MDNHAEAHWQDGWLQSVRHIPSPNFGPRESKEEVSLVVLHNISLP
FT                   PFEYGTDAVEKLFANRLDPNDHPFFGLIHTLRVSSHFLIKRDGKTVQFVSCGDMAYHAG
FT                   VSSFRGREKCNAFSIGIELEGCDFEPFAEAQYRSLEALLDAICRRYPITAVTGHQDIAP
FT                   GRKTDPGHFFDWRRIRGKGFPVDRNAV"
FT   CDS_pept        597559..598554
FT                   /transl_table=11
FT                   /locus_tag="NMO_0554"
FT                   /product="putative ADC lyase"
FT                   /function="Predicted periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04605"
FT                   /db_xref="GOA:C6S5T4"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5T4"
FT                   /protein_id="CBA04605.1"
FT                   /translation="MLKKMLKWSAVFLTVSAAVFAALLFVPKDNGRAYRIKIAKNQGIS
FT                   SVGRKLAEDRIVFSRHVLTAAAYVLGVHNRLHTGTYRLPSEVSAWDILQKMRGGRPDSV
FT                   TVQIIEGSRFSHMRKVIDATPDIEHDTKGWSNEKLMAEVAPDAFSGNPEGQFFPDSYEI
FT                   DAGGSDLQIYQTAYKAMQRRLNEAWESRQDGLPYKNPYEMLIMASLIEKETGHEADRDH
FT                   VASVFVNRLKIGMRLQTDPSVIYGMGAAYKGKIRKADLRRDTPYNTYTRGGLPPTPIAL
FT                   PGKAALDAAAHPSGEKYLYFVSKMDGTGLSQFSHDLTEHNAAVRKYILKK"
FT   CDS_pept        598614..599234
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="NMO_0555"
FT                   /product="Thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04608"
FT                   /db_xref="GOA:C6S5T5"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5T5"
FT                   /protein_id="CBA04608.1"
FT                   /translation="MKPQFITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPV
FT                   GEALREILLNPETKAGLRAETLMMFAARMQHIEDVILPALSDGIHVVSDRFTDATFAYQ
FT                   GGGRGMPSEDIEILEHWVQGGLRPDLTLLLDVPLEVSMARIGQTREKDRFEQEQADFFM
FT                   RVRGVYLDRAAACPERYAVIDSNRNLDEVRNSIEKVLDGHFGC"
FT   CDS_pept        599456..600736
FT                   /transl_table=11
FT                   /gene="maeA"
FT                   /locus_tag="NMO_0556"
FT                   /product="putative multimodular enzyme"
FT                   /function="Malic enzyme"
FT                   /EC_number="1.1.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04611"
FT                   /db_xref="GOA:C6S5T6"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5T6"
FT                   /protein_id="CBA04611.1"
FT                   /translation="MENSLKEAALKFHELPVPGKISVTPTKSLATDKDLALAYSPGVAA
FT                   PCMEIHADPQNAYKYTAKGNLVAVISNGTAVLGLGDIGALAGKPVMEGKGVLFKKFAGV
FT                   DVFDIEIDEKDPQKLVDIIAALEPTFGGINLEDIKAPECFYIERELRKRCKIPVFHDDQ
FT                   HGTAIITAAAVLNALRFTGRKIEEATLVCSGAGAAAIACLNQLLDLGLKRENVTVCDSK
FT                   GVIYQTREDKDRMDESKQFYAIEDNGQRVLADAVKGKDIFLGLSGANLLTPEMLNTMNE
FT                   KPIVFAMANPNPEILPPLAKETRPDVVIGTGRSDFPNQVNNVLCFPFIFRGALDVGATT
FT                   INEEMKRACVYALADLAMEEVTEEVVAAYGKKFEFGAEYLIPTPFDSRLLPRVATAAAK
FT                   AAMESGVATRPIADLEAYAAKLSEWKL"
FT   CDS_pept        601003..601152
FT                   /transl_table=11
FT                   /locus_tag="NMO_0557"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04614"
FT                   /db_xref="GOA:C6S5T7"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5T7"
FT                   /protein_id="CBA04614.1"
FT                   /translation="MAICPRLQNKPPPVMTTGQWVLTMIVFMLPLVNFCLGVRQRQPEP
FT                   RQFL"
FT   CDS_pept        601283..602317
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="NMO_0558"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /function="Tetraacyldisaccharide-1-P 4-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04617"
FT                   /db_xref="GOA:C6S5T8"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5T8"
FT                   /protein_id="CBA04617.1"
FT                   /translation="MPNCFKFHTVIERHWQKPYPVLSFLLKPLSGLFAKIAAKRRTDFL
FT                   SGKRQSEKLPVPVVVVGNIHAGGTGKTPIVAALVSGLQEKGVKVGIISRGYGRKSKAVH
FT                   VLNAESRAEDAGDEPLLLFRKTGAPTAVGSSRAEAGRALLAAHPDIGLIVADDGLQHYA
FT                   LRRDVEIAVFPAADTGRTDLDLLPNGSLREPLLRLDSVDAVVVSGGKADALFRPSENMF
FT                   HSRIEAGRIYRLNNPSEILDTGRLKNQTVVAVAGIAKPARFFDSLRNMGITVKRTVALP
FT                   DHADISAADLPDADAVIITEKDAVKFSDGICTDNVWVLPVCAIIEPDLAAFVLERLEDV
FT                   PKAV"
FT   CDS_pept        602517..603104
FT                   /transl_table=11
FT                   /locus_tag="NMO_0559"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04620"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5T9"
FT                   /protein_id="CBA04620.1"
FT                   /translation="MNIKLKTLLLPFATLALCTNAFAAPPSDASLARWLDTQNFDRDIE
FT                   KNMIEGFNAGFKPYADKALAEMPEAKKDQAAEAFNRYRENVLKDLITPEVKQAVRNTLL
FT                   KNAREIYTQEEIDGMIAFYGSPVGQSVVAKNPRLIKKSMSEIAVSWTALSGKIARHHLP
FT                   AFTEELRRIICGGKNPDAGCKQAGQVGKRHQK"
FT   CDS_pept        603173..603355
FT                   /transl_table=11
FT                   /locus_tag="NMO_0560"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04623"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5U0"
FT                   /protein_id="CBA04623.1"
FT                   /translation="MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYM
FT                   LENEARPLGEEELEA"
FT   CDS_pept        603352..604113
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="NMO_0561"
FT                   /product="3-deoxy-D-manno-octulosonatecytidylyltransferase"
FT                   /function="CMP-2-keto-3-deoxyoctulosonic acid synthetase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04626"
FT                   /db_xref="GOA:C6S5U1"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5U1"
FT                   /protein_id="CBA04626.1"
FT                   /translation="MTEFVVLIPARLDSSRLPGKALADIHGKPMVVRVAEQAAKSKAVR
FT                   VVVATDHPDIQTACQAHGVEVVMTSNRHESGTTRLAEASAALKLPPHLVVVNVQGDEPL
FT                   IAPELIDRTAEVLVENNVQMATAAHELHDFDELMNPNAVKVVLDKNRNAIYFSRAPIPY
FT                   PRDAMRAGKREMPFETAVLRHIGIYAYRVGFLQRYTEMSVSPLETIESLEQLRVLWHGY
FT                   PIAVETAKEAPAAGVDTQEDLDRIRAVFQTI"
FT   CDS_pept        604136..604537
FT                   /transl_table=11
FT                   /locus_tag="NMO_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04629"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5U2"
FT                   /protein_id="CBA04629.1"
FT                   /translation="MQQHIEKWQHLSREEQKILAEVWGLVQNDDQEVHYEMLKLNAPDE
FT                   ASGEFWFRMAETLSTLPPNRSLDLRMNGGRLATAVSILSVMIEDNPDIPQLWAQKITAL
FT                   NYSGLNLNQYGVASPCRTICTVCGFVALS"
FT   CDS_pept        604591..604755
FT                   /transl_table=11
FT                   /locus_tag="NMO_0563"
FT                   /product="hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04632"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5U3"
FT                   /protein_id="CBA04632.1"
FT                   /translation="MAQQPDKAAEANEEEYLTKALSQNLLSTLDVALARFPEDAWFQEI
FT                   KQDAQKHFA"
FT   tRNA            604912..605004
FT                   /locus_tag="NMO_tRNA12"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:604946..604948,aa:Ser)"
FT   CDS_pept        605431..606216
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="NMO_0564"
FT                   /product="Tryptophan synthase alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04635"
FT                   /db_xref="GOA:C6S5U4"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5U4"
FT                   /protein_id="CBA04635.1"
FT                   /translation="MSRIRQAFAALDGGKALIPYITVGDPDIRTTLAIMHSMVANGADI
FT                   LELGVPFSDPMADGSVIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPV
FT                   HKMGYREFAQEAAKAGVDGVLTVDSPVETIDPLYRELKDNGVDCIFLIAPTTTEDRIKT
FT                   IAELAGGFVYYVSLKGVTGAASLDTDEVSRKIEYLHQYIDIPIGVGFGISNAESARKIG
FT                   RVADAVIVGSRIVKEIENNTGNEAAAVGALVKELKDAVR"
FT   CDS_pept        606254..607126
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="NMO_0565"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit beta"
FT                   /function="Acetyl-CoA carboxylase beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04638"
FT                   /db_xref="GOA:C6S5U5"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5U5"
FT                   /protein_id="CBA04638.1"
FT                   /translation="MSWLDKILPPKIKNRGKDGSSNVPEGLWHKCPSCSATVYSTELQQ
FT                   NNQVCPKCNHHNPLSARQRLNLLLDEDGREEVAGNVKPTDPLKFKDGKKYPDRLSAARK
FT                   LTGEDDALVVMKGKMNGLPVVVAAFEFRFIGGSMGSVVGERFVQGIRRAVADNCPFVCV
FT                   AASGGARMQEGVNSLMQMTKTSAALHLLTEKRLPFISVLTDPTMGGVSASFAFLGDVVL
FT                   AEPNALIGFAGPRVIEQTVRETLPEGFQRAEFLLEKGAIDQIVDRRDMKRRISDLITLL
FT                   CRQDKVSAA"
FT   CDS_pept        complement(607186..607797)
FT                   /transl_table=11
FT                   /gene="cnpl"
FT                   /locus_tag="NMO_0566"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04641"
FT                   /db_xref="InterPro:IPR014861"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5U6"
FT                   /protein_id="CBA04641.1"
FT                   /translation="MRRTALLLLALTAGTSLAAGFSQKDTPINTRYRETPEEAAAREFK
FT                   EHTAKLPPLPDTHSDGWFDIYVDENYGKQPKILLDSLQIMPAPDGSIRYILNIRSDKGY
FT                   DNLTAEGIFCARFSIRFGNGKPSSYKVFGYGDTVNRRWIQPRNAEWKPIGGTLSRNDAL
FT                   RTVLYQAFCEGGVPADTKGLVQRLKERAGRYAPSIKPHNK"
FT   CDS_pept        607906..608130
FT                   /transl_table=11
FT                   /locus_tag="NMO_0567"
FT                   /product="putative sirA-like redox protein"
FT                   /function="Predicted redox protein regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04644"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5U7"
FT                   /protein_id="CBA04644.1"
FT                   /translation="MNSETLDVTGLKCPLPILRAKKALAQMQQGDVLTVLATDGGAPGD
FT                   FEAFCRQTGHVLLDASEQDGVFTLVVQHK"
FT   CDS_pept        608131..608736
FT                   /transl_table=11
FT                   /locus_tag="NMO_0568"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04647"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5U8"
FT                   /protein_id="CBA04647.1"
FT                   /translation="MPSEMRMSRLMLLLSAFVLAACNAQNRQSCVRHQDFARVAVDLFR
FT                   SACVLTQGSFESVSKFAAVGHFVPVGKEDLSHLPPAVAEPDVQVLWTLERDGGIYYLSL
FT                   TRDSCSVKAERADSAALLEHFDGLIRQPPKNTNIELRAEQSVQAPFETRQISYAWRESG
FT                   SSEETVLTAQTADSPDLPVQAVLNLTHRSHNGKPLILP"
FT   CDS_pept        608796..609830
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="NMO_0569"
FT                   /product="Dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04650"
FT                   /db_xref="GOA:C6S5U9"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5U9"
FT                   /protein_id="CBA04650.1"
FT                   /translation="MQTLTIIRPDDMHLHLRDGDALKAVAPYTARQMGRAVIMPNLKPP
FT                   VVSVADALAYKARIMAALPEGSAFEPLMTLYLTDNATPELVREAKAAGIVAFKLYPAGA
FT                   TTNSDSGVTDLFKLIPVLEEMAKQGILFLVHGEVTDPEIDIFDREAAFIGRVMKPVLAQ
FT                   VPNLKVVFEHITTAEAARLVLEAGDNVAATVTPQHLLLNRNDLLVGGVRPHHFCLPVLK
FT                   RETHRQALVAAVTGEKAHKFFLGTDSAPHAKSAKENACGCAGMFSAMTAVELYAEVFEK
FT                   AGALDKLEAFASKNGARFYGIPENTDTITLVKQSQTVPASVPYGDGELVPMRAGGEIGW
FT                   TVQY"
FT   mobile_element  609939..610898
FT                   /mobile_element_type="other:ISNme1"
FT                   /locus_tag="NMO_0570"
FT   CDS_pept        611381..612733
FT                   /transl_table=11
FT                   /locus_tag="NMO_0571"
FT                   /product="putative type II DNA modification methylase"
FT                   /function="Site-specific DNA methylase"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04653"
FT                   /db_xref="GOA:C6S5V0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5V0"
FT                   /protein_id="CBA04653.1"
FT                   /translation="MKDIRTVGSVCSGIEAASIAWQNLGFEFKWFSEILKFPSDILRNK
FT                   YPHIDNLGDMNYIPELLKHNSISSPDLICGGTPCQAFSLAGWKNGLDDERGNLTLKFID
FT                   IINENDNLRLKEGKNRTVVFWENVEGVLTDKTNAFGCFISTLAGLDKVIENKKWGTAGL
FT                   LRGKTRNVAWRVLDAKYFGLPQQRRRLYVVAGGKDTNPENILLELHDHKNNNIDGVSFP
FT                   KSELIFYKDNVKFEIFREFTDCLYSAYGTKWNGNAAAYNGSLFIAQDDKLRRLSPLECE
FT                   RLMGFPDNYTLIDGAKKTNRYQAIGNSWAIPVIKWIGKRIKKPECYDLNNHINSMLLKQ
FT                   ENSDFEYYDFSNGIIHLSDSFAINCSEIPEEVNFGHMYHIVSKEASDDIFISPTGCYGI
FT                   IRRKNERNIKINPRLEKILLDISSQETLAEIEKKSLVQKRGKYSENRQFNL"
FT   CDS_pept        complement(612778..613704)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0572"
FT                   /product="putative type II restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04656"
FT                   /db_xref="GOA:C6S5V1"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5V1"
FT                   /protein_id="CBA04656.1"
FT                   /translation="MNTTNLNPNITLPNGYNRIKHSKASEEYIVVEFKYQEIIWKGWIP
FT                   LEYRRTGVSIPYNKTNQSDVNAYLNLVYENMNPVNHETWLNDQNGFWEDSKAKVTKPFF
FT                   ECLKTGGWKCVKCTLPSNPNWARRIQDLKEMGYTLSTNTNQFCNNCKENTTHLLLVPIK
FT                   RGNLLGNGYETWSKELRKRILAVLNNIDVYENKFNTHVLPDHKFSEIRWDDNTKSQNPD
FT                   DMTDDEIKQKFQLLSNQRNQQKREVCRTCFQTGKRGVIFGIPFWYKGTADWDKSIPTKG
FT                   KNAEQGCIGCAWYDIEAWRNELVKRLK"
FT   CDS_pept        complement(613801..614226)
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="NMO_0573"
FT                   /product="transcription termination factor nusB-family
FT                   protein"
FT                   /function="Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04659"
FT                   /db_xref="GOA:C6S5V2"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5V2"
FT                   /protein_id="CBA04659.1"
FT                   /translation="MKTARRRSRELAVQAVYQSLINRTAAPEIAKNIREMPDFAKADEE
FT                   LFNKLFFGTQTNAADYIQKIRPLLDRDEKDLNPIERAVLLTACHELSAMPETPYPVIIN
FT                   EAIEVTKTFGGTDGHKFVNGILDKLAAQIRPDEPKRR"
FT   CDS_pept        complement(614304..614780)
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="NMO_0574"
FT                   /product="putative 6,7-dimethyl-8-ribityllumazine synthase"
FT                   /function="Riboflavin synthase beta-chain"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04662"
FT                   /db_xref="GOA:C6S5V3"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5V3"
FT                   /protein_id="CBA04662.1"
FT                   /translation="MNTIAPNLDGKHLRIGIVQARFTNEIGSEMLKVCCRTLKELGVAD
FT                   ENITVATVPGALEIPIALMNFASSEKFDALIAIGVVIRGETYHFELVSNESGAGVSRVA
FT                   LDYNIPIANAVLTTENDAQAIERIEEKASDAAKVAVECANLVNLLLEEQFEDEE"
FT   CDS_pept        complement(614827..615150)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0575"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04668"
FT                   /db_xref="InterPro:IPR018689"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5V5"
FT                   /protein_id="CBA04668.1"
FT                   /translation="MNAFAQALSSALDRCIATNTVAKQNQPVGFLYREAPVFENDSGWR
FT                   FFSGDETDEYTDDPDNFSIVSLADITKTNPETAALLSQPEGSAWELAEDGTFQTVADWQ
FT                   PKD"
FT   CDS_pept        615104..616036
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="NMO_0576"
FT                   /product="ribonuclease III family protein"
FT                   /function="dsRNA-specific ribonuclease"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04665"
FT                   /db_xref="GOA:C6S5V4"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5V4"
FT                   /protein_id="CBA04665.1"
FT                   /translation="MQRSSAEESACANAFIAGIRWGKTCGFYHDSCVVGRRRRFGGTMC
FT                   AVCSLKVFLYFWSMETHSGCFLRKTVMKDDVLKQQAHAAIQKRLGYAFRDISLLRQALT
FT                   HRSHHAKHNERFEFVGDSILNYTVARMLFDTFPKLTEGELSRLRASLVNEGVLAEMAAE
FT                   MNVGDGLYLGAGELKSGGFRRPSILADAMEAMFAAVSFDADFNTAEKVVRHLFAERVRR
FT                   VDFQNQAKDGKTALQEALQARRFALPKYRIEEQIGHANDSMFVVSCDLGELGFVCRAKG
FT                   TSRKAAEQEAAKEALKWLEEKLPLKKKKK"
FT   CDS_pept        616065..617006
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="NMO_0577"
FT                   /product="GTP-binding protein Era"
FT                   /function="GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04671"
FT                   /db_xref="GOA:C6S5V6"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5V6"
FT                   /protein_id="CBA04671.1"
FT                   /translation="MDTKANMDIETFLAGERAADGYRCGFVAIVGRPNVGKSTLMNHLI
FT                   GQKISITSKKAQTTRNRVTGIYTDDTAQFVFVDTPGFQTDHRNALNDRLNQNVTEALGG
FT                   VDAVVFVVEAMRFTDADRVVLKQLPKHTPVILVVNKIDKDKAKDRYALEAFVAQVRAEF
FT                   EFAAAEAVSAKHGLRIANLLELIKPYLPESVPMYPEDMVTDKSARFLAMEIVREKLFRY
FT                   LGEELPYAMNVEVEQFEEEDGLNRIYIAVLVDKESQKAILIGKGGERLKKISTEARLDM
FT                   EKLFDTKVFLKVWVKVKSGWADDIRFLRELGL"
FT   CDS_pept        619051..621336
FT                   /transl_table=11
FT                   /gene="lbpB"
FT                   /locus_tag="NMO_0578"
FT                   /product="lactoferrin-binding protein B"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04674"
FT                   /db_xref="InterPro:IPR001677"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR035313"
FT                   /db_xref="InterPro:IPR035316"
FT                   /db_xref="InterPro:IPR038197"
FT                   /db_xref="InterPro:IPR038669"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5V7"
FT                   /protein_id="CBA04674.1"
FT                   /translation="MCKPNYGGIVLLPLLLASCIGGNFGVQPVVESTPTAYPVTFKSKD
FT                   VPTSPPAEPSVETTPVNQPAVGAAMRLPRRNIASYKQDGTEIPDKHQAEEHLPLKEKDI
FT                   LFLDGTLKEQADKLKKKINERYSDVRVITSKKEEEKYQYQFVRAGYVFTRAEGKDNEKE
FT                   KTSDGKEFVNRFSYDGFVYYSGERPSQSLPSAGTVQYSGNWQYMTDAKRHRTGKAVSST
FT                   DLGYTTYYGNEIGATSYEARDADDREKHPAEYTVDFDNKTLNGKLIKNQYVQNKSNPNE
FT                   PKKPLTIYDITATLDGNRFTGSAKVSTEVKTQHADKEYLFFHDNADQRLEGGFFGDNGE
FT                   ELAGRFISNDNSVFGVFAGKQKTDASNASDTKPALPSGKHTKILDSLKISVDEASGENP
FT                   REFAISTMPDFGHPDKLLVEGREIPLVNQEQIINLADGRKMTVRACCDFLTYVKLGRIK
FT                   TDRPAAKPKAQDEDSEDEIGESEENEDEISDEEGTEDEVVEDEGSEEDEVSEGDNGENE
FT                   EEIAEEETEEEVDEAEEEKVEEPEEELPTEEGNGGSGSILPAPEAPKGRDIDLFLKGIR
FT                   TAETNIPQTGKAHYTGTWEARIGTPIQWDNQADKEAAKAKFTVDFGGKSISGTLTEENG
FT                   VEPAFHIEDGKIDGNGFHATAHTRDTGINLSGTGSTNPQRFKASNLRVEGGFYGPQAEE
FT                   LGGIIFNNDGKSLGITEGTENKVDVDAEVDAEVDAEVDVDVEQLKPEAKPQFGVVFGAK
FT                   KDNKEVEK"
FT   CDS_pept        621333..624170
FT                   /transl_table=11
FT                   /gene="lbpA"
FT                   /locus_tag="NMO_0579"
FT                   /product="lactoferrin binding protein A"
FT                   /function="Outer membrane receptor proteins mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04677"
