(data stored in ACNUC1104 zone)

EMBL: AM902716

ID   AM902716; SV 1; circular; genomic DNA; STD; PRO; 5287950 BP.
XX
AC   AM902716;
XX
PR   Project:PRJNA28135;
XX
DT   18-DEC-2007 (Rel. 94, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Bordetella petrii strain DSM 12804, complete genome
XX
KW   complete genome.
XX
OS   Bordetella petrii
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Alcaligenaceae; Bordetella.
XX
RN   [1]
RP   1-5287950
RA   Linke B.;
RT   ;
RL   Submitted (26-OCT-2007) to the INSDC.
RL   Linke B., Center For Biotechnology, Bielefeld University,
RL   Universitaetsstrasse 25, 33501 Bielefeld, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/1471-2164-9-449.
RX   PUBMED; 18826580.
RA   Gross R., Guzman C.A., Sebaihia M., Martins Dos Santos V.A., Pieper D.H.,
RA   Koebnik R., Lechner M., Bartels D., Buhrmester J., Choudhuri J.V.,
RA   Ebensen T., Gaigalat L., Herrmann S., Khachane A.N., Larisch C., Link S.,
RA   Linke B., Meyer F., Mormann S., Nakunst D., Rueckert C.,
RA   Schneiker-Bekel S., Schulze K., Vorhoelter F.J., Yevsa T., Engle J.T.,
RA   Goldman W.E., Puehler A., Goebel U.B., Goesmann A., Bloecker H., Kaiser O.,
RA   Martinez-Arias R.;
RT   "The missing link: Bordetella petrii is endowed with both the metabolic
RT   versatility of environmental bacteria and virulence traits of pathogenic
RT   Bordetellae";
RL   BMC Genomics 9(1):449-449(2008).
XX
DR   MD5; b94c2dfcb15623807c6184c9f3f463d9.
DR   BioSample; SAMEA3138272.
DR   CABRI; DSM 12804.
DR   EnsemblGenomes-Gn; Bpet1096.
DR   EnsemblGenomes-Gn; Bpet4212.
DR   EnsemblGenomes-Gn; Bpetrrna_01.
DR   EnsemblGenomes-Gn; Bpetrrna_02.
DR   EnsemblGenomes-Gn; Bpetrrna_03.
DR   EnsemblGenomes-Gn; Bpetrrna_04.
DR   EnsemblGenomes-Gn; Bpetrrna_05.
DR   EnsemblGenomes-Gn; Bpetrrna_06.
DR   EnsemblGenomes-Gn; Bpetrrna_07.
DR   EnsemblGenomes-Gn; Bpetrrna_08.
DR   EnsemblGenomes-Gn; Bpetrrna_09.
DR   EnsemblGenomes-Gn; Bpettrna_01.
DR   EnsemblGenomes-Gn; Bpettrna_02.
DR   EnsemblGenomes-Gn; Bpettrna_03.
DR   EnsemblGenomes-Gn; Bpettrna_04.
DR   EnsemblGenomes-Gn; Bpettrna_05.
DR   EnsemblGenomes-Gn; Bpettrna_06.
DR   EnsemblGenomes-Gn; Bpettrna_07.
DR   EnsemblGenomes-Gn; Bpettrna_08.
DR   EnsemblGenomes-Gn; Bpettrna_09.
DR   EnsemblGenomes-Gn; Bpettrna_10.
DR   EnsemblGenomes-Gn; Bpettrna_11.
DR   EnsemblGenomes-Gn; Bpettrna_12.
DR   EnsemblGenomes-Gn; Bpettrna_13.
DR   EnsemblGenomes-Gn; Bpettrna_14.
DR   EnsemblGenomes-Gn; Bpettrna_15.
DR   EnsemblGenomes-Gn; Bpettrna_16.
DR   EnsemblGenomes-Gn; Bpettrna_17.
DR   EnsemblGenomes-Gn; Bpettrna_18.
DR   EnsemblGenomes-Gn; Bpettrna_19.
DR   EnsemblGenomes-Gn; Bpettrna_20.
DR   EnsemblGenomes-Gn; Bpettrna_21.
DR   EnsemblGenomes-Gn; Bpettrna_22.
DR   EnsemblGenomes-Gn; Bpettrna_23.
DR   EnsemblGenomes-Gn; Bpettrna_24.
DR   EnsemblGenomes-Gn; Bpettrna_25.
DR   EnsemblGenomes-Gn; Bpettrna_26.
DR   EnsemblGenomes-Gn; Bpettrna_27.
DR   EnsemblGenomes-Gn; Bpettrna_28.
DR   EnsemblGenomes-Gn; Bpettrna_29.
DR   EnsemblGenomes-Gn; Bpettrna_30.
DR   EnsemblGenomes-Gn; Bpettrna_31.
DR   EnsemblGenomes-Gn; Bpettrna_32.
DR   EnsemblGenomes-Gn; Bpettrna_33.
DR   EnsemblGenomes-Gn; Bpettrna_34.
DR   EnsemblGenomes-Gn; Bpettrna_35.
DR   EnsemblGenomes-Gn; Bpettrna_36.
DR   EnsemblGenomes-Gn; Bpettrna_37.
DR   EnsemblGenomes-Gn; Bpettrna_38.
DR   EnsemblGenomes-Gn; Bpettrna_39.
DR   EnsemblGenomes-Gn; Bpettrna_40.
DR   EnsemblGenomes-Gn; Bpettrna_41.
DR   EnsemblGenomes-Gn; Bpettrna_42.
DR   EnsemblGenomes-Gn; Bpettrna_43.
DR   EnsemblGenomes-Gn; Bpettrna_44.
DR   EnsemblGenomes-Gn; Bpettrna_45.
DR   EnsemblGenomes-Gn; Bpettrna_46.
DR   EnsemblGenomes-Gn; Bpettrna_47.
DR   EnsemblGenomes-Gn; Bpettrna_48.
DR   EnsemblGenomes-Gn; Bpettrna_49.
DR   EnsemblGenomes-Gn; Bpettrna_50.
DR   EnsemblGenomes-Gn; Bpettrna_51.
DR   EnsemblGenomes-Gn; EBG00001049904.
DR   EnsemblGenomes-Gn; EBG00001049908.
DR   EnsemblGenomes-Gn; EBG00001049910.
DR   EnsemblGenomes-Gn; EBG00001049912.
DR   EnsemblGenomes-Gn; EBG00001049916.
DR   EnsemblGenomes-Gn; EBG00001049919.
DR   EnsemblGenomes-Gn; EBG00001049923.
DR   EnsemblGenomes-Gn; EBG00001049926.
DR   EnsemblGenomes-Gn; EBG00001049929.
DR   EnsemblGenomes-Gn; EBG00001049931.
DR   EnsemblGenomes-Gn; EBG00001049933.
DR   EnsemblGenomes-Gn; EBG00001049935.
DR   EnsemblGenomes-Gn; EBG00001049937.
DR   EnsemblGenomes-Gn; EBG00001049939.
DR   EnsemblGenomes-Gn; EBG00001049941.
DR   EnsemblGenomes-Gn; EBG00001049943.
DR   EnsemblGenomes-Gn; EBG00001049945.
DR   EnsemblGenomes-Gn; EBG00001049947.
DR   EnsemblGenomes-Gn; EBG00001049948.
DR   EnsemblGenomes-Gn; EBG00001049950.
DR   EnsemblGenomes-Gn; EBG00001049952.
DR   EnsemblGenomes-Gn; EBG00001049954.
DR   EnsemblGenomes-Gn; EBG00001049956.
DR   EnsemblGenomes-Gn; EBG00001049958.
DR   EnsemblGenomes-Gn; EBG00001049960.
DR   EnsemblGenomes-Gn; EBG00001049962.
DR   EnsemblGenomes-Gn; EBG00001049964.
DR   EnsemblGenomes-Gn; EBG00001049966.
DR   EnsemblGenomes-Gn; EBG00001049968.
DR   EnsemblGenomes-Gn; EBG00001049970.
DR   EnsemblGenomes-Gn; EBG00001049972.
DR   EnsemblGenomes-Gn; EBG00001049974.
DR   EnsemblGenomes-Gn; EBG00001049976.
DR   EnsemblGenomes-Gn; EBG00001049978.
DR   EnsemblGenomes-Gn; EBG00001049980.
DR   EnsemblGenomes-Gn; EBG00001049982.
DR   EnsemblGenomes-Gn; EBG00001049984.
DR   EnsemblGenomes-Gn; EBG00001049986.
DR   EnsemblGenomes-Gn; EBG00001049988.
DR   EnsemblGenomes-Gn; EBG00001049990.
DR   EnsemblGenomes-Gn; EBG00001049992.
DR   EnsemblGenomes-Gn; EBG00001049994.
DR   EnsemblGenomes-Gn; EBG00001049996.
DR   EnsemblGenomes-Gn; EBG00001049998.
DR   EnsemblGenomes-Gn; EBG00001050000.
DR   EnsemblGenomes-Gn; EBG00001050002.
DR   EnsemblGenomes-Gn; EBG00001050004.
DR   EnsemblGenomes-Gn; EBG00001050006.
DR   EnsemblGenomes-Gn; EBG00001050008.
DR   EnsemblGenomes-Gn; EBG00001050010.
DR   EnsemblGenomes-Gn; EBG00001050012.
DR   EnsemblGenomes-Gn; EBG00001050014.
DR   EnsemblGenomes-Gn; EBG00001050015.
DR   EnsemblGenomes-Gn; EBG00001050017.
DR   EnsemblGenomes-Gn; EBG00001050019.
DR   EnsemblGenomes-Gn; EBG00001050021.
DR   EnsemblGenomes-Gn; EBG00001050023.
DR   EnsemblGenomes-Gn; EBG00001050025.
DR   EnsemblGenomes-Gn; EBG00001050027.
DR   EnsemblGenomes-Gn; EBG00001050029.
DR   EnsemblGenomes-Gn; EBG00001050031.
DR   EnsemblGenomes-Gn; EBG00001050033.
DR   EnsemblGenomes-Gn; EBG00001050035.
DR   EnsemblGenomes-Gn; EBG00001050037.
DR   EnsemblGenomes-Gn; EBG00001050039.
DR   EnsemblGenomes-Gn; EBG00001050041.
DR   EnsemblGenomes-Gn; EBG00001050043.
DR   EnsemblGenomes-Gn; EBG00001050045.
DR   EnsemblGenomes-Gn; EBG00001050047.
DR   EnsemblGenomes-Gn; EBG00001050049.
DR   EnsemblGenomes-Gn; EBG00001050051.
DR   EnsemblGenomes-Gn; bp050705_PS_01.
DR   EnsemblGenomes-Gn; bp050705_PS_02.
DR   EnsemblGenomes-Tr; Bpet1096.
DR   EnsemblGenomes-Tr; Bpet4212.
DR   EnsemblGenomes-Tr; Bpetrrna_01-1.
DR   EnsemblGenomes-Tr; Bpetrrna_02-1.
DR   EnsemblGenomes-Tr; Bpetrrna_03-1.
DR   EnsemblGenomes-Tr; Bpetrrna_04-1.
DR   EnsemblGenomes-Tr; Bpetrrna_05-1.
DR   EnsemblGenomes-Tr; Bpetrrna_06-1.
DR   EnsemblGenomes-Tr; Bpetrrna_07-1.
DR   EnsemblGenomes-Tr; Bpetrrna_08-1.
DR   EnsemblGenomes-Tr; Bpetrrna_09-1.
DR   EnsemblGenomes-Tr; Bpettrna_01-1.
DR   EnsemblGenomes-Tr; Bpettrna_02-1.
DR   EnsemblGenomes-Tr; Bpettrna_03-1.
DR   EnsemblGenomes-Tr; Bpettrna_04-1.
DR   EnsemblGenomes-Tr; Bpettrna_05-1.
DR   EnsemblGenomes-Tr; Bpettrna_06-1.
DR   EnsemblGenomes-Tr; Bpettrna_07-1.
DR   EnsemblGenomes-Tr; Bpettrna_08-1.
DR   EnsemblGenomes-Tr; Bpettrna_09-1.
DR   EnsemblGenomes-Tr; Bpettrna_10-1.
DR   EnsemblGenomes-Tr; Bpettrna_11-1.
DR   EnsemblGenomes-Tr; Bpettrna_12-1.
DR   EnsemblGenomes-Tr; Bpettrna_13-1.
DR   EnsemblGenomes-Tr; Bpettrna_14-1.
DR   EnsemblGenomes-Tr; Bpettrna_15-1.
DR   EnsemblGenomes-Tr; Bpettrna_16-1.
DR   EnsemblGenomes-Tr; Bpettrna_17-1.
DR   EnsemblGenomes-Tr; Bpettrna_18-1.
DR   EnsemblGenomes-Tr; Bpettrna_19-1.
DR   EnsemblGenomes-Tr; Bpettrna_20-1.
DR   EnsemblGenomes-Tr; Bpettrna_21-1.
DR   EnsemblGenomes-Tr; Bpettrna_22-1.
DR   EnsemblGenomes-Tr; Bpettrna_23-1.
DR   EnsemblGenomes-Tr; Bpettrna_24-1.
DR   EnsemblGenomes-Tr; Bpettrna_25-1.
DR   EnsemblGenomes-Tr; Bpettrna_26-1.
DR   EnsemblGenomes-Tr; Bpettrna_27-1.
DR   EnsemblGenomes-Tr; Bpettrna_28-1.
DR   EnsemblGenomes-Tr; Bpettrna_29-1.
DR   EnsemblGenomes-Tr; Bpettrna_30-1.
DR   EnsemblGenomes-Tr; Bpettrna_31-1.
DR   EnsemblGenomes-Tr; Bpettrna_32-1.
DR   EnsemblGenomes-Tr; Bpettrna_33-1.
DR   EnsemblGenomes-Tr; Bpettrna_34-1.
DR   EnsemblGenomes-Tr; Bpettrna_35-1.
DR   EnsemblGenomes-Tr; Bpettrna_36-1.
DR   EnsemblGenomes-Tr; Bpettrna_37-1.
DR   EnsemblGenomes-Tr; Bpettrna_38-1.
DR   EnsemblGenomes-Tr; Bpettrna_39-1.
DR   EnsemblGenomes-Tr; Bpettrna_40-1.
DR   EnsemblGenomes-Tr; Bpettrna_41-1.
DR   EnsemblGenomes-Tr; Bpettrna_42-1.
DR   EnsemblGenomes-Tr; Bpettrna_43-1.
DR   EnsemblGenomes-Tr; Bpettrna_44-1.
DR   EnsemblGenomes-Tr; Bpettrna_45-1.
DR   EnsemblGenomes-Tr; Bpettrna_46-1.
DR   EnsemblGenomes-Tr; Bpettrna_47-1.
DR   EnsemblGenomes-Tr; Bpettrna_48-1.
DR   EnsemblGenomes-Tr; Bpettrna_49-1.
DR   EnsemblGenomes-Tr; Bpettrna_50-1.
DR   EnsemblGenomes-Tr; Bpettrna_51-1.
DR   EnsemblGenomes-Tr; EBT00001651958.
DR   EnsemblGenomes-Tr; EBT00001651959.
DR   EnsemblGenomes-Tr; EBT00001651960.
DR   EnsemblGenomes-Tr; EBT00001651961.
DR   EnsemblGenomes-Tr; EBT00001651962.
DR   EnsemblGenomes-Tr; EBT00001651963.
DR   EnsemblGenomes-Tr; EBT00001651964.
DR   EnsemblGenomes-Tr; EBT00001651965.
DR   EnsemblGenomes-Tr; EBT00001651966.
DR   EnsemblGenomes-Tr; EBT00001651967.
DR   EnsemblGenomes-Tr; EBT00001651968.
DR   EnsemblGenomes-Tr; EBT00001651969.
DR   EnsemblGenomes-Tr; EBT00001651970.
DR   EnsemblGenomes-Tr; EBT00001651971.
DR   EnsemblGenomes-Tr; EBT00001651972.
DR   EnsemblGenomes-Tr; EBT00001651973.
DR   EnsemblGenomes-Tr; EBT00001651974.
DR   EnsemblGenomes-Tr; EBT00001651975.
DR   EnsemblGenomes-Tr; EBT00001651976.
DR   EnsemblGenomes-Tr; EBT00001651977.
DR   EnsemblGenomes-Tr; EBT00001651978.
DR   EnsemblGenomes-Tr; EBT00001651979.
DR   EnsemblGenomes-Tr; EBT00001651980.
DR   EnsemblGenomes-Tr; EBT00001651981.
DR   EnsemblGenomes-Tr; EBT00001651982.
DR   EnsemblGenomes-Tr; EBT00001651983.
DR   EnsemblGenomes-Tr; EBT00001651984.
DR   EnsemblGenomes-Tr; EBT00001651985.
DR   EnsemblGenomes-Tr; EBT00001651986.
DR   EnsemblGenomes-Tr; EBT00001651987.
DR   EnsemblGenomes-Tr; EBT00001651988.
DR   EnsemblGenomes-Tr; EBT00001651989.
DR   EnsemblGenomes-Tr; EBT00001651990.
DR   EnsemblGenomes-Tr; EBT00001651991.
DR   EnsemblGenomes-Tr; EBT00001651992.
DR   EnsemblGenomes-Tr; EBT00001651993.
DR   EnsemblGenomes-Tr; EBT00001651994.
DR   EnsemblGenomes-Tr; EBT00001651995.
DR   EnsemblGenomes-Tr; EBT00001651996.
DR   EnsemblGenomes-Tr; EBT00001651997.
DR   EnsemblGenomes-Tr; EBT00001651998.
DR   EnsemblGenomes-Tr; EBT00001651999.
DR   EnsemblGenomes-Tr; EBT00001652000.
DR   EnsemblGenomes-Tr; EBT00001652001.
DR   EnsemblGenomes-Tr; EBT00001652002.
DR   EnsemblGenomes-Tr; EBT00001652003.
DR   EnsemblGenomes-Tr; EBT00001652004.
DR   EnsemblGenomes-Tr; EBT00001652005.
DR   EnsemblGenomes-Tr; EBT00001652006.
DR   EnsemblGenomes-Tr; EBT00001652007.
DR   EnsemblGenomes-Tr; EBT00001652008.
DR   EnsemblGenomes-Tr; EBT00001652009.
DR   EnsemblGenomes-Tr; EBT00001652010.
DR   EnsemblGenomes-Tr; EBT00001652011.
DR   EnsemblGenomes-Tr; EBT00001652012.
DR   EnsemblGenomes-Tr; EBT00001652013.
DR   EnsemblGenomes-Tr; EBT00001652014.
DR   EnsemblGenomes-Tr; EBT00001652015.
DR   EnsemblGenomes-Tr; EBT00001652016.
DR   EnsemblGenomes-Tr; EBT00001652017.
DR   EnsemblGenomes-Tr; EBT00001652018.
DR   EnsemblGenomes-Tr; EBT00001652019.
DR   EnsemblGenomes-Tr; EBT00001652020.
DR   EnsemblGenomes-Tr; EBT00001652021.
DR   EnsemblGenomes-Tr; EBT00001652022.
DR   EnsemblGenomes-Tr; EBT00001652023.
DR   EnsemblGenomes-Tr; EBT00001652024.
DR   EnsemblGenomes-Tr; EBT00001652025.
DR   EnsemblGenomes-Tr; EBT00001652026.
DR   EnsemblGenomes-Tr; EBT00001652027.
DR   EnsemblGenomes-Tr; EBT00001652028.
DR   EnsemblGenomes-Tr; bp050705_PS_01.
DR   EnsemblGenomes-Tr; bp050705_PS_02.
DR   EuropePMC; PMC2572626; 18826580.
DR   EuropePMC; PMC2772482; 19767427.
DR   EuropePMC; PMC2863914; 20237101.
DR   EuropePMC; PMC3209000; 21948829.
DR   EuropePMC; PMC3421494; 22675125.
DR   EuropePMC; PMC3626951; 24426112.
DR   EuropePMC; PMC4390665; 25540393.
DR   EuropePMC; PMC4761151; 26897378.
DR   EuropePMC; PMC4914157; 27226298.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02227; sX8.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; AM902716.
DR   SILVA-SSU; AM902716.
DR   StrainInfo; 163371; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5287950
FT                   /organism="Bordetella petrii"
FT                   /strain="DSM 12804"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:94624"
FT   CDS_pept        1..1437
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Bpet0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /function="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40332"
FT                   /db_xref="GOA:A9HVA1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HVA1"
FT                   /protein_id="CAP40332.1"
FT                   /translation="MKEFWQTCVSRLEQELPPQQISAWIRPLVPLAYDETQAVLRVAAP
FT                   NRFKLDWVRKNFSHQIEALAAEWFQRPVQVAFELPAGGAGPRMPAVPRTPAGAPAPVSA
FT                   GMAATPAGAPAQAPVAPAAVAAAVQADAAGVVYERSRLNTDLTFDNFVTGKANQLARAA
FT                   ALQVAENPGISYNPLFLYGGVGLGKTHLIHAIGNAMVAAGTGVRVRYVHADQYVSDVVK
FT                   AYQRKAFDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEAMVAQRKQIIITSDTY
FT                   PKELAGIDSRLISRFDSGLTVAIEPPELEMRVAILLRKAESEGVPMPEEVAFFIAKHLR
FT                   SNVRELEGALRKVLAYARFHGRDVLSVDVCKEALKDLLSVSNGQITVENIQKTVADFYK
FT                   IKVADMYSKRRPANIALPRQVAMYLAKELTQKSLPEIGDLFGGRDHTTVLHAVRKISDA
FT                   RAKQAELNHTLHVLEQTLKG"
FT   CDS_pept        1440..2549
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="Bpet0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /function="DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40333"
FT                   /db_xref="GOA:A9HVA7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVA7"
FT                   /protein_id="CAP40333.1"
FT                   /translation="MQLVQTTRDALLKPLSTVAGIVERRHTLPILANILMRKEGNKVAF
FT                   IATDLEVQITTHADFGVGQDNESTTVAARKLLDILKALPDTGEVKLGLANNKLSVQSAK
FT                   SRFALQTLAASEFPTVAQPEKWDVSLSLPQRTLRHLLNMVHFAMAQQDIRYYLNGMLLV
FT                   FEAGCVRAVATDGHRLAHCATAADGITERHEVIVPRKTVLEMQRLLEDSDEPVAVDVAP
FT                   GQIRFRFGDVELVSKLVEGKFPDFTRVIPTNYTRQFVVSREALQGSLQRAAILTTDKFK
FT                   GVRLQLAQNQMKISSSNAEQEEAQEELDIDYGHEPLDVGFNVSYLLDVLANVKTENIQW
FT                   SVMPDANASALLTLPDDDQFKYVVMPMRI"
FT   CDS_pept        2640..5093
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="Bpet0003"
FT                   /product="DNA gyrase subunit B"
FT                   /function="DNA gyrase (topoisomerase II) B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40334"
FT                   /db_xref="GOA:A9HVB3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVB3"
FT                   /protein_id="CAP40334.1"
FT                   /translation="MSDQQNSNPENSGYGADSIKMLKGLEAVRKRPGMYIGDTSDGTGL
FT                   HHMVFEVVDNAIDEALAGYCDDIVVTIHTDNSISVSDNGRGIPTAIHKDDEFGRSAAEI
FT                   VMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSEWLRLTIRRNGEVHQMEFRQGERVA
FT                   PLAVTGTTDKRGTEVRFLADPIIFNNIEYHYDVLSKRLRELSFLNNGVKIRLIDQRQGK
FT                   EENFAFSGGVRGFVEYINRSKTVLHPNVFAVSAESNAGGVPVGVEVAMQWNDTYSETVL
FT                   CFTNNIPQRDGGTHMTGLRAAMTRVINKYIADNELAKKAKVETSGDDMREGLACVLSVK
FT                   VPEPKFSSQTKDKLVSSEVRPAVEEAVARTLETWLLEHPNDAKALCGKIVEAARAREAA
FT                   RKAREMTRRKSVLEGAGLPGKLADCQEKDPALCELYIVEGDSAGGSAKQGRDRKFQAIL
FT                   PLRGKVLNVEKARFDRLIASEQIATLITALGTSIGPDFNIDKLRYHRLIIMTDADVDGA
FT                   HIRTLLLTLLYRQMPELIERGYVYIAQPPLYKVKVGREERYLKDDQEEAQFMLQLALKD
FT                   AELVPAQGAAPITGEALAELARQYVLADAVIARLTRLFDVDALSAMAEGVEIDLSSGEA
FT                   AAASAQRLSDAMHEAVAGNGVEVVAEFDETHEQHRLLVRRMHHGNVRVSVIDADFVQGA
FT                   DYAVLAKSARTFLGLIGAGAFVARGEGDKRKEQFVADFREAMQWLRSEAERGISKQRYK
FT                   GLGEMNPEQLWETTMDPTVRRLLRVKIEDAIAADEIFTTLMGDDVEPRRAFIETHALSA
FT                   SNIDA"
FT   CDS_pept        5240..5542
FT                   /transl_table=11
FT                   /locus_tag="Bpet0004"
FT                   /product="putative DNA-binding protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40335"
FT                   /db_xref="GOA:A9HVC0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVC0"
FT                   /protein_id="CAP40335.1"
FT                   /translation="MARTLTKPLEQSPLALDLQALGQLIRNRRAHSLLRIDDAAALLGV
FT                   SKDTLSRLENGRAVGTDKMMAVLQGLGLAIIITDKALASTALQAIEGEPRVKDAG"
FT   CDS_pept        5542..6885
FT                   /transl_table=11
FT                   /locus_tag="Bpet0005"
FT                   /product="HipA protein"
FT                   /note="uncharacterized protein related to capsule
FT                   biosynthesis enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40336"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVC5"
FT                   /protein_id="CAP40336.1"
FT                   /translation="MARHALSVIAPQGRVGTLVFESTEDRYEFIYDPAWPGIAQAFPLS
FT                   PHIPLAGPPAASGVVARFLQNLLPEGRALDVASSFHRVSKGNIFGLINLLGREPVGALS
FT                   FLAEDADASQAAAEPRRPISDAELSERIRARDSVPFPVWDGKVRLSVAGFQDKLQVLLE
FT                   GDQVSLVEAPLASTHILKPESPNPATPFMVANEHFCMTLALHMGLPVAPVRIRRIPEPV
FT                   LLIERFDRTVEWAQDGPTAVAVHRRHVIDACQALDMPVALKYERNMGSAEHVRHIRDGV
FT                   SFERLFALADDFENPAVARQFLLRWAILQLLIGNSDAHGKNVSFFLSGAGLAPANLYDL
FT                   VCVHAYGQAIEQEMAMGYGDEFRCNAVTAFDLADFAHRAGLPATLVARELASMAKQAQK
FT                   RVAALAQHEVYTPNERQHVQGIAAFVLAQAERLLRIAPQVPKVDPELL"
FT   CDS_pept        complement(6999..7625)
FT                   /transl_table=11
FT                   /gene="ycaC"
FT                   /locus_tag="Bpet0006"
FT                   /product="hydrolase, isochorismatase family"
FT                   /function="amidase, related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40337"
FT                   /db_xref="GOA:A9HVC9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVC9"
FT                   /protein_id="CAP40337.1"
FT                   /translation="MSKPYVRLDKDNAAVLLVDHQAGLLSLVRDIDPDKFKNNVLALAD
FT                   LAKYFKLPTILTTSFEDGPNGPLVPELKTLFPDAPFIPRPGQINAWDNEDFVKAVKATG
FT                   KKQLIIAGVVTEVCVAFPALSALEEGFEVFVVTDASGTFNELTRDAAWDRMSKAGAQLM
FT                   TWFGAACELHRDWRNDIEGLGTLFSNHIPDYRNLITSYTTLTQKK"
FT   CDS_pept        complement(7712..8506)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0007"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40338"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVD4"
FT                   /protein_id="CAP40338.1"
FT                   /translation="MFSYDSHGRHLSPFLLLDHAGPAQFAPAVKPRGVGQHPHRGFETV
FT                   TIVYQGEVDHRDSTGAGGHIGPGDVQWMTAAGGILHEEFHSEAFTRQGGALEMVQLWVN
FT                   LPARDKMSQPGYQTLLSRDIPVVGLPGNAGQVRVIAGKFNGRRGPARTHTPLDVWDVRL
FT                   RQQGTATFDLPEGRTLALAVLHGTVQINGDEIVREGQLAHLAREGTRVQIEANNDVTLL
FT                   LLSGEPIDEPIVGYGPFVMNSQAEIRQAIDDFNHGRFGQMAP"
FT   CDS_pept        8723..9640
FT                   /transl_table=11
FT                   /locus_tag="Bpet0008"
FT                   /product="LysR-family transcriptional regulator"
FT                   /function="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40339"
FT                   /db_xref="GOA:A9HVD9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVD9"
FT                   /protein_id="CAP40339.1"
FT                   /translation="MPDLMPDLNDLYYFVQVVDHGGFAPAGRALGIPKSKLSRRIALLE
FT                   ARLGARLLMRTTRQFAVTDIGQTYYAHCKAMLVEADAAEEAVALTRAEPRGTVRVTCPV
FT                   ALLDARVADMLAAFMVQYPLVQLHLEETNRRVDVVAEGVDVAIRVRPPPLEDSDLVMRV
FT                   LADRGQCLVASPALLQHTGVPRAPADLSGLPSLGLGLPQGEHVWNLLGPDGAHAAVRHQ
FT                   PRLVTRGMLALRAAAVAGVGIVQLPTMLLREQFKRGELVTVLPDWAPRREIIHVVFASR
FT                   RGQLPSVRALIDFLADRFEALDED"
FT   CDS_pept        complement(9585..10370)
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="Bpet0009"
FT                   /function="dethiobiotin synthetase"
FT                   /EC_number="6.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40340"
FT                   /db_xref="GOA:A9HVE3"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVE3"
FT                   /protein_id="CAP40340.1"
FT                   /translation="MLDAPAPTPGHASARHTDYFVTGTDTEIGKTLVSCALLHGAARQG
FT                   WRAAGMKAVAAGADLVNGGWVNQDVEQLRQASNVTLPEAVRCPYVLRQAVAPHIAAAAE
FT                   GVTLQLAAIRHAYRQAAAHADAVVVEGVGGFRVPLDDNRDTADLAQQLGLPVILVVGIR
FT                   LGCISHALLTAEAIAARGLRLAGWVANHVDPAMPHAQANVQALAQRLPAPLAGCVPYLA
FT                   HADPAAAARHLDLSVLYPVVPLSPRPAPRSGLPGNRSAP"
FT   CDS_pept        complement(10363..11553)
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="Bpet0010"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /function="7-keto-8-aminopelargonate synthetase"
FT                   /EC_number="2.3.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40341"
FT                   /db_xref="GOA:A9HVE9"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HVE9"
FT                   /protein_id="CAP40341.1"
FT                   /translation="MQLLDNLDAALRKLDAQHLRRRRRTAESPCAPHVRVDGRDMLAFC
FT                   SNDYLGLAAHPVIVAALAEGAARYGAGSGASHLISGHSHAHAQLEERLANMLAPHLEQP
FT                   RALYFCTGYMANLAVLGALAGRDADIFSEALNHASLIDGARLSRARVQVYPHADLDALA
FT                   DMLAASRAQTRLIVSDGVFSMDGDIAPLRDLLALAERHGAWLVVDDAHGFGVLGEHGRG
FT                   VLEHAGLRSPHLVLMGTLGKAAGVAGAFVAAHATVIDWLVNRARPYIFSTAAAPAQAHA
FT                   LMASLNLIEGSEGRQRRARLQALAQQLQARLSLRQWRHQPTPTAIQPIVLGANAHALRA
FT                   AAGLESQGLWVPAIRPPTVPPGTARLRVTLSASHIPAHVDRLADALNQLDNEACHA"
FT   CDS_pept        complement(11555..12895)
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="Bpet0011"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.62"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40342"
FT                   /db_xref="GOA:A9HVF4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVF4"
FT                   /protein_id="CAP40342.1"
FT                   /translation="MPHHAPTSKTAEWRTRSLRHVWHPCTQMKRQASMPLLALSHGEGP
FT                   WLVDMDGRRYLDGISSWWVNLFGHANARINAALNDQLARLPHAMLAGCTHAPAVELAER
FT                   LSALTGAALDHCFYASDGASAVEIALKMSFHAWRNQGHPAKREFVCLRHGYHGETLGAL
FT                   GVTDVAVFRDAYGPLLRQAHVVASPDARAALPGEDADAVARRAAAELQTLLDARHAHIA
FT                   AVIIEPLVQCAAGMAMHAPSYLRQVRELCDRYQAHLIADEIAVGCGRTGTFFASEQAGI
FT                   WPDLLTLSKGITGGYLPLSLVLATDAIHATFYDDDVARGFLHSHSYTGNPLACRAALAT
FT                   LDIFEADDVLARNRRRAARLDAALAPLQAHHAVRHFRRTGMIWAFDVEAGPGFGQRYAA
FT                   AALARGLLLRPIGHTVYLMPPYVLDNDTATWLARETLAALDDALEEH"
FT   CDS_pept        complement(13423..13920)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0012"
FT                   /product="putative thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40343"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVG0"
FT                   /protein_id="CAP40343.1"
FT                   /translation="METPMPDHPDLPRTQLIVQPDWTDLYGHMNAARYVRVFDHIGFQL
FT                   LEPLGVGESYTQATRCGIYTVDIAVNYRRELLAGDPLELRLRVLGADQKRLLCLMELFQ
FT                   TRDNYLAATMEQLSVHVNLDTRRSQAFPDTLVQSLQAAAQAHAAAPLPERHVTRLTLAR
FT                   RA"
FT   CDS_pept        complement(13930..14214)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0013"
FT                   /product="putative acylphosphatase"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40344"
FT                   /db_xref="GOA:A9HVG5"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVG5"
FT                   /protein_id="CAP40344.1"
FT                   /translation="MQVSQLETVHVIVKGVVQGVGYRHATVRRAHMLGVTGWVQNMEDG
FT                   TVQAMVQGTPDQVDHMLEWLRRGPPAAVVRDLATQREYTDKRYARFEQL"
FT   CDS_pept        14294..15460
FT                   /transl_table=11
FT                   /locus_tag="Bpet0014"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40345"
FT                   /db_xref="GOA:A9HVG8"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVG8"
FT                   /protein_id="CAP40345.1"
FT                   /translation="MNNANLAKITCIEDLRILAQKRVPRMFYDYADSGAWTEGTYRANE
FT                   TDFQAIKLRQRVAVDMEGRSLRTTMAGADAVMPVAIAPTGLTGMQHADGEMVAAQAAAE
FT                   FGVPFTLSTMSICSIEDVARATGKPFWFQLYVMRDREFVANLIDRAKAAGCSALVLTLD
FT                   LQILGQRHKDIRNGLSAPPKPTLANLINLATKPRWCLGMLGTPRRTFGNIVGHAKGVTD
FT                   LSSLSSWTAEQFDPRLSWADVEWIKQRWGGKLILKGILDVEDARLAADSGADALIVSNH
FT                   GGRQLDGAMSSIAALPAIADAVGSRIEVWMDGGIRSGQDVLKAVALGARGTMIGRAFLY
FT                   GLGAYGKAGVTRALEILYKEMDVTMALCGRKSLTPGDRSVLLPGTYPT"
FT   CDS_pept        15602..16375
FT                   /transl_table=11
FT                   /gene="GAF"
FT                   /locus_tag="Bpet0015"
FT                   /product="intracellular signaling protein (GAF,GGDEF
FT                   domains)"
FT                   /function="response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40346"
FT                   /db_xref="GOA:A9HVH3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVH3"
FT                   /protein_id="CAP40346.1"
FT                   /translation="MGETTDVDRSWMLEYRPDMLRFRNTHEWCRGQTRPYVTELQDVPT
FT                   TLIAWLHKYMVQGRAVAIYDVHKLPRVARTLQVEFIRQGDKSVLSVPVLNEGKLYGVIG
FT                   FDTTVKHREWPDAEVEALFQCAGLIGQAKYGNGRGQQQMPYDSPAALVYLRMRGVVQGV
FT                   QPETIAGVRSAGNYSEIWLANGSMVLDSRSLGMWLTLLPEKIFFRVHRTAIVNALHVVD
FT                   IDRRAERWQIRMRAAERAWPVSRSYRKLLRERMGI"
FT   CDS_pept        16512..17657
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="Bpet0016"
FT                   /product="penicillin-binding protein ampH"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40347"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVH5"
FT                   /protein_id="CAP40347.1"
FT                   /translation="MLASRIVSRACTLTLAMACALGFHPARAADLALTDAVSMAGMQLY
FT                   LNAGAPALLIAVVRGDDTVIQAYGETAPGSGIEPDEHSIFRLASVSKVFAADVLAALAV
FT                   KGKLGLTDPLSQYAPDGVQVQSNGRPITLLDLATHSAALPRELPDPDAKPSENPFAAFD
FT                   RAYYWKWLGSNTPPYAPGTTTLYSNAGYGLLGDALAKAGGADYSTVLANEVLAPAGLSD
FT                   TTNVLNDEQQKRLMTGLDPLNQPDPNALVPDVMYASAGVYSTAADMARWMKWHLDGARR
FT                   QTPQALLAHQMWLPYDGLKSVVGTEVTDADGMGLGWVVSLPRNGTPLLLGKSGGLGGFM
FT                   SYVALSPNRGLGILVVASRVNFAMFDGIHAQVRELAAELAR"
FT   CDS_pept        17667..18860
FT                   /transl_table=11
FT                   /locus_tag="Bpet0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40348"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVH7"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAP40348.1"
FT                   /translation="MSSSVQSIAMSGLRRLAAAGMTALAISAPPAGAQEARDVFKTEIF
FT                   LSPYSELGDATDQYPRLNGRILALTGYTNYFGIRDDNGQIPRSHWTSTQPQVESAFVLQ
FT                   LTNRFSIRAKATLDSATDETKDNAFSDLGAQLNNLFAAYTADHYALYGGKMDLGYGDAW
FT                   HVIDGLYSGFTEGSEYRGAIGVGGRYTLDTAAAGSHSFAAVLFKRDDGGLSQRLSFDDG
FT                   LLKADAPPTFSDRMQSFIVSYDFRRLPGLEGISGGVDAGRLHAQPGYGDSSNIVSARLR
FT                   YDAPLGRRWNLGWYNEATYASAFRGAPVSNGNGVTSVALSRDRWQFVVTAAARKLSGSD
FT                   EKLARYGLRGGWDWAFSGAATYVLPAGFIVQAGLTRQRDQSLIINQGVFRIAYQAEF"
FT   CDS_pept        18868..20457
FT                   /transl_table=11
FT                   /locus_tag="Bpet0018"
FT                   /product="putative secreted protein"
FT                   /note="Probable Beta-lactamase class"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40349"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR021860"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVH9"
FT                   /protein_id="CAP40349.1"
FT                   /translation="MNSKPIRIAAAAVLGAGLAMGGAMPAASQALTIERGASPPADAVA
FT                   IPNGSRERAVQELPHIIERIMRRSHVPGMAAAVVIDGKTVFAQGYGKREAGKPGAVDAQ
FT                   TVFQIASISKSISATVTAIQVTRGTVAWTDPVSRYLPGFKLSDAYVASHGTIGDFFAHR
FT                   TGLPGTAGDDLEDLGFTRDEIIARLRLLPLDPFRISYHYANFSTTIAAEAVAAAAQARW
FT                   EDLADASLFKPLGMASTSYRYRDYEARGNRAALHAYRNGSFQALGQRNADEQAPAGGVS
FT                   SNVVDLAEWLKLLLANGQRQGKPLIAPQALLPALSPQSFSAPPHAVDARPGFYGYGFNV
FT                   NTEVGGRPAMGHSGAFLLGAGTAFKIVPSAGIGIVVLTNGAPIGAAESVVAEFTDVALY
FT                   GKPSRDWFAAYNGVMRGYFVPQADLSSQSRPARPRASQPLDSYVGRYENAYFGMADIQE
FT                   ANGAMTLTLGPKAMAFQLRHWDGDTFAFSPAGEAELVDSLASLRFKMENGRASGFAIDF
FT                   YDENGLGTWVRK"
FT   CDS_pept        20586..21416
FT                   /transl_table=11
FT                   /locus_tag="Bpet0019"
FT                   /product="AraC-family transcriptional regulator"
FT                   /function="DNA gyrase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40350"
FT                   /db_xref="GOA:A9HVI2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVI2"
FT                   /protein_id="CAP40350.1"
FT                   /translation="MKATTRIHYANRLEPVLHWLASHPDAAPDLYHLADLACLSPYHFH
FT                   RVYRALMGETVNATMQRMRMHRASVDLAGSRPMPQVARRAGYTSQAAFNRAFGAAFGMP
FT                   PGRYRHARSRPFNPQELGMYPVTIEQFAGASLATLAHQGDYQNIGATFDRLFMLAAGRD
FT                   LVGPATRSFGVYYDDPAQVPADRLRSRAGLTLPDGASADPVFEPFALPAARCAVLEYTG
FT                   PYSEIEAAYNWLFAQWLPASGHETLDFPMWEEYVNDPKTTPAAELKTRIYLPLA"
FT   CDS_pept        complement(21454..22482)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0020"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized ABC-type transport system
FT                   periplasmic component/surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40351"
FT                   /db_xref="GOA:A9HVI4"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVI4"
FT                   /protein_id="CAP40351.1"
FT                   /translation="MPFRTSLSAAGQLRRSTILRLGAGLAWLAAGRAYGQIIGPVKVAG
FT                   VYTVPIGQQWVSRVHRALILARTRGDIDYAYTENVSHGSYERVLRQYAEKGVHLIVGEA
FT                   FRAEAAARAVARDYPQTAFLMGSSGRPQQPNFSVFDNYIQEAAYLSGMVAGGLSESGKI
FT                   GLVGGYPIPEVNRLMHAFMDGVREINPDARFYVAFIGSWFDPPKARQAAFDMIDQGVDM
FT                   LYAERFGVAEAAQQRGKLAIGNVIDTQPQYPDTVVTSALWNMEPTIERALTMVKRGTFK
FT                   ADDYGKYSQMRYQGSMLAPLGAFEGKLPGGLVASVEARQKAILDGSFSVKINDNPPQSS
FT                   TP"
FT   CDS_pept        22655..23584
FT                   /transl_table=11
FT                   /locus_tag="Bpet0021"
FT                   /product="putative oxidoreductase"
FT                   /function="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40352"
FT                   /db_xref="GOA:A9HVI7"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVI7"
FT                   /protein_id="CAP40352.1"
FT                   /translation="MRLLFLGAGGTGGYFGGRAAQAGADVTFLVREARAQKLRAQGLRI
FT                   ESPRGDAVVAAQVVTEGELEGAYDVVVISCKAYDLPSAIAAIRPAVGPDTAILPIMNGV
FT                   LQYDTLDAEFGAARVLGGLCQINATLGPEGQVRHLGQHAVFVYGERAGDPRSARCVALE
FT                   AALAGADFTNRLSSDIQQDVWEKYVFLTTLAAATCLMRGPVGQIVSTDDGEAIVRDLLR
FT                   ECQQVAAASGHAVRSEADAAALKVLTDRQSPMTASMFRDLSQGARVEADHIVGDMVHRG
FT                   RTLGLDTPALRMAYAHLQVYQARRAIGA"
FT   CDS_pept        23673..24284
FT                   /transl_table=11
FT                   /locus_tag="Bpet0022"
FT                   /product="conserved hypothetical protein"
FT                   /function="putative NADH-flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40353"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVJ0"
FT                   /protein_id="CAP40353.1"
FT                   /translation="MNIALIGITGRAGSRIADELLRRGHQVTGIARNPAEVVARPGLTA
FT                   RQGDVTDPAALAPLLAGHDAVISAARFVSTDAKPLLEAVRSAGVPRLLVVGGAGSLRVA
FT                   PGVMLIDTADFPDAYKPEARAGVVFLDALRRETALDWTFLSPSALFAPGERTGTFRIGS
FT                   DELLADDEGKSWISMEDYAIALVDELESPRHPRRRFTVGY"
FT   CDS_pept        24301..24828
FT                   /transl_table=11
FT                   /locus_tag="Bpet0023"
FT                   /product="conserved hypothetical protein"
FT                   /function="nucleoside 2-deoxyribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40354"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVJ1"
FT                   /protein_id="CAP40354.1"
FT                   /translation="MKTVYLAGFDVFRADALAHGAWLKLQCRNHGFEGLYPLDNQAPAG
FT                   LPGRALAQWIYEANTALIRQADAVMANLNAFRGAEPDSGTAFEVGYAVALGKPVWAYTD
FT                   HADSLVQRLAVAQADDPPRHVDAQGYTVEDFGLSLNLMLACSATVISGDATQCLAHMKQ
FT                   ALGTGAPGAREP"
FT   CDS_pept        complement(25499..26200)
FT                   /transl_table=11
FT                   /gene="ribB1"
FT                   /locus_tag="Bpet0024"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40355"
FT                   /db_xref="GOA:A9HVJ4"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVJ4"
FT                   /protein_id="CAP40355.1"
FT                   /translation="MSSVISSVPYLPPDLTAQPFEARLARALHHMRLGRPVILMDDFDR
FT                   ENEADLIVAADKLTVPVMAQLIRDCSGIVCLCLTDDTLEQLQLPPMVARNESRYSTAFT
FT                   VSIEARHGVSTGVSAADRVTTIRAAIAPGAQAADIVSPGHVFPLRAQPGGVLARRGHTE
FT                   GSVDLAVLAGLRPAAVLCELMNADGTMARGPSIARYAAEHGLVALTIAELAMHRQRLAA
FT                   QAPAQPALAEA"
FT   CDS_pept        complement(26543..27025)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40356"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVJ7"
FT                   /protein_id="CAP40356.1"
FT                   /translation="MTTAADPSKPWHVVRRSKLHGNGVFAARKIPAGTRIIEYSGKRIS
FT                   AKEADRRHPTNPDDPFHTFFFSLSSGRVIDGGDDGNDARWINHSCEPNCEAQEGRHGKR
FT                   VYITALRDIARGEELFYDYGLVLDGKITKKLKAAYQCLCGTPSCRGTMLALKKKKK"
FT   CDS_pept        complement(27107..27727)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0026"
FT                   /product="transcriptional regulator, AsnC-family"
FT                   /function="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40358"
FT                   /db_xref="GOA:A9HVK3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVK3"
FT                   /protein_id="CAP40358.1"
FT                   /translation="MAQGGEGGGVQAVIHTEYGMPFYKEDFSSFLRFPRFSSKFVFLYP
FT                   ETKKMKLDKFDLAILKALQQNSRASLNEIGAEVGLSSTPCWNRIKRMESAGVIRGYTVD
FT                   IDPASLGFMDTVIVHITLESHSEETLYEFGRALAQIPEVLEAFLVSGDYDYYIRIAVRD
FT                   TRDYERLLREQLYRIPGIRHSKSCFVLRRLKETQLPLSPPPAE"
FT   CDS_pept        27683..29494
FT                   /transl_table=11
FT                   /gene="ilvG1"
FT                   /locus_tag="Bpet0027"
FT                   /product="acetolactate synthase large subunit"
FT                   /function="thiamine pyrophosphate-requiring enzymes"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40357"
FT                   /db_xref="GOA:A9HVK0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVK0"
FT                   /protein_id="CAP40357.1"
FT                   /translation="MNDRLHASALAALRHDTPSARNGAEILLDTLIERGVDTVFGYPGG
FT                   AVLPLYDALYAEPRLRHVLVRHEQAAVHAAEGYARTTGRPGVVFVTSGPGMANTTSGLL
FT                   DAMCDSIPVLCISGQVATSAIGTDAFQECDAMGISRSVTKWNTQVRAAEDVATVVGRAF
FT                   DLTRQGRPGPVLVDFPKDVQLARPLQAEAPQALENQRLAALRARRQAGKAPLKLPQTAV
FT                   RRAAALIAQARRPVFYGGGGLVNSGPQACQAFTELVRHTGAPCTLTLMGLGAFPASDPQ
FT                   FVGMLGMHGTLEANMAMHHADLVVCIGARFDDRITGKLAEFCPHARKIHIDIDPASINK
FT                   VVRVDVALVGDCLPLIEALRGALEALPLPDGRLAGWWRRIDAWRAKDCLACPPAQDAIL
FT                   PQHLMQRLNAALAGRDAIVSTDVGQHQMWAAQYLRFDRPNRWLTSGGAGTMGYGVPAAI
FT                   GAQVAHPDKTVVCVSGDASVLMNIQELSTAMQHETPVKVVLCNNGYMGMVRQWQELIHG
FT                   GRYSHSYNASLPDFVALAKAFGWGAARVDDPARLDEALAQCLAHPGPYFLDVAVAAQEN
FT                   CFPMMPAGEGHHRMMLADGVWYEDDTA"