FT                   /db_xref="GOA:C6S5V8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR010948"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5V8"
FT                   /protein_id="CBA04677.1"
FT                   /translation="MNKKHGFQLTLTALAIATAFPAYAAQAGAAAPDAAQTQSLKEVTV
FT                   RAAKVGRRSKEATGLGKIVKTSETLNKEQVLGIRDLTRYDPGVAVVEQGNGASGGYSIR
FT                   GVDKNRVAVSVDGVAQIQAFTVQGSLSGYGGRGGSGAINEIEYENISTVEIDKGAGSSD
FT                   HGSGALGGAVAFRTKEAADLISDGKSWGIQAKTAYGSKNRQFMKSLGAGFSKDGWEGLL
FT                   IRTERQGRETRPHGDIADGVAYGINRLDAFRQTHDIQSQDKTGQFFLVEGENTLKPVAK
FT                   LAGYGIYLNRQLNRWVKERIEKNQPLSAEEEAMVREAQARHENLSAQAYTGGGRILPDP
FT                   MDYRSGSWLAKLGYRFGGRHYVGGVFEDTKQRYDIRDMTEKQYYGTDEADKFRDKSGVY
FT                   DGDDFRDGLYFVPNIEEWKGDKKLVRGIGLKYSRTKFIDEHHRRRRMGLLYRYENEAYS
FT                   DNWADKAVLSFDKQGVATDNNTLKLNCAVYPAVDKSCRASADKPYSYDSSDRFHYREQH
FT                   NVLNASFEKSLKNKWTKHHLTLGFGYDASNAISRPEQLSHNAARISEHTGEYTDDDKDK
FT                   YRLGKPEVVEGSVCGYIETLRSRKCVPRKINGSNIHISLNDRFSIGKYFDFSLGGRYDR
FT                   KNFTTSEELVRSGRYVDRSWNSGIVFKPNRHFSLSYRASSGFRTPSFQELFGIDIYHDY
FT                   PKGWQRPALKSEKAANREIGLQWKGDFGFLEISSFRNRYTDMIAVADHKTKLPNQAGQL
FT                   TEIDIRDYYNAQNMSLQGVNILGKIDWNGVYGKLPEGLYTTLAYNRIKPKSVSNRPDLS
FT                   LRSYALDAVQPSRYVLGFGYDQPEGKWGANIMLTYSKGKNPDELAYLAGDQKRYSTKRA
FT                   SSSWSTADVSAYLNLKKRLTLRAAIYNIGNYRYVTWESLRQTAESTANRHGGDSNYGRY
FT                   AAPGRNFSLALEMKF"
FT   CDS_pept        complement(625700..626326)
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="NMO_0580"
FT                   /product="N-(5'phosphoribosyl)anthranilate isomerase"
FT                   /function="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04679"
FT                   /db_xref="GOA:C6S5V9"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5V9"
FT                   /protein_id="CBA04679.1"
FT                   /translation="MRKIRTKICGITTLEDAAAAAAAGADAVGLVFFQGSSRAVDIARA
FT                   KKITAALPPFVSVVALFVNESAQNIRRILAEVPIHIIQFHGDEDDAFCRQFHRPYIKAI
FT                   RVQTASDIRNAADRFPDAQALLFDAYHPSEYGGTGHRFDWTLLAEYSGKPWVLAGGLTP
FT                   ENVGEAVRITGAEAVDVSGGVEASKGKKDPAKVAAFIATANRLSR"
FT   CDS_pept        complement(626385..626876)
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="NMO_0581"
FT                   /product="Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04682"
FT                   /db_xref="GOA:C6S5W0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5W0"
FT                   /protein_id="CBA04682.1"
FT                   /translation="MSTETKNYITPAGWQALKNELYRLVNKERPEIVQIVNWAAGNGDR
FT                   SENGDYLYGKRRMREIDRRIRFLTKRLEAAVVIDPELREATDQVFFSATVGLLRGDGRE
FT                   QTVKIVGIDEIDTAQNKISWISPLARCLIKAREGDEVVLNTPEGREEIEILSVEYIKID
FT                   "
FT   CDS_pept        complement(626976..628520)
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="NMO_0582"
FT                   /product="amidophosphoribosyltransferase"
FT                   /function="Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04686"
FT                   /db_xref="GOA:C6S5W1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5W1"
FT                   /protein_id="CBA04686.1"
FT                   /translation="MCGVLGLVSHEPVNQLLYDGLQMLQHRGQDAAGIATAEGGTFHMH
FT                   KGKGMVREVFRTRNMRDLTGNAGIAHVRYPTAGNAGSSAEAQPFYVSSPFGIVLAHNGN
FT                   LTNTAELYENVCNKHLRHVNTSSDSEVLLNVFAHELRREVSKNADPHRLNADNIFNAVA
FT                   QVHRLVRGAYGVIAMIAGYGMLAFRDPYGIRPLVLGSQTDSEGRKSYAVASESVAFNAL
FT                   TYDLERDIRPGEAVFVGFDGTMIARQCSDRAKLSPCLFEYVYFARPDSVIDGVSVYQSR
FT                   LDMGVSLAEKIKRELPVDGIDVVMPIPDTSRPSAMELAVHLDKPYREGLIKNRYIGRTF
FT                   IMPGQATRKKSVRQKLSPMETEFAGKSVLLVDDSIVRGTTSREIVEMVRAAGARKVYIA
FT                   SAAPEVRYPNVYGIDMPTREELIANGRSAAEIAAEIGADGIVFQNLSDLEAVVKALNPK
FT                   IESFDSSCFNGIYQTGDIDDAYLDRLSAEKSGCGGLKIHPSRVEHSISISDAGDEE"
FT   CDS_pept        complement(628728..629225)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0583"
FT                   /product="putative bacteriocin production protein"
FT                   /function="Uncharacterized membrane protein required for
FT                   colicin V production"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04688"
FT                   /db_xref="GOA:C6S5W2"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5W2"
FT                   /protein_id="CBA04688.1"
FT                   /translation="MNNLPVADILIFAIIAACIVLSAMRGVIAEAGSMAAWVVSFFFAK
FT                   LFAASFADLAFASFQPRLFALALSFISLFVIACLIQKMLRSLLTGAVSAVGLGFANRIL
FT                   GGVFGALKGVLIVTLLIMLASKTDLPDTEEWRQSYTLPFFVSLSEAVLNHSGGTAETPE
FT                   DD"
FT   CDS_pept        complement(629218..630216)
FT                   /transl_table=11
FT                   /gene="tpc"
FT                   /locus_tag="NMO_0584"
FT                   /product="putative cell division FtsN-like protein Tpc"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04691"
FT                   /db_xref="GOA:C6S5W3"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5W3"
FT                   /protein_id="CBA04691.1"
FT                   /translation="MSENKQNEVLSGYEQLKRRNRRRLVTASCLVAASCILLAAALSSG
FT                   PAEQTAGETSGVENKAAGAAQTPALKSAADKPQDLAGEDKPSAADSEISEPENVGAPLV
FT                   LINDRLEDSNIKGLEASEKLQQAETAKTAPKQAKQRAAEKVPATADSTDTVAVEKPKRT
FT                   AETKPQKAERTAKAKPKAKETKTAEKVADKPKTAAEKTKPDTAKSDSAVKEAKKADKAE
FT                   SKKTAEKDRSDGKKHETAQKTDKADKTKTAEKEKSGKKAAIQAGYAEKERALSLQRKMK
FT                   AAGIDSTITEIMTDNGKVYRVKSSNYKNARDAERDLNKLRVHGIAGQVTNE"
FT   CDS_pept        complement(630229..631503)
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="NMO_0585"
FT                   /product="Folylpolyglutamate synthase"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04694"
FT                   /db_xref="GOA:C6S5W4"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5W4"
FT                   /protein_id="CBA04694.1"
FT                   /translation="MKTLQDWLSHLETAHSGGLIDMGLERVGEVKKRMKLTPQCPVVVV
FT                   AGTNGKGSVCAYLTQIYKQAGFKVGTLTSPHLLRYNERIAVNAEPVSDDTIIASFERIE
FT                   AARGEISLTYFEFNALAAVDIFMREQVDVMILEVGLGGRLDAVNAFDGDCAVVTSVDLD
FT                   HQAFLGDTVEQVGFEKAGVFRSGKPAICGQNPAPKSLLSHAEAIGAKLLMVQRDFEFHA
FT                   MENIQWNYRFRPQHSDGPARNRNALPFPALRGTYQLSNAACALTVLECLNDKLPVDIGA
FT                   IKRGLLLVENPGRFQVLPGRPLTVLDVGHNPHAARALRRSLINLAFAQKRTAVFSMLSD
FT                   KDIDGVLEIVKDQFDEWYIAPLDVPRGMTLESLQNKLHEHSIENIQTFAAVREAYRAAA
FT                   SKAGENDRIVVFGSFHTVADVMSVL"
FT   CDS_pept        complement(631535..631975)
FT                   /transl_table=11
FT                   /gene="folI"
FT                   /locus_tag="NMO_0586"
FT                   /product="putative transcriptional regulator FolI"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04697"
FT                   /db_xref="GOA:C6S5W5"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5W5"
FT                   /protein_id="CBA04697.1"
FT                   /translation="MRAFQTALRPSRILNILTVSLHAASLAVCLTWFYGWMMWFGLAAL
FT                   VASYAYSLRITNLKHRHAITAITIDRDGQAEIISGKDKTAATLAGSSMVTPYALFLQWD
FT                   TGGTTVSQCIIPDMTDKESYRRLKVWILWRQPKKTAETDTPS"
FT   CDS_pept        complement(631980..632339)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04701"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5W6"
FT                   /protein_id="CBA04701.1"
FT                   /translation="MYFVDRTAVVLKPTVRFLEWLKSTDENMPDLTIEQLRANCSVFLV
FT                   PQFNEPEAVVSYFDERYRQIFEAELAGWDIDKDKWPQDMGLKAFWEFFDIEIHDMVLDM
FT                   EEAELNITPVFDNMM"
FT   CDS_pept        complement(632412..633161)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0588"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /function="ABC-type polar amino acid transport system
FT                   ATPase component"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04704"
FT                   /db_xref="GOA:C6S5W7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5W7"
FT                   /protein_id="CBA04704.1"
FT                   /translation="MPSERKDMIKFKNVHKHFKDLHVINGVNLEIKKGEVVVVCGPSGS
FT                   GKSTLIRTVNQLESIESGEIWVDGVNVADPKTDLNKIREEVGFVFQSFNLYPHLTVLEN
FT                   ITLAPMKVKGQNAEQAEKKAMELLERVGLAHKKDAFPSQLSGGQQQRVAIARGLAMEPR
FT                   VMLFDEPTSALDPEMVGEVLKVMKDLAESGMTMMCVTHEMGFAREVADRVLFVDKGQIL
FT                   EDETPEAFFTNPKHERAKQFLQQVMTH"
FT   CDS_pept        complement(633313..634092)
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="NMO_0589"
FT                   /product="dimethyladenosine transferase"
FT                   /function="Dimethyladenosine transferase (rRNA
FT                   methylation)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04707"
FT                   /db_xref="GOA:C6S5W8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5W8"
FT                   /protein_id="CBA04707.1"
FT                   /translation="MKEHKARKRFGQNFLQDTRIISDIVNAVRPQADDVVIEIGPGLAA
FT                   ITEPLAKKLNRLHVVEIDRDIVCRLKTLPFADKLVIHEGDVLQFDFNGIAGKKKIVGNL
FT                   PYNISTPLLFKLAEVADDVVDMHFMLQKEVVDRMVAAPKSNDYGRLGVMLQYFFDMEML
FT                   IDVPPESFDPAPKVDSAVVRMIPVKHRIGKADDFEHFAKLVKLAFHQRRKTIRNNLKEL
FT                   AGDDDLQAVGINPQDRAEHIAPEKYVALSNYLAGKAV"
FT   CDS_pept        634289..634978
FT                   /transl_table=11
FT                   /locus_tag="NMO_0590"
FT                   /product="hypothetical G:T/U mismatch-specific DNA
FT                   glycosylase"
FT                   /function="G:T/U mismatch-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04710"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5W9"
FT                   /protein_id="CBA04710.1"
FT                   /translation="MLFEGLPCLAVWCKNRLSAVLPVGGLNVSENLLEIETHPFDSVLP
FT                   PKAAVMMMGTFPPKEDKRAMQFHYPNFQNDMWRVYGLVFFNDAAHFQRLSEKAFDAEKI
FT                   KAFLHERGIASCPTVLKAAREHGNASDKFLKVVETVDLAAVLAKIPDCRHICTTGGKAT
FT                   EILLDIQGGGIKMPKTGETVPFPFAGRDLTLTRLPSTSRAYPLSLAKKAAAYRAFFEMA
FT                   GLCEKQL"
FT   CDS_pept        635061..636263
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="NMO_0591"
FT                   /product="Tryptophan synthase beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04713"
FT                   /db_xref="GOA:C6S5X0"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5X0"
FT                   /protein_id="CBA04713.1"
FT                   /translation="MKNYHAPDEKGFFGEHGGLFVSETLIPALQELADAYKAAKNDPSF
FT                   WEEFHRDLKHYVGRPSPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLAK
FT                   RMGKKRVIAETGAGQHGVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVG
FT                   VDSGSRTLKDAMNEAMREWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKEQML
FT                   EAIGRQPDVAVACVGGGSNAIGLFHPYIGEENVRLVGVEAGGLGVNTPDHAAPITSGAP
FT                   IGVLHGFRSYLMQDENGQVLGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTAAKDEEALE
FT                   AFDLLCRFEGIIPALESSHAVAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIK
FT                   L"
FT   CDS_pept        complement(636441..641939)
FT                   /transl_table=11
FT                   /gene="iga1"
FT                   /locus_tag="NMO_0592"
FT                   /product="IgA-specific serine endopeptidase"
FT                   /function="Type V secretory pathway adhesin AidA"
FT                   /EC_number="3.4.21.72"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0592"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04715"
FT                   /db_xref="GOA:C6S5X1"
FT                   /db_xref="InterPro:IPR000710"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR030396"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5X1"
FT                   /protein_id="CBA04715.1"
FT                   /translation="MKTKRFKINAISLSIFLAYALTPYSEAALVRDDVDYQIFRDFAEN
FT                   KGKFFVGATDLSVKNKQGQNIGNALSNVPMIDFSVADVNKRIATVVDPQYAVSVKHAKA
FT                   EVHTFYYGQYNGHNDVADKENEYRVVEQNNYEPHKAWGASNLGRLEDYNMARFNKFVTE
FT                   VAPIAPTDAGGGLDTYKDKNRFSSFVRVGAGRQLVYEKGAYHQEGNEKGYDLRDLSQAY
FT                   RYAIAGTPYKDINIDQTMNTEGLIGFGNHNTHYSAEELKQALSQDALTNYGVLGDSGSP
FT                   LFAFDKQKNQWVFLGTYDYWAGYGKKSWQEWNIYKKEFADKIKQRDNAGTIKGNREHHW
FT                   NITFGTNSKIGSTAVRLANNERDANNGQNVTFEDNGTLVLDQNINQGAGGLFFKGDYTV
FT                   KGANNDITWLGAGIDVADGKKVVWQVKNPNGDRLAKIGKGTLEINGTGVNQGQLKVGDG
FT                   TVILNQQADADKKVQAFSQVGIVSGRGTLVLNSSNQINPDNLYFGFRGGRLDANGNDLT
FT                   FEHIRNVDEGARIVNHNTDHASTITLTGKSLITDPKTISIHYIQNNDDDDNGYYYYRPR
FT                   KPIPQGKDLYFKNYRYYALKSGGSVNAPMPENGVAENNDWVFMGYTQEEAQKNAMNHKN
FT                   NQRISGFSGFFGEENGKGHNGALNLNFNGKSAQNRFLLTGGANLNGKISVTQGNVLLSG
FT                   RPTPHARDFVNKSSARKDARFSKNNEVVFEDDWINRTFKATEITVNQSASFSSGRNVSD
FT                   ITANITATDNAKVNLGYKNGDEVCVRSDYTGYVTCNTGNLSDKALNSFGATQINGNVNL
FT                   SQNAALTLGKAALWGQIQGQGNSRVSLNQHSKWHLTGDSQVHNLLLADSHIHLNNASDA
FT                   QSANKYHTLKINHLSGNGHFHYLTHLAKNLGDKVLVKESASGHYQLHVQDKTGEPNQEG
FT                   LNLFDASSVRDRSRLSVSLANNHVDLGALRYTIKTENGITRLYNPYAENRRRVKPAPSP
FT                   ATNTASQAQKATQTDGAQIAKPQNIVVAPPSPQANQAEEAKRQQAKAEQVKRQQAEAER
FT                   KSAELAKQKAEAEREARELATRQKAEQERSSAELARRHEKEREAAELSAKQKVEAEREA
FT                   QALAVRRKAEAEEAKRQAAELARRHEKEREAAELSAKQRVGEEERRQTAQSQPQRRKRR
FT                   AAPQDYMAASQDRPKRRGHRSVQQNNVEIAQAQAELARRQQEERKAAELLAKQRAEAER
FT                   EAQALAARRKAEAEEAKRQAAELAHRQEAERKAAELAHRQEAERKAAELSANQKAAAEA
FT                   QALAARQQKAFARQQEEARKAAALAAKQKAETERKTAELAKQRAAAEAAKRQQEARQTA
FT                   ELARRQEAERQAAELSAKQKAETDREAAESAKRKAEEEEHRQAAQSQPQRRKRRAAPQD
FT                   YMAASQNRPKRRGRRSTLPAPPSPSFDSSAYAAPRALHNPDWYENDYEEIPLDALEDEN
FT                   VSESVDTSDKQPQDNTELHEKYENDYEEIPLDALEDEDVSESVDTSDKQPQDNTELHEK
FT                   VETVSLQPRAAQPRAQAVAQADAVSTNTNSALSDAMASTQSILLDTGASLTRHIAQKSR
FT                   ADAEKNSVWMSNIGYGRDYASAQYRRFSSKRTQTQIGIDRSLSENMQIGGVLTYSDSQH
FT                   TFDQASGKNTFVQANLYGKYYLNDAWYVAGDIGAGSLRSRLQTQQKANFNRTSIQTGLT
FT                   LGNTLKINQFEIVPSAGIRYSRLSSADYKLGNDSVKVSSMSVKTLTAGLDFAYRFKVGN
FT                   LTVKPLLSAAYFANYGKGGVNVGGNSFAYKADNQQKYSAGAALLYRNVTLNVNGSITKG
FT                   KQLEKQKSGQIKIQIRF"
FT   CDS_pept        644012..646294
FT                   /transl_table=11
FT                   /gene="comA"
FT                   /locus_tag="NMO_0593"
FT                   /product="competence protein ComA"
FT                   /function="Predicted membrane metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04719"
FT                   /db_xref="GOA:C6S5X2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5X2"
FT                   /protein_id="CBA04719.1"
FT                   /translation="MTVFRICFIIRLFLKYLGWGDVFRRWFLPCWVVGAAASFALPVVP
FT                   HWLFWLAAFAVFAVFARRFAFAGLMLCVLAGAAYGVFRTEAALSSQWWAEAVSGVPLTV
FT                   EVADMPRSDGRRVQFAAKAVDSGGRTFDLLLSDYKRREWAVGSRWRITARVHPVVGELN
FT                   LRGLNREAWALSNGIGGAGTVGADRVLLHGGSGWGIAVWRSRISRNWQQADADGGLSDG
FT                   IGLMRALSVGEQSALRPELWQAFRPLGLTHLVSISGLHVTMVAVMFAWLAKRLLACSPR
FT                   LPARPRAWVLAAGCAGALFYALLAGFSVPTQRSVLMLAAFAWAWRRGRLSAWATWWQAL
FT                   AAVLLFDPSAVLGVGTWLSFGLVAALIWACSGRLHEGKRQTALRGQWAASVLSLVLLGY
FT                   LFASLPLISPLVNAVAIPWFSWVLTPLALLGSVVPFAPLQQLGAFLAEYTLRFLVWLAD
FT                   VSPEFAVASAPLPLLVLAVCAALLLLLPRGLGLRPWAVLLLAGFVFYRSPGVPENEVAV
FT                   TVWDAGQGLSVSVQTANHHLLFDTGTAAAAQMGIVPSLNAAGVRRLDKLVLSHHDSDHD
FT                   GGFQAVGKIPNGGIYAGQPEFYEGARHCAEQRWQWDGVDFEFLMPSERKNIDDNGKSCV
FT                   LRVVAGGAALLVTGDLDTKGEESLVGKYGGNLYSQVLVLGHHGSNTSSSGVFLNAVSPE
FT                   YAVASSGYANAYKHPTEAVQNRVRAHGIKLLRTDLSGALQFGLGRGGVKAQRLRGYKFY
FT                   WQKKPFE"
FT   CDS_pept        complement(646352..647155)
FT                   /transl_table=11
FT                   /gene="comL"
FT                   /locus_tag="NMO_0594"
FT                   /product="DNA uptake lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04725"
FT                   /db_xref="GOA:C6S5X4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5X4"
FT                   /protein_id="CBA04725.1"
FT                   /translation="MKKILLTVSLGLALSACATQGTVDKDAQITQDWSVEKLYAEAQDE
FT                   LNSSNYTRAVKLYEILESRFPTSRHARQSQLDTAYAYYKDDEKDKALAAIERFRRLHPQ
FT                   HPNMDYALYLRGLVLFNEDQSFLNKLASQDWSDRDPKANREAYQAFAELVQRFPNSKYA
FT                   ADATARMVKLVDALGGNEMSVARYYMKRGAYIAAANRAQKIIGSYQNTRYVEESLAILE
FT                   LAYQKLGKPQLAADTRRVLETNFPKSPFLTHAWQPDDMPWWRYWH"
FT   CDS_pept        647154..648278
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="NMO_0595"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /function="Pseudouridylate synthases 23S RNA-specific"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04722"
FT                   /db_xref="GOA:C6S5X3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5X3"
FT                   /protein_id="CBA04722.1"
FT                   /translation="MQNTSFDNESDYSDDSDFASASETENRIGLTVPLELAGGRLDAVL
FT                   AKLLPDYSRSRLTSWIKEGAVIVNDKPSQPKDKMIGGEQICVTVRPSEENLAFVPEPMA
FT                   LDIIYEDDTVIVVNKPAGLVVHPAAGNWTGTLLNGLLAHCPELSQVPRAGIVHRLDKET
FT                   SGLMVVAKTLPAQNSLVQHLQERTVKRIYRAVANGIVPFDGKIETQIGRDPHNRLKMAV
FT                   VKFGGKPAVTHVKVLERYLAHSYIECSLETGRTHQIRVHMREANHPLAADPVYGNPRHP
FT                   CGDTVKEAVKSLGARQALHAYRLSFTHPKTGETVSFEAPIPDDIYHLLSVLRLEAGLDS
FT                   SLSNEEEWQDKFGADDDDDWNEDDYDVEVVYVRE"
FT   CDS_pept        complement(648431..649423)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0596"
FT                   /product="putative transmembrane transport protein"
FT                   /function="Predicted Na+-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04727"
FT                   /db_xref="GOA:C6S5X5"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5X5"
FT                   /protein_id="CBA04727.1"
FT                   /translation="MYACLPLKTNTQRIIMNILSKISSFIGKTFSLWAALFAAIAFFAP
FT                   DTFKWAGPYIPWLLGIIMFGMGLTLKPSDFDILFEHPKVVIIGVIAQFAIMPATAWLLS
FT                   KLLNLPAEIAVGVILVGCCPGGTASNVMTYLARGNVALSVAVTSVSTLISPLLTPAIFL
FT                   MLAGEMLEIQAGSMLMSIVKMVLLPIVLGLIVHKVLGSKTEKLTDALPLVSVAAIVLII
FT                   GAVVGASKGKIMESGLLIFAVVVLHNGIGYLLGFFAAKWTGLPYDAQKTLTIEVGMQNS
FT                   GLAAALAAAHFAAAPVVAVPGALFSVWHNISGSLLATYWAAKAGKHKKP"
FT   CDS_pept        649985..650764
FT                   /transl_table=11
FT                   /locus_tag="NMO_0597"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04731"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5X6"
FT                   /protein_id="CBA04731.1"
FT                   /translation="MKTITETLNLAPKGKNFLTADWPAPANVKTLITTRNGGVSQGAYQ
FT                   SLNLGTHVGDNPEAVRRNREIVQQQVGLPVAYLNQIHSTVVVNAAEALGGTPDADASVD
FT                   DTGKVACAVMTADCLPVLFCDRAGTAVAAAHAGWRGLAGGVLQNTIAAMKVPPVEMMAY