FT   CDS_pept        29605..30774
FT                   /transl_table=11
FT                   /locus_tag="Bpet0028"
FT                   /product="putative acyl-CoA transferase/carnitine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40359"
FT                   /db_xref="GOA:A9HVK5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVK5"
FT                   /protein_id="CAP40359.1"
FT                   /translation="MLSRALDNIRVLDLSRILAGPWCTQNLADLGADVIKVERPGQGDD
FT                   TRKWGPPYLQSRDGQEALSAYFTCCNRNKRSICLDFSQPQGQRALLKLLATCDVLVENY
FT                   KSGTLKRYGLDYDSLKALRPDLVYVSITGYGQDGPRAAQPGYDYIFQGMGGLMSHTGIA
FT                   DGEPGAGPLRAGIPVVDISTGMYATSAVLAALLQRTRTGQGAHLDIALLDVAVAINANQ
FT                   GANFLVSGRNPKRSGNAHPNLAPYEVFAARDGFFILAVGNDSQFAKFCALCDEPALAQD
FT                   PRFATNAARVQNMPALRETLSRIIATQDRAYWASGLEAAGIAWGPVNGLDEVFADEQVR
FT                   HRAMLKHASHPRFGDIPLVRNPMLGREDTSPMRAPPLMGEHTREILGEP"
FT   CDS_pept        30857..31834
FT                   /transl_table=11
FT                   /gene="bug1"
FT                   /locus_tag="Bpet0029"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40360"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVK8"
FT                   /protein_id="CAP40360.1"
FT                   /translation="MKMTFRGVAATAAALALCAAGATARAAYPDRPVTLIVPYAPGGTT
FT                   DLMARVVAPKLGELLGQTVVVVNKPGAGGAVGSGYAARERPDGYTLVMAVESSHAVNPS
FT                   VHAKPQYDPVKDFAPISNLANVLGVLDVPGDSDIKTFDQLIARLKANPDHYSFGSSGSG
FT                   GYSHLFGELFLSSTGTKMLHVPYKGLGPALVGLMADQVQVVFDNLPSSAGFLASGKLRA
FT                   LAVASPKRIESMPDVPTYAEAGYPQLNTPSWFGLAAPAGTPDAVLDQLNQAVKQTLADP
FT                   KVAADIERLGAVPDYTSREQFAGMIKRSNAVWQKVVNDIGFEKL"
FT   CDS_pept        31842..32636
FT                   /transl_table=11
FT                   /locus_tag="Bpet0030"
FT                   /product="putative enoyl-CoA hydratase"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40361"
FT                   /db_xref="GOA:A9HVK9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVK9"
FT                   /protein_id="CAP40361.1"
FT                   /translation="MAIEIPTLAHAAFSLRDDGVGTLEIRDAGKLNILSAAVVESLIAM
FT                   LAHIDQRDDVKVLVLRAEQEKAFVAGSDIKEMAFFDHASAIAYIDRLRQLCDGVRLLRA
FT                   PVIARIPGWCLGGGMELALSCDLRIASDQARMGMPEVKVGVPSIIHAALLPRLVGKARA
FT                   NWMLLTGEIADARQAEAWGLLDRVVPAAGLDAEVERVASMLAGLGQRALAQQKRLLREW
FT                   EDEPLDVSLQNGVLEFGAAFDTGEPGRYMRAFLDEKARKTGA"
FT   CDS_pept        32643..33644
FT                   /transl_table=11
FT                   /locus_tag="Bpet0031"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40362"
FT                   /db_xref="GOA:A9HVL2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVL2"
FT                   /protein_id="CAP40362.1"
FT                   /translation="MAGPPRGGPGRLFRPARNPAHTEESMSYELKDLRLFKAILQAGNL
FT                   SAGAAMMHMTAPSASYRLKNLEYAAGSPLFVRSARGMSLTPAGEALARHVDIVLDDLQA
FT                   MQTEVSAYARNLKGSVRLLANSSSLNGFIIPSLARFLISNAHIDVNLKEQDSLSIAGKI
FT                   QRGEADIGICAGKVDDADLRCELYAIDRLVCAAPADHALAQRASVAYAEVLAHGQVCMD
FT                   RASSNFHFVQTQAERLGKSVSVRVHAHDFSSVLYLVSAGVGVAVVPASVAEPLAREGAI
FT                   MAIALQDGWALRDLHLVTRQDAEPSGLVRQFAEVLLHDPQVVAARTGKNWRE"
FT   CDS_pept        complement(34159..35595)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0032"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /function="NAD-dependent aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40363"
FT                   /db_xref="GOA:A9HVL5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVL5"
FT                   /protein_id="CAP40363.1"
FT                   /translation="MKQHFIDNRAVPGSSGESIPVLDPSTGQQYDSIARGNATDIDLAV
FT                   QAARRAYDEGAWGRLTAAERGRLMLKLSVKILDCADELTDIESRDCGKPTKQARADVTA
FT                   VARYFEYYGGAADKLHGETLPYQNGYTVLTLREPHGVTGHVVPWNYPLQIFGRSVGGAL
FT                   AAGNACVVKPAEDACLSLLRLAELAAEVGFPPGAINIVTGYGHEAGDALTRHPGIDHIS
FT                   FTGSPRIGVLVTQVAAERHVPVTLELGGKSPQIVFGDADLDALVPVAVNAIVQNAGQTC
FT                   SAGSRLLVERSAYDRVLERLSQAFSALRAGPATMDLDCGPLIRKTQQERVQNFLKAAAQ
FT                   DGIATAAQGKIADGAPAEGYYQAPTLLDNVPVDHRLAQEEVFGPVLAAIPFDDEADAVR
FT                   IANATEYGLAASVWTRDGARQLRIARKVRSGQVFINNYGAGGGIELPFGGVKASGHGRE
FT                   KGFEALYGFTVLKTISIKHD"
FT   CDS_pept        complement(35666..36457)
FT                   /transl_table=11
FT                   /gene="idnO"
FT                   /locus_tag="Bpet0033"
FT                   /product="gluconate 5-dehydrogenase"
FT                   /EC_number="1.1.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40364"
FT                   /db_xref="GOA:A9HVL9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVL9"
FT                   /protein_id="CAP40364.1"
FT                   /translation="MTAVPPTQAYLQQFSLAGQVALVTGSARGLGLCIARALAGCGAHV
FT                   LINGRNAESVQSTVAMLRNDGLAASALAFDVSDDEAMSRAYARIDAEHGRLDVLVNNVG
FT                   ARNRKTLQAISPAEIRALIDTDLVAGMLLAKLAAERMVRQGSGRLIAITSVAGELARAG
FT                   DAVYPAAKQGLTGMMRALAAEFGPLGITSNAIAPGTFATETNAAYVADPAVHDPMAARN
FT                   PMGRWGRPEEIAGAAVFLASPAASYVNGQVLAVDGGLSILF"
FT   CDS_pept        complement(36469..39075)
FT                   /transl_table=11
FT                   /gene="topB1"
FT                   /locus_tag="Bpet0034"
FT                   /product="DNA topoisomerase III"
FT                   /function="topoisomerase IA"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40365"
FT                   /db_xref="GOA:A9HVM2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVM2"
FT                   /protein_id="CAP40365.1"
FT                   /translation="MSKTLIIAEKPSVALDISRALGGFAREGDYFESERYVLASSIGHL
FT                   LGLVAPNDPVKGKWSFAHLPVIPPEFALGPADKRSAERLKLLVKLAKRKDVDALINACD
FT                   AGREGELIFRYIIQYAGVKKPIKRLWLQSMTQAAIREAFSNLRDDAQLKPLEAAARSRA
FT                   EADWLVGINGTRAMTAFNSKDGGFFKTPVGRVQTPTLAIVFEREERIRAFVPRDYWEVH
FT                   ATFVAAAGLYQGRWIDPDFKKDERDPEKRESRLWSQAAAQSVVAACREQPGSVTEESKP
FT                   STQMSPALYDLTSLQRDANGRFGFSAKTTLALAQTLYERHKALTYPRTDSRYLPEDYLG
FT                   TVRDTMQALAKGGSNAVGQLSRHADTIVAQSWVKPNRRIFDNKKVSDHFAIIPTLQIPH
FT                   DLSEAEAKLYDLVLKRFLAVFFPAAEYRVTTRITEVQGHRFKTDGKVLVAPGWLAVYGK
FT                   EAQGEDANLVPVADNETVRTEDVEAVGLSTKPPARYNEATLLSAMEGAGKLVDDEELRE
FT                   AMSERGLGTPATRAGIIEGLLGEGYLRREGRDLVPTAKARQLMTLLSGLDVTELTSPEL
FT                   TGEWEHKLKQIEQGGLDREAFMREIAQMTQVIVKRAKEYERDTVPGDYATLQTPCPKCG
FT                   GVVKENYRRYACTQCDFSIGKHPGGRTFELPEVEELLAKREIGPLQGFISKMGRPFAAI
FT                   LRISDEYKLEFDFGQNDDDDSEPVDFSGHTPVGACPKCSSRVFEHGLSYVCEKSVGPDK
FT                   TCDFRSGKIILQQEISREQMHKLLTDGRTDLLDGFVSSRTNRKFKAFLVRQPDGKVGFE
FT                   FEPRAAKTGRAPAKTASKTATKTATKTATKAASKTAAKKAAPRKTAAKKAPAKKSA"
FT   CDS_pept        39138..41744
FT                   /transl_table=11
FT                   /locus_tag="Bpet0035"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40366"
FT                   /db_xref="GOA:A9HVM5"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="InterPro:IPR025513"
FT                   /db_xref="InterPro:IPR025833"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVM5"
FT                   /protein_id="CAP40366.1"
FT                   /translation="MQVGPTGHAGSELHAWRQFLARGTLWLGVWLLGSAVICWVAANWQ
FT                   DMSKFQRFAGAQALLAVCVLAAAWAGWRLRAATGARRHAPGALLALAGLLLGALLALLG
FT                   QTYQTGADTWELFAWWAALLLPWALVAASQAVWLLWVVVVNVAALLYLGAFGGLFWWAI
FT                   GPGLPTLLLAALNLLLLAAWECAAWRWRAGTRVGPRVLAALIIGTLVLALTFGDSVLRG
FT                   LGSITGAAWVAVTLGLGYYYQRARRDLLILAMLAAGAICVSMRLAGEWLLNLEPGVWAI
FT                   LPLAGLLMAEAVWAARWLRRLAAELPAGRALADAEPAGASAGNAVAPADPGTPVAGLAD
FT                   PDAEPQLGPAWYVQGLLGLSAWLATLLLLLFLAVSGLVQTQQGAMVMGLVLCAAAVAVL
FT                   RTDAGPFWRQCATAMGFAGQILVAFGLSQSASLSSACAFVLLLGVAVYALAPDALLRFL
FT                   SAWMIALALAGLIWLGLVPGLMNDGLLDMWLDFDTVRATFVWLPVAVAGAWTAAAAFCV
FT                   GHRLARTRPNVLLPLAWAFVLAVQGMVWMAGGVSLTQLPVIWQLNPVTALLTVAAVLLP
FT                   VACALAVLWPRRRLLTAGVLWGVPLGLLALALCWLPSPGIAFALAWMLLGFGLNRSRLT
FT                   IFGGLSLLAYLVVYYYQLQVPLLDKALWLGGAALLMFFLRALVWLVPRLMRTAEQPSAA
FT                   MTGPAPAALRWRTAVVLGGLALVLAVVNGAIWQREAVLANGRIAILELAPVDPRSLMQG
FT                   DYMALRFAAGNEVMQRLAADPEAAPVPDGYVVLVPDGDGVARVARIQASAQPHASQEIA
FT                   LRYRMRSGQVRIVTNAYFFPEGQADRYAAARYGEVRVGEDGTGLLVRMLGADRQPL"
FT   CDS_pept        complement(42051..43034)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0036"
FT                   /product="IS1663 transposase"
FT                   /function="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40367"
FT                   /db_xref="GOA:A9HVM8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVM8"
FT                   /protein_id="CAP40367.1"
FT                   /translation="MFFLGIDVSKAKLNCALVGAEGDKRKTKVVANTVAGIQALLGWCA
FT                   KQGAQPEQLHVVLEPTGPYHEQAGTALHEAGATVSMINPAQARDFAGALAVRTKNDELD
FT                   SYVLARYGQALCPPAWQPAPLHARQLRALLARHEALAKDLQRELNRQEKAQFGQSPEPV
FT                   TGSIDKSVAFLTEQIKRLERAINDHIDRHPDLKEDRDLLTSIPAVGPQTGNALLSIMHN
FT                   RRIESPQALAAYLGLVPVQRQSGTSLNGRPRLSKTGPARVRATLYMAAVVAVRHNPHIQ
FT                   ALYARLLAAGKSKMAALGAAMRKLAHLCFGVLKNRTPYRSDYALPA"
FT   CDS_pept        complement(43321..44196)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0037"
FT                   /product="probable aminoacyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40368"
FT                   /db_xref="GOA:A9HVN1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVN1"
FT                   /protein_id="CAP40368.1"
FT                   /translation="MSYVGRFAPSPSGPLHLGSLVAALASWLDARAHGGRWLLRIEDVD
FT                   TPRTVPGAAGIIMDQLRALQLHWDGDILWQSQRGPAYQRAFDALAARGLVYGCGCTRRE
FT                   IADSSLRGAAPGADGERPYPGTCRHGLPPGRQARAWRLRVPAGMETFTDRWLGPQQQDV
FT                   AQAVGDFALRRADGLWAYQLAVVVDDAEQGVTDIVRGADLLSSTARQRVLARLLGFPAP
FT                   RVMHVPLITDPATGLKLSKQNSAPPLDTTQPLAMLAQAWQALEFPPCPADTPAAFLTQA
FT                   TARWATRFGP"
FT   CDS_pept        complement(44200..44658)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40369"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HVN4"
FT                   /protein_id="CAP40369.1"
FT                   /translation="MFDILVYLFENYYTPQACPAADVLAKRLAAAGFEHEDIDDALGWL
FT                   YGLAETTERCVDLAQAPSSGIRIYTDSEYQQLGTESIGFIAFLESAGVLPAPLREIVID
FT                   RALAAPETPVSLAKTKIIALMVLWSQEAEIDNLVLEELLDDDGARRLH"
FT   CDS_pept        complement(44854..46878)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0039"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /function="TRAP-type uncharacterized transport system fused
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40370"
FT                   /db_xref="GOA:A9HVN6"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVN6"
FT                   /protein_id="CAP40370.1"
FT                   /translation="MEIDHEQTQKLAEKFDSEIRFRPLAKTATWIVSILLVSLSLFHYY
FT                   TAGFGLLREATHRGVHLAFVLSLIFLVFGFSKAHYQREPRSTFLAPGGVPLYDWIIAIA
FT                   LAFSVLYIPYIFEDLAFRVGNPLPLDVFMGTILIVGLLEGTRRAMGWPLPIIALVFLAY
FT                   AAFGPIFPGLLKHAGNSWPQIVNHMYLTSQGIYGVAVGVVATYVFHFVLFGVLASRIGL
FT                   GQLFLDVASTLAGRYAGGPAKVSVFGSAMFGMLSGSSVANAVTVGSLTIPAMIRIGYPR
FT                   HFAAGVEAASSTGGQITPPIMGAAAFLMIEFLDIPYQQIIVAGIFPAFLYFFGMFMQVH
FT                   FEAKREGLRGLRADEMPNLRDSFKRRWPTLLPLVGLIAVLASGRTPYLAAFTGITGCIL
FT                   VGLLNPYQRLKLRDLYDSFETGAKYALAVGAAAGTVGLVIGVVTLTGVGFKVSYIVISA
FT                   AQAIAGGVGAVIPDIIANTQTLTLIAALVMTGIVCILMGCGIPTTANYLIMVAVAAPTL
FT                   VQLGVQPIAAHFFVFYFGILADITPPVALAAYAAAGMAGSDPFKTGNTAFRLGITKLIV
FT                   PFVFVFSPSLLISVQGFSWYAFFLTLLGCMIGLVLLSAALSRYLLVTLKPWERWVCVVG
FT                   ALLTIIPGLGSGLVGLAVCIPVFIRQLTQFKAEKTLPAA"
FT   CDS_pept        complement(47122..48081)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0040"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /function="TRAP-type uncharacterized transport system
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40371"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVN9"
FT                   /protein_id="CAP40371.1"
FT                   /translation="MSFKNWIKTLTVALAVAGAVGPAHAQQFFRIGTGGTAGTYYPVGG
FT                   MIANAISQPGKLIATAVASNGSVANINGILGGSLEAGFTQSDVAYWAFTGTGTFDGKPK
FT                   AENLRLIATLYPESIHLVARKGAGIKSVADLRGKRVSMDEPGSGTLVDVRLILGAFGMT
FT                   DKDIDAEYLKPNQAGDKLKDGGLDAFFFVGGAPAGAIAELASSGAGIELVPIVGPEIDK
FT                   LRSQQEFFTPDTIAAGMYQGIGEVKTISVNAQMVTSTKLSEQTVYDITKALYSDATRKV
FT                   LDNGHAKGKLITKENAVKGAGIPFHPGAEKFYKEAGLL"
FT   CDS_pept        48260..49399
FT                   /transl_table=11
FT                   /locus_tag="Bpet0041"
FT                   /product="putative amino acid aldolase or racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40372"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVP2"
FT                   /protein_id="CAP40372.1"
FT                   /translation="MANPPAASVPALPPAAAPGDPLARVDTPSLVLDLDAFESNLRQMQ
FT                   AWADRHGVALRPHAKAHKCPEIARRQLALGARGICCQKVSEALPFVAAGIDDVHISNEV
FT                   VGAAKLALLAQLARAARVSVCVDDAGNLADISAAMARAQAQVEVLVELDVGQGRCGVPD
FT                   AAAAVALARQAQALPGVTFGGLQAYHGSVQHVRGHAERAAVAARAAQAAAECARQLRAA
FT                   GIPCDRITGAGTGSAEFDAASGVYTEMQAGSYAFMDGDYGANAWSGPLAFRHSLFLLAT
FT                   VMSMPAPGRAVVDAGLKSTTIECGLPQVAGGAGLQYAAANDEHGVLKVAADAALRLGDT
FT                   LLLIPAHVDPTFNLHDSLVAYRDGVVEGVWDISARGLSR"
FT   CDS_pept        49497..50690
FT                   /transl_table=11
FT                   /gene="argM1"
FT                   /locus_tag="Bpet0042"
FT                   /product="succinylornithine transaminase"
FT                   /function="ornithine/acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40373"
FT                   /db_xref="GOA:A9HVP5"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVP5"
FT                   /protein_id="CAP40373.1"
FT                   /translation="MEFSQFNVNALMEITSRPDLVFVRGQGSWLEDHAGKRYLDFVQGW
FT                   AVNTLGHCAPEMKRALVEQADKLMNPSPAFYNQPSIDLSLRLTGASCFDRVFFANSGAE
FT                   ANEGAIKLARKWGRVKRNGAYKIITMNHGFHGRTLATMSASGKPGWDTMYAPQVEGFPK
FT                   AELNDLDSVRALIDAQTVAIMLEPVQGESGVIPATPEFMKGLRQLADEHQLLLIVDEVQ
FT                   TGMGRTGSLFAYQQFDVVPDIMTLAKGIGGGVPLAALLARQEVCVFAHGDQGGTYNGNP
FT                   LMTAVGVAVFDTLAAPGFMDTVRARAQQLSEGLLALSAKWGMGGERGMGLLRALILDRE
FT                   DGPAVVEAARKLEPQGLLLNAPRGNLLRFMPALNVSEQEIAQMLSQLDGVIGALRKS"
FT   CDS_pept        complement(50942..52600)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0043"
FT                   /product="AMP-dependent synthetase and ligase family
FT                   protein"
FT                   /function="Acyl-CoA synthetase (AMP-forming)/AMP-acid
FT                   ligase II"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40374"
FT                   /db_xref="GOA:A9HVP8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVP8"
FT                   /protein_id="CAP40374.1"
FT                   /translation="MTTPFDDELPRNAANHVPLTPLGFLQWAAEVYPQRPALVHGNRSQ
FT                   SWRATQQRCRQMAAALRAWGVQRGDVVAVLAPNIPALYEAHFGVPMAGAVLNALNTRLD
FT                   AATLAFILEHGRATVLLFDSEYASLVQDVLGRLAAPPRTVRIEDAEYTGEHGTLGDAEY
FT                   ETWLAAQPPDAAWDWPADEWQSICLNYTSGTTGNPKGVVYHHRGAYLNATGNVLACGMP
FT                   PHAVYLWTLPMFHCNGWCFPWTLAALAGTNVCLRRVEPAAIFDAIRRYRVGYFCAAPVV
FT                   LNMLINAPSQVQHRATHRVQALTGGAAPPAAVIEAMEQLGVGVTHLYGLTETYGPSVSC
FT                   AWHDEWDELPLAERAALKARIGVRKLNVEHVQVVDDRLQPVPADGATLGEIVLRGNTLM
FT                   KGYLHNPGATAEAFAGGWFHSGDLGVVHPDGYIEIKDRAKDIIISGGENISTVEVESVL
FT                   YRHPDILEAAVVARPDPTWGETPCAFVTLKDGAHCTADDVLRHCREHLARFKVPRTVVF
FT                   GPLPKTATGKIQKFVLRGQAAALGSRANTDPQSGA"
FT   CDS_pept        complement(52597..53676)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0044"
FT                   /product="putative aminoglycoside phosphotransferase"
FT                   /EC_number="1.3.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40375"
FT                   /db_xref="GOA:A9HVQ1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVQ1"
FT                   /protein_id="CAP40375.1"
FT                   /translation="MNAPGHRPETQPGAQPEWLPALTAYLAARGLADSTGLRARPLAGG
FT                   QSNPTFLLEDAHGLRVLRKQPPGTLLPSAHAVDREYRVMSALADTAVPVPRMLHYCEDR
FT                   AVIGTPFYLMSYAQGRVFMDPALPGLAPAERGAIYAEAGRVLAALHAVAPGEIGLGDYG
FT                   RAGDYFARQVARWTRQYRDTSTGAIPAMDALIDWLPRHLPADDGQVCLVHGDYRIDNLV
FT                   FAADAPRAIALLDWELSTLGHPLADLAYHCMCWRIPPSLWRGIAGLDLPALGIPDEAAF
FT                   VAAYCRARGIAAPANWDFYLAYSFFRIAAILQGVYARAQAGNAAAADAREMGARVAPLA
FT                   ELGWQAARRESAPWPEPSR"
FT   CDS_pept        complement(53673..54899)
FT                   /transl_table=11
FT                   /gene="acd1"
FT                   /locus_tag="Bpet0045"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40376"
FT                   /db_xref="GOA:A9HVQ4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVQ4"
FT                   /protein_id="CAP40376.1"
FT                   /translation="MDFSLPPELEDYRSRVRRFVDEELIPLEADPGNFDDHENIAEPVL
FT                   ARARAKVREAGLWALQMPRERGGQGLPMVGLAACYEEMNRSIFGPVCFNAAAPDDGNMR
FT                   VLAQVARPDQKDRWLQPIIDGKVRSSFVMTEPSPGSGSDPSMMRTTATRQGDKWIVNGR
FT                   KWFITGAGVARHFILIARTSDDARKGLSAFLFDAAQPGWRIERRIPIMGPEEHGGHCEL
FT                   IFDGLEIPDENRLMEVGDGLKLTQIRLGPARLTHCMRWLGLARRAMAVAVDYVGQRSSF
FT                   GLKLAEREGVQWLLGDAAMQIEIGRLLTMRAAARLDQGDYARKEISMAKIVVSETLHKV
FT                   VDTALQLNGARGYSKDTPLEWIYRYARQARLVDGASEVHKMVLARYLMDEGDAYWRWDD
FT                   ADAPRKALV"
FT   CDS_pept        complement(54949..55710)
FT                   /transl_table=11
FT                   /gene="kduD1"
FT                   /locus_tag="Bpet0046"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40377"
FT                   /db_xref="GOA:A9HVQ7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVQ7"
FT                   /protein_id="CAP40377.1"
FT                   /translation="MFEDLKSKTALVTGAYSGLGRHFAGLLAGAGARVALCGRRTELGH
FT                   EVAEAIRQQGGQACVVPMDVTRPDSVQAAIDAAASELGPLDIVINNAGVALSEPALDIS
FT                   EQAWTGLIDVNLNGAWRVAQASARHFRAQGRPGSIVNIASILGQRVASHVAPYAAAKAG
FT                   LLHLTRALALEWARHGIRVNALAPGYIATDLNREFFASPAGEALIKRVPQRRLGQPQDL
FT                   DGPLLLLASDASAFMTGSVIDVDGGHLASSL"
FT   CDS_pept        complement(55729..56094)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40378"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVQ9"
FT                   /protein_id="CAP40378.1"
FT                   /translation="MHVSLRRVAHTRSGDKGNTSNIAVIAYEPAFYPYIKQAVTVDALR
FT                   TIYNETAVRGAITRYEVDGLGVLNFVLEGALGGGVSRSLAIDNYGKALASAVLRLELEV
FT                   PDTLAPLLRGPKTDQGQ"
FT   CDS_pept        complement(56130..57488)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40379"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVR2"
FT                   /protein_id="CAP40379.1"
FT                   /translation="MTHKTGTLRIGSGAGWWGDRIDPARWNAERGALDFLCFETMAEAT
FT                   VSAAQVRKRRDPAFPGYDTWLDDRMRAVLPHCMANGTRIVSNQGWIHPLAAARRVAELC
FT                   AEAGWKHARVAAVSATDLSGSIGTSGLAIMESGAPVASVADTLISAEPYAGAEAIVRAL
FT                   DQGADIVITGRVADPSLFLAPMMHHFGWRADDWARLGQGSGIGHLLECGAQVTGGYFGD
FT                   PGYKDVPDPWNLAFPYADVEADGTAEIGKVDGTGGCIDLRTVKEQMFYEVHDPARYITP
FT                   DVVVDFTTARLEQAGPDRVRVGGISGRPRTDTLKVSMGCTEGYIGEDMFFFAGPGCLDK
FT                   ARLAETILRERLRLAGLQADDLRIDFIGANAVHGAASAAPACEPVEIAVRIAARCATRA
FT                   QAEKIGREVDGMAVCGLACTGKRVPHQDRVREVIGLWSTLVPRASVDCTIEFV"
FT   CDS_pept        complement(57518..58495)
FT                   /transl_table=11
FT                   /gene="bug2"
FT                   /locus_tag="Bpet0049"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40380"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVR4"
FT                   /protein_id="CAP40380.1"
FT                   /translation="MRGYPLLLATALALPLASMAHAEPAPAWPARPITLVVPFPPGGTT
FT                   DLLARLVAHAAGSRLGQNVVVENRPGAGGGIGAAAVARAQPDGYTLVMGTLGTQVTNQF
FT                   IYKQVPYDPARDFAPVTLVANSPNVLLANPQLGIGTVAQLIERARREPGQLNFASTSLG
FT                   GSPHLSGELFNGLAKVDIRHVPYKGSAPAMTGLLGGQVQIMYDNLPSAMGQIRAGAVRA
FT                   LAVTTSTRVPLLPDVPTVAEAGLPGYEVNAWFGLLAPAGTPAAVVARTQSAVAEALAEP
FT                   DTRRQVENLGAIPVAGTPQAFSDTIRADTEKWRQVISRAGIQPQ"
FT   CDS_pept        complement(58521..60635)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0050"
FT                   /product="Acyl-CoA synthetase"
FT                   /function="Acyl-CoA synthetase (NDP forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40381"
FT                   /db_xref="GOA:A9HVR7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVR7"
FT                   /protein_id="CAP40381.1"
FT                   /translation="MALAQPRRNSLDRLLDPASIAIVGASDNPDKIGGRPIYYMRQQGY
FT                   AGTLYPINPQRAEVQGQRAWPTLDALPAAPDLAIVAVAGEQAVQAVDRCAELGVAAAIV
FT                   ISAGFAETGDAGRALQDAMMARARAAGMRIVGPNSQGLANFGNGAIASFSTMFLEVAPA
FT                   DGPVAVLSQSGGMGAMVYGLLRQRGLGVRHVHATGNEADVTVAELACAVLRDPEVRIVL
FT                   LYLESLQDAGALAEAAAMASARGVPLIAVKSGRSEAGARAAASHTGAMASEDRAVDAYF
FT                   ERHAILRARDPQELVRFAELALRGPLPRGPRMVAVSNSGASCVLASDAAVERGLQIAPL
FT                   AETTRQQLDGLLPGFASTANPVDITAALLSNNGLFGQVLPVIASDPAADMFLIDIPVAG
FT                   RGYDVATFAADTAGFAAAAARPVAVVAWQDDVAAAFRARGVAVYADEQQAADAMAALYR
FT                   LHRWRSRAPVCWPDAAPFSLPSARQPFLSEAQSLALLAGQGLAVAEHARCTDADAAVAA
FT                   WRAIGAPVALKACSARLPHKSEHGLVALGLDDEQALRAALARQAQTLGKLRIDDAEWIV
FT                   ARMHAGLHECALGVRHDPVFGPVVMVGSGGKYVEAMQDVALLLPPFSVDEVIGKLQDLR
FT                   IGKLLAGVRGDPPADMRALAEQAVLLGRCALAARGSLASIDINPVLVGARGQGAVAVDA
FT                   LVELAAPAAP"
FT   CDS_pept        complement(60675..61646)
FT                   /transl_table=11
FT                   /gene="bug3"
FT                   /locus_tag="Bpet0051"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40382"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVS0"
FT                   /protein_id="CAP40382.1"
FT                   /translation="MPAIPVWRAALAAIVLAANTAAAAATWPDKPVTLVVPYPPGGPTD
FT                   IVARTVAQGLGDELGQTVIVDNRSGAGGNIGADMVAKSAPDGYTLLLATTAHAINMSLF
FT                   KNLGYDTRKSFAPISLLTKGPLVIVTRPDLPAQNVRELIALAKASPGKLTFASSGNGQS
FT                   THLSAELFNTMAGTRMVHVPYRGSAPAMTDVMGGQADIMFNTMLSSMPYVKDGKLRALA
FT                   VTSAARSPAAPDVPTVAESGLDGYEATAWNGLMAPAGTPDAVVQKLSAALQKVLGRPDL
FT                   QKQFAQQGFDADWMTPAEYGQFLDDEIRKWAEVVKVSGATVN"
FT   CDS_pept        complement(61717..62085)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0052"
FT                   /product="protein of unknown function DUF35"
FT                   /function="putative nucleic-acid-binding protein containing
FT                   a Zn-ribbon"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40383"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVS3"
FT                   /inference="ab initio prediction:Glimmer/Critica"
FT                   /protein_id="CAP40383.1"
FT                   /translation="MSTNPINHPERDRHPLDLQRCDDCGAWWALRPYACASCGGTALRW