FT                   LGPAISADAFEVGQDVFDAFCTPMPEAAAAFEGIGGGKFLADLYALARLILKREGVGGV
FT                   YGGTHCTVLERDTFFSYRRDGATGRMASLIWLDGNAV"
FT   CDS_pept        650816..651295
FT                   /transl_table=11
FT                   /locus_tag="NMO_0598"
FT                   /product="Rare lipoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04734"
FT                   /db_xref="GOA:C6S5X7"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5X7"
FT                   /protein_id="CBA04734.1"
FT                   /translation="MNKLFLTAAVLMLGACGFHLKGADGISPPLTYRSWHIEGGQALQF
FT                   PLETALYQASGRVDDAAGAQMTLRIDSVSQNKETYTVTRAAVINEYLLILTVEAQVLKR
FT                   GEPVGKPMTVSVRRVLAYADNEILGKQEEEAALWAEMRQDAAEQIVRRLTFLKAE"
FT   CDS_pept        651297..652295
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="NMO_0599"
FT                   /product="putative DNA polymerase III, delta subunit"
FT                   /function="DNA polymerase III delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04737"
FT                   /db_xref="GOA:C6S5X8"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5X8"
FT                   /protein_id="CBA04737.1"
FT                   /translation="MAAHIGHIDTDAPLKPLYVIHGEEELLRIEALDALRAAAKKQGYL
FT                   NREVYTADNAFDWNELLQTAGSAGLFADLKLLELHIPNGKPGKTGGEALQDFAARLPED
FT                   TVTLVLLPKLEKTQLQSKWFAALAAKGEVWEAKPVGAAALPQWIRGRLDKIGLGIGADA
FT                   LALFAERVEGNLLAARQEIDKLGLLYPKGHTVNIDEAQTAVANVARFDAFQLAGAWMKG
FT                   DVLRVCRLLDGLREEGEEPVLLLWAVAEDVRTLIRLAAALKQGQSVQSVRNSLRLWGEK
FT                   QTLAPLAVKRISVVRLLDALKTCAQIDRIIKGAEDGDAWTVFKRLVVSLAE"
FT   CDS_pept        652416..652835
FT                   /transl_table=11
FT                   /locus_tag="NMO_0600"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0600"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04740"
FT                   /db_xref="GOA:C6S5X9"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5X9"
FT                   /protein_id="CBA04740.1"
FT                   /translation="MDNKTKLRLGGLILLTTAVLSLIIVLIVDSWPLAILLAAVIVAAA
FT                   AGGFVWTSRRQQRQFIERLKKFDIDPEKGRINEANLRRMYHSGGQHQKDAITLICLSQK
FT                   CSVDEAHAMFKKRPTRQEINQMAAKQSRGQKRPHR"
FT   CDS_pept        652860..653426
FT                   /transl_table=11
FT                   /locus_tag="NMO_0601"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein/domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04743"
FT                   /db_xref="GOA:C6S5Y0"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Y0"
FT                   /protein_id="CBA04743.1"
FT                   /translation="MPSEACWRFRRHILIEKMMTLKTAPLKRRFAAMLYEMLLVGAATC
FT                   LAALFAGIAAIFLNPVSIAVSALVTSILIMGAWWLYFRANWHGQGQTLAMRTWKIGLCD
FT                   LNGIQPSLHLLRLRFIWACIFIVFIPMLAYAGLRHFLGIPPKGAAGAALIWLILPWGFA
FT                   LLNPDRQFLYDFLAGTRLVAVKGKP"
FT   CDS_pept        complement(653510..654394)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0602"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized stress-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04746"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Y1"
FT                   /protein_id="CBA04746.1"
FT                   /translation="MSSGNIHIHSMTGFANAAAECGSKRINLDIRAVNHRFLDIQIRMP
FT                   DDLRYLESGIREKISSHIARGKVECKIQIQDTENSRQSLELNSDLVNQLAEINKNLRKH
FT                   HDLAKLGVADILRFPGVLASQRENTEELAKSITELTEKALKDFTAARRREGKKLGEHLL
FT                   QRLESMEEIIDALSELFPTLLETHKEKIRARLVEAVGDINNDRLQQEFALFIQKSDIDE
FT                   EFSRLRTHIDEVRRIVTEHKGSSGKRLDFLMQELNREANTLGSKSIAAECTQASVELKV
FT                   LIEQMREQVQNIE"
FT   CDS_pept        complement(654878..655741)
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="NMO_0603"
FT                   /product="RNA polymerase sigma subunit"
FT                   /function="DNA-directed RNA polymerase sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04749"
FT                   /db_xref="GOA:C6S5Y2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Y2"
FT                   /protein_id="CBA04749.1"
FT                   /translation="MNNAFALPAIQSGNGSLEQYIHTVNSIPMLSQEEETRLAERRIKG
FT                   DLNAAKQLILSHLRVVVSIARGYDGYGLNQADLIQEGNIGLMKAVKRYEPGRGARLFSF
FT                   AVHWIKAEIHEFILRNWRLVRVATTKPQRKLFFNLRSMRKNLNALSPKEAQDIADDLGV
FT                   KLSEVLEMEQRMTGHDIAIMADNSDDEDSFAPIDWLADHDSEPSRQLSKQAHYALQTEG
FT                   LQNALAQLDDRSRRIVESRWLQDDGGLTLHQLAAEYGVSAERIRQIEAKAMQKLRGFLT
FT                   EEAEAV"
FT   CDS_pept        complement(656005..657579)
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="NMO_0604"
FT                   /product="Apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04752"
FT                   /db_xref="GOA:C6S5Y3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Y3"
FT                   /protein_id="CBA04752.1"
FT                   /translation="MFRRYLPNRQMNMVSKLDKYWQHPALYWPLLILFAAATPFTFAPY
FT                   YHFWLMPLIFGAFVHLIELRPRFAASSAYLFGLTAYTAQFYWIHTALHDVSGLPDLYAV
FT                   PLTFLLPAYLALYPALCFWLWKKFTLPRGIKIGLVLPILWTLTEFARERFLTGFGWGAI
FT                   GYSQITPDSPLAGFAPLGGIHMVTLATAFLGVWLVLASDNTARSGKRLLPIILIAALLA
FT                   AGYTARQTDFTRPDGSRSTVALLQGNIDQTLKWREDQVIPTIQKYYEQVGKTTADIVIL
FT                   PETAIPVMRQNLPENILAKFAEQAQNNGSALAVGISQYTSDGNGYENAVINLTGYQENN
FT                   QDGIPYYAKNHLVPFGEYKPLPFLTTPLYKMMNMPLSDFRKGGGKQSALLMKNQKIAFN
FT                   ICYEDGFGDELIAAAKDATLLANASNMAWYGKSNAMYQHLQQSQARAMELGRYMVRATN
FT                   TGATAIISPKGNIIAQAQPDTETVLEGHIKGYVGETPYMKTGSSWWLMGILTLAALILF
FT                   IFRNKEH"
FT   CDS_pept        complement(657583..658413)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0605"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0605"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04755"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Y4"
FT                   /protein_id="CBA04755.1"
FT                   /translation="MPPETAQIRVLLYNVGLCAAFQDSLMAFASLFTLPDDITAVLDDV
FT                   ALMTKAAAKKTAGVVGDDLAPNANRVTGVSAERELPIVWSMAKGSFSNKPVLVPAALLL
FT                   SAFLPQLITPLLTAGGIYLCFEGVEKLLHKFLHRHDAHARNGGNRHRHDCFGVRNRCRH
FT                   RQTRRLRHAADAPPTNLFAQFGANADCLYALLYARFERGRHACHVSYRRRTGRPQPRPS
FT                   ARFPARATLGRWLGGVLRQPRCRAAFRFDCLRPRLAADESFRQALISFSNTDAV"
FT   CDS_pept        658541..659296
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0606"
FT   CDS_pept        complement(659339..659761)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0607"
FT                   /product="putative cytochrome c"
FT                   /function="Cytochrome c mono- and diheme variants"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04759"
FT                   /db_xref="GOA:C6S5Y5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Y5"
FT                   /protein_id="CBA04759.1"
FT                   /translation="MNTTRLPTALVLGCLCAAASAADNSIMTKGQKVYESNCVACHGKK
FT                   GEGRGTMFPPLYRSDFIMKKPQVLLHSMVKGINGTIKVNGKTYNGFMPATAISDADIAA
FT                   VATYIMNAFDNGGGSVTEKDVKQAKNKKKLNRQNAV"
FT   CDS_pept        complement(659952..661034)
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="NMO_0608"
FT                   /product="ferrochelatase"
FT                   /function="Protoheme ferro-lyase (ferrochelatase)"
FT                   /EC_number="4.99.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04762"
FT                   /db_xref="GOA:C6S5Y6"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Y6"
FT                   /protein_id="CBA04762.1"
FT                   /translation="MPSEAASDGILPRYPTRTIFQKPIMLPFLPEPSLSYTQQNRTAVL
FT                   LLNLGTPDAPTAQAVRPYLKSFLTDRRVVELPKWLWYPILHGLVLTLRPKKSAHAYEKI
FT                   WFKEGSPLEVYTARQAAALAKRMPDLIVRHAMTYGNPSVADVLSELKAQGAGRLLVIPM
FT                   YPQYAASSSGAAVDKVCEQLLLQRNQMSVRTVSRFYDDTGYIDAMKNHILRYWAEHGRG
FT                   KKLMLSFHGVPQKHHDLGDPYPDECRHTAKLLAEALELTEDQYVVSFQSQFGRAKWVTP
FT                   STQDLFGKLPKQGVTELDVFCPGFLADCLETMEEIALMGREQFYEAGGKSYRYIPCLND
FT                   NPDWIDALVALAEENLGGWR"
FT   CDS_pept        complement(661044..662159)
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="NMO_0609"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /function="Queuine/archaeosine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04765"
FT                   /db_xref="GOA:C6S5Y7"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Y7"
FT                   /protein_id="CBA04765.1"
FT                   /translation="MLKFTLHKKDGYARRGTLELNHGKIETPVFMPVGTYGSVKAMNPQ
FT                   NLHDIKAQIILGNTYHLWLRPGLEVVEQFGGLHGFIGWDKPILTDSGGFQVFSLSDMRK
FT                   LTEEGCTFKSPINGDKLFLSPEISMKIQTVLNSDIAMQLDECTPGEATREQAKKSLQMS
FT                   LRWAERSKKAFEDLKNPNALFGIVQGAMYEDLREESLRGLEQFDFPGLAVGGLSVGEPK
FT                   PEMYRMLRAVGPILPEHKPHYLMGVGTPEDLVYGVAHGIDMFDCVMPTRNARNGWLFTR
FT                   FGDLKIKNAKHKLDKRPIDESCTCYACQNFSRAYLHHLHRTGEILGAQLNTIHNLHFYQ
FT                   VIMAEMREAVEQGKFADWQAQFHENRARGTD"
FT   tRNA            662338..662414
FT                   /locus_tag="NMO_tRNA13"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:662372..662374,aa:Val)"
FT   CDS_pept        662468..664381
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="NMO_0610"
FT                   /product="Threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04768"
FT                   /db_xref="GOA:C6S5Y8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Y8"
FT                   /protein_id="CBA04768.1"
FT                   /translation="MLNITLPDGSVRQYESPVTVAQIAASIGAGLAKAAVAGRVNGKLV
FT                   DACDPITEDSSVQIITPKDQEGIEIIRHSCAHLVGHAVKQLYPNAKMVIGPVIEEGFYY
FT                   DIATEKPFTPEDVAAIEARMKELIAQDYDVVKIMTPRAEAIKIFQERGEEYKLRLIDDM
FT                   PKVEAMGMYHHQEYVDMCRGPHVPNTRFLKNFKLTKLAGAYWRGDSNNEMLQRIYGTAW
FT                   ATKDELKAYIQRIEEAEKRDHRKLGKQLDLFHLQDEAPGMVFWHPKGWALWQVIEQHMR
FT                   KELNAAGYKEVKTPQIMDKTFWEKSGHWENYKDNMFVTSSEKREYAVKPMNCPGHVQIF
FT                   NNGLRSYRDLPMRLAEFGSCHRNEPSGALHGLMRVRGFVQDDAHIFCTEDQIVSEARAF
FT                   NELLVRIYKQFGFHDVAVKLSLRPEQRAGSDEVWDKAEQGLRDALTACGVEWEELPGEG
FT                   AFYGPKIEYHVKDALGRSWQCGTLQLDFVLPERLDAEYVTENNDRARPVMLHRAILGSL
FT                   ERFIGILIENHAGSFPLWLAPVQLVIMNITENQADYCREVAAKLQAAGFRAELDLRNEK
FT                   IGYKIRDNSQYRFPYQIVVGDKEKQENKVAVRRKAEDLGSLDLDDFIAQLQQEITDALV
FT                   NH"
FT   CDS_pept        664516..664920
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="NMO_0611"
FT                   /product="translation initiation factor IF-3"
FT                   /function="Translation initiation factor 3 (IF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0611"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04771"
FT                   /db_xref="GOA:C6S5Y9"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Y9"
FT                   /protein_id="CBA04771.1"
FT                   /translation="MAEGQDVDLVEISPTAKPPVCKLMDYGKYKYQQAKKRDEAKKNQK
FT                   QVQIKEIKFRPGTDEGDYQIKMRNINRFLADGDKVKVTLRFRGREMAHQQLGAQLLERV
FT                   KEDLAEVAQIESFPKMEGRQMVMMIAPKKK"
FT   CDS_pept        665067..665264
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="NMO_0612"
FT                   /product="50S ribosomal protein L35"
FT                   /function="Ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0612"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04774"
FT                   /db_xref="GOA:C6S5Z0"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Z0"
FT                   /protein_id="CBA04774.1"
FT                   /translation="MPKMKTKSSAKKRFKVLGNGGVKRAHAFKRHILTKKTTKNKRQLR
FT                   GTSMVNDRDLASVAKMLPYA"
FT   CDS_pept        665277..665636
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="NMO_0613"
FT                   /product="50S ribosomal protein L20"
FT                   /function="Ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0613"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04777"
FT                   /db_xref="GOA:C6S5Z1"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Z1"
FT                   /protein_id="CBA04777.1"
FT                   /translation="MPRVKRGVTARARHQKIFALAKGYRGRRKNVYRVAKQAVMKAGQY
FT                   AYRDRRQRKRQFRQLWIVRINAGARENGLSYSKFMNGLKRASIEIDRKVLADLAVFDKA
FT                   AFAQLVEKAKAALAA"
FT   CDS_pept        665681..665905
FT                   /transl_table=11
FT                   /locus_tag="NMO_0614"
FT                   /product="hypothetical protein"
FT                   /function="Transposase and inactivated derivatives IS5
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04780"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Z2"
FT                   /protein_id="CBA04780.1"
FT                   /translation="MQKFYVIDFLSLKSIFLNKFALKYSGLNLNQDKATKPQTVQIVRQ
FT                   GEATPYWFKFNPLYRKFIQWIDREENKVV"
FT   CDS_pept        665982..666974
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="NMO_0615"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /function="Phenylalanyl-tRNA synthetase alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0615"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04783"
FT                   /db_xref="GOA:C6S5Z3"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Z3"
FT                   /protein_id="CBA04783.1"
FT                   /translation="MENVNRIVAEGIAAVEAAKDFNALEQIKARYLGKTGELTGLLKTL
FT                   GQMSPEERKTIGAHINECKNQFQMAFNNKRDALNEAKLQARLAAEALDITLPGRAQEGG
FT                   SLHPVTLTLQRVVELFHGMGFEVADGPEIEDDFHNFQALNIPANHPARAMQDTFYVENG
FT                   DVLRTHTSPIQIRYMLDKKEPPIRIIAPGRVYRVDSDATHSPMFHQAEGLWVEEGVTFA
FT                   DLKAVFTDFIRRFFERDDLQVRFRPSFFPFTEPSAEIDIMGENGKWLEVGGCGMVHPNV
FT                   LKNVNIDPEKYTGFAFGIGLDRFAMLRYNVNDLRLFFDNDLNFLKQFAK"
FT   CDS_pept        667027..668412
FT                   /transl_table=11
FT                   /locus_tag="NMO_0616"
FT                   /product="putative type II DNA modification methylase"
FT                   /function="DNA modification methylase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0616"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04786"
FT                   /db_xref="GOA:C6S5Z4"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Z4"
FT                   /protein_id="CBA04786.1"
FT                   /translation="MLSKEYIKQIKQHTPHIFPLLIEEYQNNVGSILFILKNLGNLPKN
FT                   FRTDWIEKLLQNDNEQVRFWAVKTLGKVENSQLLDLLNYVVLSDSSTIVKREAVSSIGR
FT                   MRDPKIQTLLLQYLQSYDPKIICQAIRGLLPFKGQPEIDNALRKLVNHENEMVRSVIYK
FT                   EYFTQKVNKKTLLPHTETYPFLKNVVVNSDVRDVLQLVPEDSVHLTFTSPPYYNARDYS
FT                   IYPSYEAYLVFLQEVFKEIHRITKEGRFLIVNTSPVIVPRISRAHSSKRYPIPFDLHHR
FT                   LIQIGWEFIDDIVWMKPEYSVKNRIGGFQQHRKPLAYKPNSVTEYLMVYRKQTDRLLDW
FT                   NMNQYDKQTIEESKVADGFETTNVWQIHPKSDKVHSAIFPADLCKRIVEYYSFKDDLVF
FT                   DPFGGSGTLGRVAKKLGRHFFLTEKDEKYFEYMQTFQKKDSLFLERDTKFLTLTEFAGS
FT                   IIK"
FT   CDS_pept        668409..669338
FT                   /transl_table=11
FT                   /locus_tag="NMO_0617"
FT                   /product="putative type II restriction enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04789"
FT                   /db_xref="InterPro:IPR019042"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Z5"
FT                   /protein_id="CBA04789.1"
FT                   /translation="MRITNQVTKNIIKRVIKSEDYRIEIVNLLNAEFLQFSIDFFKKVV
FT                   TAKLNSKDITIDWYKEHFLAKNSPKGELIIYSGLNEKTITNMYGTAKKSVVIDASIEHF
FT                   ETLYSSIQMLVENEQNEIDLTLTIKLKNVSVDLSISESLIVINTLAVKRSQLRGGLWST
FT                   AGKSVEKYLMLTLCQLYQVPEDNYDASTFVKDKSKSVDREIDFYLIKNQNRYLCEVKLM
FT                   GKGNPESADAIIARNTQIFIADTLSQQNKNQCDELKVEWVALREQQGFLKFEKILRTFD
FT                   IPFISYQYEDGNKLDCNLDDILNRLLDD"
FT   CDS_pept        669411..671774
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="NMO_0618"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /function="Phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04792"
FT                   /db_xref="GOA:C6S5Z6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Z6"
FT                   /protein_id="CBA04792.1"
FT                   /translation="MQFSYSWLKTQADTELSADKLEHLLTMAGLEVEEIDTAAPAFSGV
FT                   VVAEVKSVEKHPDADRLNVTRVDAGTGGLVQIVCGAPNVKAGIKVPCSLPGAVLPGNFK
FT                   IKPTKMRGVPSNGMLCSTDELGLPDDGVNGLHILPEDAPVGTNIREYLDLDDTLFTLKI
FT                   TPNRADCLSIKGIAREVSALTGCAFRQPEIHTAPITGSRKQPVQINAPADCGRFISRVI
FT                   ENVNAKAATPDWMKQRLERSGIRSISALVDIGNYVMLEIGQPMHVFDADKISGSLIVRR
FT                   AKNGEILECLNEKTVSLSDNTLVVADEKGALSLAGLMGGAASSVSDGTQNIVLEAAWFA
FT                   PEIIAGKSRQYGFGSDSSFRFERGVDYRLQADAIERATELVLQICGGAAGEMVEAQGEL
FT                   PEAKQVGLRLDRLKTVLGVDIPAEQVETILQHLGLQPEKTAEGFRVTAPSFRFDIEIEA
FT                   DLIEEIGRVYGYENIPDDYTSGRLKMLELPETRRPRFAVYNEMAARGYREVVSYAFVNE
FT                   QWEQDFAANADPIRLQNPLAAQYAVMRSTLIGGLVEILQNNLNRKQNRVRVFEIARVFG
FT                   KGSDGRFVQNERIGGLWYGAAMPEQWGGKTRNADFYDIKADVENLLKNKAVEFVKTGHP
FT                   ALHPGRAANIVSDGKVIGFVGELHPKWLQKYDLPQAPLVFEIDMAAVLECGKTRYRVVS
FT                   KFQPVRRDLAFVMPEAMSHDDLLLVLKGAANKLVQEISVFDVYRGTGLPEGMKSVAVKV
FT                   ILQDMENTLTDEAVEPLIGKLIGAATAAGARLRS"
FT   CDS_pept        671848..672150
FT                   /transl_table=11
FT                   /gene="himA"
FT                   /locus_tag="NMO_0619"
FT                   /product="integration host factor alpha-subunit"
FT                   /function="Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04795"
FT                   /db_xref="GOA:C6S5Z7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Z7"
FT                   /protein_id="CBA04795.1"
FT                   /translation="MTLTKAELADILVDKVSNVTKNDAKEIVELFFEEIRSTLASGEEI
FT                   KISGFGNFQLRDKPQRPGRNPKTGEEVPITARRVVTFHASQKLKSMVEHYYDKQR"
FT   CDS_pept        672134..672442
FT                   /transl_table=11
FT                   /locus_tag="NMO_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04798"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Z8"
FT                   /protein_id="CBA04798.1"
FT                   /translation="MTNNVDLKVPAKRYFTLDELCGLLQISPYGFAQWQHDHGVVVGYG
FT                   GERYTRLDVVKLLKLQSTFAPYAEGAESGSDGNRPVTLQEIGDGLKELLADLDKELC"
FT   CDS_pept        672772..673257
FT                   /transl_table=11
FT                   /gene="fxsA"
FT                   /locus_tag="NMO_0621"
FT                   /product="putative membrane protein"
FT                   /function="Protein affecting phage T7 exclusion by the F
FT                   plasmid"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04801"
FT                   /db_xref="GOA:C6S5Z9"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:C6S5Z9"
FT                   /protein_id="CBA04801.1"
FT                   /translation="MRFFGIGFLVLLFLEIMSIVWVADWLGGGWTLFLMAATFAAGVLM
FT                   LRHTGLSGLLLAGAAMRSGGRVSVYQMLWPIRYTVAAVCLMSPGFVSSVLAVLLLLPFK
FT                   GGAVLQAGGAENFFNMNQSGRKEGFSRDDDIIEGEYTVEEPYGGNRSRNAIEHKKDE"
FT   CDS_pept        673612..674994
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="NMO_0622"
FT                   /product="Adenosylmethionine-8-amino-7-oxononanoateaminotra
FT                   nsferase"
FT                   /EC_number="2.6.1.62"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04804"
FT                   /db_xref="GOA:C6S600"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6S600"
FT                   /protein_id="CBA04804.1"
FT                   /translation="MERCGKRSVGVEYAFAFEYSKKKREKLMPSEHQHISSLLDFDRTH
FT                   LLHPYTSMTDPLPVYPVKRAEGVFIELADGTRLIDGMSSWWCAIHGYNHPVLNQAVETQ
FT                   MKQMAHVMFGGLTHEPAVELGKLLVGILPQGLNRIFYADSGSISVEVALKMAVQYQQAR
FT                   GLTAKQNIATVRRGYHGDTWNAMSVCDPETGMHHIFGSALPQRYFVDNPKSRFYDEWDG
FT                   ADLQPVRALFEVHHADIAAFILEPVVQGAGGMYFYHPQYLRGLHDLCDEFDIMLIFDEI
FT                   ATGFGRTGKMFACEHAEVVPDIMCIGKGLSGGYMTLAAAITSQKVTETISRGEAGVFMH
FT                   GPTFMANPLACAVACASVKLLLSQDWQANIRRIESILKGRLKAAWDIRGVKDVRVLGAI
FT                   GVIELEKGVDMARFQADCVAQGIWVRPFGRLVYLMPPYIISDGVLTKLADKTVQILKEH
FT                   SK"
FT   CDS_pept        674991..675638
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="NMO_0623"
FT                   /product="dethiobiotin synthase"
FT                   /function="Dethiobiotin synthetase"
FT                   /EC_number="6.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04807"
FT                   /db_xref="GOA:C6S601"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S601"
FT                   /protein_id="CBA04807.1"
FT                   /translation="MKGVYFVSGIDTDIGKTVATGVLAKQLLQQGKSVITQKPVQTGCQ
FT                   NIADDIAVHRKIMGKPMQEADKQGLTMPEIFSYPASPHLAARLDGRALDLDKIRTATQE
FT                   LAAQYEIVLVEGAGGLMVPLTEKLLTIDYIRQQGYPVILVTSGRLGSINHTLLSFAALK
FT                   QYGIRLHSLIFNHIHDSSDECVAQDSLNYLQCRLKDSFPEAEWLELDKTDAV"
FT   CDS_pept        675653..676129
FT                   /transl_table=11
FT                   /locus_tag="NMO_0624"
FT                   /product="putative 4-hydroxybenzoate synthetase"
FT                   /function="4-hydroxybenzoate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0624"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04810"
FT                   /db_xref="GOA:C6S602"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:C6S602"
FT                   /protein_id="CBA04810.1"
FT                   /translation="MEHLFGKWLPDLPADVSDGISLPMVRLLHTRSLTAALRALPHTFS
FT                   VELLKLGELETECGGRLVREVLLKLDRIPVVEARSECRIGSAFWQNILDCGTRPLGERL
FT                   FQADLEGARSVFEFAVFGEGCGRYFAARRSRFSRHGEEMLLTEYFLPELKRFIG"
FT   CDS_pept        676024..677049
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="NMO_0625"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /function="4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0625"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04813"
FT                   /db_xref="GOA:C6S603"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C6S603"
FT                   /protein_id="CBA04813.1"
FT                   /translation="MRTVLCRAAFSVFPSRRGNAADRVFSARTETLYRIKYRFFKLCGN
FT                   MNPKSPLFLRLSDRLDVYLRLMRADKPIGTLLLLWPTYWALWLASDGIPDPAVLAAFTI
FT                   GTFLMRSAGCVINDFADRDFDGAVERTKNRPFAQGRVKKKEALLLTAFLCLLAALCLIP
FT                   LNHLTWLMSLPALFLALTYPFTKRFFPIPQLYLGLAFSFGIPMAFAAVAGNVLPQAWIL
FT                   FAANVLWTLAYDTVYAMADKEDDLKIGIKTSAVTFGRYDIAAVMLCHGGFTLLMAVLGA
FT                   VIGAAWAYWTAIPIVLLLQYRQYAAIKSRVRQICFETFLANNRIGWVWFTAIFAHTFFA
FT                   K"
FT   CDS_pept        677234..677683
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="NMO_0626"
FT                   /product="nitrogen regulatory IIA protein"
FT                   /function="Phosphotransferase system mannitol/fructose-
FT                   specific IIA domain (Ntr-type)"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0626"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04816"
FT                   /db_xref="GOA:C6S604"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C6S604"
FT                   /protein_id="CBA04816.1"
FT                   /translation="MSLIGEILPLSHIVLDMEVGSKKRLFEEAGLLLERESSLSHADVF
FT                   ECLFAREKLGSTGLGQGVAIPHGRHAGVKQATGAFIRTREPVGFDAPDGKPVSLVFILL
FT                   VPENATGEHLEVLSKLAGKFSQKSIRESLMTVSSAEEARAILIEE"
FT   CDS_pept        677687..678649
FT                   /transl_table=11
FT                   /locus_tag="NMO_0627"
FT                   /product="Hpr serine kinase/phosphatase"
FT                   /function="Serine kinase of the HPr protein regulates
FT                   carbohydrate metabolism"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0627"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04819"
FT                   /db_xref="GOA:C6S605"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:C6S605"
FT                   /protein_id="CBA04819.1"
FT                   /translation="MPSISVRRLFDDNQYKLQLAWAAGNSGADNRIGVEADKPVLALVG
FT                   HLNFIHPNQIQVVGLAESEYLNRLESGETGYQFGDLFDISMSLVIVANGLPVSPGLRDY
FT                   CHKNDIPLLTSKLESPYLMDVLRIYLQRTLAASSVKHGVFLDVFEIGVLITGHSGLGKS
FT                   ELALELISRGHSLIADDAVELFRIGPETLEGRCSPMLRDFLEVRGLGILNIRHIFGETS
FT                   IRPKKILQLIINLVEADDEYMKQLDRLSIRTETESILNVNVRSVTLPVAVGRNLAVLVE
FT                   AAVRNYILQLRGKDSTREFLERHQTQLKENEQNHENRPD"
FT   CDS_pept        678630..679484
FT                   /transl_table=11
FT                   /locus_tag="NMO_0628"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted P-loop-containing kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0628"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04823"
FT                   /db_xref="GOA:C6S606"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S606"
FT                   /protein_id="CBA04823.1"
FT                   /translation="MKIVLISGLSGSGKSVALRQMEDSGYFCVDNLPLEMLPALVSYHI
FT                   ERADETELAVSVDVRSGIDIGQAREQIAYLRGLGHRVEVLFVEAEESVLVRRFSETRRG
FT                   HPLSNQDMTLLESLKKEREWLFPLKEIAYCIDTSKMNAQQLRHAVRQWLKVERTGLLVI
FT                   LESFGFKYGVPNNADFMFDMRSLPNPYYDPELRPYTGMDKPVWDYLDGQPLVQEMVDDI
FT                   ERFVTHWLPRLEDESRSYVTVAIGCTGGQHRSVYIVEKLARRLKGRYELLIRHRQAQNL
FT                   SDR"
FT   CDS_pept        679565..680506
FT                   /transl_table=11
FT                   /locus_tag="NMO_0629"
FT                   /product="putative GTPase"
FT                   /function="Predicted GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0629"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04826"
FT                   /db_xref="GOA:C6S607"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S607"
FT                   /protein_id="CBA04826.1"
FT                   /translation="MAIQWFPGHMNKAKKAIAERAKSVDMVIEMLDARMPASSENPLLA
FT                   QLSKGKPKLKILNKQDLADSERTKVWLDHYNSRPDTCAIALDSSETGAHGKITQACRAM
FT                   IPHRQGIDKPLRVLICGIPNVGKSTLINGMIGKKSAKTGNEPGITKAEQRLFLADDFWL
FT                   YDTPGMLWPKIIVEESGYNLAAGGAVGRNALDEEEVALELLDYLRRHYLPMLQERYQAD
FT                   KDPSSHWDENVWLEWIAKKRGAVLSGGRINYQKAAENILTDFREGKIGRITLETPNQWE
FT                   TWLKKARQKEAELKAIREARKAERKGQKPSEA"
FT   CDS_pept        680607..681209
FT                   /transl_table=11
FT                   /locus_tag="NMO_0630"
FT                   /product="putative transcriptional regulator"
FT                   /function="Predicted transcriptional regulator containing
FT                   the HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04829"
FT                   /db_xref="GOA:C6S608"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6S608"
FT                   /protein_id="CBA04829.1"
FT                   /translation="MTDKISPDALIEAALLTQTEPLTEKSMRELCVPPLSQDKLIDVLA
FT                   QLKTRWQDRALQLVHTQEGWRFQIVQTAFERLGSLQEQRAPRYSRAVMETLAIIAYQQP
FT                   VTRGDIEGIRGVAVSQNVMQTLQDRGWIEVIGHRDTLGKPALWATTATFLSDLRLDGLE
FT                   ELPPLTELGELVLPDLMEMPPTDEEEPEAVPSDTLPN"
FT   CDS_pept        681393..683066
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="NMO_0631"
FT                   /product="DNA repair protein"
FT                   /function="ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04832"
FT                   /db_xref="GOA:C6S609"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S609"
FT                   /protein_id="CBA04832.1"
FT                   /translation="MLLTLSLRDFVIVENLNLDFQSGFTVLTGETGAGKSITLDAIGLL
FT                   LGDKADYSQVRSGAKEAQLSALFDISHLPVLKAELYEQGLLNDGEEELSIRRIIDAKGK
FT                   SRSFINNQAATLAQLKSVGSQLIDIHGQNAHHSLNQEAAQRELLDAFAGSREQAETVRQ
FT                   LYQNWANAKKALQEAQEHADAVIIERERLEWQFNELNQLDIKQGEWEALSQSHDSLAHS
FT                   AELLQAAEEVGSKIDGDNGIQRHIYQCQKLLANLQNIEPRFAESLNMLASIEAELGEIS
FT                   ANMRDVAGRSDINPNELAAQEQRMGELMGMARKYRIEPEELPAKLAEIEERLQSLQAAA
FT                   DLDALEHNVAHNFAEYQEAAHILSAMRHQAAERLSGETTEHMQHLAMKGARFDIVLLPS
FT                   SPTAHGLEQVQFQVAANKGNPPRPLNKVASGGELARISLALQVVASQYTQVPTLIFDEV
FT                   DTGIGGGVAEMVGKALRALGRKHQVLAVTHLPQVASCGENHWRVRKHSEGEQTVSEISI
FT                   LDEIQRIEEVARMLGGEVITDTTRQHAAELLQLASKNSLF"
FT   tRNA            683176..683252
FT                   /locus_tag="NMO_tRNA14"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:683210..683212,aa:Arg)"
FT   tRNA            683270..683344
FT                   /locus_tag="NMO_tRNA15"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:683303..683305,aa:Glu)"
FT   CDS_pept        complement(684023..685642)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0632"
FT                   /product="putative amino acid oxidase"
FT                   /function="Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04835"
FT                   /db_xref="GOA:C6S610"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6S610"
FT                   /protein_id="CBA04835.1"
FT                   /translation="MDNLVWDGVPDIRTLDQTIRKHAHPLNLIVCLPDNQIPDFQTAQD
FT                   ASDAECRLKHRLDQATQCLQFDSINLIEHILPDVRFWLVPPSRTRSLHEHFHHISWQTE
FT                   AIPQTESKPDKPWFALPQTAERQKPEHILVIGAGISGAATAHALASHGISVTVLEARKA
FT                   AQAASGNRQGLLYAKISPHDTEQTELLLAGYGYTKRLLGHILPESETWGGNGIIHLNYS
FT                   RTEQQRNHELGLQKHHNHLYRSITQAEAEKIAGIPLSVPYDHPSCGLYWQHGVWLNPPA
FT                   FVRTLLNHPLIGLHEDTPLTDISHDGEKWIASTPNGTFTATHIIYCTGANSPYLPETNL
FT                   AALPLRQIRGQTGLTPSTPFSEQLRCAVSGESYISPSWHGLHCYGASFIPNSSHTGWNE
FT                   AEEASNRQALAHLNPALSESLFAANPNPQKHQGHAAIRCDSPDHLPLVGALGDIAAMRQ
FT                   TYTKLALDKNYRIDTPCPYLPNAYVNTAHGTRGLATAPICAAAIAAQILGLPHPFSQRL
FT                   RHALHPNRTIIRAIVRRKDLTP"
FT   CDS_pept        685762..686130
FT                   /transl_table=11
FT                   /locus_tag="NMO_0633"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04838"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:C6S611"
FT                   /protein_id="CBA04838.1"
FT                   /translation="MNNIPVEIRLLKNRTVLVLTYGDEPKNLPAEFLRVYSPSAEVRGH
FT                   GVGQDVLQTGKADVQITDLQPVGQYALKISFSDGHDSGLYDWAYLHRLAYGYDAMWQEY
FT                   LDKLAAAGASRFEKQSDC"
FT   CDS_pept        686173..686910
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="NMO_0634"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /function="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0634"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04841"
FT                   /db_xref="GOA:C6S612"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6S612"
FT                   /protein_id="CBA04841.1"
FT                   /translation="MGGQKTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLH
FT                   RVWKHFTINTAHLKKGDKVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDR
FT                   LLNEGMILPVSLADAEKLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLV
FT                   LEFSKIYKPLEGAYDFYSFKLLPAMGRLIAKDAESYQYLAESIRMHPDQETLKQMMLDA
FT                   GFDSVDYHNMSAGIVALHKGVKF"
FT   CDS_pept        687130..687609
FT                   /transl_table=11
FT                   /locus_tag="NMO_0635"
FT                   /product="hypothetical protein"
FT                   /function="Predicted flavin-nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0635"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04844"
FT                   /db_xref="UniProtKB/TrEMBL:C6S613"
FT                   /protein_id="CBA04844.1"
FT                   /translation="MPESIFKQISLDILKLHRDSVYSLLATSGCNCQVHEAAYVNIDGK
FT                   YYISLSCEPEVGEVKTGILLIEDESRNLRLSWVGSARELDRKDNAYKRALSALSRKLGR
FT                   CKDRLHTAVQPFLLELVPEKGRFSVGDEEVWISRNDLVRALYPVGYSMRQAMLQI"
FT   CDS_pept        complement(687736..688230)
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="NMO_0636"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridi
FT                   ne pyrophosphokinase"
FT                   /function="78-dihydro-6-hydroxymethylpterin-pyrophosphokina
FT                   se"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0636"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04847"
FT                   /db_xref="GOA:C6S614"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:C6S614"
FT                   /protein_id="CBA04847.1"
FT                   /translation="MNNRHFAVIALGSNLENPAQQVRAALDTLSSHPDIRLEQASSLYM
FT                   TAPVGYDNQPDFVNAVCTVSTTLDGIALLAELNRIEADFGRERSFRNAPRTLDLDIIDF
FT                   DGISSDDPRLTLPHPRAHERSFVIRPLAEILPDFVLGKHGKVAELSKQLGNQGIRLLPD
FT                   K"
FT   CDS_pept        complement(688240..688614)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0637"
FT                   /product="putative transcriptional regulator"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0637"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04850"
FT                   /db_xref="GOA:C6S615"
FT                   /db_xref="InterPro:IPR007360"
FT                   /db_xref="UniProtKB/TrEMBL:C6S615"
FT                   /protein_id="CBA04850.1"
FT                   /translation="MQYLIVKYSHQIFVTITILVFNIRVFLLWKNPEKPLVGFWKALPH
FT                   LNDTMLLFTGLWLMKITHFSPFNAPWLGTKILLLLAYIALGMMMMRARPRSTKFYTVYL
FT                   LAMCCVACIVYLAKTKVLPF"
FT   CDS_pept        complement(688668..689234)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0638"
FT                   /product="putative rRNA methylase"
FT                   /function="SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0638"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04853"
FT                   /db_xref="GOA:C6S616"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6S616"
FT                   /protein_id="CBA04853.1"
FT                   /translation="MLLKNILPFAHCLLRQALPEGGNALDGTAGNGHDTLFLAQTAGIR
FT                   GKVWAFDIQPQALSRTRCRLKEARYENVQLILDGHENLKQYVSEPLNAAIFNFGWLPGG
FT                   DKSLTTHTETSIPALCATLSLLKEGGMLIAVLYPGHENGKQEAEAIEQWAKNLPQEQFA
FT                   VLRYGFTNRKNSPPYLLAFEKLRQK"
FT   CDS_pept        complement(689319..689612)
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="NMO_0639"
FT                   /product="putative host factor-I protein"
FT                   /function="Uncharacterized host factor I protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0639"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04856"
FT                   /db_xref="GOA:C6S617"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:C6S617"
FT                   /protein_id="CBA04856.1"
FT                   /translation="MTAKGQMLQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVV
FT                   LLRNTSVTQMVYKHAISTIVPARSVNLQHENRPQAAPASTLVQVETVQQPAE"
FT   CDS_pept        complement(689740..690849)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0640"
FT                   /product="probable D-alanyl-D-alanine carboxypeptidase"
FT                   /function="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0640"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04859"
FT                   /db_xref="GOA:C6S618"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:C6S618"
FT                   /protein_id="CBA04859.1"
FT                   /translation="MSNHKICSDLKTECYKTQSPKHNKTARLRAVSCQTTYFTDGCFFN
FT                   KITPILKNMESKMSIHTLKRLPSSLLLGLCLSLPSAHLFADNDILGQFLEQNMLTSSDP
FT                   IEIFAESTIHPTNTQAITGGLILSSQSALVVNNKTGQILYQKNADRIMPIASISKLMSA
FT                   MVVLDANLDMNETVTITPDEIDRLKGTGSRLAIGTALTRKELLHLSLMSSENRATHALG
FT                   RTYPGGMGAFVAAMNRKAQSLGMYGSRFYEPTGLNFQNVSTAKDLSLMVNAAAQYPQIR
FT                   TNSTSNYASVQTKNGQQNYKNSNALVREGMWNIELQKTGYIREAGRSMVVKANIQNQPV
FT                   TIVLLNSPTSATRVNDARKIESWMLQQRS"
FT   CDS_pept        690999..691439
FT                   /transl_table=11
FT                   /locus_tag="NMO_0641"
FT                   /product="bacterioferritin comigratory protein"
FT                   /function="Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0641"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04862"
FT                   /db_xref="GOA:C6S619"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6S619"
FT                   /protein_id="CBA04862.1"
FT                   /translation="MDVKYEFTLPSSSGADFHSAEHLPLVVYFYPKDSTPGCTTEGLDF
FT                   NARLEQFEALGYTVVGISRDGVKAHQNFCAKQGFRFELLSDKDETVCRLFDVIKLKKLY
FT                   GKESLGIERSTFVLNKDGEIAHEWRKVKVAGHAQEVLETLSR"
FT   CDS_pept        691491..692366
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="NMO_0642"
FT                   /product="putative site-specific recombinase/integrase"
FT                   /function="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0642"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04865"
FT                   /db_xref="GOA:C6S620"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:C6S620"
FT                   /protein_id="CBA04865.1"
FT                   /translation="MEEGLIDRLLETLWLDRRLSQNTLNGYRRDLEKIARRLSQSGRML
FT                   KDADEADLAAAVYVDGEQRSSQARALSACKRLYIWMEREGIRTDNPTRLLKPPKIDKNI
FT                   PTLITEQQISRLLATPDTDTPHGLRDKALLELMYATGLRVSEAVGLNFGSVDLDRGCIT
FT                   ALGKGDKQRMVPMGQESAYWVGRYYTEARPALLKGRSCDALFVSQKKTGISRQLAWMIV
FT                   KEYAGRAGIGHISPHSLRHAFATHLVQHGLDLRVVQDMLGHADLNTTQIYTHVANVWLQ
FT                   GVVKEHHSRN"
FT   CDS_pept        692538..692738
FT                   /transl_table=11
FT                   /locus_tag="NMO_0643"
FT                   /product="Bacterioferritin-associated ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0643"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04868"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C6S621"
FT                   /protein_id="CBA04868.1"
FT                   /translation="MFVCICNAVTDHQIKETIAAGATTMGDLQSQLGVASCCGCCGELA
FT                   ASFLTAHNAQPTVTAGINVQA"
FT   CDS_pept        692904..693137
FT                   /transl_table=11
FT                   /locus_tag="NMO_0644"
FT                   /product="putative thioredoxin"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0644"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04871"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6S622"
FT                   /protein_id="CBA04871.1"