FT                   RRAEGAGTVIARSEVHRAPDARWRALAPYVLVLVRLRENVTLMGHADAGIAIGQAVSGR
FT                   AAELNGHVLLTFEACRPP"
FT   CDS_pept        complement(62082..63236)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0053"
FT                   /product="putative thiolase"
FT                   /function="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40384"
FT                   /db_xref="GOA:A9HVS5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVS5"
FT                   /protein_id="CAP40384.1"
FT                   /translation="MRNGDCRRAYVQAAATTRFGRHEGMSALDLMAEAANRALAQSGLA
FT                   RADIDGVLCGYATTFPHLMLGTLLSEKLGLDPCYAHGMQMGGATGAAMVMLARELLRAG
FT                   TCRRILVVAGENRLTGQAVDTSIQTLAQVGEADTEVPNGASVPAYYALLASAYMHHTGT
FT                   RRDAMAGFAALMRHNAAGHPHAHLREPITVEQVLASRPIATPLHLLDCCPISDGAAALV
FT                   LSVDEGPVQVTGGGQAHRHQHLSAMRDVLDTGAARACARALAEARVDASQIDYLAIYDS
FT                   FTITLIMLLEELGYAPRGGAGARLQRGDFAATGPLPLNTHGGLLSFGHSGVAGGLAHVV
FT                   EACTQLAGRAGERQIAPRRRALVHADGGVLSAHVSLVLQAEGAA"
FT   CDS_pept        complement(63229..63999)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0054"
FT                   /product="transcriptional regulator, IclR family"
FT                   /function="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40385"
FT                   /db_xref="GOA:A9HVS9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVS9"
FT                   /protein_id="CAP40385.1"
FT                   /translation="MPTPDVTTVSATKKTCRVLASLSDRRVHRLTDIAQSAALDISTAR
FT                   RILKDLEAEGFVERDPVSKHYMLGPQVYAMHHAMVDGLDVRALARPALIRLARRFGDTV
FT                   ILSLPMGWESVCLDLCFGDYPIRANYLEVGSRRPLGVGAGSLALLSTLDESESRAVLPM
FT                   VRQRLAIKYPRYPERDLDLATQRARALGHAMLLDVVVEKMGGLGVAVRGPSGRAIAALS
FT                   VAALNERIESREQELAQALSHEAREIERAWLPHA"
FT   CDS_pept        complement(64163..66196)
FT                   /transl_table=11
FT                   /gene="accA1"
FT                   /locus_tag="Bpet0055"
FT                   /product="putative biotin carboxylase subunit of
FT                   methylcrotonyl-CoA carboxylase"
FT                   /function="biotin carboxylase subunit of acetyl-CoA"
FT                   /EC_number="6.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40386"
FT                   /db_xref="GOA:A9HVT1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVT1"
FT                   /protein_id="CAP40386.1"
FT                   /translation="MTHMFDTLLIANRGEIACRVAATARRLGIRTVAVYSDADAGARHV
FT                   AACDVAVHIGGPEPRASYLRADAILQAARDTGAQAIHPGYGFLSENEAFAQAAADAGIA
FT                   FVGPPASAIAAMGSKSAAKALMEKAGVPLVPGYHGDNQDPQFLKTQADAIGYPVLIKAS
FT                   AGGGGKGMRVVESADAFLEALASCQREAASSFGDDRVLIERYLQKPRHIEIQVFADTHG
FT                   NCVYLFERDCSVQRRHQKVIEEAPAPGMTPERRQAMGEAAVAAARAVGYVGAGTVEFIA
FT                   EPDGRFYFMEMNTRLQVEHPVTEMITGHDLVEWQLRVAAGQPLPAAQQDLRIHGHAIEA
FT                   RIYAENPDKGFLPSIGRLAYLELPPHAAFANGEVRVDGGVRMGDAITPYYDPMIAKLIV
FT                   HGADRDQARARMIQALAHTHAVGVQTNVAFLTRLMQDDAFAAADLDTGLIERRRQTLLP
FT                   PPAAADTTALALATAAVLVRQGLAQSGSQAAKPATDPWDVRDGWRLGERYAQAVQWQDG
FT                   DTLRDVTVARDGKAWTLACAGAPQAFSWRSNASANPNLAYGLRIVLDGRESAGTVVLHD
FT                   DKAYVFREGRTQVLVLHDALAHAQDDQADHAGGLTAPMPGKIISIAVRAGDSVSRGQPL
FT                   LVMEAMKMEHTISAPADGKVQEVFYAVGDQVAEGAELVAIGA"
FT   CDS_pept        complement(66218..67825)
FT                   /transl_table=11
FT                   /gene="accB1"
FT                   /locus_tag="Bpet0056"
FT                   /product="putative methylcrotonyl-CoA carboxylase subunit"
FT                   /function="Acetyl-CoA carboxylase carboxyltransferase
FT                   component (subunits alpha and beta)"
FT                   /EC_number="6.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40387"
FT                   /db_xref="GOA:A9HVT5"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVT5"
FT                   /protein_id="CAP40387.1"
FT                   /translation="MPTIESRINPRSQDYADNARAMQAQLDDLARQLAQTALGGSESAR
FT                   AKHVARGKLLPRDRVERLIDPGSPFLELSPMAAHGMYDGAAPGAGVITGIGRISGTECV
FT                   IVCNDATVKGGTYYPMTVKKHLRAQEIAAQNRLPCVYLVDSGGANLPQQDEVFPDRDHF
FT                   GRIFYNQAVMSAQGIAQIAVVMGSCTAGGAYVPAMSDESIIVRNQGTIFLGGPPLVKAA
FT                   TGEEVSAEDLGGGDVHTRLSGVADHLAANDLHALQLARNAVARLNLRKPAQLALAPVRE
FT                   PRYDPAELNGIIPADTRKPYDVREIIARIVDGSDFDEFKARFGTTLVTGFAHIHGMPVG
FT                   IVANNGILFSESAQKGAHFIELCAQRKIPLVFLQNITGFMVGRKYENEGIARHGAKMVT
FT                   AVATANVPKFTVLIGGSFGAGNYGMCGRAYSPRLLFMWPNARISVMGGEQAASVLATVR
FT                   RDGIQAKGGQWSAEEEEAFKAPIRAQYEHEGHPYYATARLWDDGIIVPADTRRVLGLAL
FT                   SAALNAPIEDTRFGVFRM"
FT   CDS_pept        complement(68009..69190)
FT                   /transl_table=11
FT                   /gene="fadA1"
FT                   /locus_tag="Bpet0057"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /function="Acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40388"
FT                   /db_xref="GOA:A9HVT7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVT7"
FT                   /protein_id="CAP40388.1"
FT                   /translation="MSDPVVIVSVARTPMGGMLGSLSSLAAHELGSVAIKAAVERAGLK
FT                   PEQVDEVIMGNVLQAGQGQAPARQAALGAGLPLGVGCTTIHKVCGSGLKAAMFGHDLLV
FT                   AGSARVVVAGGQESMSNAPYLMLKGRQGYRYGHATVYDHMALDGLEDAYDRGKAMGVFA
FT                   EDCAAKYSFTREQQDEYSLESLRRARAATEDGSFKWEITPVTVAGRKGDTVVDTDEAPT
FT                   KAMPEKIPTLKPAFKKDGTVTAANSSSISDGAAAMVLMRASTAEELGLKPLARIVAHSQ
FT                   HSQEPGWFTTAPVGALKNLFTKTGWKAEDVDLYEINEAFAVVAMAAMHDFKLPHEKVNV
FT                   HGGATALGHPIGASGARLVATLVGALRQKGGKRGVATLCIGGGEAVAMAIEMM"
FT   CDS_pept        complement(69224..71062)
FT                   /transl_table=11
FT                   /gene="aceK"
FT                   /locus_tag="Bpet0058"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /EC_number="2.7.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40389"
FT                   /db_xref="GOA:A9HVU1"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVU1"
FT                   /protein_id="CAP40389.1"
FT                   /translation="MIYSGDVQRIEQAPAPPPQPQEVARQILAGFDRHYALFRYSAQRA
FT                   KALFESGDWHGIQRLSRERIEYYDMRVRECAAQLRQVLRDSAAPEAAVSLTPAQTAFWQ
FT                   DVKQQFVGLLAGHRQPECAETFFNSVSCRILHRDYFHNDFLFVRPAVATDYLDSRIPSY
FT                   RVYYPLTEGLRKSLIRMVADFGLAAPFADLPRDTRLLARAAVRQLRAQWPRQPGQRVAS
FT                   DCQVQVLGSLFFRNKGAYIVGRLINQSTVHPFAVALARNAAGQIELDALLLGADDLSTL
FT                   FSFTRAYFLVDMETPAAVVSFLSSLLPRKPKAELYTMIGLQKQGKTLFYRDFLHHLAHS
FT                   RDAFDIAPGIKGMVMCVFTLPSYPYVFKLIKDRIDKDGIDHATVRRKYQMVKLHDRVGR
FT                   MADTWEYSQVALPRARFAPALLDELRQRVPSLLEENGDTVVIRHVYIERRMTPLNLYLQ
FT                   RAPEPLLDQAVREYGDAIRQLATANIFPGDMLYKNFGVTRLGRVVFYDYDEIQRMTEMQ
FT                   FRRIPPAPNEEAEMASEPWYAVGPNDVFPEEFDRFLLGDPRVRRAFLRHHADLLEPEWW
FT                   QACRAHVAQGRIEEFFPYDTDRRLRPGSAPHRVAAS"
FT   CDS_pept        complement(71084..72262)
FT                   /transl_table=11
FT                   /gene="ivd"
FT                   /locus_tag="Bpet0059"
FT                   /product="putative isovaleryl-CoA dehydrogenase"
FT                   /function="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.10"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40390"
FT                   /db_xref="GOA:A9HVU3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVU3"
FT                   /protein_id="CAP40390.1"
FT                   /translation="MNLPGLNFDLGEDLDMLRDAVRTFAQAEIAPRAAEVDRSDQFPMD
FT                   LWRKFGELGVLGMTASEEYGGANLGYLAHMVVMEEISRASASVGLSYGAHSNLCVNQIH
FT                   RNGTAEQKARYLPKLISGEHVGALAMSEPGAGSDVVSMKLRADKKGDRYVLNGTKMWIT
FT                   NGPDADTLVVYAKTDPAAHQRGITAFLVEKNFKGFSVAQKLDKLGMRGSHTGELVFQDC
FT                   EIPEENVLGQVNGGVRVLMSGLDYERAVLSGGPLGIMQAVMDVVVPYIHDRKQFGQAIG
FT                   EFQLIQGKVADLYTTLQASRAFCYAVGKNLDQLGAEHVRQVRKDCAALILYTAEKATWM
FT                   AGEGVQILGGNGYINEYPTGRLWRDAKLYEIGAGTSEIRRMLIGRELFAETA"
FT   CDS_pept        72520..73698
FT                   /transl_table=11
FT                   /locus_tag="Bpet0060"
FT                   /product="putative hydrolase"
FT                   /function="metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /EC_number="3.5.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40391"
FT                   /db_xref="GOA:A9HVU6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVU6"
FT                   /protein_id="CAP40391.1"
FT                   /translation="MIELADLDEIVALRRDIHAHPELAYDEHRTAGLVAERLRAWGIET
FT                   HTGIGRTGVVGVLKAGSGDRAILLRADMDALPIQEANEFGHRSRHDGKMHGCGHDGHTA
FT                   MLLAAARHLQQAGGFNGTVYVAFQPAEENGGAGARAMIEDGLFERFPCEAVFGMHNWPG
FT                   LPAGSFGVCSGPMMSAANAFKITVTGRGGHAAAPHDCDDPVPAVLAIGQALQTILTRSK
FT                   RPLDAAVISITQLQAGNDVTNIIPGTAWLGGSVRAYSDAVVDLIERRMNELAEPIAAAH
FT                   GCQAEVYFERRYPALVNTPDETAFCLDVMRDVAGASRASVIEPAMASEDFAFMLQAKPG
FT                   CYVFLGNGDGGHRLAGHGLGPCSLHNASYDFNDSLIPVGASYWVRLAQRYLA"
FT   CDS_pept        73775..74767
FT                   /transl_table=11
FT                   /gene="bug4"
FT                   /locus_tag="Bpet0061"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40392"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVV0"
FT                   /protein_id="CAP40392.1"
FT                   /translation="MTRTAVLSRFARALAFAAIATGAAPAAVAQEPAWPGKTLTLVVPY
FT                   TAGGTNDMLGRTLGEVLRARHGTATIIENKPGAGGSVGADAVARAKPDGATLLLASTSP
FT                   LTIFPNLVKTPYDPMTDLVPVASVAVGPVAILATKALPVRSFAELVDYAKKHPGKVTFG
FT                   VPGVGTVAHIGMADLNKQVGIDMLQVPYRGGSQAVSDGLGGQVDLLVVNTDITLPHVQA
FT                   GSLTPLAVMAPQRLAPWPQVPTMAELKLPGIRYFSNFALFAPAGVPPEVMHAMLDEIGK
FT                   ALASPQFQQMLDKAFMQPGTGMGQDFIEQVRADYANNQRVIRDNNIRVQ"
FT   CDS_pept        complement(74778..75110)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0062"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40393"
FT                   /db_xref="GOA:A9HVV4"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HVV4"
FT                   /protein_id="CAP40393.1"
FT                   /translation="MPLLHTLGLFALTAVAEIVGCYLPYLWLKQGHSAWLLVPAALSLA
FT                   VFAWLLTLHPTASGRVYAAYGGVYVSMALLWLWAVDGVRPATTDWAGVGLCLAGMALIM
FT                   AGPRHG"
FT   CDS_pept        complement(75146..75523)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0063"
FT                   /product="transcriptional regulator, MerR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40394"
FT                   /db_xref="GOA:A9HVV7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVV7"
FT                   /protein_id="CAP40394.1"
FT                   /translation="MPPTWTISELSREFDITPRTIRFYEDQGIVSPGRDGRNRVYSARD
FT                   RTRLKLALRGKRLGLQLSEIRALIDMYDGPGDSTLQLRQYLDVLAQHRAALEQQRRDID
FT                   DTLAEIAEQERQCQLLLAQKP"
FT   CDS_pept        75556..76656
FT                   /transl_table=11
FT                   /locus_tag="Bpet0064"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /function="Zn-dependent hydrolases including glyoxylases"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40395"
FT                   /db_xref="GOA:A9HVW0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVW0"
FT                   /protein_id="CAP40395.1"
FT                   /translation="MMAWNNRQAYPRVFMNPNEHQLQYPWGDEQPAPGRAQQVADGVKW
FT                   IRMPLPFALDHINLWLLRDEIDGRQGWTVVDCGISRDEVKALWEEVFANELEGLPVLRV
FT                   LVTHMHPDHVGLAHWLCERWNAPLWMSMTDFMVGSLWSSRQGGSGPNGHAAVEHFARHG
FT                   LTDPDAQDQIRRRAGYYPNLVPAMPPRYTRLLHGDRVAIGGRDWRVIVGYGHAPEHVSL
FT                   FSPDLSTLISGDMVLPRISTNISVFDYEPESNPLPLYLDSLDRYADLPADTLVLPSHGR
FT                   PFKGLHQRIAQQHQHHAERLAEVLEACAQPQSTSDIVPVLFKRKLDLHQLTFAMGEALA
FT                   HLHALYFAGKVARQTGADGIVRFTAR"
FT   CDS_pept        complement(76679..77335)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0065"
FT                   /product="putative efflux protein"
FT                   /function="Putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40396"
FT                   /db_xref="GOA:A9HVW3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVW3"
FT                   /protein_id="CAP40396.1"
FT                   /translation="MRPARGRLFAMLPFDTLLAFSGIAVLLALTPGPDNLFVLMQSAIW
FT                   GRSAGMFVVLGLCTGLLGHTAAVAAGLAAVFAASPHAFIALKLAGAAYLAYLAWQALRA
FT                   RGGPAQAERPAPLARGALYRRGIIMNLTNPKVLLFFFAFLPQFTSHAHGPVGLQIVELG
FT                   AVFMAATLLVFGAIAFFSGTFGQLLQRSPAASRWLNRVAGVVFLGLAVRLATASR"
FT   CDS_pept        77479..78669
FT                   /transl_table=11
FT                   /gene="metC1"
FT                   /locus_tag="Bpet0066"
FT                   /product="cystathionine beta-lyase"
FT                   /function="Cystathionine beta-lyases/cystathionine gamma-
FT                   synthases"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40397"
FT                   /db_xref="GOA:A9HVW6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVW6"
FT                   /protein_id="CAP40397.1"
FT                   /translation="MDKSQAPHIDTLLQHTATAPFNPQTGSAPVNLPSMRASTVRFQSL
FT                   DALEATQRRKAGGERAATYGRMGMDTHAALEQVFCELEGGTHAYLASSGMAGITMVMTS
FT                   LLSAGDHALVADCVYGPVYELDAALLKRMNIELTYFSAGDDLETLVRPNTRLVYVESPG
FT                   SLLFQMLDLPALAAFARRHDLVLACDNTWGSGYVYQPLQLGAHVSVVAGTKYVGGHSDL
FT                   MLGAVITNDADVAKRLNRTQYAMGYSVSADDAWLALRGVRTLPIRMAQHARNALQVCEF
FT                   LATRPEVARIYHPAWPADPGHALWQRDCTGSNGMLAVELRLSPEASRRFVDALRLFGIG
FT                   FSWGGFESLVQWVTRGELARHRYWTGGDHALVRLHIGLENPRDLIADLAQALQAAA"
FT   CDS_pept        complement(78732..79361)
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="Bpet0067"
FT                   /product="thiol:disulfide interchange protein DsbA
FT                   precursor"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /EC_number="5.3.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40398"
FT                   /db_xref="GOA:A9HVW9"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVW9"
FT                   /protein_id="CAP40398.1"
FT                   /translation="MQSSLFTRLVAAAALAASTLFAPASQAQGAQQYVAINPPLPSDTP
FT                   GKIEVLEFFAYTCPHCATMEPLVEAWAKTAPSDVVVKQVPVAFNASMKPLQQLYYTLQT
FT                   LNRPDLHSKVFTAMHVEHKRLFNKKAMGDWAAEQGVDRAKFDSIFDSFSVQTQVQRADQ
FT                   LAQAYNIDGTPSFGVGGKFLTSPALAGNSYEGALKEVDRLIPLARQ"
FT   CDS_pept        complement(79437..80075)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0068"
FT                   /product="putative membrane protein"
FT                   /function="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40399"
FT                   /db_xref="GOA:A9HVX2"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVX2"
FT                   /protein_id="CAP40399.1"
FT                   /translation="MATKRKSSRQPKQSGSTMYGALAGLLVGLIIAAVVAFYVTKAPMP
FT                   FVDRATRDADRTKLPDPRQAPDPNQGLYGRDGAAGTPPSGPTATAPAPLPGVQPAAPAP
FT                   SKGQSDELGALIATLPPGTPPEAPAARAPAPASGKYFLQAGAYRVLEDAEGLKARILLL
FT                   GLPVAVQRAEVNGMQVNRVRVGPFARLDDMNRARSLLGENKIESAVVRQ"
FT   CDS_pept        complement(80085..81770)
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="Bpet0069"
FT                   /function="Arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40400"
FT                   /db_xref="GOA:A9HVX4"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HVX4"
FT                   /protein_id="CAP40400.1"
FT                   /translation="MLPEQQQQLISLIQAAVASVLPDAQAQVLLERPKVAAHGDVATNI
FT                   AMQLAKPARRNPRELAQGIVDALMAETAARALVENAEIAGPGFINFRITAAARQAVIQA
FT                   VAEQGEAYGHAPATGEKVLVEFVSANPTGPLHVGHARQAALGDAICRLYAATGRDVTRE
FT                   FYYNDAGNQIQNLAVSVQARARGIAPDSPDYPADGYKGDYIVDIAQDFIARKTLQAADG
FT                   AAVTASGDVDNLDDIRVFAVAYLRREQDLDLQAFGLAFDNYYLESSLYTSGRVEQTVQA
FT                   LVAKGHTYEQDGALWLRTTELGTGDDKDRVMRKSEGGYTYFVPDVAYHKAKWERGFRHA
FT                   VNIQGSDHHGTVARVRAGLQALEEGIPKDYPAYVLHKMVKVMRGGEEVKISKRAGSYVT
FT                   LRDLIDWVGRDAVRYFLIQRRADTEFVFDIDLALSKSDENPVYYIQYAHARICSMIANA
FT                   GADDARIAQADTALLTAPTEFALMQRLASFPQIVAQAAQELAPHHIAFWLRDCASDFHA
FT                   WYNAERVLVDDEPLKLARLRLAATTRQVLANGLALLGVSAPQRM"
FT   CDS_pept        82094..82474
FT                   /transl_table=11
FT                   /locus_tag="Bpet0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40401"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVX7"
FT                   /protein_id="CAP40401.1"
FT                   /translation="MELTTEGARNMLIKFHSKAVAEVLMLSQNAAPLLRAAGKSFGDDV
FT                   PERGVFTCEQLQAAIDGIEAAVAADDRAHAGQEDDADRHDKPVHPMAQAVDLHQRAFPL
FT                   LDMMRRSLAEGADVTWEATKGW"
FT   CDS_pept        82574..82891
FT                   /transl_table=11
FT                   /locus_tag="Bpet0071"
FT                   /product="hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40402"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVY0"
FT                   /protein_id="CAP40402.1"
FT                   /translation="MRSDVTVIFDARRTVDLSVDVAPSPQAASDARDWFEAAWDTLGCE
FT                   PLRPSGKVLLLDKIMGVADALGYDVLSSDAKESREFAQHAALALDKPRIIVDLPGLSVG
FT                   Y"
FT   CDS_pept        complement(82928..83728)
FT                   /transl_table=11
FT                   /gene="ugpE1"
FT                   /locus_tag="Bpet0072"
FT                   /product="Glycerol-3-phosphat transport system, permease
FT                   component"
FT                   /function="ABC-type sugar transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40403"
FT                   /db_xref="GOA:A9HVY2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVY2"
FT                   /protein_id="CAP40403.1"
FT                   /translation="MTRKLDTLGAWLLGLLWILPLAYALWAAFHPPAYATRFDLLAPLT
FT                   LENFSRAWHAAPFPRYFLNTFMLVTMVLAAQLVLSTLAGYAFARFEFRGRDLVFMLVLL
FT                   QLMIMPDVLLVENYRSMSLLGVRDTVFAVGLPYFASAFGIFLLRQTFKTVPRELEEAAR
FT                   VEGAGPLQVLMKVYVPLAKPIYVAYGLVSVSHHWNNFLWPLIITNSVESRPLTVGLQVF
FT                   AATDQGIDWSVITAATLLSAAPLLVGFLLFQRQFVQSFMRAGIR"
FT   CDS_pept        complement(83725..84600)
FT                   /transl_table=11
FT                   /gene="ugpA1"
FT                   /locus_tag="Bpet0073"
FT                   /product="Glycerol-3-phosphat transport system, permease
FT                   component"
FT                   /function="ABC-type sugar transport systems permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40404"
FT                   /db_xref="GOA:A9HVY4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVY4"
FT                   /protein_id="CAP40404.1"
FT                   /translation="MNRSLQAVYGWLLLLPALVLLAAFTHYPALATLWHSFFSTPRGSR
FT                   PARFVGLENYAVMGDDPVFWQALWNNLWFALGTIPLSIAIALVMALWVNRNLAGRGFLR
FT                   MAYFTPTVLPMVAVANIWLFFYTPQYGLIAQVMHWFGAAGPNWLGTRDTALPALMVVTI
FT                   WKEAGFFMIFYLAALQTVSPSLREAALLEGASRWQYFRRVLWPLLMPTTLFVLVNALIN
FT                   AFRLVDHVVVMTRGGPDNASTLLLFYIYQVGFSFWDTSYAATLTVVLLLILAITALVKF
FT                   RWLDRRTHYQ"
FT   CDS_pept        complement(84613..85908)
FT                   /transl_table=11
FT                   /gene="ugpB1"
FT                   /locus_tag="Bpet0074"
FT                   /product="Glycerol-3-phosphate-binding periplasmic protein,
FT                   precursor"
FT                   /function="ABC-type sugar transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40405"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVY7"
FT                   /protein_id="CAP40405.1"
FT                   /translation="MRRTALKALAAALAGAFVSLPLYAQDKPVEVEFYYPVAVGGPITK
FT                   IVDDMVAAFEKDNPGIDIKPIYAGSYQDSIAKALTALKGGTPPQLAVLLSTDMFTLIDE
FT                   DAIVPIDSLAKSETDKKWLGGFYDAFMQNSRTGGHVWGVPFQRSTIVMYYNKDLFKEAG
FT                   LDPEHPPATWDELVDYGKKLTKKDASGNVTQWGVKIPSGGAFAYWLFQALTTPNDAILM
FT                   NEEGNQVYLDKPAVIEAAQFWNDLSAKHGVMPRGTVDWGTTPKDFLEKKAAIVWTTTGN
FT                   LTNIRKNADFPFGVAMMPKAKRGGSPTGGGNFYIFKSGTPEQQAAALKFAQWATTPERA
FT                   ADWSIATGYVAVTPAAWETDKMKKYAAEVPAATVARDQLSVSVAEFSTHENQRVTKTLN
FT                   DALQAMLTGSKTPQQAMGDAQREADRVLRSYR"
FT   CDS_pept        complement(85920..86993)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0075"
FT                   /product="Putative sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /function="ABC-type sugar transport systems ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40406"
FT                   /db_xref="GOA:A9HVZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVZ0"
FT                   /protein_id="CAP40406.1"
FT                   /translation="MSTLILEDLTKQYGEAAAIQGVGFTAPAGSFTVLLGPSGCGKSTT
FT                   LRMIAGLDTPTSGRIRIGDRDVTHLPPSQRRISMVFQSYALFPHLSVRENILFGLKVRK
FT                   EPAADYPRRLQRVADLLGLSPLLDRKPSQLSGGQQQRVALGRAVISEAPVCLMDEPLSN
FT                   LDAQLRHDMRREIRALQQALGITMVYVTHDQTEAMSMADQVVLLRNGRIEQLDTPDGLY
FT                   ARPATEFAARFIGTPPMNLIGLAAQDGAHVIDGLAGAPVAHAPSGAARLGVRPEHIRID
FT                   ADGRPATVESVEYFGADSIVVCRLGNSSGVAVRVAGHLRAAAGDALGLSWQPEHQHFFA
FT                   ADTAVISTPGRSGASSL"
FT   CDS_pept        complement(87098..87919)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0076"
FT                   /product="putative cAMP phosphodiesterase"
FT                   /function="Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40407"
FT                   /db_xref="GOA:A9HVZ3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR042281"
FT                   /db_xref="InterPro:IPR042283"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVZ3"
FT                   /protein_id="CAP40407.1"
FT                   /translation="MLIAQITDLHIRMPGQKAYRVVETDRYLPPAVDALNRLDPAPTLT
FT                   IVSGDLTDFGRPQEYAHLKNMLDGLNAPYFLMPGNHDAREALVQAFPEHRYLHGEDGYV
FT                   QYTVEDHPLRLLMLDTVVPMQSHGALCAQRLQWLRERLAEQPGRPTVIAMHHPPFLTGI
FT                   AHMDAIGLLEGAAELEQIVAAHPNVERILCGHLHRTIFRRFGGTVASTCPSPAHQVALD
FT                   LRPEGPSAFVMEPPGFHLHEWRDHALVTHHAYIGAYPGPYPFHEGGALIDE"
FT   CDS_pept        complement(87982..89049)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0077"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type sugar transport systems, ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40408"
FT                   /db_xref="GOA:A9HVZ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVZ5"
FT                   /protein_id="CAP40408.1"
FT                   /translation="MAGRARRPAFSYRIYPDLVTMTDPVAITLKHCAKTWPDGSRALQP
FT                   IDLHVQGGETLALLGPSGCGKTTLLRLICGLEQADAGASIRFGEDEVTTLPPEARGVGV
FT                   VFQSYALFPNMSVVQNVAYGLRVRDIAAAERERRARELLALVRLDGFADRRVDQLSGGQ
FT                   RQRVALARALAIEPRVLLLDEPLTALDAKLREHLRVELAQMLRQLRVTTVIVTHDQDEA
FT                   MMLGDRIAVMSAGHLEQVGTAETLYREPASDFVAEFLGTLCRVRAGLQSGMLVAGADSL
FT                   AFRPHEARLEPARSGALPARVLARFFLGGSVRYEIGLDDGQRFPVVAPAHSGHAAGDTV
FT                   SVMVAPGAAARENRA"
FT   CDS_pept        complement(88986..89807)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0078"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40409"
FT                   /db_xref="GOA:A9HVZ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVZ8"