FT                   /translation="MKLTLMFREYCSLCHKMRDALKPFQNEYGFGLEVVDVDENPVLEE
FT                   KYNELVPVLLAGDEEICHWFLDEDRLKQFLER"
FT   CDS_pept        complement(693612..694475)
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="NMO_0645"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0645"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04874"
FT                   /db_xref="GOA:C6S623"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S623"
FT                   /protein_id="CBA04874.1"
FT                   /translation="MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNM
FT                   VKSFQPDAIVNTAAYTAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYIF
FT                   DGKGKRPYQESDFTNPSNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFVRTML
FT                   NLARERSPLSAVHNQIGCPTYAGDLAAAIIRLLQQTSPVRGIYHYAGGKSVSWYEFAQH
FT                   IFQAASQQQTSFPVPELTAVSDKEYPTAAPRPAYSILDCRKIENDFSIKPSDWQKALAQ
FT                   VVSKLL"
FT   CDS_pept        694675..695538
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="NMO_0646"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamidesy
FT                   nthase"
FT                   /function="Phosphoribosylaminoimidazolesuccinocarboxamide
FT                   (SAICAR) synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0646"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04877"
FT                   /db_xref="GOA:C6S624"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:C6S624"
FT                   /protein_id="CBA04877.1"
FT                   /translation="MSEIGLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIP
FT                   SKGEILTQISNFWFKKLVHIMPNHFTGDTVYDVLPENEAKVLEKRAVVAKKLTPVKVEA
FT                   IVRGYLAGSGWKDYQKTGSVCGIRLPEGMREAQQLPEVIFTPSTKAAVGDHDENISFEE
FT                   CGRIIGKELAEEVRAKAVRLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTP
FT                   DSSRFWPADQYKVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREAL
FT                   TLLTQD"
FT   CDS_pept        695775..697895
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="NMO_0647"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /function="Polyribonucleotide nucleotidyltransferase
FT                   (polynucleotide phosphorylase)"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0647"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04880"
FT                   /db_xref="GOA:C6S625"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C6S625"
FT                   /protein_id="CBA04880.1"
FT                   /translation="MFDKHVKTFQYGNHTVTLETGEIARQAAAAVKVSMGDTVVLVAVT
FT                   TNKEVKEGQDFFPLTVDYLERTYAAGKIPGGFFKREGKQSEKEILTSRLIDRPIRPLFP
FT                   EGFFHDIQIVAMVVSVDPEIDSDIPAMLGASAALVLSGVPFAGPIGAARVGYVNGVYVL
FT                   NPTKAELAKSQLDLVVAGTSKAVLMVESEAKILPEDVMLGAVVYGHDQMQVAINAINEF
FT                   ADEVNPELWDWKAPETNEELVAKVRGIAGETIKEAFKIRQKQTRSAKLDEAWNAVKEAL
FT                   ITEETDTLAANEIKGIFKHLEADVVRSQILDGQPRIDGRDTRTVRPLNIQTGVLPRTHG
FT                   SALFTRGETQALAVATLGTSRDEQIIDALSGEYTDRFMLHYNFPPYSTGEVGRMGAPKR
FT                   REIGHGRLAKRALLAVLPKPEDFSYTMRVVSEITESNGSSSMASVCGGCLSLLSAGVPL
FT                   KAHVAGIAMGLILEGNKFAVLTDILGDEDHLGDMDFKVAGTTEGVTALQMDIKIQGITK
FT                   EIMQIALAQAKEARLHILDQMKAAVAGPQELSAHAPRLFTMKINQDKIREVIGKGGETI
FT                   RSITAETGTEINIAEDGTITIAATTQEAGDAAKKRIEQITAEVEVGKVYEGTVVKILDN
FT                   NVGAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVDDRGRVRLSIKAL
FT                   LDAPAREENAAE"
FT   CDS_pept        complement(697968..698714)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0648"
FT                   /product="conserved putative membrane protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0648"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04883"
FT                   /db_xref="GOA:C6S626"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:C6S626"
FT                   /protein_id="CBA04883.1"
FT                   /translation="MPSADPMCRTAANHPFSRKIFDFKLPMNHDITFLTLFLLGFFGGT
FT                   HCIGMCGGLSSAFALQLPPHINRFWLILLLNTGRVSSYTAIGLILGLIGQVGVSLDQTR
FT                   VLQNILYTAANLLLLFLGLYLSGISSLAAKIEKIGKPIWRNLNPILNRLLPIKSIPACL
FT                   AVGILWGWLPCGLVYSASLYALGSGSAATGGLYMLAFALGTLPNLLAIGIFSLQLKKIM
FT                   QNRYIRLCTGLSVSLWALWKLAVLWL"
FT   CDS_pept        complement(698650..698970)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0649"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04886"
FT                   /db_xref="UniProtKB/TrEMBL:C6S627"
FT                   /protein_id="CBA04886.1"
FT                   /translation="MLPLTRNTMFRILLLLFPCAILAACTRNIPANPAVSNCAHLQNRT
FT                   ILYFDAHGKPADGAVKGGFYKIIEIQGANCILIQDFNSTGNALGGSYVPDCRKSSLFPK
FT                   NI"
FT   CDS_pept        699083..699934
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="NMO_0650"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0650"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04889"
FT                   /db_xref="GOA:C6S628"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:C6S628"
FT                   /protein_id="CBA04889.1"
FT                   /translation="MNTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAAWADRFRGVGF
FT                   DQLLVVGRSETEGVDFRYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETAN
FT                   GVIFPKLSDNGMVTVNMGKPKFMPSEIPFVPESGEGDDACIYGVHLESGIQPVSCVNMG
FT                   NSHAVIVVDDVECAPVRETGSLIEPHRQFPERVNVGFMQIVSRTAIRLRVFERGVGETQ
FT                   ACGTGACAAVVAGIRLGLLDEGKTVEVILPGGTLYIEWACGGDVMMTGPAETVFEGELA
FT                   YS"
FT   CDS_pept        699931..700536
FT                   /transl_table=11
FT                   /locus_tag="NMO_0651"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0651"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04892"
FT                   /db_xref="GOA:C6S629"
FT                   /db_xref="UniProtKB/TrEMBL:C6S629"
FT                   /protein_id="CBA04892.1"
FT                   /translation="MILLHLDFLSALLYAAVFLFLIFRAGMLQWFWASIMLWLGISVLG
FT                   AKLMPGIWGMTRAAPLFIPHFYLTLGSIFFFIGHWNRKTDGNGWQADPEHPLLGLFAVS
FT                   NVSMTFAFVGICALVHYCFSGTVQVFVFAALLKLYALKPVYWFVLQFVLMAVAYVHRCG
FT                   IDRQPPSTFGGSQLRLGGLTAALMQISVLVLLLSEIGR"
FT   CDS_pept        700682..701662
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="NMO_0652"
FT                   /product="Cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0652"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04895"
FT                   /db_xref="GOA:C6S630"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C6S630"
FT                   /protein_id="CBA04895.1"
FT                   /translation="MGIAPYCRNLIIQEQKMKIANSITELIGNTPLVKLNRLTEGLKAE
FT                   VAVKLEFFNPGSSVKDRIAEAMIEGAEKAGKINKNTVIVEATSGNTGVGLAMVCAARGY
FT                   KLAITMPESMSKERKMLLRAFGAELILTPAAEGMAGAIAKAKYLVDAHPDTYFMPRQFD
FT                   NEANPEIHRKTTAEEIWRDTDGKVDVFVAGVGTGGTITGVGEVLKKYKPEVKVVAVEPE
FT                   ASPVLSGGEKGPHPIQGIGAGFIPTVLNTKIYDSITKVSNEAAFETARAMAEKEGILVG
FT                   ISSGAAVWSALQLAKQPENEGKLIVVLLPSYGERYLSTPLFADLA"
FT   CDS_pept        702125..703030
FT                   /transl_table=11
FT                   /locus_tag="NMO_0653"
FT                   /product="putative transporter permease protein"
FT                   /function="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0653"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04898"
FT                   /db_xref="GOA:C6S631"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6S631"
FT                   /protein_id="CBA04898.1"
FT                   /translation="MGKGGDIVVGNGKKYAAPLLVLGCVVFGLGSLIVRSVPVGSYAIA
FT                   FWRLLISVFVFWFLARFFGQKFPKNRKTVRYALTAGVFLAFDLALWHESIHAVGPGIST
FT                   LLNSLQIFFLSAIGVFFFGERLSGLKKAGLISAVAGVAMIAGAEFGYNGNAVWGFVSGL
FT                   VSGLMLALSMVFVRKTHEIEPVALFPSMMILSLGGAVSLVVPALLMDGGALYPTTWKDA
FT                   GLVLVYGVVMQCFAWAMVAYAIPLLSLSLTGLLLLSEPVAALFIDYFELGKPIEGVQWA
FT                   GVALTLSAIYLGSLKQQSEP"
FT   CDS_pept        complement(703444..704463)
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="NMO_0654"
FT                   /product="Signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0654"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04901"
FT                   /db_xref="GOA:C6S632"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:C6S632"
FT                   /protein_id="CBA04901.1"
FT                   /translation="MNTMLMSGAAAALLAGIILYFKSDKKRQENGEWSSGLEYAYILTA
FT                   VGVFAALSLFMSFTAVFLIFVVLCGTAWGVYKYRLKTHPEISESSHFGYYFGSFFPTVL
FT                   VLFLIRSFIAEPFQIPSSSMRPGLIKGDFILVGKFSYGLRVPVLNNVFIPTGKIERGDV
FT                   VVFNYPLQPEMTYIKRIVGIPGDVVEYRNKVLTVNGKPASDIPDGTYRYPDDTDPSEIH
FT                   NTDMFHSGLDGKSFNILKKEGQPAVSLPVLGKYTSDIMSENGYSIEQSGLEHCQYADDG
FT                   SGFVCKVPEGRYFAMGDNRDNSADSRYWGFVDDKLVVGKAMFILMNFGDFGRAGTAIR"
FT   CDS_pept        complement(704606..706399)
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="NMO_0655"
FT                   /product="GTP-binding protein"
FT                   /function="Membrane GTPase LepA"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0655"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04904"
FT                   /db_xref="GOA:C6S633"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:C6S633"
FT                   /protein_id="CBA04904.1"
FT                   /translation="MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMD
FT                   IEKERGITIKAQTAALNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDA
FT                   SQGVEAQTVANCYTAIDLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSA
FT                   KSGIGVEDVLEEIVAKIPAPTGDENAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDK
FT                   VRFMSTKAETQVEQLGVFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPA
FT                   TEPLPGFQEVQSQVFAGLYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRC
FT                   GFLGLLHLEIVQERLEREFDMDLITTAPTVIYEVVLKSGEKIEVENPSKLPDIGSIETI
FT                   LEPIITATILVPQEYVGNVMTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKL
FT                   KSTSRGYASLDYHFKEFQPSDLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRE
FT                   LIPRQMFDIAVQAAIGSQIIARENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMK
FT                   QVGNVEIPQSAFLAILQVSDK"
FT   CDS_pept        complement(706542..707243)
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="NMO_0656"
FT                   /product="5'-methylthioadenosine nucleosidase /
FT                   S-adenosylhomocysteine nucleosidase"
FT                   /function="Nucleoside phosphorylase"
FT                   /EC_number="3.2.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0656"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04907"
FT                   /db_xref="GOA:C6S634"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C6S634"
FT                   /protein_id="CBA04907.1"
FT                   /translation="MSLKTVTVIGAMEQEIELLREMMENVKAVSFGKFAAYEGELAGKR
FT                   MVLALSGIGKVNAAVATAWLIHQFAPDCVINTGSAGGLGKGLKVGDVVVGTEIAHHDVD
FT                   VTAFGYVWGQVPQLPARFASDGILIETAKRAARTFEGAAVEQGLIVSGDRFVHSSEGVA
FT                   EIRKHFPEVKAVEMEAAAIAQTCHQLETPFVIIRAVSDSADEKADISFDEFLKTAAANS
FT                   AKMVAEIVKSL"
FT   CDS_pept        707411..708541
FT                   /transl_table=11
FT                   /gene="pilT2"
FT                   /locus_tag="NMO_0657"
FT                   /product="twitching motility-like protein"
FT                   /function="Tfp pilus assembly protein ATPase PilU"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0657"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04910"
FT                   /db_xref="GOA:C6S635"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S635"
FT                   /protein_id="CBA04910.1"
FT                   /translation="MFTDENMTAKEELFAWLRHMNQNKGSDLFVTTHFPPAMKLDGKIT
FT                   RITDEPLTAEKCMEIAFSIMSAKQAEEFSSTNECNFAISLPDTSRFRVNAMIQRGATAL
FT                   VFRAITSKIPKFESLNLPPVLKDVALKKRGLVIFVGGTGSGKSTSLASLIDYRNENSFG
FT                   HIITIEDPIEFVHEHKNCIITQREVGVDTENWMAALKNTLRQAPDVILIGEIRDRETMD
FT                   YAIAFAETGHLCMATLHANSTNQALDRIINFFPEERREQLLTDLSLNLQAFISQRLVPR
FT                   DGGKGRVAAVEVLLNSPLISELIHNGNIHEIKEVMKKSTTLGMQTFDQHLYQLYEKGDI
FT                   SLQEALKNADSAHDLRLAVQLRSRRAQSSSPDLELL"
FT   CDS_pept        708575..709552
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="NMO_0658"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /function="ATPase involved in DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04913"
FT                   /db_xref="GOA:C6S636"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S636"
FT                   /protein_id="CBA04913.1"
FT                   /translation="MIYPWHNEQWRQIAEHWERRPNAWLFAGKKDTGKTTFARFAAKAL
FT                   LCETPAPGCKPCGECMSCHLFGQGSHPDFYEITPLSDEPENGRKLLQIKIDAVREIIDN
FT                   VYLTSVRGGLRVILIHPAESMNVQAANSLLKVLEEPPPQVVFLLVSHAADKVLPTIKSR
FT                   CRKMVLPAPSHEEALAYLRERGVAEPEERLAFHSGAPLFDEADGVRALRIKLLDILAEP
FT                   RLLKILDYAALFDKEKLPLAVFVGWMQKWLVDLGLCLQHMKPVYYPAYEDRLLQTVSGF
FT                   RPRNVFAAEDMLKQLAPYGFHTLNVKMQIEHLLINYLELKKENG"
FT   CDS_pept        709556..709906
FT                   /transl_table=11
FT                   /gene="pilZ"
FT                   /locus_tag="NMO_0659"
FT                   /product="type IV fimbriae assembly protein"
FT                   /function="Tfp pilus assembly protein PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0659"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04916"
FT                   /db_xref="GOA:C6S637"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:C6S637"
FT                   /protein_id="CBA04916.1"
FT                   /translation="MSDGQNIPAKMMSLQLKDMNLLYSSYMPFLEHGGLFVQTNDVFSI
FT                   GDDILLAVEILNFPKLFLPTKVAWINPARTSSKPKGVGLAFTKHENCLKVKDQIEVELG
FT                   NTIGGSRPTFTM"
FT   CDS_pept        709911..710690
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="NMO_0660"
FT                   /product="Mg-dependent DNase"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0660"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04918"
FT                   /db_xref="GOA:C6S638"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6S638"
FT                   /protein_id="CBA04918.1"
FT                   /translation="MHIIDSHCHLNFEGLKERLPEVLSNMEANGVGQALAISVSRESFA
FT                   EVSAIAEVYEHIYCTIGVHPDSKEAEEFSIAEMVAAAAHPKVVGIGETGLDYYWCKGDL
FT                   SWQHKRFADHIEAANQTGLPVIVHTRDAAADTLSILKECRVNSGVIHCFSEDIGFARAA
FT                   MDLGLYISFSGIVTFKNAPLVQEAAKYVPDDRILVETDAPFLAPVPKRGRQNEPAFVRY
FT                   TAEHIAKLRNQTLEQVAAYTTENFYRLFQKVPDMRVV"
FT   CDS_pept        710739..710931
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0661"
FT   CDS_pept        711032..711343
FT                   /transl_table=11
FT                   /locus_tag="NMO_0662"
FT                   /product="Glutaredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0662"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04923"
FT                   /db_xref="GOA:C6S639"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6S639"
FT                   /protein_id="CBA04923.1"
FT                   /translation="MASIHDQIKEVVTTHRVVLFMKGTKQFPQCGFSSRAVQILNAAGC
FT                   TDYVTVNVLENPEVRQGIKEYSDWPTIPQLYVNGEFVGGSDILMEMYEAGELQELLKA"
FT   CDS_pept        711449..712075
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="NMO_0663"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0663"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04925"
FT                   /db_xref="GOA:C6S640"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:C6S640"
FT                   /protein_id="CBA04925.1"
FT                   /translation="MNVNVINHPLVRHKLTLMREADCSTYKFRTLAIELARLMAYEASR
FT                   DFEIEKYLIDGWCGQIEGDRIKGKTLTVVPILRAGLGMLDGVLDLIPTAKISVVGLQRD
FT                   EETLKPVSYFEKFVDSMDERPALIIDPMLATGGSMVATIDLLKAKGCKNIKALVLVAAP
FT                   EGVKAVNDAHPDVTIYTAALDSHLNENGYIIPGLGDAGDKIFGTR"
FT   CDS_pept        712098..712418
FT                   /transl_table=11
FT                   /locus_tag="NMO_0664"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04928"
FT                   /db_xref="InterPro:IPR016755"
FT                   /db_xref="UniProtKB/TrEMBL:C6S641"
FT                   /protein_id="CBA04928.1"
FT                   /translation="MNFQDYLATFPSIDHLGGLDVQDADGKTVHHIPAVQGKLGSLKLY
FT                   NALAERFDGKLDKEAAEQGLIWFAEHVADARAHPGKHPNIDLLEKVVQSGETLLLKPLA
FT                   AQ"
FT   CDS_pept        712669..713091
FT                   /transl_table=11
FT                   /locus_tag="NMO_0665"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0665"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04931"
FT                   /db_xref="UniProtKB/TrEMBL:C6S642"
FT                   /protein_id="CBA04931.1"
FT                   /translation="MKKMFLSAVLLLSAAAQTVWADTVFSCKTDNNKYIEVQKINRNLY
FT                   EYSFGSAAKKEIAIRNSKADLSGRSDRWQGMGSGRWATMKFQNGEFMYTIWTGFDSVTH
FT                   TESSGVVVERRGKEVARVGCTPQTAQANFNDADFSR"
FT   CDS_pept        713109..713870
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="NMO_0666"
FT                   /product="Uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04934"
FT                   /db_xref="GOA:C6S643"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:C6S643"
FT                   /protein_id="CBA04934.1"
FT                   /translation="METAKPIMLIVRPSGRAKDDVETCRRAGWQAEVLSPIEIEADAAG
FT                   LELLSEQYARADAVFWVSPTAVETAVPYLNLSDGIKIHIAVGQGSRRALERYLGRTVIA
FT                   PHDGNDSEAVLRLPVWNSLPEGARVLFVRGHGGRDFLMNALQEKGFRTEMAEVYFRRHK
FT                   PLNFQNFQTENIAAAYITSTELVRLLFGQLPPQFSRFFKSLLYFTHHPRIAEALKREGV
FT                   CSVETVPTLEAALSHSSISVSDGMVFPGTSN"
FT   CDS_pept        713885..715192
FT                   /transl_table=11
FT                   /gene="hemX"
FT                   /locus_tag="NMO_0667"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /function="Uncharacterized enzyme of heme biosynthesis"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0667"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04937"
FT                   /db_xref="GOA:C6S644"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:C6S644"
FT                   /protein_id="CBA04937.1"
FT                   /translation="MGEPENKSSEPVREIQASKEMPSETSSPRKENETEVHIPAAPFIV
FT                   KQSGSNALAVCALVLAALGLGTSGFLFVQGQNVLKNQELAFNQKIDKAALGESENAALL
FT                   KDNLNRQAAIQSELDRLDGNVKANGEQILEMQKSYRELTKGRADWLVDETDTILNLAAQ
FT                   QLVLTGNIQTAVGVLEHIDSRLSRFNQAELLPIKQAVSSDLAELKNRPYVDISGTALRL
FT                   DRLETAVFGLPLILDGVLKPGVQVKNEAASASWWQNVWEKSLGTLKGLVEIRRLENNDA
FT                   MLISPEQAYFVRENLRLRLLDARTALMQRNSEVYQGDLNNAEAAVRQYFDAKSPATQSW
FT                   LKELAELKELDVRMTADDGLKASLNAVRAYRDGTRMMAAENQEAEQAVSEPSAASDVKT
FT                   IEAPSLPSERKPEQPAKKQPVPEKAGRSPSAKGERA"
FT   CDS_pept        715189..716406
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="NMO_0668"
FT                   /product="HemY protein"
FT                   /function="Uncharacterized enzyme of heme biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0668"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04941"
FT                   /db_xref="GOA:C6S645"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C6S645"
FT                   /protein_id="CBA04941.1"
FT                   /translation="MKTVVWIVVLFAAAVGLALASGIYTGDVYIVLGQTMLRINLHAFV
FT                   LGSLIAVVVWYFLFKFIIGVFNIPEKMQRFGSARKGRKAALALNKAGLAYFEGRFEKAE
FT                   LEASRVLGNKEAGDNRTLALMLGAHAAGQMENIELRDRYLAEIAKLPEKQQLSRYLLLA
FT                   ESALNRRDYEAAEANLHAAAKMNANLTRLVRLQLRYAFDRGDALQVLAKTEKLSKAGAL
FT                   GKSEMERYQNWAYRRQLADAADAAALKTCLKRIPDSLKNGELSVSVAEKYERLGLYADA
FT                   VKWVKQHYPQSRRPELLEAFVESVRFLGERDQQKAIDFADAWLKEQPDNALLLMYLGRL
FT                   AYGRKLWGKAKGYLEASIALKPSISARLVLAKVFDETGEPQKAEAQRNLVLASVAEENR
FT                   PSSETC"
FT   CDS_pept        716481..717545
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="NMO_0669"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /function="Uroporphyrinogen-III decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0669"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04943"
FT                   /db_xref="GOA:C6S646"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C6S646"
FT                   /protein_id="CBA04943.1"
FT                   /translation="MTLLKNDTFLRALLKQPVEYTPIWMMRQAGRYLPEYKATRAKAGS
FT                   FLDLCKNTGLATEVTIQPLERFDLDAAILFSDILTVPDAMGLGLYFAEGEGPKFKRALQ
FT                   HEADIAKLHVPDMEKLQYVFDAVTSIRKALDGRVPLIGFSGSPFTLACYMVEGGGSKEF
FT                   RTIKTMMYSRPDLLHKILDTNAQAVTAYLNAQIDAGAQAVQIFDTWGGVLSDAAFKEFS
FT                   LKYIRQIVAGLKRESEGRLVPVIVFAKGGGLWLESMAQIGADALGLDWTCNIGEARRRV
FT                   GNQVALQGNFDPFALFGTPESIRTEVARILADYGHGSGHVFNLGHGINQHADPEHTKIL
FT                   VDTVHELSRHYHGG"
FT   CDS_pept        717734..719113
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="NMO_0670"
FT                   /product="DNA repair protein"
FT                   /function="Predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0670"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04946"
FT                   /db_xref="GOA:C6S647"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C6S647"
FT                   /protein_id="CBA04946.1"
FT                   /translation="MAKTLKTLYQCTECGGTSPKWQGKCPHCGEWNTLQESLAAPEPKN
FT                   ARFQSWAADTSTVQSLSSVTATEVPRNPTGMGELDRVLGGGLVDGAVILLGGDPGIGKS
FT                   TLLLQTITKMAQSRKVLYVSGEESAQQVALRAQRLELPTEGVNLLAEIRMEAIQTALKQ
FT                   HQPEVVVIDSIQTMYSDQITSAPGSVSQVRECAAQLTRMAKQMGIAMILVGHVTKDGAI
FT                   AGPRVLEHMVDTVLYFEGDQHSNYRMIRAIKNRFGAANELGVFAMTENGLKGVSNPSAI
FT                   FLASYRDDTPGSCVLVTQEGSRPLLVEIQALVDDAHGFTPKRLTVGLEQNRLAMLLAVL
FT                   NRHGGIACFDQDVFLNAVGGVKIGEPAADLAVILAMLSSFRNRPMPEKTVVFGEIGLSG
FT                   EVRPVARGQERLKEAEKLGFKRAIVPKANMPRNAKEFPNLKIYGVSSLQEAIDICRDSR
FT                   E"
FT   CDS_pept        complement(719389..719868)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0671"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0671"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04949"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:C6S648"
FT                   /protein_id="CBA04949.1"
FT                   /translation="MKHILPLIAASALCISTASAHPASEPSTQNETAMTTHTLTSKYSF
FT                   DETVSRLETAIKSKGMDIFAVIDHQEAARRNGLTMQPAKVIVFGTPKAGTPLMVKDPAF
FT                   ALQLPLRVLVTETDGKVRAAYTDTRALIAGSRIGFDEVANTLANAEKLIQKTVGE"
FT   CDS_pept        complement(719993..720352)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0672"
FT                   /product="putative Rhodanese-related sulfurtransferase"
FT                   /function="Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0672"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04952"
FT                   /db_xref="GOA:C6S649"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C6S649"
FT                   /protein_id="CBA04952.1"
FT                   /translation="MNIKHLITTTLIASAAFAAQAAPQKPVSAAQTAQHPAVWIDVRSE
FT                   QEFSEGHLHNAVNIPVDQIVRRIHEAAPDKDTPVNLYCRSGRRAKAALQELKKAGYTNV
FT                   ANHGGYEDLLKKGMK"
FT   CDS_pept        complement(720391..724005)
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /locus_tag="NMO_0673"
FT                   /product="exodeoxyribonuclease V, beta subunit"
FT                   /function="ATP-dependent exoDNAse (exonuclease V) beta
FT                   subunit (contains helicase and exonuclease domains)"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0673"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04955"
FT                   /db_xref="GOA:C6S650"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C6S650"
FT                   /protein_id="CBA04955.1"
FT                   /translation="MSAPIQAFDPLTVPIAGTNLIEASAGTGKTYGIAALFTRLIVLEQ
FT                   KNVERVLVVTFTKAATAELKTRLRARLDDVLQVLESKEIAELGDGALSDGIAAYCAEHH
FT                   KGDTFLPALLKQALQKEGRTRLIVRLKAAIGQFDNAAIYTIHGFCQRILRDYAFLCQAP
FT                   FDVELTEEDGDRLLIPAQDFWRERVSNDPVLAALAFKRKAVPQTVLAQIRAYLSRPYLN
FT                   FRRPQADLKQAQRNAETSWQTVCRLLPELEAGFWRIHPDLNGNSYRKNSFGNLFKELAQ
FT                   KSAAGQLPFLDKDTHDRLLKLASDKLEAGLKKGKTPDAAVFAELQKLADFGYDLNALEE
FT                   AEEATIIRLQLDLIGYLNRSLAEMKKSRRERGFDDLLLDVHTALTDNPHAETLARTVAE
FT                   NWETALIDEFQDTDPLQYEIFQKIFIAQNRPLFLVGDPKQAIYSFRGADIYAYLQAAED
FT                   ARHRYTLATNYRSHAALIGSIGALFRLKERPFVLENIGYSEVGAARAESRLSPKRPAVQ
FT                   VRWLHENDNEKANKDVLRRRAADYCADEIAHALNEAAGGRLNFKGCPLQSGDIAVLVRT
FT                   HNEAVMVSAALKKRQVQSVLLSRESVFASPEAAALSALIGFWLEPRRAGTLRFVLTSSI
FT                   FGYNAQQLHDFNQNESEILHWAESARTALDNWNQYGIFAAMQQFSQTHGIETRLLSRNN
FT                   GRSLTNYFQLLELLAAEDAQNRNPAALHKWLRDQISLAGNNGGDNRSIRLESDEDLVKI
FT                   VTMHASKGLQYPLVYCPFAWDAQDTGPSDWQILHQSANRTELLAKAQLSEDEQKQYADE
FT                   EMAERLRLLYVALTRAEEQLNIYAAYSSDTADNPLAYLIEGLPQDSRETVRRAYACEKD
FT                   GIAMLKRNWQRVADNAPSGTNFSFTEDAPPPAVYCGNAGQTAEFAASDIPKRGFRFIRH
FT                   TSFTALSRQTQTPDGGEEDACPSLDAAETSVAAMPSETPTASDGISIHNFPKGTQAGLC
FT                   LHEILEDFKFGQAAAGQETLIADKLKKYGFEEIWLPAVAEMAEACRKTPLTGAYCLSDI
FT                   PPECRCPEMGFTLHTEDFGLKRLRDWFARDDIRLPEVCRAAAETLDFHTVNGFLNGFAD
FT                   MVCQDPDGNICVIDYKSNHLGADASAYTQQAMDEAVAHHHYYLQALIYAVAAMRYFKLR
FT                   GQPPAAVSVRYLFLRGFDGKGGGVWRWDIDAAALEQIK"
FT   CDS_pept        complement(724238..725146)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0674"
FT                   /product="putative iron-dependent peroxidase"
FT                   /function="Predicted iron-dependent peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0674"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04958"
FT                   /db_xref="GOA:C6S651"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C6S651"
FT                   /protein_id="CBA04958.1"
FT                   /translation="MNTPQSAIIPDHAQAGIFIEADFAANRLNDIKAACRASLDALTAL
FT                   KARFPDDILGLTIAFGSKAWATFGHTDEGSEIKPFSEMGNGLAPSTQHDMSIHIQSFRQ
FT                   NAAYALAQSVLGAFGDSICVASEEHGLRLYQDRGLDGFVDGTENPQGDENVREVAIIPE
FT                   GKPDAGGSYVLLQKYLHDLKKWDAVPVAEQEASVGRGKETDDEFGRDVRLPDSHLGRVN
FT                   LKENGVGLKIVRRSLPFGKISGEHGLMFTAYCRTLHNIEAQLLSMFGDTDGKTDLLLRH
FT                   LSAAVSGGYYYAPSVERLQNL"
FT   CDS_pept        725434..726258
FT                   /transl_table=11
FT                   /gene="hisJ1"
FT                   /locus_tag="NMO_0675"
FT                   /product="polar amino acid transport system
FT                   substrate-binding protein"
FT                   /function="ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0675"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04961"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C6S652"
FT                   /protein_id="CBA04961.1"
FT                   /translation="MLKKFVLGGIAALVLAACGGSEGGSGASSAPAQSAVSGSLIERIN
FT                   NKGTVTVGTEGTYAPFTYHDKDGKLTGYDVEVTLAVAEKLGVKVEFKETQWDSMMAGLK
FT                   AGRFDVVANQVGLTSPERQATFDKSDPYSWSGAVLVARNDSNIKSIDDIKGVKTAQSLT
FT                   SNYGEKAKAAGADLVAVDGLAQSLTLIEQKRADATLNDELAVLDYLKKNPNAGVKIVWS
FT                   APADEKVGSGLIVNKGNDEAVAKFSTAINELKADGTLKKLGEQFFGKDISVQ"
FT   CDS_pept        726281..726964
FT                   /transl_table=11
FT                   /gene="hisM"
FT                   /locus_tag="NMO_0676"
FT                   /product="polar amino acid transport system permease
FT                   protein"
FT                   /function="ABC-type amino acid transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0676"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04964"
FT                   /db_xref="GOA:C6S653"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6S653"
FT                   /protein_id="CBA04964.1"
FT                   /translation="MTETRADMIVSAFLPMVKAGFAVSLPLAAASFVIGMMIAVAVALV
FT                   RIMPAGGIVRKILLKLVEFYISVIRGTPLLVQLVIVFYGLPSVGIYIAPIPAAIIGFSL
FT                   NVGAYASETIRAAILSVPKGQWEAGFSIGMTYMQTFRRIVAPQAFRVAVPPLSNEFIGL
FT                   FKNTSLAAVVTVTELFRVAQETANRTYDFLPVYIEAALVYWCFCKVLFLIQARLEKRFD
FT                   RYVAK"
FT   CDS_pept        726974..727729
FT                   /transl_table=11
FT                   /locus_tag="NMO_0677"
FT                   /product="putative polar amino acid transport system
FT                   ATP-binding protein"
FT                   /function="ABC-type polar amino acid transport system
FT                   ATPase component"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0677"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04967"
FT                   /db_xref="GOA:C6S654"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6S654"
FT                   /protein_id="CBA04967.1"
FT                   /translation="MIKIRNIHKTFGKNTILRGINLDVCKGQVVVILGPSGSGKTTFLR
FT                   CLNALEMPEDGQIEFDNERPLKIDFSKKPSKHDILALRRKSGMVFQQYNLFPHKTALEN
FT                   VMEGPVAVQGKPAAQAREEALKLLEKVGLGDKVDLYPYQLSGGQQQRVGIARALAIQPE
FT                   LMLFDEPTSALDPELVQDVLNAMKELAREGWTMVVVTHEIKFALEVATTVVVMDGGVIV
FT                   EQGSPKELFDHPKHERTRRFLSQIQSTKI"
FT   CDS_pept        complement(727749..729131)
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="NMO_0678"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0678"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04970"
FT                   /db_xref="GOA:C6S655"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C6S655"
FT                   /protein_id="CBA04970.1"
FT                   /translation="MASIARDIFKAYDIRGIVGKTLTDEAAYLIGKAIAAKAAEKGMTR
FT                   IALGRDGRLSGPELMEHIQRGFTDSGIDVLNVGMVATPMLYFAAINECGGSGVMITGSH
FT                   NPPDYNGFKMMLGGDTLAGEAIQELLSIIEKDGFAAAGKQGSVTEKDISGEYHNHIVGH
FT                   VKLKRPMNIAIDAGNGVGGAFAGKLYRALRCGVTELFCDVDGNFPNHHPDPSKPKNLQD
FT                   LIAALKNGDAEIGLAFDGDADRLGVVTKDGNIIYPDRQLMLFAQDVLSRNPGAKVIFDV
FT                   KSTRLLAPWIKEHGGEAIMEKTGHSFIKSTMKKTGALVAGEMSGHIFFKERWFGFDDGL
FT                   YAGARLLEILSASDNPSEVLNNLPQSISTPELNIALPEGSNGHQVIDELAAKAEFEGAT
FT                   EIITIDGLRVEFPDGFGLMRASNTTPILVLRFEADTQEAIERIQNQFKAVIESNPNLIW
FT                   PL"
FT   CDS_pept        complement(729298..729807)
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="NMO_0679"
FT                   /product="peptidyl-prolyl cis-trans isomerase B"
FT                   /function="Peptidyl-prolyl cis-trans isomerase (rotamase) -
FT                   cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0679"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04973"
FT                   /db_xref="GOA:C6S656"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C6S656"
FT                   /protein_id="CBA04973.1"
FT                   /translation="MIILHTNKGDIKIELDFDKAPVTAKNFEQYVKDGFYDGVIFHRVI
FT                   KGFMIQGGGMDENMNEKETRDPIQNEASNGLPNDKYTIAMARTSDPHSASAQFFINTAD
FT                   NAFLNFRSKELYGKTVVQDWGYAVFGKVVDGFDVVDAIEGVSTKRHGYHDDVPSEPVVI
FT                   IKAEAV"
FT   CDS_pept        complement(729926..731341)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0680"
FT                   /product="putative transport protein"
FT                   /function="Di- and tricarboxylate transporters"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0680"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04976"
FT                   /db_xref="GOA:C6S657"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:C6S657"
FT                   /protein_id="CBA04976.1"
FT                   /translation="MNLHAKDKTQHPENVELLSAQKPITDFKGLLTTIISAVVCFGIYH
FT                   ILPYSPDANKGIALLIFVAALWFTEAVHITVTALMIPILAVVLGFPDMDIKKAMADFSN
FT                   PIIYIFFGGFALATALHMQRLDRKIAVALLRLSRGSMKAAVLMLFLVTAFLSMWISNTA
FT                   TAAMMLPLAMGMLSHLDREKERKTYVFVLLGIAYCASIGGLGTLVGSPPNLIAAKALNL
FT                   DFVGWMKLGLPMMLLILPLMLLSLYVILKPNLNERVEIKAESIPWTLHRVIALLIFLAT
FT                   AAAWIFSSKIKTAFGISNPDTVIALSAAVAVVVFGVAQWKEVARNTDWGVLMLFGGGIS
FT                   LSTLLKTSGASEALGQQVAATFSGAPAFLVILIVAAFIIFLTEFTSNTASAALLVPIFS
FT                   GIAMQMGLPEQVLVFVIGIGASCAFMLPVATPPNAIVFGTGLIKQREMMNVGILLNILC
FT                   VVLVALWAYAVLM"
FT   CDS_pept        complement(731572..731934)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0681"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0681"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04979"
FT                   /db_xref="GOA:C6S658"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:C6S658"
FT                   /protein_id="CBA04979.1"
FT                   /translation="MNLPRNRFILLSALWFAGSIYSLLFKAAETAPPPFPHFDKAAHLA
FT                   LFFAQIWLLTKAFKTGKLPIPYRSLMVFALCFALFSECAQAWFTATRTGSLGDVLADMA
FT                   GTVLALFAARAADRPD"
FT   CDS_pept        complement(731931..732137)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0682"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04982"
FT                   /db_xref="UniProtKB/TrEMBL:C6S659"
FT                   /protein_id="CBA04982.1"
FT                   /translation="MTELKQLIQTESIPVIEETLDFLLYECSIDDAPSAEEVAQWRDIL
FT                   AARGGKFLRLSKLCRTWLEEEQA"
FT   CDS_pept        complement(732198..732776)
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="NMO_0683"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0683"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04985"
FT                   /db_xref="GOA:C6S660"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C6S660"
FT                   /protein_id="CBA04985.1"
FT                   /translation="MSNTIKMVVGLGNPGKEYEQTRHNAGFWFLDELAWKWKASFKEEK
FT                   KFFGEVARAALPDGDVWLLKPATFMNRSGQAVAALAQFYKIKPEEILVVHDELDIPCGR
FT                   IKFKLGGGNGGHNGLKDIQAKLGTADYYRLRLGIGHPGDRNLVVGYVLNKPSTEHRRQI
FT                   DDAVAKSLQAIPDILAGKWEEATRFLHSK"
FT   CDS_pept        complement(732829..733107)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0684"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0684"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04988"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/TrEMBL:C6S661"
FT                   /protein_id="CBA04988.1"
FT                   /translation="MLEIEIVYGLPDRQVLKTMQLAEGTTVRAAALQSGLDGIFEDLNL
FT                   HSAPLGIFGKAVKDDTPLRDGDRIEVYRPLLIDPKEARRKRVQNQEE"
FT   CDS_pept        complement(733100..733537)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0685"
FT                   /product="putative oligoketide cyclase/lipid transport
FT                   protein"
FT                   /function="Oligoketide cyclase/lipid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0685"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04991"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C6S662"
FT                   /protein_id="CBA04991.1"
FT                   /translation="MPVKKVEKNILVLHGADKMFELVDKVEDYPHFLPWYSKTEVIGRS
FT                   GNELKARLFMDYMHVRQSFATHNRNIPGREIRMELLEGPFKTLRGTWKFIDLGDDMCKI
FT                   EFNLEYDFSNAVLSALISPVFNHLSVTLVEAFVKEADRRYA"
FT   CDS_pept        complement(733752..735719)
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="NMO_0686"
FT                   /product="cell division protein"
FT                   /function="ATP-dependent Zn proteases"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0686"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04994"
FT                   /db_xref="GOA:C6S663"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C6S663"
FT                   /protein_id="CBA04994.1"
FT                   /translation="MGNTFKSILVWVALGIGLMAAFNALDGKKEDNGQIEYSQFIQQVN
FT                   NGEVSGVNIEGSVVSGYLIKGERTDKSTFFTNAPLDDNLIKTLLDKNVRVKVTPEEKPS
FT                   ALAALFYSLLPVLLLIGAWFYFMRMQTGGGGKGGAFSFGKSRARLLDKDANKVTFADVA
FT                   GCDEAKEEVQEIVDYLKAPNRYQSLGGRVPRGILLAGSPGTGKTLLAKAIAGEAGVPFF
FT                   SISGSDFVEMFVGVGASRVRDMFEQAKKNAPCIIFIDEIDAVGRQRGAGLGGGNDEREQ
FT                   TLNQLLVEMDGFESNQTVIVIAATNRPDVLDPALQRPGRFDRQVVVPLPDIRGREQILN
FT                   VHSKKVPLDESVDLLSLARGTPGFSGADLANLVNEAALFAGRRNKVKVDQSDFEDAKDK
FT                   IYMGPERRSMVMHEDEKRATAYHESGHAIVAESLPFTDPVHKVTIMPRGRALGLTWQLP
FT                   ERDRISMYKDQMLSQLSILFGGRIAEDIFVGRISTGASNDFERATQMAREMVTRYGMSD
FT                   KMGVMVYAENEGEVFLGRSVTRSQNISEKTQQDIDAEIRRILDEQYQVAYKILDENRDK
FT                   METMCKALMEWETIDRDQVLEIMAGKQPSPPKDYSHNLRENADAAEDNAPHAPTREETE
FT                   APAPADTASTESEQQPENKA"
FT   CDS_pept        complement(735783..736403)
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="NMO_0687"
FT                   /product="ribosomal RNA large subunit methyltransferase j"
FT                   /function="23S rRNA methylase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0687"
FT                   /db_xref="EnsemblGenomes-Tr:CBA04997"
FT                   /db_xref="GOA:C6S664"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6S664"
FT                   /protein_id="CBA04997.1"
FT                   /translation="MAVRSKSSKAWLHEHVNDHYVHMAQKDGYRARAAYKLLEINDKDK
FT                   LIKPGTVLADLGSAPGSWSQVAAKLTGSSGAVFALDILPMEAIGGVSFIQGDFRENDVL
FT                   AQFETLLDNRPLDLVICDMAPNMSGNAVSDQARSFYLCELALDFASQHLKTGGSFLVKV
FT                   FQGAGYQEYMAAMREIFGTVQTRKPEASRNRSSEIYLLGKNKR"
FT   CDS_pept        736477..736797
FT                   /transl_table=11
FT                   /locus_tag="NMO_0688"
FT                   /product="putative RNA-binding protein"
FT                   /function="Predicted RNA-binding protein containing KH
FT                   domain possibly ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0688"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05000"
FT                   /db_xref="GOA:C6S665"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:C6S665"
FT                   /protein_id="CBA05000.1"