FT                   /protein_id="CAP40409.1"
FT                   /translation="MNASKTDTRLGLAITLAVAAFLIGPVVLSVLAGLTKNYFVGLSSG
FT                   LTLRWIEQVWSLYADTIWRSFAVALLTLAICTVVGVPAAWVLTLYRGRLARALEELLTL
FT                   PVAVPGLASALALIVSWGTVRGLRGSIWFIVIGHVLFTLPFMVRAARASMHGADLATLD
FT                   EAAATLGASRAQRFLQIVVPNAASGIVTGALTVLTLSIGEFNLTWLLHTPLTKTLPVGL
FT                   ADSYASMRLEIASAYTLVFLLMLVPLLVGLQWLAARGDRPSRIASTRTSSP"
FT   CDS_pept        complement(89821..90636)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0079"
FT                   /product="probable Binding-protein-dependent transport
FT                   system, permease protein"
FT                   /function="ABC-type sulfate transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40410"
FT                   /db_xref="GOA:A9HW01"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW01"
FT                   /protein_id="CAP40410.1"
FT                   /translation="MARRGWIWFAVPAATLFLAFWLLPMAGLALIGAEIKDGQSAYLTV
FT                   LTRPQYWISLFNTVALSLAATLATLLLALPVGRFLAWHRDFPGRRLLMSLLMFPLAFPG
FT                   VVVGFLIILLAGRQGVIGNITSWLTGERMVFAYGMGGLFLGYLYFSLPRCIGVLAAAAE
FT                   QIDASLLEAARTLGASPWRRFVDIELPALTPALIGAGAMSFATSMGAFGTAFTLATQID
FT                   VLPITIYNEFTNYANIPVAAALSIVLGLATWAVLYVAHSLAGARLGAAG"
FT   CDS_pept        complement(90667..91677)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0080"
FT                   /product="probable ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /function="ABC-type Fe3+ transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40411"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW03"
FT                   /protein_id="CAP40411.1"
FT                   /translation="MKPLIRTALRAAALAMALTGAAAQAQNAICYNCPPEWADWGTQLK
FT                   AIKQATGINVPADNKNSGQSLASIAAEKNNPVADVVYYGVTFGIQAANDGLVQAYRPQH
FT                   WDQIPDGMKDPDGKWFAIHSGALGLMVNVDALGGKPVPRSWADLLKPEYRGMVGYLDPA
FT                   SAFVGYAGAVAINRAMGGTLDDFGPALAWFKKMSGNDPIVPKQTAYARVLSGEIPILID
FT                   YDFNAYRAKYKDGGNVEFVIPSEGTIAVPYVMSLVAGAPHADNGKKVLDFTLSDQGQAI
FT                   WANAFLRPVRPEAMSAEAQKKFLPAAEYARVGTVDYAKMAAGQRAFSQRYAQEVN"
FT   CDS_pept        complement(91674..92720)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0081"
FT                   /product="probable LacI-family transcriptional regulator"
FT                   /function="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40412"
FT                   /db_xref="GOA:A9HW04"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW04"
FT                   /protein_id="CAP40412.1"
FT                   /translation="MPDKPPHRPSILEIARKAGVSPATVSRAFNQPGLLRPETRARIEA
FT                   VAQRSGFRPNRVGRSLRAGRTRTIGLLLPTLANPVFADCFEGAEQHARTAGYSVMMGIT
FT                   GYDPSVEAESVQALIDHQIDGLILTVGNPARNTTLQALDAAGMPHILAYNESGSHPFVS
FT                   VDNKAAAHEMVARLAALGHRRIAFVSGPLPASDRARRRLLGARACARELGLPAVAHLAV
FT                   AAHTESSAPMLRKLLARADAPTALFCSNDLLAASVIAQLAALRVRVPDDIAVCGFDGVS
FT                   IGALMVPPLSTVQQPSREIGATACAMLLARLDGGEFPASVRLPHRIVDGGTAATVAPSI
FT                   TPTRKRSS"
FT   CDS_pept        92970..94265
FT                   /transl_table=11
FT                   /gene="gatA1"
FT                   /locus_tag="Bpet0082"
FT                   /product="putative amidase"
FT                   /function="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40413"
FT                   /db_xref="GOA:A9HW06"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW06"
FT                   /protein_id="CAP40413.1"
FT                   /translation="MAVELNCLSATRAAQLLARRELSAEQLLRACFARIEQRDGVVHAW
FT                   AALDKAQALAQARALDQSATRGVLHGLPFGVKDMFATFDLPTSYGSPIYEGHRPPMDAA
FT                   AVALCREAGALVAGKTVTTEFATYQPGPTRNPHNPAYTPGGSSSGSAAAVGDCMVPFAL
FT                   GTQTAGSIIRPAAYCGVVGFKPSFGRVARAGLKSLAESLDTIGGFARSVDDVALFASVL
FT                   MRDPGLRELDYDSRPRIGMYRTLQWRHTLPETRKAYEFAAGLLSRAGAQVCELELPPDL
FT                   CALVQVHADIMSFEAAQSLAFEHVHHAGRLSSSLLALLEAGSQISADEHRVNLERAAQG
FT                   RAQAEPWFEDYDLLLAPSASGEAPFIEQGTGDPQFCRVWTLFGCPCVHLPFDTGPQGLP
FT                   VGLQAVGRPGDDRRTLAIARWVLNVLRPEGDA"
FT   CDS_pept        complement(94608..96314)
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="Bpet0083"
FT                   /product="2-isopropylmalate synthase"
FT                   /function="Isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40414"
FT                   /db_xref="GOA:A9HW07"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HW07"
FT                   /protein_id="CAP40414.1"
FT                   /translation="MLANPATKYVPFAPFARDFSERTWPSRRITQPPIWMSTDLRDGNQ
FT                   SLIEPMSVERKLRFFEQLVKIGFKEIEVGFPSASQTDFDFVRKLVDEKRIPDDVTIIVL
FT                   TQSREDLISRTVEAAAGAKQAIVHLYNACAPAFRKVVFNMSKDEIKQIAISGTQWVKQY
FT                   MAQHPETQWRYEYSPEVFSTTEPEFALEVSNAVADVWQPTPECKMVLNLPATIEATTPN
FT                   LYADQIEWMHKNLARRDSIVLSVHPHNDRGTAVAAAEFAVMAGADRIEGCLFGSGERTG
FT                   NVDLVTLALNLYTQGVHPGLDFSDIDEVRRCAEYCNQLPVHPRHPYAGDLVFTAFSGSH
FT                   QDAIKKGFAQQKPDAVWEVPYLPIDPADLGRSYDAVIRVNSQSGKGGVSYLLEQEHGLV
FT                   LPRRLQIEFSRAIQRVTDETGREVTADDVHTIFNREYLEQHSPWKLVRHRIDGDPAGGQ
FT                   GKQFSIQVELDYNGERRVVTGSGDGAISAFVAALGIPVRIMDYHEHAIGTGTDTRAASY
FT                   VELRVGDSATGFGVGIDRDIVTASFQAVLSAVNRHLANGVTVTESETAQAA"
FT   CDS_pept        complement(96684..97325)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0084"
FT                   /product="putative membrane protein"
FT                   /function="ABC-type Fe3+-hydroxamate transport system
FT                   periplasmic component"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40416"
FT                   /db_xref="GOA:A9HW12"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW12"
FT                   /protein_id="CAP40416.1"
FT                   /translation="MMNATSPERVRQDCRLIGQTLLKLALPRLLIRAVVLVVAAIVWLL
FT                   VASWLLSLGQGLNFENLPIVGQDGSNFLQRALPYARWGVVVIWTLIIFFIARAWVASDM
FT                   AAARARPVPSDDLADLVPQLSDEVVAVLRWVWGSRDEPFTVGDLRQALAELRHSRIGKL
FT                   DLVRQQADILDGRAARQPMGNPGSPATARPAANLPQPEARPAGARIEPNL"
FT   CDS_pept        97324..98763
FT                   /transl_table=11
FT                   /gene="rpoN1"
FT                   /locus_tag="Bpet0085"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit sigma54 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40415"
FT                   /db_xref="GOA:A9HW09"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW09"
FT                   /protein_id="CAP40415.1"
FT                   /translation="MQNIVPMTRPALELRTGQHLTLTPQLQQSIRLLQLSTLDLQAEIS
FT                   QALADNPMLERNDERSEAEVDAPTEREADIDAEPAREAETRIDEMPGAGGVYPDDRPDG
FT                   PDTARSDTLREHLLAQLGLTRAGRRDAALVSLLIDELDENGYLASPLEEILEWLPPEAE
FT                   ADLDELRAALCLLQSFDPPGIGARDMAECLVLQLRNPDPSRLPEAADPTVLACARRLCA
FT                   DHLPLLAGGNAARLRDALQCDDATARAAHALIRRLDPRPGRAWTVPAADYAVPDVIVRK
FT                   TRQGWQAVLNSAAVPRLQVNTLYAQLLGNQREASHAGLHAQLQQARWMIRNVEQRFDTI
FT                   LRVAQAIVAHQSAFFSEGPAAMRPLILKDIAGELGLHESTISRATTQKYMLTPFGTLEL
FT                   KHFFGSGVATDAGDVASATAVQAVIRQMVAGEDRAKPLSDNQITQRLADQGIVIARRTV
FT                   AKYREALRIAPASLRKAHAGR"
FT   CDS_pept        98862..99146
FT                   /transl_table=11
FT                   /locus_tag="Bpet0086"
FT                   /product="putative bacterioferritin-associated ferredoxin"
FT                   /function="Bacterioferritin-associated ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40417"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW13"
FT                   /protein_id="CAP40417.1"
FT                   /translation="MYICVCNAITERQVRASVDAGATTLSDLQFELGVATCCGCCAATA
FT                   QEYLPGGRCSSVCNVNSVAMDVAPAAAGAVVETDAPAANGFPVRLVAAA"
FT   CDS_pept        99508..99984
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="Bpet0087"
FT                   /product="bacterioferritin"
FT                   /function="Bacterioferritin (cytochrome b1)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40418"
FT                   /db_xref="GOA:A9HW16"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW16"
FT                   /protein_id="CAP40418.1"
FT                   /translation="MKGDKTVIQFLNKQLTNELTAINQYFLHARILRHWGLQKLGKHEY
FT                   EESIGEMKHADRLIERILMLDGLPNLQDLHKLLIGEDVPEMLSCDLKLEQGAQATVKEA
FT                   IAHCESVRDYVSRDLFQDILDDTEEHIDYLETQIELIGKVGLQNYLQSQMEAEG"
FT   CDS_pept        complement(100070..100732)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0088"
FT                   /product="putative exported protein"
FT                   /function="DNA polymerase I - 3-5 exonuclease and
FT                   polymerase domains"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40419"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW18"
FT                   /protein_id="CAP40419.1"
FT                   /translation="MSWRVLFATLLLALGAAAWGGIQLGDWLVAHAPKATAAPGQESLV
FT                   SQEPVLDANGRPYVAQPPQPRVDGTLGVPDKPSGESWTVSTVSLFDTTTDPSVHISRDN
FT                   ISMDEARELAAASPVPLPSGPSDVTTLDLQSLPPTTTAPPPNQQAYALNPPVTMPTAPT
FT                   PPAANNGAWKQALQQELARCADKGFFERPTCSWNARNKYCGPNRAWGTIAECPRRPE"
FT   CDS_pept        complement(100765..102372)
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="Bpet0089"
FT                   /function="Peptide chain release factor RF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40420"
FT                   /db_xref="GOA:A9HW20"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HW20"
FT                   /protein_id="CAP40420.1"
FT                   /translation="MNISQEVARRRTFAIISHPDAGKTTLTEKLLLFAGAIQIAGSVKA
FT                   RKASRHASSDWMEIEKQRGISVASSVMQMEYRDCVINLLDTPGHQDFSEDTYRVLTAVD
FT                   AALMVIDAANGVEPQTIRLLQVCRARNTPIITFINKMDREVREPLDLLSEIEGHLGMDA
FT                   VPFSWPVGMGKSFGGVFDIRRDRMRVFRPGQERRSDDDDIIDGLDNPEIASRFGSAFEQ
FT                   ANGEIELIQEAAPAFDREAFLAGRQTPVFFGSAINNFGVQEVLDALVEQAPPPGPRQAL
FT                   ERLVEPQEPKFTGVVFKVQANMDPAHRDRVAFVRVSSGRFERGMRLKVARTNKEMRPNN
FT                   VVSFLSQRRELLDEAYAGDVIGIPNHGVLQLGDVLTEGESLRFTGLPFFAPELFQAVEV
FT                   KDPLRTKQLRIGLTQLGEEGAIQVFRPEAAGGTLLLGAVGQLQFEVVAHRLKTEYGVEA
FT                   RMLPSRYTMARWITSENPRALRKFMDANAAHIAYDVVDAAAFLIGSPAQLRVAEDLYPD
FT                   VKFHAMREHGGQVFGSHA"
FT   CDS_pept        complement(102422..103051)
FT                   /transl_table=11
FT                   /gene="rhtB1"
FT                   /locus_tag="Bpet0090"
FT                   /function="Homoserine/homoserine lactone efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40421"
FT                   /db_xref="GOA:A9HW23"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW23"
FT                   /protein_id="CAP40421.1"
FT                   /translation="MTLSTWLTFFVASWAISFSPGAGAISAMTSGLKYGFARGYWNTAG
FT                   LIMGILVQFVIVAVGLGAVLATSEIAFSVVKYLGVAYLVYLGVRQIRTDAAPVAVDTGD
FT                   PARFSVRELVVRGVLVNVMNPKGTVFLLAVVPQFVDTAHALTPQYAALAGTLVFTDMVA
FT                   MGVYTLLAAKVLRLLRDARHIRWMNRIFGSLFIVAGVFLATFRRQA"
FT   CDS_pept        complement(103103..103591)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0091"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /function="Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40422"
FT                   /db_xref="GOA:A9HW25"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW25"
FT                   /protein_id="CAP40422.1"
FT                   /translation="MPEDYVHRIGRTGRAGATGAAVSLVDNSEIKLLKGIERLIGKTIE
FT                   RLPVQGWTPPAGSSAAAYERQERDEDNRQPRRQGARGNGGDRAGRPGQAPRQGNGGRAA
FT                   AQGRPGGQRQAPAPRGDRPSGGGHRADNRTAPQAPRQAESGRPAGHRTGAPRAALLGK"
FT   CDS_pept        complement(103609..104574)
FT                   /transl_table=11
FT                   /gene="rhlE1"
FT                   /locus_tag="Bpet0092"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /function="Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40423"
FT                   /db_xref="GOA:A9HW27"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW27"
FT                   /protein_id="CAP40423.1"
FT                   /translation="MTATVSFADLGLADPLLRAIAETGYTAPTPIQAQAIPQVLKGGDL
FT                   LAAAQTGTGKTAGFTLPILHLLMQQKPALKKPGRPRCLILTPTRELTAQVAESVRTYGK
FT                   HTPLTSMVMFGGVNINPQISALKKPLDILVATPGRLLDHCGQKTVDLSGVEILVLDEAD
FT                   RMLDMGFIRDIRKVLALLPKQRQNLLFSATFSDEIRSLARGVLNNPGEVSVTPRNTATE
FT                   LVTQTVHLVEQHHKRDLISHIIRESGWHQVLVFTRTKHGANRLAEKLVKDGLSAAAIHG
FT                   NKSQAARTRACRASRTATWPCWWPPTSPRADSTSTSCRRW"
FT   CDS_pept        105128..105754
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="Bpet0093"
FT                   /product="LemA protein"
FT                   /function="LemA Family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40424"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW30"
FT                   /protein_id="CAP40424.1"
FT                   /translation="MRISRWLGLSLIALAAAVLSGCGYNSIQAADEQVKAAWSEVLNQY
FT                   QRRADLVPQLVKSVDAYMTHEREVLTQVTEARSKVGSVQITADQLDDPAAVQRFQQAQG
FT                   QLTSALSRLIAVSENYPQLKADGLFRDLQAQLEGTENRISVARGRYVQSVQAYNVLVRQ
FT                   FPGVITAKIFGYAPKANFGVDDEAAISRPPEIRFSNDASAPKPAQ"
FT   CDS_pept        105843..106649
FT                   /transl_table=11
FT                   /locus_tag="Bpet0094"
FT                   /product="putative membrane protein"
FT                   /function="Beta-propeller domains of methanol dehydrogenase
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40425"
FT                   /db_xref="GOA:A9HW32"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW32"
FT                   /protein_id="CAP40425.1"
FT                   /translation="MAQPAAPAAVPALHARVTDSTGTLDSARRQALEQRLAALEQRKGA
FT                   QVAVLVVPSTAPDTIEQYATRVFEQWKLGRKNTDDGVLLVVAKEDRTLRIEVGYGLEGA
FT                   IPDALASRIIREQIVPRFQSGDFGGGIEAGVAAIEKLIDGEPLPAPAPRAAEGGPEQDW
FT                   PFFLLLGAFMLGLPAIVAGLAAAAASWMIFGTWWAAVLGGVGGFAVSGLLGLLGIKRRL
FT                   LNASRRGGRGGGGFGGGFGGGGGFGGGGGFGGGGGRSGGGGASGRW"
FT   CDS_pept        complement(106654..108042)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0095"
FT                   /product="sensor histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40426"
FT                   /db_xref="GOA:A9HW34"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW34"
FT                   /protein_id="CAP40426.1"
FT                   /translation="MNGSVSMAPPRRAGSLRWRLLVGTLAWISLSVAVAGWGLASLFRQ
FT                   HVTQQLHAELMLHLNQLTAAVNIGPDGKVNVFPPLSDPRFDQPLSGLYWQIDRAGNGAA
FT                   APEGLARSRSLWDQTLPVVTADPQEGYLINGPENRQLYAVARLLTPAEPDTPRLRLVVA
FT                   ADRGVLAEPIERFNHMLAISLGALAAGLVLAAVMQVLIGLRPLARLRRQLSQQPAGSSV
FT                   RIEGRYPSEVQPLVDDFNRMLTVNDEIIQRARTQAGNLAHAVKTPLAILANAAAAEQSP
FT                   LAELTREQVEIARRQIDHHLARARAAASSGAADLRTPLHEPMQGLVRAMRQLYAERKLD
FT                   IALAPHPPELCFRGEPHDLQEMVGNLLDNACKWANRRVLVTAERDSDGAGRLAIHVDDD
FT                   GAGIAATERERIFQRGVRMDEQRPGSGLGLDIVRDLACTYGGDVQAGASPLGGLRITLL
FT                   LPAA"
FT   CDS_pept        complement(108039..108701)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0096"
FT                   /product="two-component response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40427"
FT                   /db_xref="GOA:A9HW36"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW36"
FT                   /protein_id="CAP40427.1"
FT                   /translation="MRVLLIEDEPTLAAQLEQALRAAGYTVDRAADGQTAHYLGDVEAF
FT                   DAVVLDLGLPVLDGLTVLRRWRAAGRNMPVLILTARDSWHEKVAGIDAGADDYLAKPFH
FT                   MEELLARVRALIRRNSVHASAEWRCGPLMLDTRQARVTLDGAPITLTSHEFKVLAMLMQ
FT                   HAGEVVSRQQLVEHLYAQDFDRDSNTIDVFIGRLRKKLPPDTIETVRGLGYRLAGNS"
FT   CDS_pept        complement(108701..109105)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0097"
FT                   /product="hypothetical protein"
FT                   /function="Predicted membrane protein"
FT                   /EC_number="3.4.24.28"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40428"
FT                   /db_xref="GOA:A9HW38"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW38"
FT                   /protein_id="CAP40428.1"
FT                   /translation="MARFPVPPCRPHAIPMSRSVSPLAAPLRACLAVFLCCATLLGLPP
FT                   ASAGERDHDRARQALQEGKILPLRSVLDIVEQSYPGQVVKVEFEEDDGEYLYEIRLLQD
FT                   SGNLLKLKIDARDGRVLAVKGKNVRFRGDH"
FT   CDS_pept        109244..109555
FT                   /transl_table=11
FT                   /locus_tag="Bpet0098"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40429"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW40"
FT                   /protein_id="CAP40429.1"
FT                   /translation="MNTTIRTLLAGVALGAAALAVQAQTPTPAPAAASGPAASAPKAAI
FT                   WSIRQVYDSLEAAGYRDITEIELERDRYEVKARDAQARRVKLYINAHNGAIERTKLHD"
FT   CDS_pept        109512..110981
FT                   /transl_table=11
FT                   /locus_tag="Bpet0099"
FT                   /product="putative flavocytochrome"
FT                   /function="Predicted ferric reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40430"
FT                   /db_xref="GOA:A9HW43"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW43"
FT                   /protein_id="CAP40430.1"
FT                   /translation="MRTTAPSSAPSCTIDRPHPAARAPPRPGRLSAGPGRHHKSFIMHT
FT                   RTVIGLFLGVLALAWGLDVVVLQAPLQGDWPWLLRQQSLYLTGIWSIGLMSLVMILALR
FT                   PAWLERPLGGMDRVYRLHKWAGILAVAFGLAHWLAKLASGPLKTLIGVAGRAPRPAALP
FT                   WFENARDFAKDVGEWGLYVLLAMLLITLWRRVPYHAWRWVHRAMPLLYLALVAHAVALL
FT                   PRQHWLGATGVLLAPLMAGGVLAAWRVLRGRVGQRRKVGGKVVALSQPALGGQTAGVLE
FT                   LVCELDTGWPGHRPGQFAFLTLDRAEGAHPYTIASAPGPDRRVTFQIKELGDYTRGLAA
FT                   RVRPGQRVTVEGPYGCFQPAPRQPEAMQIWVAGGIGITPFLSWLQAMQADPDAAPRAHL
FT                   HYCVRDAGADPFVARLRAMCDALPSITLTVYDGRGGQGLTAAQLVSPDVAAQAEGVWFC
FT                   GPAGLAALVRRELRRAGLPGLRVHQEAFEMR"
FT   CDS_pept        complement(110978..112216)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0100"
FT                   /product="Imidazolonepropionase"
FT                   /function="Imidazolonepropionase and related
FT                   amidohydrolases"
FT                   /EC_number="3.5.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40431"
FT                   /db_xref="GOA:A9HW44"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW44"
FT                   /protein_id="CAP40431.1"
FT                   /translation="MSAAHESASTGNTGPLLFTGGNVFDGQGGLLAGQAVLVEDGRIAR
FT                   VAPAGQFEGYAGQRVDTTGMTLLPGLADCHVHLVFTGSADPHAQMSRQGPAQITLTALE
FT                   NAQAALRGGITAVRDCGGKDYLEFGVRDAIARGVFAGPTIKAAGRMICMTGGHGNRTGR
FT                   VADGCDEVVKAVREQVHAGCDLVKIMATGGVMTPGVNPMDAHYSYDEMHAGVREAKRFS
FT                   KSTASHAQGTEGILNAVRAGIDSIEHGIFMDQQCLDEMLARQTFLVPTIAALRNILDNA
FT                   DRGIPAYVVDKARAVEQRHRESFQMYYRAGGRIAMGTDAGTPFNRHGRNAEELAYMVAF
FT                   GMTPADALVAGTSRAHELLGLPGHGIVSEGAVADLLLVRGDPTQDIACAADTQHHVAVL
FT                   KQGRLAAGALPPA"
FT   CDS_pept        complement(112213..113940)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0101"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ATPase components of various ABC-type transport
FT                   systems contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40432"
FT                   /db_xref="GOA:A9HW47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW47"
FT                   /protein_id="CAP40432.1"
FT                   /translation="MALLDIEKMRIEFASRRGTLVAVDGVSLALERGEILGVVGESGAG
FT                   KSTIGNAVMGLLEFPGRLAGGEVHLDGHRIDALPEAEKRKVRGRRIGMIFQDPLTSLDP
FT                   LQTVERQLVETMLVHLDLSVAQAEQRAVDLLRQVGIDSPELRVKQYPHQFSGGMRQRVV
FT                   IALALCCEPEIIIADEPTTALDVSIQAQILDLLRKLCKEKQVGMIIITHDMGVIADVTD
FT                   RVAVLYRGKLVEQGPTAKILGDPDHPYTRSLISAVPRPDVKLRRFPLVTYIEDVKTPAK
FT                   PLDISTHWLGQRRDFGQDASGPLVQTQDLGMRFVLKNAFLARNRRTLDAVKQVSLSIAQ
FT                   GEVFGLVGESGSGKSTVARLISGLYTPSGGAVLFNGTNLTALKDEKQLNAFRRQIQMVF
FT                   QDPFSSLNPRMRVLDIVAEPIRFHKLAATETETRQVVSDLLDIVGLGAAAARRYPHEFS
FT                   GGQRQRICIARALATRPRFLICDEPTSALDVSIQAQILNLLKDLQEQLGLTMLFISHDL
FT                   PVIRQMCDRVGVMRHGELLEVAETETLFNAPQHEYTQHLLGLMPQLQVMSRKGLEVES"
FT   CDS_pept        complement(113950..114876)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0102"
FT                   /product="probable ABC-transporter permease"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40433"
FT                   /db_xref="GOA:A9HW48"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW48"
FT                   /protein_id="CAP40433.1"
FT                   /translation="MTARIAPWFARAADSDLWYSFRTSPSAVISAIVTLAILVGALCAP
FT                   IIAPHNPFDLASLNIMDANTPPAWNPDGSAEFLLGTDDQGRDILSAILYGSRVSLLVGF
FT                   ASVLFSMVLGVSLGLISGYVGGRVDSIIMRIADVQLSFPAILIALLIDGVARGILPRDM
FT                   HNELALYVLIFAIGISGWVQYARTVRGSTMVERNKEYVQAARLIGIGPLTILRRHILPN
FT                   VMGPVLVIATIHLAIAIITEATLSFLGVGVPPTAPSLGTLIRIGNSYLFSGMWWISIFP
FT                   GIALVALVLSVNLLGDWLRDALNPKLR"
FT   CDS_pept        complement(114887..115858)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0103"
FT                   /product="putative ABC-transporter permease protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40434"
FT                   /db_xref="GOA:A9HW51"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW51"
FT                   /protein_id="CAP40434.1"
FT                   /translation="MLFFIGQRLLQSVLVMLTVALIAFAMFRYVGDPIVSMVGQDTTEA
FT                   QRAELRERLGLNDPFVVQYARFVRDAAQGNFGISYRQRQPVSDLIEQRLPATLELSFVS
FT                   ALMALAFGIPMGIYTALRRHGALSRAFMALSLAGISLPTFLIGILLILVFSVQLRWLPS
FT                   FGRGEVIAIGGWTTGLLTRSGLAALILPAITLALFQMTLIMRLVRAEMLEILRSDFIKF
FT                   ARARGLPERLINFRHALKNTMVPVITITGLQLGSIIAFAIITETVFQWPGMGLLFIQAI
FT                   STVDIPVMAAYLVLIAFFFVVINLIVDILYVVVDPRLRVQSK"
FT   CDS_pept        complement(115992..117596)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0104"
FT                   /product="putative extracellular solute-binding protein"
FT                   /function="ABC-type dipeptide transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40435"
FT                   /db_xref="GOA:A9HW53"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW53"
FT                   /protein_id="CAP40435.1"
FT                   /translation="MRITPFIKKSALALAVCGAMLASPAHAKTLHWAYQGDATSMDPMA
FT                   LNETFTLGFQGNIYETLAGYDGDMKLTPLLAENWENTEPTKWVFKLRKGVKFHDGSPFT
FT                   ADDVIFSWKRSLTPGSDMKGYGAKASDVKKIDDYTIEVTTPTPNPILPREWTFLYIMSK
FT                   SWSEKNKTTEATNVKGDNQGNYANLHANGTGPFMLVERQPDVKTVLKRYDGYWDKNIKT
FT                   NIDEVVFQPISQEATRVAALISGEMDIVQPVPVQDWQRLEDAPGVKPLTEPEARAIFIG
FT                   MDQHRDELLFSNIKGKNPFKDARVREAVVLAVDIEAINKKIMRGAAKPLGSLVATSVNG
FT                   YDDSFGKPYKPDPAKAKKLLADAGYPDGFEVTLDCPNDRYVNDEKICQAVAGMLARVGI
FT                   KINLLAQTKSKYFGKILLQAGNQTSMYMLGWTPSSTDAHNVLLNLAACRDSKTAAGQFN
FT                   LGGYCNPKVDELTNKIGVETDQAKRNAMIKEAFDIVRNDYGYLPLHQQPMSWGIKDKLQ
FT                   VVQRADDVLDLRNVVMP"
FT   CDS_pept        complement(118231..119214)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0105"