FT                   /translation="MPHYSFYSSSRKMTDTKLNTKEILELKARAHHLHPVVMVGQQGLT
FT                   DAVIKETDAALTAHELIKVRVFGDDRAERIEICTALCEAVDAQPVQHIGKLLVLWRKNI
FT                   EG"
FT   CDS_pept        complement(736819..736926)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0689"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05003"
FT                   /db_xref="UniProtKB/TrEMBL:C6S666"
FT                   /protein_id="CBA05003.1"
FT                   /translation="MQTASGGNQNPFSPERVSARRNAAPKDGVPPIKEQ"
FT   CDS_pept        736980..737981
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="NMO_0690"
FT                   /product="Delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0690"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05006"
FT                   /db_xref="GOA:C6S667"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:C6S667"
FT                   /protein_id="CBA05006.1"
FT                   /translation="MQFPYRNVPASRMRRMRRDDFSRRLMREHTLTADDLIYPVFVLEG
FT                   SAREEDVPSMPGVKCQSLDRLLFTAEEASNLGIPMLALFPVVTTNKTECAQEAYNPEGL
FT                   VPTAVRALRERFPELGIMTDVALDPYTVHGQDGLTDENGYVMNDETVEVLVKQALCHAE
FT                   AGAQVVAPSDMMDGRIGAIREALEDAGHIHARIMAYSAKYASAFYGPFRDAVGSSGNLG
FT                   KADKKTYQMDPANTDEALNEVALDIREGADMVMVKPGLPYLDVVRRVKDEFGVPTYAYQ
FT                   VSGEYAMLQAAIANGWLDGGKVVLESLLAFKRAGADGILTYYAIEAAKMLKR"
FT   CDS_pept        complement(738044..739348)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0691"
FT                   /product="cystathionine gamma-synthase"
FT                   /function="Cystathionine beta-lyases/cystathionine gamma-
FT                   synthases"
FT                   /EC_number="2.5.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0691"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05012"
FT                   /db_xref="GOA:C6S669"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6S669"
FT                   /protein_id="CBA05012.1"
FT                   /translation="MVWRFRRGIYRQSANARLYHSLLAAALIVSIFQIVIKSSIIHIYI
FT                   GRDQMKFATKAIHSSYDCDEHNRALMPPIYQNSMFTLHEIGENVPYRYSRLSNPTRQIL
FT                   EDTVADLEHGAAGFAFSSGMAGIDAVWRTFLQPGDTIVAVADIYGGAYDLLVDVYQKWG
FT                   VNVVFADLGNPDNLDELLKAHKVKLVWLETPSNPLLRLVDIKALAAKAKATGALVGIDN
FT                   TFATPYLQQPLDMGCDFVFHSATKYLCGHSDVLMGIVVAKTKELAQPLHDMMVHTGAIA
FT                   GPMDCWLVLRGIKTLALRMEAHCKNALEIARRLEDHPAIEKVFHPGLPSHEHYELAQAQ
FT                   MPKGIGGVVTVYLKNDTREAANSVIKNMKLVKMASSLGGVESLVNHCYSQSHSGVPHNV
FT                   KMEMGIKVGLLRFSIGIEDADDIWNDISAALDTTL"
FT   CDS_pept        739270..740166
FT                   /transl_table=11
FT                   /locus_tag="NMO_0692"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0692"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05009"
FT                   /db_xref="GOA:C6S668"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/TrEMBL:C6S668"
FT                   /protein_id="CBA05009.1"
FT                   /translation="MQLLKASDIISHLQIDGIFPGGNAIPCTHLNNYMNIKEKQLMNTI
FT                   ADVQSSRDLRNLPINQVGIKDLRFPITLQTAEGIQSTVARLTMTVYLPAEQKGTHMSRF
FT                   VALMEQHSEALDFAQLHRLTAEMVALLDSRAGKISVSFPFFRKKTAPVSGIRSLLDYDV
FT                   CLTGEMKDGAYGYSMKVMIPVTSLCPCSKEISQYGAHNQRSHVTVSLTADAEVGIEEVI
FT                   DYVEAQASCQLYGLLKRPDEKYVTEKAYENPKFVEDMVRDVATSLIADKRIKSFVVESE
FT                   NFESIHNHSAYAYIAYP"
FT   CDS_pept        740181..740351
FT                   /transl_table=11
FT                   /locus_tag="NMO_0693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0693"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05015"
FT                   /db_xref="UniProtKB/TrEMBL:C6S670"
FT                   /protein_id="CBA05015.1"
FT                   /translation="MPKCRLKGIGALFPSLPPLCFPSRREMGKVRMKLDGEDGLYGAAV
FT                   PYRFEINLQYK"
FT   CDS_pept        740366..741031
FT                   /transl_table=11
FT                   /locus_tag="NMO_0694"
FT                   /product="putative NAD(P)H-flavin oxidoreductase"
FT                   /function="Nitroreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0694"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05018"
FT                   /db_xref="GOA:C6S671"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:C6S671"
FT                   /protein_id="CBA05018.1"
FT                   /translation="MAVLSKEQVLSAFKNRKSCRHYDAARKISAEDFQFILELGRLSPS
FT                   SVGSEPWQFVVVQNPEIRQAIKPFSWGMADALDTASHLVVFLAKKNARFDSPFMLESLK
FT                   RRGVTEPDAMAKSLARYQAFQADDIKILDDSRALFDWCCRQTYIALGNMMTGAAMAGID
FT                   SCPVEGFNYAEMERVLSGQFGLFDAAEWGVSVAATFGYRVQEIATKARRPLEETVIWA"
FT   CDS_pept        complement(741086..741844)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0695"
FT                   /product="pseudouridylate synthase"
FT                   /function="16S rRNA uridine-516 pseudouridylate synthase
FT                   and related pseudouridylate synthases"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0695"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05021"
FT                   /db_xref="GOA:C6S672"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6S672"
FT                   /protein_id="CBA05021.1"
FT                   /translation="MNPKTPPDHTEDAVRLSKRMAQLGLCSRREADGYIEQGWVTVNGK
FT                   TAVLGQKVSPADRIELNKKAHEQQAARITILLNKPVGYVSAQAEKGYKSAAELITSENR
FT                   WESDTSRIRFDPKHKIGLAPAGRLDIDSVGLLVLTQDGRIAKQLIGENSGSEKEYLVRV
FT                   RGKLDEKGLALLNHGLSLDGEKLRPAQVEWQNEDQLRFVLKQGKKRQIRRMCELVGLRV
FT                   VGLKRIRMGKVKLGRLPLGKWRYLAPGESF"
FT   CDS_pept        complement(741869..742759)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0696"
FT                   /product="probable inorganic polyphosphate/ATP-NAD kinase"
FT                   /function="Predicted sugar kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0696"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05024"
FT                   /db_xref="GOA:C6S673"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C6S673"
FT                   /protein_id="CBA05024.1"
FT                   /translation="MNSPFHNIGIVTRPNTPDIQDTAHTLITFLKQHGFTVYLDEVGIK
FT                   EGCIYTQDTVGCHIVNKTELGQYCDLVAVLGGDGTFLSVAREIALRAVPIIGINQGHLG
FT                   FLTQIPREYMTDKLLPVLEGKYLAEERILIEAALIREGKTAERAIALNDAVLSRGGAGQ
FT                   MIEFEVFVNREFVYTQRSDGLIVSTPTGSTAYSLAAGGPIMQAGLHAFTLVPICPQSMT
FT                   NRPIAIPDTSEIEILVTQGGDARVHFDGQTHIDVQNLDRITIRRYRNPLRILHPTDYQY
FT                   FKTLRQKLHWGEQLV"
FT   CDS_pept        complement(742779..743345)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0697"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0697"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05027"
FT                   /db_xref="UniProtKB/TrEMBL:C6S674"
FT                   /protein_id="CBA05027.1"
FT                   /translation="MSAFLPIINRLILQSPDSRSELAAFAGKTLTLNIAGLKLAGRITE
FT                   DGLLSAGNGFADTEITFRNSAVQKILQGGEPGAGDIGLEGDLILGIAVLSLLGSLRSRA
FT                   SDELARIFGTQADIGSRAADIGHGIKQIGRNIAEQIGGFSRESESANIGNEALADCLDE
FT                   ISRLRDGVERLNERLDRLERDIWID"
FT   CDS_pept        complement(743396..744193)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0698"
FT                   /product="conserved hypothetical protein"
FT                   /function="Nucleoside-diphosphate-sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0698"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05030"
FT                   /db_xref="GOA:C6S675"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S675"
FT                   /protein_id="CBA05030.1"
FT                   /translation="MRAVPPPHISITGLGYLGLPLAQKFYQHGSRVAAIKRSLTSDDIN
FT                   LPIHLDTIDLNQDSAFQSANLARDTSFWRHHANKPVWFCLLPPSSLTHYADTVKQWAEL
FT                   ARACNVQHLIFTSSTSVYGDTARECDEIALPDPQTESARQILAAEQHLLDSGVPNIDIL
FT                   RLGGLYCAERHPVSRLVQKQNIPGGNRPINIVHRNIAVESLFQTAFNPSGRRLKNIIEP
FT                   RHPTRREFFTEEAAKLGLPAPDFAPDDSVGKIIRTVCDNGLSL"
FT   CDS_pept        complement(744248..744898)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0699"
FT                   /product="TetR-family transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0699"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05033"
FT                   /db_xref="GOA:C6S676"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:C6S676"
FT                   /protein_id="CBA05033.1"
FT                   /translation="MPVTRPAKINTYTRIIDASLALFNEEGERNISTNHIAAHLGISPG
FT                   NLYYHFRNKDEIIVQLFKRYSEALLAYLNEAVLPSDVEDSINYMAGIYDVMWEYRFLFS
FT                   DVNTLLARSAELLGEHNTFTQAKVSPLLVNLLTQLNGLNIIQADQTAMNDLAVNMWMVT
FT                   KYWFDFDSSLRGRTKLTEDSKARGIRRTLSLLRPYLLPEHRKKYDRKIGNGNP"
FT   CDS_pept        complement(744910..745950)
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="NMO_0700"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /function="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.1.1.158"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0700"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05036"
FT                   /db_xref="GOA:C6S677"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:C6S677"
FT                   /protein_id="CBA05036.1"
FT                   /translation="MQPIRYRTDLTPYNTFGLRAQARAFIALEHADGLRDIVRLPEFNR
FT                   DTVLWLGGGSNILLMEDYAGLVVHMENKGIREIARSDGMVLIEAQAGEIWHDFVLHAVA
FT                   LGLNGLENLSLIPGTVGASPVQNIGAYGVEAKDVIHSVRCFDLDTEAFVELANADCRFA
FT                   YRESLFKQEGKGRYVIVSVVFALKEHFVPNLGYGDLAAAVAERCAGREITAKEVSDAVC
FT                   AVRRRKLPDPGILGNVGSFFKNPVVGAGKAAALLQQHPDMPHYPQPDGSVKLAAGWLID
FT                   QCRLKGFQIGGAAVHDKQALVLVNKNNASANDVRQLAQHIKFTVFAQFQVELHAEPNWL
FT                   PASFSL"
FT   CDS_pept        complement(746129..747508)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0701"
FT                   /product="putative multidrug efflux protein"
FT                   /function="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0701"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05039"
FT                   /db_xref="GOA:C6S678"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C6S678"
FT                   /protein_id="CBA05039.1"
FT                   /translation="MLLDLNRFSFSVFLKEVRLLTALALPMLLAQVAQVGIGFVDTVMA
FT                   GGAGKEDLAAVALGSSAFATVYITFMGIMAALNPMIAQLYGAGKTDEVGETGRQGIWFG
FT                   LFLGVFGMVLMWAAITPFRNWLTLSDYVEGTMAQYMLFTSLAMPAAMVHRALHAYASSL
FT                   NRPRLIMLVSFAAFVLNVPLNYIFVYGKFGMPALGGAGCGLATMAVFWFSALALWIYIA
FT                   KENFFRPFGLTAKFGKPDWAVFKQIWKIGAPIGLSYFLEASAFSFIVFLIAPFGEDYVA
FT                   AQQVGISLSGILYMIPQSVGSAGTVRISFSLGRREFSRARYISGVSLVLGWMLAVITVL
FT                   SLVLFRSPLVSMYNNDPAVLSIAATVLLFAGLFQPADFTQCIASYALRGYKVTKVPMFI
FT                   HAAAFWGCGLLPGYLLAYRFDMGIYGFWTALIASLTIAAIALVWCLELCSREMVRSHKV
FT                   V"
FT   CDS_pept        747843..748994
FT                   /transl_table=11
FT                   /gene="hisZ"
FT                   /locus_tag="NMO_0702"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /function="ATP phosphoribosyltransferase involved in
FT                   histidine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0702"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05042"
FT                   /db_xref="GOA:C6S679"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C6S679"
FT                   /protein_id="CBA05042.1"
FT                   /translation="MQTWQLPEHIADVLPTNARQLESAREQLLALFRVHGYELVQPPLM
FT                   EYAHSLLTHIDAGLSLKTILVTDRLSGRQLGIRADITPQVARIDAHLLSANQGINRLCY
FT                   AGPVLHAQPDGLLNMREPLQAGAEMYGFADIRGDIELIDLMLKSMKIADMGKVLLSLGH
FT                   IGIFRALSDAAHLDAGQSATLLALMQDKDTGAVEAQVKAWKLDGMWAKAFSLLPRLYGG
FT                   REVLSDARGRLPDLSAVGGALGELQAVCDAFPDCEIHIDLSELRVDNYHTGLLYAAYAA
FT                   DFHDAVARGGRYDGLGGYFGRARPATGFSFDLRSFIGRLPTIERQPAVLVDAEDAEAAR
FT                   EAVEALREQGQCVVIDYGIGHNVSEELAGRLKKTDGVWQVVKR"
FT   CDS_pept        749098..750396
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="NMO_0703"
FT                   /product="adenylosuccinate synthetase"
FT                   /function="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0703"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05045"
FT                   /db_xref="GOA:C6S680"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C6S680"
FT                   /protein_id="CBA05045.1"
FT                   /translation="MAKNVVVIGAQWGDEGKGKIVDWLAEEAGGVVRFQGGHNAGHTLV
FT                   VGGKKTILRLIPSGILHESLDCFIGSGVVVSPEALLGEIDELNAAGVKNVEGRLKIAPT
FT                   CPLILPYHIALDQAREASRGKGKIGTTGRGIGPAYEDKVARRAIRAADLLHPEKLREKL
FT                   DAVLAYYNVQLQHLHNAEPVKAEDVMAVIEKVAPRIAPMITDVSRVLNEKNKNGEKLLF
FT                   EGAQGALLDIDYGTYPFVTSSNCLAGAASAGAGVGPQMLDYVLGIVKAYTTRVGSGPFP
FT                   TELFDEVGAGLAERGHEFGSVTGRARRCGWFDAAALKRSIQINGISGMCITKLDVMDGV
FT                   ETINICVGYELPDGGKTNILPCGSDAVEACKPIYETMPGWRESTFGVKDYGALPENAKA
FT                   YLKRIEEVCGAPVAIVSTGPDREETIVLHHPFA"
FT   CDS_pept        750851..751561
FT                   /transl_table=11
FT                   /locus_tag="NMO_0704"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0704"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05048"
FT                   /db_xref="InterPro:IPR007929"
FT                   /db_xref="UniProtKB/TrEMBL:C6S681"
FT                   /protein_id="CBA05048.1"
FT                   /translation="MPKISSIVSANLRYQKIFPDKELIVYTRSAAPTTIRCPIHGEVPS
FT                   GTLDSLLRTKHGCPECNKLTRSEYLRGNPANAKVVRVFDSLSGKTLEFVSASAAARGLE
FT                   TNLGNIRSRLSGRVSVDNLIQDRYKVLLDSTDCVTQTPQKVLPEGFKLVEGFENYALNR
FT                   LGQVYNVKYGRLLTPSFSNSANAVIISLYSNGEAVSIFLAKLMLQTFRPDEPLPKRITY
FT                   KDGDRRNCSLDNLA"
FT   CDS_pept        751651..752070
FT                   /transl_table=11
FT                   /locus_tag="NMO_0705"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0705"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05051"
FT                   /db_xref="InterPro:IPR007929"
FT                   /db_xref="UniProtKB/TrEMBL:C6S682"
FT                   /protein_id="CBA05051.1"
FT                   /translation="MAYTVYSFEKKFLEKFGVYGLSVLNFRGSMYPLDIHCPKHGNQTV
FT                   SNATSCLRSKLGCPACGREHQQSKASERLKQSNKSAKPLLILDTTTNETLTFPSVTAAG
FT                   AALGVHFQQINHRLKGRTSPDNLISNRYKVLGYDR"
FT   CDS_pept        752278..752670
FT                   /transl_table=11
FT                   /locus_tag="NMO_0706"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0706"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05054"
FT                   /db_xref="InterPro:IPR007929"
FT                   /db_xref="InterPro:IPR010896"
FT                   /db_xref="UniProtKB/TrEMBL:C6S683"
FT                   /protein_id="CBA05054.1"
FT                   /translation="MGKRMTFDTAKSRFQEKFPHLELLEFSGIYKPSSVRCPTHEVVQL
FT                   LYYDTAIKSKYGCPECARLKMKKNTPPQNQKTVSILDTTTGETLTFPSVQAAAKALNTS
FT                   YGSIRTKLDGRSSPDNLVCNRYKVLL"
FT   CDS_pept        752678..753343
FT                   /transl_table=11
FT                   /locus_tag="NMO_0707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0707"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05057"
FT                   /db_xref="UniProtKB/TrEMBL:C6S684"
FT                   /protein_id="CBA05057.1"
FT                   /translation="MENIEEYALLSPEALLERLDTVLSIRIGGKGWESSMTANFAQTLV
FT                   EIQDSLYRVVSTVQYGDDNLKRLTADKRKQYELNFKISEGSTRVESDFKETLVRFGRDM
FT                   LQDMPPKIRSATLVALTTLLVGGALGYGYLEYLKQVASEGYQTERLYNAVDRLAESQER
FT                   ITSAILKGARGADFVQIGRRSYSREDISEANRRAERVPYGAELVSDGNFTAVLSDIVD"
FT   CDS_pept        complement(753644..754483)
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="NMO_0708"
FT                   /product="heat shock protein HtpX"
FT                   /function="Zn-dependent protease with chaperone function"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0708"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05060"
FT                   /db_xref="GOA:C6S685"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:C6S685"
FT                   /protein_id="CBA05060.1"
FT                   /translation="MKRIFLFLATNIAVLVVINIVLAVLGINSRGGTGSLLAYSAVVGF
FT                   TGSIISLLMSKFIAKQSVGAEVIDTPRTEEEAWLLNTVEAQARQWNLKTPEVAIYHSPE
FT                   PNAFATGASRNSSLIAVSTGLLDHMTRDEVEAVLAHEMAHVGNGDMVTLTLIQGVVNTF
FT                   VVFLSRIIANLIARNNDGSQSQGTYFLVSMVFQILFGFLASLIVMWFSRQREYRADAGA
FT                   AKLVGAPKMISALQRLKGNPVDLPEEMNAMGIAGDTRDSLLSTHPSLDNRIARLKSL"
FT   CDS_pept        754698..755345
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="NMO_0709"
FT                   /product="adenylate kinase"
FT                   /function="Adenylate kinase and related kinases"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0709"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05063"
FT                   /db_xref="GOA:C6S686"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:C6S686"
FT                   /protein_id="CBA05063.1"
FT                   /translation="MKALLLGAPGAGKGTQAQFITAAFGIPQISTGDMLRAAIKAGTPL
FT                   GLEAKKIIDEGGLVRDDIIIGMVKERIAQDDCKNGFLFDGFPRTLAQAEAMVEAGVDLD
FT                   AVVEIDVPDSVIVDRMSGRRVHLASGRTYHVTYNPPKVEGKDDVTGEDLIQRDDDKEET
FT                   VKKRLAVYHEQTEVLVDFYSKLEGEHAPKYIKVDGTQPVEAVKAEVLGALGK"
FT   CDS_pept        755872..756612
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="NMO_0710"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /function="Orotidine-5-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0710"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05066"
FT                   /db_xref="GOA:C6S687"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:C6S687"
FT                   /protein_id="CBA05066.1"
FT                   /translation="MNLLISDFQTPQQRTPVIVALDFANEKDTLGFVRNLDPTLCQIKI
FT                   GKELFTATGRNLAESLINQGFKLFLDLKYHDIPHTVAQACKVAADMGVWMVDMHASGGR
FT                   RMMEAAAEAVAGYGTKPLLIGVTVLTSMEQSDLAEIGLNIAPEEQVIRLAKLAQSSGLD
FT                   GVVCSAQEAAPLRRELGQDFVLVTPGIRLDVAGNNDDQRRIMTPAEALAAGSTYLVMGR
FT                   PVTQAANPLAVLREVNRVANLEAN"
FT   CDS_pept        756668..757630
FT                   /transl_table=11
FT                   /gene="rfaE"
FT                   /locus_tag="NMO_0711"
FT                   /product="ADP-heptose synthase"
FT                   /function="ADP-heptose synthase bifunctional sugar
FT                   kinase/adenylyltransferase"
FT                   /EC_number="2.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0711"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05069"
FT                   /db_xref="GOA:C6S688"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6S688"
FT                   /protein_id="CBA05069.1"
FT                   /translation="MPAKFQQETLKSRFAQAKVLVVGDVMLDRYWFGDVSRISPEAPVP
FT                   VAKIGRIDQRAGGAANVARNIASLGGRAGLLSVTGDDEAADALDALMVQDGVASYLMRD
FT                   KQIATTVKLRVVARNQQLIRLDFEEHPNREVLEQIKRKYREILPEYDAIIFSDYGKGGL
FT                   SHISDMIDWAKHEGKTVLIDPKGDDYEKYAGATLITPNRAELKEVVGSWKNEGELTEKA