FT                   /product="transposase for IS1663"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40436"
FT                   /db_xref="GOA:A9HVM8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVM8"
FT                   /protein_id="CAP40436.1"
FT                   /translation="MFFLGIDVSKAKLNCALVGAEGDKRKTKVVANTVAGIQALLGWCA
FT                   KQGAQPEQLHVVLEPTGPYHEQAGTALHEAGATVSMINPAQARDFAGALAVRTKNDELD
FT                   SYVLARYGQALCPPAWQPAPLHARQLRALLARHEALAKDLQRELNRQEKAQFGQSPEPV
FT                   TGSIDKSVAFLTEQIKRLERAINDHIDRHPDLKEDRDLLTSIPAVGPQTGNALLSIMHN
FT                   RRIESPQALAAYLGLVPVQRQSGTSLNGRPRLSKTGPARVRATLYMAAVVAVRHNPHIQ
FT                   ALYARLLAAGKSKMAALGAAMRKLAHLCFGVLKNRTPYRSDYALPA"
FT   CDS_pept        complement(119462..120865)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40437"
FT                   /db_xref="GOA:A9HW57"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW57"
FT                   /protein_id="CAP40437.1"
FT                   /translation="MTVADMLKIAVVGHTNTGKTSLLRTLTRDSGFGDVADSPGTTRHV
FT                   EGARLRLDGRPVLEWFDTPGMEDSIALLEYLERLDEPGARRDGPSRIRRFLDSPEAHRR
FT                   YEQEARVLAKMLDCDAALYVIDARDPVLSKHRDELTLLAACGRPLLPVLNFVNAPAHRA
FT                   AEWRDAMARLGLHAALEFDTVAPPLDGERQLYAKLAVLLDRHAVTLNRLSDELERQRRE
FT                   RSLAAWQLAADLLIDVAALRVASPADDEALQAHAATLRDQVRRREQACVDALLALYNFR
FT                   RSDYAEDDLPLAGTRWGMDLFHPQALKDMGIQLGAGMAAGAMAGAAVDLFSAGLSLGTG
FT                   MLIGAAAGGLWQGVERFGGRILGKLRGYREITVDDAVLRLLALRQRQLVHALERRGHAA
FT                   RDPLRLDQPADQAWRAGRLPDALKEARSRPEWSALGKGHEDDERRKRVVADLARRLAED
FT                   TGAAAAPEA"
FT   CDS_pept        complement(120852..122291)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0107"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40438"
FT                   /db_xref="GOA:A9HW59"
FT                   /db_xref="InterPro:IPR021296"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW59"
FT                   /protein_id="CAP40438.1"
FT                   /translation="MATHALGAAPAPEPSGAWQTHWLAEAIRLREEHWGPLEDAEAVRQ
FT                   ARLAPDTLEDRILLRARLLGRREGLDSLVARWRQGAMLSLAILLLAAVAAGIASAAGAL
FT                   GDGTRPVNVLWAVGALLGVHALTFLLWLASFLLRPGAATGLGRLWLWATRKLARGPDAA
FT                   LVPQALMNLLGRAGALRWVFGAVSHALWLAGLAAALATLLIMLSTASYRFVWATTLLQP
FT                   DTFVALTRLLGWLPAQFGFAAPADAIVRASDGLQALPAAAQAQWSVWLIGVVAIYGVLP
FT                   RLLAAALCLARAARARRRLRIDTALPGYATLRDRLLPPVQSTGIDRPADPLHQPQVGPG
FT                   RLADLGDQPVLAGLELPADVQWPPAGLPAQVLDAGNLDSREQRNRLLDALAQAGARRLL
FT                   IACDMRQTPDRGTLGLIAALAGKAGQTRVWLSTFGAPAAGGPARLDAWRDRLTAAGMAA
FT                   DAILSDADQPLRWLETDHDSR"
FT   CDS_pept        complement(122292..122666)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0108"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40439"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW62"
FT                   /protein_id="CAP40439.1"
FT                   /translation="MPIANPTYEKAYSDQRFWRKATRHASAAGRQALEKALWLYYAVQN
FT                   PGTPKWARRVIYGALGYFVLPLDAIPDLAPLVGYTDDLGVMTAALATVAFYINDDVKHQ
FT                   ASAKLHDWFGASASTTTRAG"
FT   CDS_pept        complement(122733..123638)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0109"
FT                   /product="Putative HTH-type transcriptional regulator"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40440"
FT                   /db_xref="GOA:A9HW64"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW64"
FT                   /protein_id="CAP40440.1"
FT                   /translation="MNKLASAPSDFTLFHTLRDAGVHLDRAASLGTGLAVAQWNRDQRA
FT                   GRALMDYDTPGHHTLSLYLRGGETCFRLGLHDLRGGAGKFCVLPDQHHSRWAMNEDVRF
FT                   LHLYIAPQRLAREAVVRLDREPRELELRDRTYIQDPSLADSCRALLAADWNVPAARLAA
FT                   SSAAEAVLHHLLAHGTGRPAGRAAPLGGLAPVVRRRVRDYIEAHLADPLTLDVLAGVAA
FT                   LSTYHFARMFHASFGEPPHAWVLGRRLARARALLSSTAHDLAAVARACGFGNASHLSRA
FT                   FVQAAGITPGQYRAAVRAGR"
FT   CDS_pept        123822..124694
FT                   /transl_table=11
FT                   /locus_tag="Bpet0110"
FT                   /product="putative membrane protein"
FT                   /function="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40441"
FT                   /db_xref="GOA:A9HW66"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW66"
FT                   /protein_id="CAP40441.1"
FT                   /translation="MNLFLYLLTVLIWGSTWMAIKLQLGVVAIPVSILYRFALASVVML
FT                   AGLVALGRLQRLSRHGHLLCLGQGLCLFCLNFLCFYSATQWISSGLVSVVFSASTLWNA
FT                   LNARLWFGTRIAPRVMLGGAFGLAGLVLLFWPEVAGQQASHETMLGLGLALLGTLCFST
FT                   GNMLSSAQQRAGIGPLTGNAYSMLYGSLVLLAGCVVTGQSFDFDPSPVYVGALLYLAFF
FT                   GSVVAFTSYLTLVGRLGPARAAYCTVLFPVVALSISTVAEGYRWTLPAVAGLALVMLGN
FT                   VLVFARRAR"
FT   CDS_pept        complement(124760..125818)
FT                   /transl_table=11
FT                   /gene="fimD1"
FT                   /locus_tag="Bpet0111"
FT                   /product="putative fimbrial adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40442"
FT                   /db_xref="GOA:A9HW68"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW68"
FT                   /protein_id="CAP40442.1"
FT                   /translation="MYQHWIKLLVVLGALLSLPQAALALSCKDAQTESVRRVISLTEDI
FT                   YVSTGDITPGKLLWRSENFTVSFRCVDDHNYPGGESSYFYWDPADTMSQIDPAIAVGIT
FT                   LKSVNYQLIKGQHELAGPGTSPPATRANCTMYWNNSSAPRCATSQQVTVTFSVYIVATG
FT                   APPPASGQVNSLGTYDLFQIDGVGGLNDRPNSNYRAAISGLGRIHFISCNPDIRVRANA
FT                   GNAIDFGRIPSSQARAGAIQRSIPFVVEVNMSGPNSGNQCSGRALVGSFSTSQPLQEGT
FT                   TILPRNDSGFGIVLSDADTPTIPIAMNTAVPLGVVNSTTVQHDFIASLKWLSDTPRIGP
FT                   FHATATIDVSFR"
FT   CDS_pept        complement(125821..128451)
FT                   /transl_table=11
FT                   /gene="fimC1"
FT                   /locus_tag="Bpet0112"
FT                   /product="outer membrane usher protein"
FT                   /function="export and assembly of fimbrial subunits across
FT                   the outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40443"
FT                   /db_xref="GOA:A9HW71"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW71"
FT                   /protein_id="CAP40443.1"
FT                   /translation="MNTLLNRFRAATRRGAALPRLAPLAAALYALCGSLPAVAQPEFNL
FT                   DFLRGSAREADVSALASPGAILPGTYPFSVYLNGIETAREDIVFTKAATGRVEPCLSRS
FT                   QLTAWGVLLPDAQDDGAPAACVDLAAAIPDAHASYNGNQQRLDLSVPQRYLVAVPRGYI
FT                   APSLRDQGITAAFLNYNLSGTHNHQKQYGNSDYFFASFNSGLNLGAWRLRHNATVSHES
FT                   RGDGTHWQNQNTWLERDLQSIRSRVLLGDGYTSNNVFDSVQFRGAQLASDDEMLPYSQR
FT                   SYAPVVRGVAASNARVEIRQDGNLIYAVNVAPGPFLINDIVPNRLSGDLEVSVIEADGT
FT                   VQRYRQAFSAVETMLRPGLWRYELNAGELRNGNLSYRPVFLQGTVARGLESNTTPYGGL
FT                   LLAEHYAAASVGVAQSLGEFGSVSVDVTAARTKLASGDTKTGQSYRFLYAKSLNEWGTE
FT                   FRLVGHRYSTSGYYDFSDAAAERDRWRNGYYDATYWDPRETFDGTPGWASSRERHAISN
FT                   TYYNKRNRLEVAVNQQLPGNMSLYASYNNQTYWGSKDKERNIQIGLNGRVKSVSYGLFV
FT                   RDTRSQYGYSDRMVGLNISIPLGRPESSRISSNSSYTHSRESGSSYRTGVSGVALDDNR
FT                   LAYGVNVGHSDGAGTSGAANVDYQGSKAAVSAGVTSSEQYSQFNWGLRGGVLAHGGGVT
FT                   LSQPLQRTAVLVHAPDGAGIGVENQSGVRVDDNGYAVVSGMSPYRFNRVALRTDDLGGD
FT                   IDASKVSANVVPTRGAIVQVDFDTRRGDSLLISSSRPDGKQIPLGANVFNAEGLNRGVA
FT                   GPQGQIFVSGVQPREVLSVQWGDAPGDRCLLDLGQLPATQDDAPAAGYRRVDLQCRPDG
FT                   RPQGS"
FT   CDS_pept        complement(128475..129218)
FT                   /transl_table=11
FT                   /gene="fimB1"
FT                   /locus_tag="Bpet0113"
FT                   /product="pili assembly chaperone"
FT                   /function="P pilus assembly protein chaperone PapD"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40444"
FT                   /db_xref="GOA:A9HW74"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW74"
FT                   /protein_id="CAP40444.1"
FT                   /translation="MNIYSHPLRRGAAWFKRLAAGIALGLAAHGGAQAAIHVQATRVIY
FT                   NGKSASASVAISNNSTLPYMVQTWLDKGDPTAMPDNLPMAITPPLMRLSPGEEALVRTI
FT                   YAGQGLPADRESLFWINIQEIPPSAEASNALQVAIRTRIKLFYRPAQLKTTLDEAARAL
FT                   QWRISGQTLQVTNPSPLHITFSHIQGRDAGGGAKNIDADMIAPGQTLNVPLRQLNLASG
FT                   AASLRFGYINDYGGISEVASAPLQH"
FT   CDS_pept        complement(129327..129857)
FT                   /transl_table=11
FT                   /gene="fimA1"
FT                   /locus_tag="Bpet0114"
FT                   /product="type-1 fimbrial protein"
FT                   /function="P pilus assembly protein pilin FimA"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40445"
FT                   /db_xref="GOA:A9HW76"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW76"
FT                   /protein_id="CAP40445.1"
FT                   /translation="MNSSMAFILKRTALGLALAGALPMAAQAASGTVEFQGEIIQSTCD
FT                   VTTATKDQTVVIGTYPTTLFKNVGDVSASKGFTIGLENCVPGDYTIRFDGQAPAGQPEL
FT                   LAVNVATGVGIEILDNNDKVFPLNQDITDPAIVSVAADGTATVNLKARYKSFEQTVGAG
FT                   EANATSTFSIEYR"
FT   CDS_pept        complement(130425..131201)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0115"
FT                   /product="Carboxyvinyl-carboxyphosphonate phosphorylmutase"
FT                   /function="PEP phosphonomutase and related enzymes"
FT                   /EC_number="2.7.8.23"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40446"
FT                   /db_xref="GOA:A9HW78"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW78"
FT                   /protein_id="CAP40446.1"
FT                   /translation="MGKSTKQVLREKVARRDGLIVAGAFNAMSAKVVADQGFEAVYLTG
FT                   AGLTNMHYGVPDLGIIGLRDVADATLRIREAVPELPLIVDIDTGFGNAVNAWHTVRALE
FT                   RAGADAVQIEDQVFPKRCGHFAGKAVAPLSEMLDKIRAATDARTDPDFQIIARTDARAV
FT                   EGFDATIERARQFAEAGADVLFVEAMTSLDEIRQIPQLLKHPLLINIVVGGKTPTLTAR
FT                   ELGDMGYSLVLYANAALQARCWACRKPCPPSSATAS"
FT   CDS_pept        complement(131236..131430)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40447"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW81"
FT                   /protein_id="CAP40447.1"
FT                   /translation="MTQELAAFIAGIEPGALRQPDLREKLQNVGVTTINEGPAQAGELL
FT                   MSEAARWHKLITAAKIRLE"
FT   CDS_pept        131659..132411
FT                   /transl_table=11
FT                   /locus_tag="Bpet0117"
FT                   /product="predicted permease"
FT                   /function="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40448"
FT                   /db_xref="GOA:A9HW82"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW82"
FT                   /protein_id="CAP40448.1"
FT                   /translation="MSFVPPDITTVFAAVLVITSFLTSALTAAMGLGGGVAMLAVLSLG
FT                   LPVTSVLPVHGVVQMGSNSGRVIIQRRHLVTPVLLWFALGSLAGIALGASVVISIPDAL
FT                   AKGTLALFILWSVYRKKPSATAQRHGKTYFVLGGAISSFCTMLVGATGPLVAALLARTG
FT                   LIKQPLVATHAACMVIQHGMKILVFGTLGFAYAQWAPLIAAMIASGLAGTWVGTRTLDN
FT                   LPEATFRLGFKIVMTAVSLHMLWQAFAR"
FT   tRNA            complement(132412..132487)
FT                   /gene="b_petrii_trna_01"
FT                   /locus_tag="Bpettrna_01"
FT                   /anticodon="(pos:132452..132454,aa:Thr)"
FT   CDS_pept        complement(132561..133004)
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="Bpet0118"
FT                   /function="Stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40449"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW85"
FT                   /protein_id="CAP40449.1"
FT                   /translation="MGETSTKPYLLRALHEWCTDNGYTPYITVQVDEHTLVPVAHVRDG
FT                   QITLNVGTLATNKLVLGNEFIEFQARFSGVTENVSVPVAAVSAIYARETGAGMGFEVQP
FT                   YEAPRREDAAVDPSAAETAGEASTPSDDGGDDEPKRPHLTIVK"
FT   CDS_pept        complement(133023..133634)
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /locus_tag="Bpet0119"
FT                   /product="stringent starvation protein A"
FT                   /function="Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40450"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW87"
FT                   /protein_id="CAP40450.1"
FT                   /translation="MMVLYSGTTCPFSQRCRFVLFEKGMDFEIRDIDLYNKPEDISVMN
FT                   PYGQVPILVERDLVLYESNIINEYIDERFPHPQLMPADPVMRARTRLFLYNFEKELFVH
FT                   VSTLEDRSAKPDEKKLATARQNIRDRLAQLAPLLLKNKYMLGDEFSMLDVAVAPLLWRL
FT                   DHYGIELPKNAAPLQKYAERIFSRPAYIEALTPSEKVMRR"
FT   CDS_pept        complement(133778..134632)
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="Bpet0120"
FT                   /product="cytochrome C1 precursor"
FT                   /function="Cytochrome c1"
FT                   /EC_number="1.10.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40451"
FT                   /db_xref="GOA:A9HW89"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW89"
FT                   /protein_id="CAP40451.1"
FT                   /translation="MTMIKKLIGAVAFTLACTAAYASEGGYPLDAAPNRVNDVAALQNG
FT                   AKLFVNYCLNCHSASAMRYNKLQDIGLTDEQIKENLLFTGEKVGDLMHVAMRPEDAKRW
FT                   FGTTPPDLSVIARAKSINAGPSGADYIYTYLRTFYRDTARATGWNNLVFPNVGMPHVLW
FT                   ELQGPRELTTVAMHQVEGKDGATSWERVTTTYDPQGYAAVKTEPVADFHGHASLEAKFK
FT                   ALDPAKAAAYDNDVADLTAFLAWMAEPGQLFRKQLGVWVLLFLGLFLVVAWRLNASFWK
FT                   HVR"
FT   CDS_pept        complement(134652..136040)
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="Bpet0121"
FT                   /product="ubiquinol-cytochrome c reductase cytochrome b
FT                   subunit"
FT                   /function="Cytochrome b subunit of the bc complex"
FT                   /EC_number="1.10.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40452"
FT                   /db_xref="GOA:A9HW92"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW92"
FT                   /protein_id="CAP40452.1"
FT                   /translation="MAGEKTVETTGLLGWLDRRFPVTSTWKAHLSEYYAPKNFNFWYFF
FT                   GSLALLVLVIQIVTGIFLVMHYKPDAERAFLSVEYIMREVPWGWLVRYMHSTGASMFFV
FT                   VVYLHMLRGLFYGSYRKPRELVWIFGVAIFLCLMGEAFFGYLLPWGQMSYWGAQVIVNL
FT                   FSAIPFIGPELSIWIRGDYVVSDATLNRFFSFHVIAIPLVLIGLVAAHIVALHEVGSNN
FT                   PDGVEIKQGPKDKHGRPIDGIPFHPFYTVHDIMGVAGFLIVFAAIVFFGPEMGGYFLEY
FT                   NNFIPADPLKTPPHIAPVWYFTPFYSMLRATTNEFTWVLAGAAVLGAIALLVKSNLKGF
FT                   LRIAVPGLLIVVAVLLRVIDAKFWGVVAMGGAVVILFFLPWLDHSPVKSIRYRPSWHKW
FT                   FYGIFIVNFLVLGFLGTQPPNDAYNLMSQIGTLIYLGFFFLMPVWSRLGTFKPVPDRVT
FT                   FHAH"
FT   CDS_pept        complement(136105..136746)
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="Bpet0122"
FT                   /product="ubiquinol-cytochrome C reductase iron-sulfur
FT                   subunit"
FT                   /function="Rieske Fe-S protein"
FT                   /EC_number="1.10.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40453"
FT                   /db_xref="GOA:A9HW94"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW94"
FT                   /protein_id="CAP40453.1"
FT                   /translation="MSQDTLVHDDDGAVDPNLPPDPSRRFWVTTACAVGGVAGVATAVP
FT                   FVSTFAPSEKARAAGAPVEVDVADLAPGQMRTVEWRGKPVWIIHRSQDQLAGIKSQDPY
FT                   LADPNSDRPGFTPEYAKNEYRSRKPELFVCVGICTHLGCSPTAHFESGGGGGLPSSWEG
FT                   GFLCPCHGSTFDLAGRVYKNKPAPDNLEVPPYQYLSDTRIIVGVDEDNKA"
FT   CDS_pept        136883..137329
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="Bpet0123"
FT                   /function="Large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40454"
FT                   /db_xref="GOA:A9HW97"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HW97"
FT                   /protein_id="CAP40454.1"
FT                   /translation="MSKASGFLKEFRDFAVKGNAIDLAVGVIIGAAFGKIVDSVVKDLI
FT                   MPLVNYILGGSVDFSNKFLVLSAPDGYAGPMTYADLTKAGAIVLAWGNFLTILINFILL
FT                   ALVVFIIVKAINAARRKEEEAPAEPAAPPEDVVVLREIRDLLKK"
FT   CDS_pept        complement(137352..138128)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0124"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40455"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:A9HW99"
FT                   /protein_id="CAP40455.1"
FT                   /translation="MKTIDTRELAAWLDATLQAPRFKDYCPNGLQVEGKPRVGHIITGV
FT                   TASEALLRAAIERGADAVLVHHGWFWKNEDPRVRGPRRTRLAVTLAHDLNLFAYHLPLD
FT                   AHPQWGNNAQLARVLGLEPEFDATGAPLTCGPDNLIWLGTAPGLDTLDALAERVRQRLG
FT                   RAPLVVGEPGRPLARVAWCTGAAQGMLADAVQAGADAYITGEASEPTVHLARETGTGFI
FT                   GAGHHATERYGVQALGQAVAQQFGIRVEFVDIDNPV"
FT   CDS_pept        138148..139296
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /locus_tag="Bpet0125"
FT                   /product="protease"
FT                   /function="Trypsin-like serine proteases typically
FT                   periplasmic contain C-terminal PDZ domain"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40456"
FT                   /db_xref="GOA:A9HWA1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWA1"
FT                   /protein_id="CAP40456.1"
FT                   /translation="MRRYWLIFAQAVTVCLAILFVVTTLRPDWLRLSASAPGAAPVPGG
FT                   ARVPGESSYAAAVAKAAPAVVNVFTSKHVNVPLVPLPDDPVLRQLFGQVPGLSRRESST
FT                   SLGSGVIVSGEGYVLTNYHVVEAADAIEVALADGRRGSAKVVGADPDTDLAVLKLDAGT
FT                   RPLPVAALAADRNLRVGDVVLAIGNPFGVGQTTTQGIVSALGRNGLGINTYENFIQTDA
FT                   AINPGNSGGALIDAQGNLVGINTAIYSESGGSLGIGFAIPIDAARKVMDDIVKTGSVRR
FT                   GWLGIEPQDITPELARAFGLPADTHGVVIAGVMRDGPAGKAGLRVGDIVQTVNGAPVLD
FT                   TVSMLRLTAALPPGEKASLGILRGGKARDVTVVAGTRPARPR"
FT   CDS_pept        complement(139339..139689)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0126"
FT                   /product="putative DNA-binding protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40457"
FT                   /db_xref="GOA:A9HWA4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWA4"
FT                   /protein_id="CAP40457.1"
FT                   /translation="MTLAHRLRARMQWRGIKSQNQLARISGVPQSSIHRILTRDETYSP
FT                   TRSTLQRLAMALDTTVPWLTDGIEGAAPGAVPARAAPSDGYTAELQALMSKLPTDTRKK
FT                   IVAVVRLIANDA"
FT   CDS_pept        complement(139787..140590)
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="Bpet0127"
FT                   /product="Sec-independent protein translocase protein"
FT                   /function="Sec-independent protein secretion pathway
FT                   component TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40458"
FT                   /db_xref="GOA:A9HWA6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWA6"
FT                   /protein_id="CAP40458.1"
FT                   /translation="MTQDAKPDELDQEQPQETFISHLVELRSRLMKAAVAVLGIFVVLF
FT                   IYPGASVIYDVLAQPMLASLPEGTRMIATGVITPFMVPVKVTLMAAFVVALPVVLYQAW
FT                   AFVAPGLYRHEKRLALPLIVSSTLLFILGMAFCYFFVFRTVFHFIATFAPQSITPAPDI
FT                   EAYLSFVMTMFMAFGITFEVPVAVVLLVKTGIVELSKLRSARGYVVVGAFIIAAVVTPP
FT                   DVVSQFMLAVPLVLLYEVGLICARMVTPEKKDHDADAASGLTEHH"
FT   CDS_pept        complement(140587..141018)
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="Bpet0128"
FT                   /product="Sec-independent protein translocase protein"
FT                   /function="Sec-independent protein secretion pathway
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40459"
FT                   /db_xref="GOA:A9HWA8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWA8"
FT                   /protein_id="CAP40459.1"
FT                   /translation="MFDVSFTELMVIGVIALIVIGPERLPKVARTVGHLLGRAQRYVND
FT                   VKSDIQREIEIDELRKFKSEMDEAANSVQSSLRDTENTLRNDLNDTAREARQAVSGSPA
FT                   AEPAEPAPPVADAPQAVQAPEAPAAPAQPADQPKTGATP"
FT   CDS_pept        complement(141096..141323)
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="Bpet0129"
FT                   /product="Sec-independent protein translocase protein"
FT                   /function="Sec-independent protein secretion pathway
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40460"
FT                   /db_xref="GOA:A9HWB1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HWB1"
FT                   /protein_id="CAP40460.1"
FT                   /translation="MGSFSIWHWLIVLVIVALVFGTKKLRNIGSDLGGAVKGFKEGMKD
FT                   ANSDKPAEQVTQQKVADDTIDVQAKEKTNS"
FT   CDS_pept        complement(141342..141710)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0130"
FT                   /product="MttA/Hcf106 family protein"
FT                   /function="Diadenosine tetraphosphate (Ap4A) hydrolase and
FT                   other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40461"
FT                   /db_xref="GOA:A9HWB3"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWB3"
FT                   /protein_id="CAP40461.1"
FT                   /translation="MSDNCIFCKIARGEIPSKKVHEDEEFVAFHDINPAAPVHLLLIPR
FT                   RHVVSLQDIGPEDAGWLGRMVTLASRLAADNGCRPGPEGGFRLMANSGVEGGQEVPHLH
FT                   FHIIGGQRPWKGRMAPNA"
FT   CDS_pept        complement(141724..142074)
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="Bpet0131"
FT                   /function="Phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40462"
FT                   /db_xref="GOA:A9HWB5"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWB5"
FT                   /protein_id="CAP40462.1"
FT                   /translation="MSTAAPSTTDTLARLADTLATRRPDRGGDPQSSYTARLLAKGPDA
FT                   FLKKIGEEATELVMAAKDGVPERIVSETADLWFHCLVTLTHYNLRPEDVLAELARREGL
FT                   SGLEEKARRPAS"
FT   CDS_pept        complement(142071..142475)
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="Bpet0132"
FT                   /function="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40463"
FT                   /db_xref="GOA:A9HWB8"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HWB8"
FT                   /protein_id="CAP40463.1"
FT                   /translation="MNTDPAWMADVAFDDNGLIPAIAQDAENGQILMVAWMNREALAET
FT                   AATGRAVYWSRSRQRLWRKGEESGHTQTVHDLRLDCDGDVVLLKVHQEGGIACHTGRAS
FT                   CFFRRLEGPAGSASWVTVDPVLKDPEHIYK"
FT   CDS_pept        complement(142485..143312)
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="Bpet0133"
FT                   /product="histidine biosynthesis protein"
FT                   /function="Imidazoleglycerol-phosphate synthase"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40464"
FT                   /db_xref="GOA:A9HWC0"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWC0"
FT                   /protein_id="CAP40464.1"
FT                   /translation="MNAATTQGAAEQGTGAATALTRRIIPCLDVTAGRVVKGVNFVNLA
FT                   DAGDPVEIARRYDEQGADELTFLDITATSDGRDLILPIIEQVASQVFIPLTVGGGVRQV
FT                   SDIQRLLNAGADKISINSAAVANPELVRAAADYHGSQCIVVAIDARRVSQPDEPARWEV
FT                   FTHGGRKPTGLDAVQWASRMAAYGAGEILLTSMDRDGTKAGFDLELTRAVSDAVPVPVI
FT                   ASGGVGSLQHLADGVTTGRASAVLAASIFHFGQHTVRECKAFMAKQGIAVRLD"
FT   CDS_pept        complement(143309..144049)
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="Bpet0134"
FT                   /product="histidine biosynthesis protein"
FT                   /function="Phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribonucleotide (ProFAR) isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40465"