FT                   QNLHRHLDLTAILLTRSEEGMTLFSEGEPIYQPTRAQEVYDVSGAGDTVIAGMGLGLAA
FT                   GCTMPEAMHLANTAAGVVVAKLGTAVCSFAELVEALDGQ"
FT   CDS_pept        757694..758698
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /locus_tag="NMO_0712"
FT                   /product="ADP-L-glycero-D-mannoheptose-6-epimerase"
FT                   /function="Nucleoside-diphosphate-sugar epimerases"
FT                   /EC_number="5.1.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0712"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05072"
FT                   /db_xref="GOA:C6S689"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6S689"
FT                   /protein_id="CBA05072.1"
FT                   /translation="MTIIVTGAAGFIGSNIVKALNQRGITDIVAVDNLSKGEKFKNLAE
FT                   CEIAHYLDKHEFIRQVREHILPYQNIEAVFHQGACSDTMNHDGLYMMENNYQYTLDLLD
FT                   WCQDERIPFLYASSAAVYGKGEIFREERELEKPLNVYGYSKFLFDQVLRRRMKEGLTAQ
FT                   VVGFRYFNVYGQHEQHKGRMASVTFHHFHQYREHGYVNLFGSNDGYGNGEQTRDFVSVE
FT                   DVAKVNLYFFDHPELSGIYNLGTGRSQQFNELAAATVNACRAAEGKPEMSLKELVKEEL
FT                   IRYIPFPNALKGKYQSFTQADITKLREAGYKEEFFDVKSGVDRYVKWMLENLA"
FT   CDS_pept        758771..760315
FT                   /transl_table=11
FT                   /locus_tag="NMO_0713"
FT                   /product="putative type I restriction-modification system
FT                   DNA methylase"
FT                   /function="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0713"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05075"
FT                   /db_xref="GOA:C6S690"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:C6S690"
FT                   /protein_id="CBA05075.1"
FT                   /translation="MMTEIQQRAQLHRQIWKIADEVRGAVDGWDFKQYVLGTLFYRFIS
FT                   ENFTDYMQAGDSSIDYAAMPDSIITPEIKDDAVKVKGYFIYPSQLFCNIAAEAHQNEEL
FT                   NTKLKEIFTAIESSASGYPSEQDIKGLFDDFDTTSSRLGSTVADKNKRLAAVLKGVAEL
FT                   DFGNFEDHRIDLFGDAYEYLISNYAANAGKSGGEFFTPQSVSKLIARLAVHGQEKVNKI
FT                   YDPACGSGSLLLQAKKQFDEHIIEEGFFGQEINHTTYNLARMNMFLHNVNYNKFHIELG
FT                   DTLTNPKLKDGRPFDAIVSNPPYSINWIGSDDPTLINDDRFAPAGVLAPKSKADFAFIL
FT                   HALNYLSSRGRAAIVSFPGIFYRGGAEQKIRQYLVEGNYVETVIALAPNLFYGTGIAVN
FT                   ILVLSKHKDNTDIQFIDASSFFKKETNNNVLTEEHIAEIVKLFADKADVPHIAQNAAQQ
FT                   TVKDNGYNLAVSSYVEAKDTCEAVDIKQLNAEISETVAKIERLRREIDEVIAEIEA"
FT   CDS_pept        760432..761276
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="dinD"
FT                   /locus_tag="NMO_0714"
FT   CDS_pept        761440..762710
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMO_0715"
FT   CDS_pept        762697..762858
FT                   /transl_table=11
FT                   /locus_tag="NMO_0716"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0716"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05080"
FT                   /db_xref="UniProtKB/TrEMBL:C6S691"
FT                   /protein_id="CBA05080.1"
FT                   /translation="MPFGRVGFSPPKQRQTETTAKQQQAGRWAEARPTADTTAPHSAEA
FT                   CGNRKIWR"
FT   CDS_pept        763159..763365
FT                   /transl_table=11
FT                   /locus_tag="NMO_0717"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0717"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05083"
FT                   /db_xref="UniProtKB/TrEMBL:C6S692"
FT                   /protein_id="CBA05083.1"
FT                   /translation="MGFSPPKQRQAATTVKQRQAGRWAEAHPTADTTAPYSAEANQSSL
FT                   HIFRQPNPNIKPFNTRHRKGRPI"
FT   CDS_pept        763362..766460
FT                   /transl_table=11
FT                   /locus_tag="NMO_0718"
FT                   /product="putative type I restriction-modification system
FT                   endonuclease"
FT                   /function="Type I site-specific restriction-modification
FT                   system R (restriction) subunit and related helicases"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0718"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05086"
FT                   /db_xref="GOA:C6S693"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:C6S693"
FT                   /protein_id="CBA05086.1"
FT                   /translation="MNLETKPIAETPNFIVLDQYEKIEQSGSYQSENRLEAELIADLQN
FT                   QGYEYRKDLNSQSRLLENLRAQLQRLNDVAFSDGEWARFLTEYLDRPSENITDKTRKIH
FT                   DDHIYDFAFDDGRLKNIYLLDKKNLARNHVQLINQFEQTGTHANRYDVTVLVNGLPLVQ
FT                   IELKKRGVAVREAFNQVHRYSKESFNSDNSLFKFLQIFVISNGTDTRYFANTTKRDKNS
FT                   FDFTMNWARSDNHPIKDLKDFTATFLQKSVLLGVLLHYSVFDANNTLLIMRPYQIAAAE
FT                   RILWKINSSAQAKNWSKPESGGYVWHTTGSGKTLTSFKAARLATESAFIDKVFFVVDRK
FT                   DLDYQTMKEYQRFSPDSVNGSESTAGLKRNLEKDDNKIIVTTIQKLNNLMKGEDNLPVY
FT                   HQQVVFIFDECHRSQFGEAQKNLKKKFKKFCQFGFTGTPIFPENALGAETTAGVFGREL
FT                   HSYVITDAIRDEKVLKFKVDYNDVRPKFKAVEAEQDEKKLSAAENRQALLHPERIREIT
FT                   QYILNQFRQKTHRLNAGGKGFNAMFAVSSVDAAKCYYEAFKTQQAGSLHPLKVATIFSF
FT                   AANEEQNAVGEIVDETFEPEAMDSSAKEFLQAAINDYNACFKTNFGTDSKAFQNYYRDL
FT                   AKRVKNQEVDLLIVVGMFLTGFDAPTLNTLFVDKNLRYHGLMQAFSRTNRIYDATKTFG
FT                   NIVCFRDLEQATIDAITLFGDKNTKNVVLEKSYEEYMNGYTDDRTGEARRGYLDVAKEL
FT                   RERFPEPDKIETEKDKKDFAKLFGEYLRAENVLQNYDEFAALRELQNVDAADEDAMKAF
FT                   QEKYYLSDEDVKEMRQVPMPSERAVQDYRSAYNDIRDWLRRQKAGEQKEQSKIDWDDVV
FT                   FEVDLLKSQEINLDYILQLVFEHHKKIKGKAELVEEIRRIIRASIGHRAKEGLIVDFIN
FT                   DTDLDKVPDVPAILETFYTYAQEVMRHEAAGLIAAEDLNETAAKRYLTGSLKRGYASEN
FT                   GTELTETLPKMSPLNPQYLTKKQSVFQKIAAFVEKFAGIGTDI"
FT   CDS_pept        complement(766500..768791)
FT                   /transl_table=11
FT                   /gene="clpA"
FT                   /locus_tag="NMO_0719"
FT                   /product="ATP-dependent clp protease"
FT                   /function="ATPases with chaperone activity ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0719"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05089"
FT                   /db_xref="GOA:C6S694"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C6S694"
FT                   /protein_id="CBA05089.1"
FT                   /translation="MLAPELEQILQQLYREARKAHYEFISLEHLLLVLIEEDASVPNVL
FT                   KLCGADLKVVSEQLAASVAENTPLIPEHLLDTVETRPTLGFQRVMQRAMVHTQSAGKAA
FT                   VEPLDVLVALMSETDSHTVYFLKLQSVTRFEVLRCIAHGSPDEDEDDGNYSSDGMDDDN
FT                   ENRTKPGKNPLSAYTVNLNAEVKAGRIDPLIGRKHEMERLVQILCRRRKNNPLLVGEAG
FT                   VGKTALAEGLAHQIVNGGIPDALKDAEVYALDMGSLLAGTKYRGDFEARVKSVLKQLEK
FT                   IPHAILFIDEIHTIIGAGSTSGGTMDASNLLKPALAKGSLRCIGATTYDEYRTIFDKDH
FT                   ALSRRFQKIDVVEPTVSETVQILRGLKPMFEAFHQVRYTQGALEAAAELSSRYINERFL
FT                   PDKAIDVMDEAGAAQRILPKSKQKKVIGKAQIETVIAKVARIPEKTVSHDDKQVLQFLG
FT                   RDLKNMVYGQENAIDALVAAVKMSRSGLGLPDKPIGSFLFSGPTGVGKTEAAKQLAYSM
FT                   GVPLQRFDMSEYMERHAVSRLIGAPPGYVGFEQGGLLTEAVNKQPHCVLLLDEIEKAHP
FT                   DIFNVLLQVMDAGKLTDNNGKSADFRNVILIMTTNAGAESLSRPSLGFTAKRERGDEMQ
FT                   AINKLFTPEFRNRLDAIIPFAPLSEPIIVKVVDKFLLQLEHQLLDKKVEAEFTPALHKY
FT                   LAEKGFDPQMGARPMHRLIQEKIRKPLADELLFGKLTDGGFVRIDWDAAKEEAVLKFKK
FT                   SKVKIKTASA"
FT   CDS_pept        complement(768793..769095)
FT                   /transl_table=11
FT                   /gene="clpS"
FT                   /locus_tag="NMO_0720"
FT                   /product="putative ATP-dependent Clp protease adaptor
FT                   protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0720"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05092"
FT                   /db_xref="GOA:C6S695"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:C6S695"
FT                   /protein_id="CBA05092.1"
FT                   /translation="MTAQHQSDTLLRRLNTLPPKRYGVFLLNDDYTTMEFVVEILTEIF
FT                   MLGQEQAVAVMLLVHHEGKGLCGTYTRDIAQTKQQQVMQRAKAEGHPLQCIVEEI"
FT   CDS_pept        769338..769541
FT                   /transl_table=11
FT                   /gene="csp"
FT                   /locus_tag="NMO_0721"
FT                   /product="putative cold-shock protein"
FT                   /function="Cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0721"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05095"
FT                   /db_xref="GOA:C6S696"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C6S696"
FT                   /protein_id="CBA05095.1"
FT                   /translation="MATGIVKWFNDAKGFGFITPDEGGEDLFAHFSAINMEGFKTLKEG
FT                   QRVSFDVTTGPKGKQAANIQAA"
FT   CDS_pept        complement(769838..771169)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0722"
FT                   /product="PmbA protein"
FT                   /function="Predicted Zn-dependent proteases and their
FT                   inactivated homologs"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0722"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05098"
FT                   /db_xref="GOA:C6S697"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C6S697"
FT                   /protein_id="CBA05098.1"
FT                   /translation="MLFNHTASELLDLCRRTLDLAKATGATAAEADFSESLGQSVSVRL
FT                   GEIEQIEFQQDKSLDITVYVGKRKGRASTADFSEKALQDTVKAAIDIARYTAEDDCAGL
FT                   ADASLMAQHIGDPDLYHEWDLDTEAAVGLAKQCEQAALNEDERIENSEGAAVQTGHYQY
FT                   VYGNTHGFAAHRQGTHHSISCSVVAADENGMQRDYWYDSACRHPDMDSPETIGQTAARR
FT                   TLRRLGSRSIPTGSYPVLFDTTVSGGLIGHLVGALSGGALYRQSSFLIDSIGKKVLPDF
FT                   LNLREEPHIPRSFRSSYFDAEGVATAPRFVIQNGIVKGYFLSSYSARKLGMQTTGNAGG
FT                   AHNLYLNHTHETQSDLLKEMGTGLLVTKLMGQGANTITGDYSRGAAGFWVENGIIAYPV
FT                   HEITVAGRLQDMYRDIVGVADDALRRSSNKIGSILIAGMTVAGS"
FT   CDS_pept        771260..771829
FT                   /transl_table=11
FT                   /locus_tag="NMO_0723"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0723"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05101"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:C6S698"
FT                   /protein_id="CBA05101.1"
FT                   /translation="MPSERGGILLKCAIGKNSRIKMFEQEDEWISKTQMKKQMNGLQDL
FT                   GMELTKLSNDTLKKIGLDEDLYEAVVTYKKITSNGALKRQAQFIGRLMRDTDPAPIEAF
FT                   LAKLRGDDAAHNAFLQRVEQARVRLLADDGALTQFMSDFPHADAGKLRTLVRNTKKEQE
FT                   QNKPPKNFRALFQELKTVMENGDAEI"
FT   CDS_pept        771876..772517
FT                   /transl_table=11
FT                   /locus_tag="NMO_0724"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0724"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05104"
FT                   /db_xref="UniProtKB/TrEMBL:C6S699"
FT                   /protein_id="CBA05104.1"
FT                   /translation="MLFRKTTAAVLAATLMLNGCTAMMWGMNDPFSQTTAYKHVDKDQI
FT                   RAFGVVAKDNAQLEKGSLVMMGGKYWFVVNPEDSAKLTGILKAGLDKPFQIVEDTPSYA
FT                   RHQALPVKLESPGSQNFSTEGLCLRYDTDRPADIAKLKQLEFEAVELDNRTIYTRCVSA
FT                   KGKYYATPQKLNADYHFEQSVPADIYYTVTEKHTDKSKLFANILYTPPPF"
FT   CDS_pept        772663..774363
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="NMO_0725"
FT                   /product="single-stranded-DNA-specific exonuclease"
FT                   /function="Single-stranded DNA-specific exonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0725"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05107"
FT                   /db_xref="GOA:C6S6A0"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:C6S6A0"
FT                   /protein_id="CBA05107.1"
FT                   /translation="MSVKIQTRSINTDVFNHLLTAGADPLIARLCASRGVQSPAELDDK
FT                   LAALLPYQTLTNCEAAAGRLADAVGRKEKILIVADYDADGATACAVGLDGLAAMGAKVD
FT                   FLVPNRFEHGYGLTPELAEIAAAQGVDLLITVDNGIASIAGVARAQALGLDVIVTDHHL
FT                   PADTVPDCIIVNPNQKGCGFQSKSLAGVGVIFYVLTALRAELRRRNYFSDGLKEPNLGD
FT                   LLDLVALGTVADVVPLDHNNRILVSQGLKRMRSGKMRPGIRALFEVARRDWRKAQPFDM
FT                   GFALGPRINAAGRLDDMSVGIACLLARDDSEAQELAAQLNNLNIERREIEQSMLQDALN
FT                   AFPETLPSGQTTLVAYRDDFHQGVVGIVASRLKDRFYRPTIVFAPADNGEVRGSGRSIP
FT                   NLHLRDALDLVSKRHPDLILKFGGHAMAAGLSILEHNIPAFQTVFEEAVREMVCEDDLS
FT                   QTFITDGSLKACDITLEQAQNLARHVWGQGFAPPSFTDEFHVVRQQPLGAEGKHKKAWL
FT                   QKDGCEFEAMFWRCSEDIPEYIRTVYRPVANEWRNNLELQLYIDYWEAV"
FT   CDS_pept        774724..776085
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="NMO_0726"
FT                   /product="poly(A) polymerase"
FT                   /function="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0726"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05110"
FT                   /db_xref="GOA:C6S6A1"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:C6S6A1"
FT                   /protein_id="CBA05110.1"
FT                   /translation="MLKKWLNKMLPSGRSSKKAESKTVIPAERHNIRAEMLSFAAENVI
FT                   RRLKGAGFQAYVVGGAVRDLLLGIEPKDFDVATDATPEQVHKLFRRSRIIGRRFQIVHV
FT                   MNGAEIIEVTTFRGGAKVHQNAHGRIMKDNTYGSIEEDAMRRDFTCNALYYDPEKEEIL
FT                   DFHNGIADVAARRLVMIGDAAERYQEDPVRILRAIRLSGKLGFDLSEETAAPIAESICR
FT                   LKHEPVARLFDEIMKLLFSGHARECLKRLNGFDIPDDIHPLLNALRVSDGIAGKMTVLA
FT                   LKNTDERLRADKSVSVGFVLAALMWPELERHWKSNLQQGLKPVPALSDAINTMRETVER
FT                   GWGVPQRFSATMREIWMFQPQFENRKGARPHKLFAQARFRAAYDFLLLRAETGNADRAL
FT                   AEWWTAFQTASQEQRTEMTKNEAAARHEKNEGQAKKRRRRRRKPKPKVEGTDWE"
FT   CDS_pept        776233..776556
FT                   /transl_table=11
FT                   /locus_tag="NMO_0727"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0727"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05113"
FT                   /db_xref="UniProtKB/TrEMBL:C6S6A2"
FT                   /protein_id="CBA05113.1"
FT                   /translation="MKKCILGILTACAAMPAFADRIGDLEARLAQLEHRVAVLESGSNT
FT                   VKIDLFGSNSTMYVCSVTPFQKTFEASDRNEGVARQKVRQACNRETSAMFCEDEAIRCR
FT                   KFD"
FT   CDS_pept        complement(776660..777613)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0728"
FT                   /product="putative PhoH-like ATP-binding protein"
FT                   /function="Phosphate starvation-inducible protein PhoH
FT                   predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0728"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05116"
FT                   /db_xref="GOA:C6S6A3"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6S6A3"
FT                   /protein_id="CBA05116.1"
FT                   /translation="MTHTVHLHLEETDNLALQRLCGSFDNNLDLLAKALDIHISRRFEH
FT                   FTFNGAFAHAGKRALLKLLETAQTRDLNDGDIRLAAVEAQTEDAGHQEKNHDHAYYFRT
FT                   KRGSIGGRTPRQNGYIRALLNHDIVFGLGPAGTGKTYLAVAAAVDAMEKHQVERIILVR
FT                   PAVEAGEKLGFLPGDLTQKVDPYLRPLYDALYDLMGFDRVTKLIEKGLIEIAPLAYMRG
FT                   RTLNGAYIILDEAQNTTPEQMKMFLTRIGFGAKAVITGDTSQIDLPKNIKSGLKDAREK
FT                   LHNVEGLYFHTFTGEDVVRHPLVQKIVEAYESAEHD"
FT   CDS_pept        complement(777752..778360)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0729"
FT                   /product="putative glycosyltransferase"
FT                   /function="Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0729"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05119"
FT                   /db_xref="GOA:C6S6A4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C6S6A4"
FT                   /protein_id="CBA05119.1"
FT                   /translation="MFCTVSHLRRLKGHDVLLTAFARALAQCPQLRLNIGGSGQEEQRL
FT                   KQQAADLGITHAVTFLGALQPEAVLDLMRNSDAFVLASRTETFGVVYIEALSQGLPVIA
FT                   TRCGGAESIVSDGNGYLVPVDDDDALADALIKMYEHHSDFEPARLRENCLNEFGENAVI
FT                   GRLIGIFRQAIAEYGKKIPVKYSGLTKIRTRRRSRRQYK"
FT   CDS_pept        complement(778392..778952)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0730"
FT                   /product="putative glycosyltransferase"
FT                   /function="Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0730"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05122"
FT                   /db_xref="GOA:C6S6A5"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C6S6A5"
FT                   /protein_id="CBA05122.1"
FT                   /translation="MWTGFFSKSGTGIAEERHQNRRACTDVPLLAERNSKHPDRPYGFA
FT                   KYRQSGLDIYAWHGMYFFPRFPFIDIDRIRWVCAGLKAFKHYIRENGLPDLIHAHCMNY
FT                   AGILAQKISEKYGIPYVLTEHSSTITRGLIRPHQWQPMEKAAAHASALLAVSRHFAHVL
FT                   QHKYGCEWQYLPQHTGRNIQPTV"
FT   CDS_pept        779144..779848
FT                   /transl_table=11
FT                   /locus_tag="NMO_0731"
FT                   /product="putative periplasmic protein"
FT                   /function="Predicted periplasmic/secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0731"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05125"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:C6S6A6"
FT                   /protein_id="CBA05125.1"
FT                   /translation="MLRSILAASLLAVSFPTAAEALNYNIVEFSESAGVEAVQDTMSAR
FT                   FQVTAEGRDKNAVNAEFVKKFNNFTRKSKNGSFKTELVSRSAMPRYQYTNGRRIQTGWE
FT                   ERAEFKVEGRDFDALNRFIADVQADAALEYTDFHVSRERRNEVIDQVSKDAVLRFKARA
FT                   EKLAGVLGASGYKIVKLNLGHIGSHIAGGGAAQAKMLRAMPMAASYGVEGTDSVAPGVE
FT                   EISISVNGTVQF"
FT   CDS_pept        complement(779912..780478)
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="NMO_0732"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /function="Deoxycytidine deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0732"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05128"
FT                   /db_xref="GOA:C6S6A7"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C6S6A7"
FT                   /protein_id="CBA05128.1"
FT                   /translation="MSIKSDKWIRRMSEEFGMIDPFEPNQIKEADGKRIISYGTSSYGY
FT                   DIRCANEFKIFTNINSTIVDPKNFDPKNFVTVEDDCCIIPPNSFALARTVEYFRIPRNV
FT                   LTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSNTTPLPAKIYAGEGVAQVLFFESD
FT                   EICETSYKDRNGKYMGQTGVTLPKA"
FT   CDS_pept        complement(780544..780816)
FT                   /transl_table=11
FT                   /locus_tag="NMO_0733"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0733"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05131"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:C6S6A8"
FT                   /protein_id="CBA05131.1"
FT                   /translation="MRCQDGRNYTGSFKNGKFDGQGVYTVAANREIFIEPFNSDSTKFR
FT                   NMVLSGTFKKGLAHGRFTVSQNGETLFIMKCENGMIKEVKLPKNK"
FT   CDS_pept        complement(781012..781911)
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="NMO_0734"
FT                   /product="recombination associated protein RdgC"
FT                   /function="DNA recombination-dependent growth factor C"
FT                   /db_xref="EnsemblGenomes-Gn:NMO_0734"
FT                   /db_xref="EnsemblGenomes-Tr:CBA05134"
FT                   /db_xref="GOA:C6S6A9"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:C6S6A9"
FT                   /protein_id="CBA05134.1"
FT                   /translation="MWFKQISFYPLNKEKL