FT                   /db_xref="GOA:A9HWC3"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HWC3"
FT                   /protein_id="CAP40465.1"
FT                   /translation="MLLIPAIDLKDGRCVRLRQGDLDEATVFSEDPAAMATHWLDLGAR
FT                   RLHLVDLNGAVAGKPKNDAPIKAILDAVGDDIPVQIGGGIRDLDTIESYLDAGISYVII
FT                   GTAAVKNPGFLQDACGAFPGHIIVGLDARDGKIATDGWSKLTRHDVLDLAKKFEDYGCE
FT                   AIIYTDISRDGMLSGVNVDATVRLAQHVRIPVYASGGIAGLSDIEALCAVEEEGVEGAI
FT                   LGRSIYEGALDFQAAQARADELTQ"
FT   CDS_pept        complement(144114..144767)
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="Bpet0135"
FT                   /product="amidotransferase"
FT                   /function="Glutamine amidotransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40466"
FT                   /db_xref="GOA:A9HWC6"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWC6"
FT                   /protein_id="CAP40466.1"
FT                   /translation="MTTIAIVDYGMGNFHSVARALRFAAPDADIRICNRAADIDAADRV
FT                   VFPGQGAMPDCMRTLNESGLREAVVRAARAKPLLGVCVGEQMLFEASEEGDTPCLGLFP
FT                   GKVRRFAGAQFAGDDLAQNGAERLKVPHMGWNQVRQTRSHALWDGIPDHTHFYFVHSYY
FT                   AAPADPALTVGETDYGVTFTCAVAAANIFAVQFHPEKSAAHGLRLYRNFVDWNP"
FT   CDS_pept        complement(144789..145376)
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="Bpet0136"
FT                   /function="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40467"
FT                   /db_xref="GOA:A9HWC8"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HWC8"
FT                   /protein_id="CAP40467.1"
FT                   /translation="MRTAEITRNTNETRIRVAVNLDGTGKQTLDTGVPFLDHMLDQIAR
FT                   HGLIDLDIKAEGDLHIDAHHTVEDVGITLGMAIAKAVGDKAGLRRYGHAYVPLDEALSR
FT                   VVIDFSGRPGLEYHIPFTRARIGDFDVDLTREFFQGLVNHALVTLHIDNLRGVNAHHQC
FT                   ETVFKAFGRALRMALELDPRMGGAVPSTKGVL"
FT   CDS_pept        complement(145392..146492)
FT                   /transl_table=11
FT                   /gene="hisC1"
FT                   /locus_tag="Bpet0137"
FT                   /product="putative histidinol-phosphate aminotransferase"
FT                   /function="Histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40468"
FT                   /db_xref="GOA:A9HWD1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWD1"
FT                   /protein_id="CAP40468.1"
FT                   /translation="MNAANPADRITATVRADIRVLTAYPVPPAADGIKLDAMECPYALP
FT                   DAVRDDIARAVRETALNRYPPGDPTALANEVRQAFGIPPQAGLLFGNGSDELIHLIVQA
FT                   CCQPGDTVLSPWPSFVYFDMAARFDHARFVGVPLTADLQLDLPAMLQAIAQHRPKVVFL
FT                   ALPNNPTGGLWPDAAVQAILDAAPGLVVLDEAYQPFAGHSWMPRLPELPHAVVLRTVSK
FT                   IGLAGLRFGYLAGHPDWIAEFDKVRPPYNLNVLTQAALRAVLRHKPVLDGQAARLRADR
FT                   EPLADSLAALPGVTVYRSAANFVLARFSGKPGGNAVHLALKTRKILVKNVAGAHPLLAD
FT                   CLRISVGTPDENRALLSALQDILSSN"
FT   CDS_pept        complement(146489..147796)
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="Bpet0138"
FT                   /function="Histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40469"
FT                   /db_xref="GOA:A9HWD4"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWD4"
FT                   /protein_id="CAP40469.1"
FT                   /translation="MAALINRLDSRQPDFASALSKLLAFEAAEDESIDRAAAGILADVR
FT                   SRGDAALLEYTQRFDRVAAATAEALEIPKADWHAALAALPAAQRNALETAADRVRAYHE
FT                   HQRGETWTYTDSEGNLLGQQITPLDRVGLYVPGGKAAYPSSVLMNAIPAKVAGVPELVM
FT                   VTPTPDGARNPIVLAAAAIAGVDRAFAIGGAQAIGALAYGTATVPAVDKIVGPGNAYVA
FT                   AAKRRVFGTVGIDMIAGPSEILVICDGKTPADWIAMDLFSQAEHDELAQSILLCPDAAF
FT                   IDEVEAAIARLLPTMPRADILRVSLANRGALILVRDLEEACAIANDIAPEHLEISTEQP
FT                   EHWTARIRHAGAIFMGRFSSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIQ
FT                   VSRQGAQTLGRIAAELALGEGLPAHAASAQYRLDTQ"
FT   CDS_pept        complement(147902..148582)
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="Bpet0139"
FT                   /function="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40470"
FT                   /db_xref="GOA:A9HWD6"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWD6"
FT                   /protein_id="CAP40470.1"
FT                   /translation="MSSTPAAPITLALSKGRIFEETLPLLAEAGIEVAENPEKSRKLIL
FT                   PTSDPALRLIIVRASDVPTYVQYGAADLGIAGKDVLIEHAAQHPGGLYQPIDLDIAKCR
FT                   LCVAVRNGFDYQAAVHQGARLRVATKYVQSAREHFAAKGVYVDIIKLYGSMELAPLVGL
FT                   ADCIVDLVSSGGTLRANDLVAVEDIMAISSRLIVNQASLKTRGARLQPLLQAFQRAAQG
FT                   TAAS"
FT   CDS_pept        complement(148579..149847)
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="Bpet0140"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /function="UDP-N-acetylglucosamine enolpyruvyl transferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40471"
FT                   /db_xref="GOA:A9HWD9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HWD9"
FT                   /protein_id="CAP40471.1"
FT                   /translation="MDKLRITGGAQLRGEVTISGAKNSALPILCAGLLTADPLVLANVP
FT                   DLNDTSTMLRLLGRMGVRAERGADGIVTVQASQVDNLEAPYDLVKTMRASILVLGPLLA
FT                   RFGQARVSLPGGCTIGQRPVDQHIKGMAALGADIRIEHGFVVAQAARLKGASIRTDMVT
FT                   VTGTENLLMAAVLAEGQTVLENAAREPEIVDLAELLIKMGARIQGHGTDRIVIDGVASL
FT                   HGAEHSVIPDRIEAGTFLCAVGAAGGDITLRNAAPDTLGATLDKLIEAGLTIETGPDWI
FT                   RGAMQGRPRAVGARTHEYPGFATDMQAQLMALDTVAQGTAVIVENIFENRYMHVQELRR
FT                   MGADIDIDGHTAVVRGVPRLSGAAVMATDLRASASLVIAGLAAEGQTQVDRIYHLDRGY
FT                   DRMEVKLRALGANIQRLTGKEPA"
FT   CDS_pept        complement(149847..150092)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0141"
FT                   /product="BolA-like protein"
FT                   /function="Predicted transcriptional regulator BolA
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40472"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWE1"
FT                   /protein_id="CAP40472.1"
FT                   /translation="MLPTPEQVRQYIADNLPCEHLDVQGDGSHFDAVIVSPAFEGKRLI
FT                   ARHQLVYAALGERMKAEIHALSMRTMTPEEYAKAGN"
FT   CDS_pept        complement(150098..150907)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0142"
FT                   /product="putative ABC-2 type transporter protein"
FT                   /function="ABC-type multidrug transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40473"
FT                   /db_xref="GOA:A9HWE3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWE3"
FT                   /protein_id="CAP40473.1"
FT                   /translation="MTPPLTPAAPLVQPRLDAGSGFPTLLRKELLRFWKVAFQTIAAPV
FT                   VTALLYLLVFAHVLEGRVMVYGTVPYTSFLIPGLMMMSMLQNAFANPSSSLIQSRITGN
FT                   LVFVLLPPLSHREIFSAYLLAAMARGLAVGACVWLVAVCFTPLPPAHPLWIVIFAVLAS
FT                   GIMGTLGLVAGLWSEKFDQLAVFQNFLIMPATFLSGVFYSIHTLPPFWQAVSHWNPIFY
FT                   TIDGFRYGFFSVSDVSPWHSLAVVSGVFAVLAIFAMRLLASGYKLRN"
FT   CDS_pept        complement(150904..151713)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0143"
FT                   /product="probable ATP-binding ABC transporter protein"
FT                   /function="ABC-type multidrug transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40474"
FT                   /db_xref="GOA:A9HWE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWE5"
FT                   /protein_id="CAP40474.1"
FT                   /translation="MSAVSLDHVSKIYPPRSPGWKRLLGHTAGPGFQALNDVSLTIEPG
FT                   EFFGLLGPNGAGKTTLISILAGLARATSGRASVCGYDVATDYKSARRALGVVPQELVYD
FT                   PFFTVRETLRIQSGYFGLRKNDDWIDEILFNLGLADKANANMRALSGGMKRRVLVAQAL
FT                   VHRPPVIVLDEPTAGVDVDLRRTLWEFISRLNKAGHTIMLTTHYLEEAEALCGRIAMLK
FT                   AGRIVALDTTQALLARVGGVDLEDAFVRIMHRDDAPVADLEPEEIAS"
FT   CDS_pept        complement(151799..152434)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0144"
FT                   /product="putative exported protein"
FT                   /function="ABC-type transport system involved in resistance
FT                   to organic solvents auxiliary component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40475"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWE8"
FT                   /protein_id="CAP40475.1"
FT                   /translation="MRFPVYSLLQRLFFAGVLGLLTATAAAQAKPDPHGAPDQFVLDAA
FT                   NEALAALKADGQLRSGDLARVNQAVDTYILPYVNFRKTTQLAAGRYWRQATAEQKTALA
FT                   DAFRGTLIRTYSGALTGVTQATTIKLLPFRGDPNADDVVVRSLITQANGQPVGVDYRLE
FT                   KDPQQGWRIYDMNVEGIWLIQNYRNQFAQEINQSGIDGLIKALNQRNQ"
FT   CDS_pept        complement(152468..153298)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0145"
FT                   /product="putative lipoprotein"
FT                   /function="Surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40476"
FT                   /db_xref="GOA:A9HWF1"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWF1"
FT                   /protein_id="CAP40476.1"
FT                   /translation="MNMPTYARLASVLAACALTAGCATPGNPDPRDPWEGFNRGVYKFN
FT                   DTVDRALLKPVAQAYTYVTPQPVRSCIHNMFSNVGDLWGATNSFLQGRGHDFVNTLGRF
FT                   LFNTTMGIGGCFDVASANGARKIPNDFGTTLGVWGFGQGPYLVLPILGASTVRDGVGLI
FT                   GDWQGGMITYSNPGAIENTRWRNSLWGLDIVDTRASLLDTTDMVDRVALDPYSFVRDAY
FT                   LQRRAAMVRGTATGEGNLPDYSDDGGDLPDYSDDGDDKAAPASAPAQPPAAPKP"
FT   CDS_pept        complement(153407..153883)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0146"
FT                   /product="mce related protein"
FT                   /function="ABC-type transport system involved in resistance
FT                   to organic solvents periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40477"
FT                   /db_xref="GOA:A9HWF3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWF3"
FT                   /protein_id="CAP40477.1"
FT                   /translation="MSREKTDFWVGLFVLLGAAALVFLALRAGNLSSFSFTPTYTLTAN
FT                   FDNIGGLKVRAPVKSAGVVVGRVGKISFDDKVFQAVVTLDLEEGYQFPKDSSASILTSG
FT                   LLGEQYVGLSAGSEEENFADGGKIRYTQSAVVLEQLISKFLYGSAEKQGSTPGN"
FT   CDS_pept        complement(153896..154675)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0147"
FT                   /product="putative membrane protein"
FT                   /function="ABC-type transport system involved in resistance
FT                   to organic solvents permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40478"
FT                   /db_xref="GOA:A9HWF5"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWF5"
FT                   /protein_id="CAP40478.1"
FT                   /translation="MSGPVQALGGWVRAQVSGVGFFTRFLGALLARSGIAVSRPRLVSQ
FT                   QVHFIGNYSLLIIIVSGMFVGFVLGLQGYYTLNRYGSEEALGLLVALSLVRELGPVVTA
FT                   LLFAGRAGTSLTAEIGLMKAGEQLAAMEVMAVDPMRRVLVPRLWGGIIAMPVLAAVFSM
FT                   VGILGGWVVGVLLIGVDAGAFWSQMQSGVDVWDDVANGVLKSLVFGVTVTLVALYEGWQ
FT                   ARPTPEGVARATTRTVVVGSLAVLGLDFLLTALMFGN"
FT   CDS_pept        complement(154672..155508)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0148"
FT                   /product="putative ABC transport system ATP-binding
FT                   protein"
FT                   /function="ABC-type transport system involved in resistance
FT                   to organic solvents ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40479"
FT                   /db_xref="GOA:A9HWF8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWF8"
FT                   /protein_id="CAP40479.1"
FT                   /translation="MPDHIPDSPDLALSLDGVALGYGDFTVLQDINMAVQAGQVVAVMG
FT                   GSGSGKTTLLRAATGQLPALRGQVRVFGTDIGQANGDTVQALRKRMGVLFQQGALFTDL
FT                   NVFENVAFPLREHTRLPEPEVTARVLDKLDAVGLRAAAHLRVAEISGGMSRRVALARAV
FT                   VLEPELILYDEPFAGLDPISMGITARLIRDLADRLHCASVLITHDVQESFAIADQVYLV
FT                   GQGRLVAAGTPQTLSDSQDPYVRQFLRGEPDGPVAFQYPDTPAFQAWLAQQEGRKP"
FT   CDS_pept        complement(155734..156924)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0149"
FT                   /product="probable MFS permease"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40480"
FT                   /db_xref="GOA:A9HWG0"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWG0"
FT                   /protein_id="CAP40480.1"
FT                   /translation="MPAASIPRSSFPLLLAWPGLLALAVAMGIGRFAFTPLWPLMAQDA
FT                   GLSLAQGGWLASANYAGYLLGALAAVAFPIRRLRAGLLGSLAAAGLLTLAMGQLDGMAA
FT                   WLALRLAAGYASAYTFICVAAWRPVPAGDPREGPVMNWTYAGVGIGIAASGLACLVLMQ
FT                   QGASADASWRALGVLALAASAMVAAALVRAPAPAPAARATPAKHAAHGISQASPGGERG
FT                   ARWLVLHYGLFGMGYIVPATFLPAMAKAQVSDPAVFGWVWPCFGAAAAVSCLLAPRLAR
FT                   GRNERHIWRAAQLLMAAGMAAPALLDSLGATALAALLVGGTFVVITQAGMQAARRSAGG
FT                   NAARAAAAMTAAFALGQILGPLAAAWAARHGIGLPAVLAASAALLAAGALALPQRA"
FT   CDS_pept        156989..157864
FT                   /transl_table=11
FT                   /locus_tag="Bpet0150"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40481"
FT                   /db_xref="GOA:A9HWG2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWG2"
FT                   /protein_id="CAP40481.1"
FT                   /translation="MRNLDLDALQIFKAVAERGGVARAAAHLNRVQSNVSTRLRQLEAA
FT                   LGATLFQRQNRRLVLSAQGRLLLDYADRLLQLSDEAQAALRAGTPGGLLRVGTMESTAA
FT                   ARLPPILAAYHQTWPQVRIELVSGTSGALVNQVHRGDIEAAFVARPYAEDGLDAAPAFT
FT                   EELALISPLARPPVERAQDLRGATLIAFSTGCSYRRILETWLAQENVAPGSIMEFASYH
FT                   AIVACVAAGTGVAIVPRSVLGVLQAEASLRVCALPQPFAQAPTMLVWRRGHQSPALDAL
FT                   RAGLPGAAAA"
FT   CDS_pept        complement(157861..158487)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0151"
FT                   /product="outer membrane protein precursor"
FT                   /function="Outer membrane protein W"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40482"
FT                   /db_xref="GOA:A9HWG4"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWG4"
FT                   /protein_id="CAP40482.1"
FT                   /translation="MSLRTLLAAALCTAGLTAPLAHAHEAGDWLFRLGVTQVSPKSNNG
FT                   SVLNGAVDLDVSSNVRPSFTVAYMATRHIGIELLGAWPFQHDIRGSGGLGKIGTTKHLP
FT                   PTLSLQWHFLPDSTVQPYVGVGLNYTHFFDTQTRGALSGSDLKLGDSWGLAGQVGVDVK
FT                   LDDRWFLNADLRYIDISSKVKLDGQRIGTARIDPWVATVAVGYRF"
FT   CDS_pept        complement(158655..160121)
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="Bpet0152"
FT                   /product="glutamate synthase (NADPH) small chain"
FT                   /function="NADPH-dependent glutamate synthase beta chain
FT                   and related oxidoreductases"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40483"
FT                   /db_xref="GOA:A9HWG7"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWG7"
FT                   /protein_id="CAP40483.1"
FT                   /translation="MGKITGFMEFQRLQEAAEAPQKRLKNWREFVLHLNDEQSKQQAAR
FT                   CMDCGIPFCNNGCPVNNIIPDWNDLVYRQEWRRALDVLHSTNNFPEFTGRICPAPCEAA
FT                   CTLNINSDAVGIKSIEHAIIDKGWAEGWVVPQVPARKTGKKVAVVGSGPAGLACAQQLA
FT                   RAGHSVTVFDKSDRIGGLLRYGIPDFKLEKAQIDRRIAQMEAEGVEFAPSTYVGNPADP
FT                   IADGLTVRTPDSLLAEFDAVVMSGGSETPRDLPVPGRELDGVYFAMDFLRQQNKAVAGD
FT                   RLTGQTLAKGKHVVVIGGGDTGSDCVGTSNRQGAASVTQFELMPQPPESENKPLVWPYW
FT                   PLKLRTSSSHEEGCERDWSVTTKLFKGSNGKVEKLVGARVEWFKDEATGQMKMREVEGS
FT                   EFEIQADLVLLAMGFVSPVQNVLDAFGVDRDARGNVRANTDDYRTSVDKVFAAGDMRRG
FT                   QSLVVWAIREGRQCARAVDEYLMGATELPR"
FT   CDS_pept        complement(160139..164875)
FT                   /transl_table=11
FT                   /gene="gltB,asb"
FT                   /locus_tag="Bpet0153"
FT                   /product="glutamate synthase, large subunit"
FT                   /function="Glutamate synthase domain 2"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40484"
FT                   /db_xref="GOA:A9HWH0"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWH0"
FT                   /protein_id="CAP40484.1"
FT                   /translation="MSPTSKDTSCRPAETPIDARRIGIPARQGLYNPEHEHDACGVGFV
FT                   AHIKGRKSHAIIQQGLKILENLDHRGAVGADKLMGDGAGILIQIPDALYRDEMGQQGVV
FT                   LPPPGEYGVAMVFLPKETASRLACEQELERAVRAEGQTVLGWRDVPVDVDMPMSPTVRS
FT                   VEPVIRQLFIGRGADVMVPDALERKLYVIRKTASHAIQAMRLAHGKEYFVPSASVRTVV
FT                   YKGLLLADQVGRYYRDLADPRTVSALALVHQRFSTNTFPAWPLAHPYRMIAHNGEINTV
FT                   KGNFNWLRAREGMMQSAVLGDDLKKLYPIVYEGQSDTATFDNCLELLVNSGYSLAHAMM
FT                   MMIPEAWEQHPHMDESRRAFYEYHAAMMEPWDGPAAVAFTDGRQIGATLDRNGLRPARY
FT                   LITDDDMVIMASEAGTLSIPENRIIKKWRLQPGKMFLIDLEQGRIIDDAEIKLQLANSR
FT                   PYRQWIERLQIKLESLPAPKPAAPAAQSAVSLLDRQQAFGWTQEDYKFILEPMAATGEE
FT                   VIGSMGNDAPLAVLSNRAKPFYNYFRQLFAQVTNPPIDPIREQMVMSLVSFIGPKPNLL
FT                   DINNVNPPLRLEVSQPVLDFAAMAQIRDIEQATGKKFRSYELDITYPVAWGSEGIEARV
FT                   AALCARAVDAVQSGYNILIVSDRLVDSERVAIPALLATSAVHQHLIRAGLRTATGLVVE
FT                   TGSAREVHHFALLGGYGAEAIHPYLALESLSRMPNPEKAVKNFIKAIGKGLNKVMSKMG
FT                   ISTYMSYTGAQIFEAVGLQRALVDKYFTGTASNVEGIGIFQVAEEALRQHRAAFSTDPV
FT                   LANDLDAGGEYAFRVRGEEHMWTPDSIAKLQHASRANNYRTYKEYAQIINDQSRRHMTL
FT                   RGLFEFRFDPARAIPLDEVEPAKEIVKRFATGAMSLGSISTEAHTVLAVAMNRIGGKSN
FT                   TGEGGEDELRYRAEMRDGKSNIKDGDTLASLLGGERIEADVALKAGDSLRSRIKQVASG
FT                   RFGVTAEYLASADQIQIKMAQGAKPGEGGQLPGHKVSEYIAKLRYSVPGVGLISPPPHH
FT                   DIYSIEDLAQLIHDLKNVNSKASISVKLVSEVGVGTVAAGVAKAKADHVVIAGHDGGTG
FT                   ASPVSSIKHVGTPWELGLAETQQTLVLNRLRSRIRVQADGQMKTGRDVVIGALLGADEF
FT                   GFATAPLVVEGCIMMRKCHLNTCPVGVATQDPVLRRKFQGKPEHVVNFFFFIAEEVREI
FT                   MAQLGIRKFDDLIGRADLLDMRASIDHWKAQGLDFSRVFYQPQVDTEKRQTESQDHGLA
FT                   GALDHLLIERSKPALERGEKVSFITPVRNRNRTVGAMLSGALAARYGHEGLPDDTIHIQ
FT                   CNGTAGQSFGAFLAHGITLDLVGEGNDYVGKGLSGGRIIVRSPNDFRGFGPDHIIVGNT
FT                   VLYGALAGEAFFNGVAGERFAVRNSGAAAVVEGTGDHGCEYMTGGTVVVLGSTGRNFAA
FT                   GMSGGVAYVWDPDRSFKDRCNLSMVELEAVVPHAEQQAQDNREDWHSAQRGGERETDEA
FT                   ILRRLIEDHFRYTGSFRAREILGDWEASRGKFIKVMPTDYRRALGEMWRAANPEQLAA"
FT   CDS_pept        complement(165315..166058)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40485"
FT                   /db_xref="GOA:A9HWH1"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWH1"
FT                   /protein_id="CAP40485.1"
FT                   /translation="MARLPRLYAPGLPQLVQANFVQPLAAPSQPAPQDVLNQLAAWLGD
FT                   SAQRHRVAVHGWVLANDRILLLATPADEEGLPRLMQTLGRNLAARLRGGRVFAGRYRSA
FT                   LLEPGVWVLPALVWLETYPVRSGSAHDPDSWPWSSAGSHTGNTAAATPPSPWQSDHADY
FT                   WACGNTPFDRQANYRRRLQEGLSREQSQRIDQAVSGQWALGGPDFIASLAHTASRRVAP
FT                   GQRGRPRKKPADTPAASDGNGGPGA"
FT   CDS_pept        166248..167354
FT                   /transl_table=11
FT                   /locus_tag="Bpet0155"
FT                   /product="alcohol dehydrogenase class III"
FT                   /function="Zn-dependent alcohol dehydrogenases class III"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40486"
FT                   /db_xref="GOA:A9HWH4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWH4"
FT                   /protein_id="CAP40486.1"
FT                   /translation="MKTKAAVAWKAGAPLTIEEVDLEGPRAGEVLIEVKATGICHTDYY
FT                   TLSGADPEGLFPAILGHEGAGIVVDVGAGVTSLKKGDHVIPLYTPECRQCKFCLSRKTN
FT                   LCQAIRATQGKGLMPDATSRFSLNGKPLLHYMGTSTFANHIVVPEIAVAKVREDAPFDK
FT                   ICYIGCGVTTGVGAVVYTAKVEAGANVVVFGLGGIGLNVIQGARMVGADKIIGVDLNPG
FT                   REAMARKFGMTHFVNPKDVDNVVDHIVQLTDGGADYSFECIGNTQVMRQALECCHKGWG
FT                   QSIIIGVAEAGAEISTRPFQLVTGRQWKGSAFGGARGRTDVPKIVDWYMEGKINIDDLI
FT                   THTLPLERINEGFDLMKRGESIRSVVLY"
FT   CDS_pept        167380..168225
FT                   /transl_table=11
FT                   /locus_tag="Bpet0156"
FT                   /product="putative esterase"
FT                   /function="Predicted esterase"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40487"
FT                   /db_xref="GOA:A9HWH7"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWH7"
FT                   /protein_id="CAP40487.1"
FT                   /translation="MADLELISQHRCFGGWQRYYRHASAQIGLPMRFSVYVPPQAEHGR
FT                   VPVLFYLAGLTCTEETFMIKGGAQRLAAEYGLMLVAPDTSPRGAGVAGEDQDWDFGTGA
FT                   GFYLDATAEPWRTHYRMESYVVDELHGLVTGQLPGDAGRAGIFGHSMGGHGALVLALRH
FT                   PQKFRSVSAFAPIAAPTRCPWGRKAFSGYLGPDTEAWKAHDASELMARAHQPFPRGILV
FT                   DQGLADGFLAEQLYPEAFEQACQQAGQPLTLRRHADYDHGYYFIATFMQDHIRFHADRL
FT                   "
FT   CDS_pept        168304..168966
FT                   /transl_table=11
FT                   /locus_tag="Bpet0157"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40488"
FT                   /db_xref="GOA:A9HWH9"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWH9"
FT                   /protein_id="CAP40488.1"
FT                   /translation="MALAALVVVLPGLALLFGRGGPRDASGRRVFRLRPVRRLFGALLI
FT                   ALAGVSAMLALTLVQFLRLTTDTPVASVQIHEQAPGRFLLTAQAPPDAAPRTYPMSGDQ
FT                   WQIDAKVVRWRLPALLAGAPPLYAFERISGRYSDVARERSEPRSVHALGDWPVPDLAVL
FT                   KRVFPNWLPFVDVQYGSAAYMPMLDGARYTVFMDARGAVVIRPDGQATEEALQRAGW"
FT   CDS_pept        complement(168971..169237)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0158"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40489"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWI1"
FT                   /protein_id="CAP40489.1"
FT                   /translation="MSAFAKATRARAQGDDVVFELETGGVTRPFEISGDALRRYFGAAD
FT                   GTGSELLRAFEGAEEKIRALAKKMQWVPSDGPIKLGAGDFDDA"
FT   CDS_pept        169519..170406
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="Bpet0159"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /function="DNA-directed RNA polymerase sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40490"
FT                   /db_xref="GOA:A9HWI3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWI3"
FT                   /protein_id="CAP40490.1"
FT                   /translation="MKQPSSSLALSGNALALAIANPGSLGTIEAYISAVNRLPVLTAER
FT                   ETELGRRLRDRDDLDAARELVLSHLRLVVSVARQYLGYGLPHADLIQEGNVGLMKAVKR
FT                   FDPERGVRLVSFAVHWIKAEIHEFIIRNWRMVKVATTKAQRKLFFNLRSMRPDGQTLDP
FT                   EQVDRIAQELNVRREDVSEMEVRLSGRDLSLEKQDDDEEAFAPISYLSDEGRQEPTRVL
FT                   DRRDHDELQGAGLAHALQALDARSRRIIEARWLQDDGGVTLQELAQEFGVSAERIRQIE
FT                   SAALKKMRGALAPA"
FT   CDS_pept        complement(170659..171465)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0160"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40491"
FT                   /db_xref="GOA:A9HWI6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWI6"
FT                   /protein_id="CAP40491.1"
FT                   /translation="MPASNSSAGRADAPTLLVQLTDTHLLAEPESVMCQVNTDASLRAV
FT                   LDLVRANGHRPDLLLATGDLAQDGSPAAYRRLRALLEQTDWPVRCLPGNHDDPHALRHA
FT                   LGLWTQPVTDIGAWRIILLDSSVPGSNGGHIDDTQFDLLERAAALAGDRHILVALHHNP
FT                   VQMDSKWHDDMMVDNAQALFQQLASLPRTRVLLWGHVHQAFDRRRHHLRMLATPSTCFQ
FT                   FAIRDGRHVLDDAAPGYRWLKLYRDGSLATGVRRIDAATWREAQAA"
FT   CDS_pept        171632..174190
FT                   /transl_table=11
FT                   /locus_tag="Bpet0161"
FT                   /product="putative sodium/hydrogen exchanger family"
FT                   /function="NhaP-type Na+/H+ and K+/H+ antiporters"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40492"
FT                   /db_xref="GOA:A9HWI9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWI9"
FT                   /protein_id="CAP40492.1"
FT                   /translation="MDIGFIVFGLSGLLTLVCFMPPLAGRVKLPYSVLLAIVGCLLGIG
FT                   LHLHGWAPPVLGDLFDTIERFEISSETFLMVFLPVLLFETALAMNVRRLMDDIGPILMM
FT                   AIVAVVVCTVVVGFAVNAVSSYGLVACLLLGAIVATTDPVAVVGIFREVGAPRRLTTLV
FT                   EGESLFNDAASIALYSVLLAVLGGKGSLSVSGVFNDFVFHFVGGGIAGYVMGRGACLLF
FT                   AWLRGFPTAEITLTLTLAYLSFFTSEHYLGVSGVVATVIAGLVVGSAGRTRMSPVTFEH
FT                   LASSWEQFGFWANSLIFLFAAMLIPKLMAAADLEELLLVGVVFVVTLVARAIVVFGLLP
FT                   LLGMTPLGTKVSTPYKTVMLWGGLRGAVSLALALAVTEQTAVPEAARQFIAVVTTGYVL
FT                   ATLFVNGITLRPLIRMLGLNQLSPVERTIRNQALVVALEDLQGKTDEVAKTDHISGEAS
FT                   ERIHAVFDASLASVHDGQLSQMTDEQRVAVGLAIVAQREQEMFFDILKAQIVDWRMAES
FT                   LLARSERLEDAIRTGGLAGFERGIEADVRHSKAFRLALRMHYMFGFQGWLARELGQRFA
FT                   NLMTKRSVAQRLMAFAREQIAPLLGEAAAQQIVAAHQRRLDLIEHALQALNLQYPSYSL
FT                   WLQESHLGRTARELERIRYHDMLEQSLISGEVYADLMGQLKSRWRHIDRHPPLDMELGA
FT                   AELITRVPLFEGLSADSLRAISKLLRPRLALPDQPVLTRGRHGQEMCFVASGAVSVQLP
FT                   DGTAIELGSGEFFGELALLGKQNINPDVHSLGYSKLLMLSLRDFEALLARDPDLRERIQ
FT                   VVAKQRLRAIEVWKQFSQTGTTTPPEPPAPPRPPAEPADA"
FT   CDS_pept        complement(174303..175331)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0162"
FT                   /product="transcriptional regulator, LacI-family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40493"
FT                   /db_xref="GOA:A9HWJ0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWJ0"
FT                   /protein_id="CAP40493.1"
FT                   /translation="MSARKPRSTRDGRITMQQVARRAGVSAITVSRTLRSPDKVAPALR
FT                   ERILRICQELGYVPNHAASALASSRSRIVVALIPSLSNVVFVDIIAGIKETLDAQGYHL
FT                   LVGVTGYSLDAEEAQLRTYLQHSPDGVILTGIDHNPGVWQLLRTAAIPAVHTIETLPAD
FT                   ATDLSVGFSQFDSGLAACRHLAERGYRRIGIVGAQLDPRSLRRCEGGRAALREAGLYDP
FT                   ALEIMTPQKSSIGLGAELLDLVLDRHPDCDGLFFCNDDLAQGAVFQCARRGIAVPARMG
FT                   LVGFHDFAGTAWTTPPLSTIATPRYQIGLTAATLLLQQMAGQPPAQRHVDLGFSLVQRE
FT                   TT"
FT   CDS_pept        175533..175991
FT                   /transl_table=11
FT                   /locus_tag="Bpet0163"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   small permease component"
FT                   /function="TRAP-type C4-dicarboxylate transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40494"
FT                   /db_xref="GOA:A9HWJ2"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWJ2"
FT                   /protein_id="CAP40494.1"
FT                   /translation="MVVCLAVMVVLLFGNVALRYLFNSGINVSDELSRLAFVWLIFLGA
FT                   VLALREHQHIGVTMLVQRFGRAGRKLTHVACQLLTLWVLWLMADGSWKQTVIGMDTRLP
FT                   VTGLPVAVFDAAVLYAAVAMGLLVLVDLARVLAGGEPPLDSSPEDPLT"
FT   CDS_pept        176024..177304
FT                   /transl_table=11
FT                   /locus_tag="Bpet0164"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   large permease component"
FT                   /function="TRAP-type C4-dicarboxylate transport system
FT                   large permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40495"
FT                   /db_xref="GOA:A9HWJ3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWJ3"
FT                   /protein_id="CAP40495.1"
FT                   /translation="MTLTLFLAVLLGLIALGMPIAFALLLSAVALMFQLNFFDSQILAQ
FT                   NMLSGANSFTLMAVPLFMLAGEIMNAGGLSRRIVNMASTFVGHIPGGLGYVAIFASVLL
FT                   AALSGSAVADAAALGTLLIPMLRDKGYSAEQASGLIAAGGIVAPIIPPSISFIIFGVAT
FT                   NVSITKLFFAGIAPGLLMGLTLVAVWTWVARRHGSLTPTPRESWPVRLRALRQAAWALM
FT                   LPVIIIGGLRGGIFTPTEAAVVAAVYALAVSLFIYREITVRDLGRLFISAARTTAVVMF
FT                   LVAAAMVSSYMITLADMPQDLINLLTPVLDQPKLLMFSLMVLLTLVGTVMDLTPTILIL
FT                   APVLMPVITKAGIDPIYFGVMFVLVGCVGLLTPPVGTVLNVVCGVARINMETICRGVWR
FT                   YVAAYTTLIVILVIFPELITVPARWLY"
FT   CDS_pept        177357..178373
FT                   /transl_table=11
FT                   /locus_tag="Bpet0165"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   periplasmic component"
FT                   /function="TRAP-type C4-dicarboxylate transport system
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40496"
FT                   /db_xref="GOA:A9HWJ4"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWJ4"
FT                   /protein_id="CAP40496.1"
FT                   /translation="MFKTCKYTLLAMTLAVSCAAAGAASAQDIKPRLIRFGYGLNEDSV
FT                   QGRAARHLAQELEKLSGGKLKMKTFGSASLGPDEQMQSALVGGVQEMMVGSTAPLATMV
FT                   KEFGVFDLPFLFNSDKEADAVLDGQLGESLLKKLEAKGLVGLVYWENGFRNLTNSRHPV
FT                   VKAEDLDGIKLRVMQNQVALGVFNALGANAVPMPFSELFTALETRTVDGQENPVTTIQS
FT                   SKFYEVQPYLTITRHVYTPWVVLASKKWWDTLSPDEQKLIRQAAVASRDFERKDSRADS
FT                   TKAMETLKEHGMKINVVSEEEIARMREKVQPVVDKYTQELGPDLVKELQDEIRKARG"
FT   CDS_pept        178440..180224
FT                   /transl_table=11
FT                   /gene="ilvD1"
FT                   /locus_tag="Bpet0166"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /function="Dihydroxyacid dehydratase/phosphogluconate
FT                   dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40497"
FT                   /db_xref="GOA:A9HWJ6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWJ6"
FT                   /protein_id="CAP40497.1"
FT                   /translation="MPQTPRRLRSQKWFDDPSHADMTAIYVERYLNSGITRAELQSGRP
FT                   IIGIAQTGNDLTPCNRHHLQLADRIKAGIRDAGGIPMEFPVHPLAEQGRRPTAALDRNL
FT                   AYLGLVEILHGYPLDGVVLTTGCDKTTPACLMAAATVDIPAIVLSGGPMLDGWHEGKRV
FT                   GSGTVIWHARNLMAAGKIDYEGFMTLATASSPSVGHCNTMGTALSMNSLAEALGMSLPG
FT                   CASIPAPYRERGQMAYATGMRICDMVREDIRPSHILTRQAFENAIVVASALGASSNCPP
FT                   HLIAIARHAGVDLSLDDWQRLGEDVPLLVNCVPAGEYLGESFHRAGGVPAVQHELHAAG
FT                   RLHGGCLTVSGRTVSDIAAAAATHDRDVIRSYQAPLRHRAGFIVLSGNFFDSAIMKMSV
FT                   VGEAFRRSYLETPGDENAFEARAIVFDGPEDYHARIEDPSLNIDEHCILVIRGCGAVGY
FT                   PGSAEVVNMAPPSHLLKRGIDSLPCLGDGRQSGTSASPSILNMSPEAAVGGGLNLLQTD
FT                   DRLRIDLNQRSVTLLVDADEMARRKANAKPVPVPPPQTPWQEIYRQMVGQLSTGGCLEP
FT                   ATLYLRVVETRGDPRHSH"
FT   CDS_pept        complement(180608..181369)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40498"
FT                   /db_xref="GOA:A9HWJ8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR031804"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWJ8"
FT                   /protein_id="CAP40498.1"
FT                   /translation="MQEHPPELARPLYVADRCCGWATHAACDALGRLPAARVQADALRI
FT                   GSGLAAGPELDALLASVAQTLREADCLRGWRDELLDVTAADEHLGVIERAAMRPLGLLT
FT                   RAVHLNAWTPDGRLWIARRALSKSTDPGMWDTLVGGLAGSREDLEQALLRECGEEAGLE
FT                   SAQLGGRSPLRTILRMHRRLPEGYQVEDLLTSTCVLPAGTQPANRDGEVMEIAHVSVNE
FT                   ASRRIADGEFTVEASLVILEDIMQRRARGEI"
FT   CDS_pept        181679..182836
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="Bpet0168"
FT                   /product="Cytochrome c oxidase, subunit II"
FT                   /function="Heme/copper-type cytochrome/quinol oxidases
FT                   subunit 2"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40499"
FT                   /db_xref="GOA:A9HWJ9"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWJ9"
FT                   /protein_id="CAP40499.1"
FT                   /translation="MKKWRGILGACALLSGSAVNAQVQDMPGGPKVDQLNLHEGVTQIA
FT                   HDVMWLHWLLLIICGVIFIGVFGVMFYSIWAHRKSRGHKAATFHEHLGVEVAWTVIPFI
FT                   IVIAMALPATKTVVAMKDTSSADLTVKVTGYQWKWGYEYLDGPAAGVKFLSTLATPRAQ
FT                   IEGREPKGEFYLMEVDNHLVVPVDKKVRIVLTAADVIHSWMVPDFGVKQDAIPGFLRDT
FT                   WFRAEKTGTYRGQCAELCGKDHAFMPIVVEVKSQADYDKWVEEQKKKMAANADDPNKEW
FT                   TKEELLARGEKVFGANCVACHQANGKGVPGSFPALDGDKTVLGPKDAQIQTVLHGRPGT
FT                   AMAAFGGQLNDVEIASVITYTRHAWSNAGKGQDPVVQPKDVVAAR"
FT   CDS_pept        182934..184541
FT                   /transl_table=11
FT                   /gene="coxA1"
FT                   /locus_tag="Bpet0169"
FT                   /product="Cytochrome c oxidase, subunit I"
FT                   /function="Heme/copper-type cytochrome/quinol oxidases
FT                   subunit 1"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40500"
FT                   /db_xref="GOA:A9HWK1"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWK1"
FT                   /protein_id="CAP40500.1"
FT                   /translation="MSSVTVDHVSPGHGHEHDDHHHATPTGWRRWLFATNHKDIGTMYL
FT                   IFSFVMLLEGGTLALLLRTELFEPGLQFFQPELFNQFTTMHGLIMVFGAIMPSFVGFAN
FT                   WMIPMQIGASDMAFARMNNFSFWLLPVAAIMLTTSFFVPGGATAAGWTLYAPLSAQMGP
FT                   GMDLAIFAIHIMGASSIMGAINVIVTILNMRAPGMTLMKMPMFCWTWLITAFLLIAVMP
FT                   VLAAAITMVLTDRHFGTGFFNAAAGGDPVLYQHVFWFFGHPEVYIMILPAFGIVSAIVP
FT                   AFARKKLFGYASMVYATSAIAVLSFIVWAHHMFTTGMPVTGQLYFMYATMLISIPTGVK
FT                   VFNWIATMWRGSMTFETPMLFAVGFIFVFTMGGFTGLILSVAPIDIQVHDTYYVVAHFH
FT                   YVLVAGSLFALFAGAYYWVPKWTGRMYNEKLGKLHFWSTLISFNVTFFPMHFLGLAGMP
FT                   RRYADYAAQFTTFHQVATIGAFWFGLSQLLFLYVIVQCYRGKGATAAAKPWEGAEGLEW
FT                   TVPSPAPFHTFTTPPEVK"
FT   CDS_pept        184572..184697
FT                   /transl_table=11
FT                   /locus_tag="Bpet0170"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40501"
FT                   /db_xref="GOA:A9HWK3"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWK3"
FT                   /protein_id="CAP40501.1"
FT                   /translation="MTPEQRRRNKTVGLILLAIVIALFAWTFFRGSAILTGTAVK"
FT   CDS_pept        184704..184928
FT                   /transl_table=11
FT                   /locus_tag="Bpet0171"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40502"
FT                   /db_xref="GOA:A9HWK4"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWK4"
FT                   /protein_id="CAP40502.1"
FT                   /translation="MTHDIRDASRRKLNFLQTLKAVLWGMFGVRRGAGYEEDAGKLNPV
FT                   HLIVAGVLAGVIFVTVLVLIVRWAVASLT"
FT   CDS_pept        184969..185844
FT                   /transl_table=11
FT                   /gene="coxC"
FT                   /locus_tag="Bpet0172"
FT                   /product="putative cytochrome c oxidase, subunit III"
FT                   /function="Heme/copper-type cytochrome/quinol oxidase
FT                   subunit 3"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40503"
FT                   /db_xref="GOA:A9HWK7"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWK7"
FT                   /protein_id="CAP40503.1"
FT                   /translation="MSASHSVQGKEAPYYYVPADSGHPVRTAVALLAMGLGAAAWVNDV
FT                   SWGKWLVLVGVLGLITVLYFWFGDAIHESETGLNSKRIDLSYRWGMSWFIFSEVMFFAG
FT                   FFGALWYVRTITTPWLGDLDHQLLLWPDFQAVWPNFGPAGVVEHFQTVGPFWLPTINTA
FT                   LLLSSGVTLTIAHHALRENHRGKTMFWLAATVLLGFIFVACQAYEYHHAITELNLKFSS
FT                   GVYGSLFYMLTGFHGFHVIMGATMLTVILIRLARGHFTADHHFGFEGAAWYWHFVDVVW
FT                   LGLYLFVYWF"
FT   CDS_pept        complement(186026..186226)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0173"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40504"
FT                   /db_xref="GOA:A9HWK8"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWK8"
FT                   /protein_id="CAP40504.1"
FT                   /translation="MRVIVGLAFIGILASLASALVYLMRDKGSTNRTVNALTVRIGLSV
FT                   ALFLFVLLAHHLGWIESTGIR"
FT   CDS_pept        186262..187035
FT                   /transl_table=11
FT                   /locus_tag="Bpet0174"
FT                   /product="putative membrane protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40505"
FT                   /db_xref="GOA:A9HWK9"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWK9"
FT                   /protein_id="CAP40505.1"
FT                   /translation="MAHSVRRTLAALVLLGVAVAILASLGAWQLRRADERRALLAAIQA
FT                   GRAQPPLALTPATAPGELSAWRPAQAQGQWLNQYSVLLDNRNQDGRPGYWLATPLLLEP
FT                   ASRGAVLVLRGWLPRALPGQPAPTPPAAPAGQHSVIGELSPRVPRLFELWSFGGSAQGQ
FT                   LPATLPVPGGALPQVQNLELPAYAHATGLALLPAVLMQTQGDDTLVRDWPQPSVDYNQN
FT                   QGYALQWFSFAAIAAAAWLAVAWRGLRRGRGAVRP"
FT   CDS_pept        187063..187692
FT                   /transl_table=11
FT                   /locus_tag="Bpet0175"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40506"
FT                   /db_xref="GOA:A9HWL0"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWL0"
FT                   /protein_id="CAP40506.1"
FT                   /translation="MARETSTPAPAKKRSLTPLVLVFLCTLAPILAAWVLYNNPQWWPD
FT                   ESSNYGTLVDPQRPMPAASELQLTTLDGQPFDLQSLKGKWLLLSVGEAACPESCARKLY
FT                   ITRNSHASQGKNVDRLARVWFITDDAEVPAKVLEAYQGTVMVRARPEQLARFLLARDTV
FT                   AGQPGLLDPIWVIDPLGNLMLQFPANADGVKVRKDISKLVYNSRIG"
FT   CDS_pept        187706..188719
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="Bpet0176"
FT                   /product="putative cytochrome oxidase assembly protein"
FT                   /function="Uncharacterized protein required for cytochrome
FT                   oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40507"
FT                   /db_xref="GOA:A9HWL3"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWL3"
FT                   /protein_id="CAP40507.1"
FT                   /translation="MERIKQRYRKLVFFTWFLTLDLIMFGAFVRLTDSGLGCPDWPGCY
FT                   GNVTPLGAMTDIHQASQAMPFGPVTLSKAWIEMIHRYVGALLGMLIIAIVFMAWRYRRE
FT                   LGRSPALAITALVAVCVQGAFGAWTVTHRLMPAVVTAHLVFGLSVLALMTWLSARERPH
FT                   LALPAHAARWRPWLVVGMALLLVQITLGGWVSTNYAALACLDFPTCHGQWLPDMDFHGG
FT                   FSVIRGLGELPSGEMISQNALTAIHWVHRNFAFIVLAYLGVLASRLRAEPGLRGPATLA
FT                   LALLAAQLFTGLTTIFFQWPLLIAVLHNGGAAGLTLACVVMLVRLSTAGRAPASAT"
FT   CDS_pept        188745..189638
FT                   /transl_table=11
FT                   /gene="ubiA1"
FT                   /locus_tag="Bpet0177"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /function="Polyprenyltransferase (cytochrome oxidase
FT                   assembly factor)"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40508"
FT                   /db_xref="GOA:A9HWL4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HWL4"
FT                   /protein_id="CAP40508.1"
FT                   /translation="MTSLAAPQTGLLRQYLVLTKPRVTQLAVFCAIIGMFLAVPGLPDP
FT                   GRVVFGTLGIWLLAAAAFAINCLIEQEIDARMLRTARRATARGTISAAQVISLSGLLGG
FT                   AGMLVLYHLVNPLTMWLTFATFVGYAIIYTVILKPRTPQNIVIGGLSGAMPPALGWAAV
FT                   ADAVPAEAWVLVLIIFIWTPPHFWALALYRNHDYAKAGLPMLPVTHGQRFTRLHILLYS
FT                   LALVATTTLPYIIRMSGLLYLASALALGGMFVAYAWRLYREYSDALARRLFRFSILYLA
FT                   LLFAALLMDHWAGLLA"
FT   CDS_pept        189657..190265
FT                   /transl_table=11
FT                   /gene="senC1"
FT                   /locus_tag="Bpet0178"
FT                   /product="SCO1/SenC/PrrC family protein"
FT                   /function="Uncharacterized protein SCO1/SenC/PrrC involved
FT                   in biogenesis of respiratory and photosynthetic systems"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40509"
FT                   /db_xref="GOA:A9HWL6"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWL6"
FT                   /protein_id="CAP40509.1"
FT                   /translation="MSAFSFSRRALLRGAAAFALAGALAACGDPAPSFKGNDISGTQLG
FT                   KGLALTDHNGQARTLQDFAGKVTVVFFGFTQCPDVCPTSLAELSQVMEKLGPDADRVQV
FT                   LMITVDPERDTAEILKQYVTTFDPRFLGLTGTAEQIKQAAASFKAYYAKVPTENGKNYT
FT                   MDHTAAFYLLDGKGDSRVLANNTIGVDALAHDIKALLGS"
FT   CDS_pept        190672..191442
FT                   /transl_table=11
FT                   /locus_tag="Bpet0179"
FT                   /product="putative membrane protein"
FT                   /function="Predicted outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40510"
FT                   /db_xref="GOA:A9HWL8"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWL8"
FT                   /protein_id="CAP40510.1"
FT                   /translation="MRTLSQNPARSSGQVLQRVTIATRRYCGQMLYNGPYCRWRTIMNT
FT                   PVPGQNARRGLHPLVATAAVSVILLCAVAVAALVGWLPTPWAESSGETPVHEAQAQAEQ
FT                   QAGQAQPPAPEAPAKVAAGPQAAARPAAKPAPKPAACADCGVVETVRQVQVPAQNNGYN
FT                   VVGTVAGGVVGGVVGHQFGGGHGKDALTVLGAVGGALAGHEIERNIRQQQTVTHYEMIV
FT                   RMDNGTTRSFKSSQPFAYASGDHVRVENGQVLPR"
FT   CDS_pept        191471..192160
FT                   /transl_table=11
FT                   /locus_tag="Bpet0180"
FT                   /product="hypothetical protein with conserved N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40511"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWL9"
FT                   /protein_id="CAP40511.1"
FT                   /translation="MSDPNTNPFVLPGLGQGGDLAGNPLLASMEMMRKAWAGLAGPGGL
FT                   AQTLPMAAPMNLEDLERRIADLRTVENWLRMNLSMLTSTIQGLEVQRATIATLRSFVGG
FT                   AAAGGEASPLEEVLGLKPAAAAASPSVPPVSEPANEPAREPGSPDASAADQINQAAQSA
FT                   SQAWWNLLQQQFNQLATATAASMPDAAAPGATASSAASSAAPANAAPRKRAPRKTAAKR
FT                   APASRKS"
FT   CDS_pept        192220..193590
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="Bpet0181"
FT                   /product="glucosamine-1-phosphate N-acetyltransferase /
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /function="biosynthesis of N-acetyl glucosamine"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40512"
FT                   /db_xref="GOA:A9HWM1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HWM1"
FT                   /protein_id="CAP40512.1"
FT                   /translation="MLNVVILAAGLGKRMQSDLPKVLHSLAGKPMLEHVLDSASQLEPG
FT                   RIVVVVGHGADRVRGAYEGRAGLSFALQQPQQGTGHAVQQAVPLLQEDGKDDVTLVLYG
FT                   DVPLVQPDTLRRLLQARGQGAAVLTELLDDATGYGRIVRNEQGQVQRIVEHKDASEAER
FT                   AIREVNTGILAAPTGRLKDWLSRIDNNNAQGEYYLTDVVGLAVADGVPVGAAQPSAGWE
FT                   TLGVNSRVQQAELERRWQQEQARRQLEAGVTLADPARFDVRGTLTCGRDVFIDVGCVFE
FT                   GKVELADGVRVGPHCVLRDVSVGAGTHIDAYSHVQQATVGRDARIGPYARLRPGASLGD
FT                   RTHVGNFVEIKNSVLDADSKANHLAYIGDADIGARVNVGAGTITCNYDGANKHRTIIED
FT                   DAFIGSDTQLVAPVRVGRGATLGAGTTLTRDAPAGQLTVSRARQTTIEGWQRPQKKS"
FT   CDS_pept        193587..194978
FT                   /transl_table=11
FT                   /locus_tag="Bpet0182"
FT                   /product="putative transport protein"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40513"
FT                   /db_xref="GOA:A9HWM3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWM3"
FT                   /protein_id="CAP40513.1"
FT                   /translation="MSADPKASSAACARPSLPDGLPTPRRYWAAATVLTGISLSVLDTT
FT                   IANVALPTIATDLHALPSQAVWIVNAYNLAVVALLLPLSALAERIGFKRMFSFGLALFA
FT                   LASLFGAVSQTLWQLTLARVVQGIGAATLMCMFGGLVRNIYPLRLLGRGISLNATTVAV
FT                   MSVVGPTLGSVILEIAHWRWIFAINLPVCAAVMLGLRHLPVVPRTNVRLDWLSALLCMA
FT                   TLAVFISGVDTLGQNLVRGAVMIVAAILVGWVLVRRANNQPAPLVPVDLLRIRSVGFAV
FT                   AASACTFAAQMASYVSLPFYFQQVLGRSYLEVGMLMGAWPVGTAIVAPLAGRMSDRYSA
FT                   ATLSGAGAGAMVIGLATLAFLPLDATNTWIMVAMFITGTGFGFFQTPNNRAMLSSSPRQ
FT                   RSGAAGGLQATTRVFGQSFGTALVAIAFGISGAAGPASALILAMLCAAVAVAVNVVRVN
FT                   KLRPS"
FT   CDS_pept        195051..196373
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="Bpet0183"
FT                   /product="UDP-glucose dehydrogenase"
FT                   /function="Predicted UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40514"
FT                   /db_xref="GOA:A9HWM4"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWM4"
FT                   /protein_id="CAP40514.1"
FT                   /translation="MKITVIGTGYVGLVSGACLADMGNEVLCLDVDAAKIQTLQQGGIP
FT                   IYEPGLDDLVKRNAQAGRLKFTDDVAASVAFGDVQFIAVGTPPGEDGSADLQHVLAAAR
FT                   NIARHMTTRKVVVDKSTVPVGTADKVRQAMAGVLAERGVDVPFSVASNPEFLKEGAAIK
FT                   DFMSPDRIIVGADDDYTVDVMRRLYAPFQRTHERLMVMDVRSAELTKYAANAMLATRIS
FT                   FMNEMANLAEALGADVEQVRRGIGADPRIGYHFLYPGVGYGGSCFPKDVQALVQTAAEH
FT                   GLPMRVVAAAEAANDAQKLRLSQKIVARFGEDLSGRTFALWGLAFKPNTDDMREAPSLT
FT                   AIAELTRRGALVRAYDPIAMPHSRQILAHNPAVAFADDMYQALDGADALLIATEWKVFR
FT                   APDLDRMRALLKTPLVIDGRNLYVPAEIRAQGFEYLGIGRA"
FT   CDS_pept        196370..197437
FT                   /transl_table=11
FT                   /locus_tag="Bpet0184"
FT                   /product="glycosyltransferase"
FT                   /function="Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40515"
FT                   /db_xref="GOA:A9HWM6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWM6"
FT                   /protein_id="CAP40515.1"
FT                   /translation="MNILQLNFEKGWRGGERQTLYCMRAFRAAGHQVELLCRAGGPLEA
FT                   RAGEEGFTAHGVRNVPGQLGFLARAGRNYDIIHAQTANTVTWAVLTKGLHRRPVVFSRR
FT                   TSFVVEPNEEWKTGAKWRRVDGFVAISEMAAAEPRRLGIDPIIIRSAVEPHDIDRANVE
FT                   RLADELGLRGKKVLATSAALIRDKDPLTLVRAVGELARTRNDFVFVHFGAGGDREAEAR
FT                   AEVQALGLQQVYLFAGFRKGIEDFYSIFDVFVMSSQEEALGSSVLDAFLQHVPVVSTDA
FT                   GGLKESLADGRGVLCPVGDAHAMAKGMARCLDDAAFRADCTQRAYDYVRTEHDVTEMGR
FT                   RYLALFDRLLAARRA"
FT   CDS_pept        complement(197434..197925)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0185"
FT                   /product="transcriptional regulator, AsnC-family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40516"
FT                   /db_xref="GOA:A9HWM8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWM8"
FT                   /protein_id="CAP40516.1"
FT                   /translation="MQEQAPPPVELDELDRRILDQLQHDCALTNQELATRVHASPPTCL
FT                   RRVRRLVDTGVIARQVAIVAPEKLGSTLTAIVEITLDVQAAESLDAFERTLMDEPAVLQ
FT                   CYRVSPGPDFLVVAQVRDMPAYHALAHRAFTAQANVRNVRTFFSVHRAKFETRIDVSAS
FT                   "
FT   CDS_pept        198076..199908
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="Bpet0186"
FT                   /product="glucosamine fructose-6-phosphate
FT                   aminotransferase"
FT                   /function="Glucosamine 6-phosphate synthetase contains
FT                   amidotransferase and phosphosugar isomerase domains"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40517"
FT                   /db_xref="GOA:A9HWM9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWM9"
FT                   /protein_id="CAP40517.1"
FT                   /translation="MCGIVGAVAQRDITPVLVEGLKRLEYRGYDSCGVALYVDGHLRRT
FT                   RSTQRVAELGEQIAQDKLAGFTGIAHTRWATHGVPATHNAHPHFSRLGKDEPRIALVHN
FT                   GIIENHDDLRAELEAAGYVFESQTDTEVIAHLVNHLYNGDLLDAVQQAVRRLHGAYAIA
FT                   VFCRDEPHRVVGARQGSPLVVGVGQNENFLASDALALAGTTDQIIYLEDGDVVDLQLSR
FT                   VWITDTEGKPVERKVHSVQVHTGAAELGPYRHYMQKEIFEQPRAVGDTLQDIETITAEL
FT                   FGDGAHKIFKDIDSLLILACGTSYYAGLTAKYWIESIAKIPVAVEIASEYRYRDSVPNP
FT                   RTLVVTISQSGETADTLAALKHARSLGMEQTLTICNVATSAMVRECKLAYITRAGVEIG
FT                   VASTKAFTTQLTALFLLTLALAQTRGHLTDEQEVEHLKALRHLPVAIGAVLALEPQIMA
FT                   WADRFASKENALFLGRGMHYPIALEGALKLKEISYIHAEAYPAGELKHGPLALVTEHMP
FT                   VVTIAPKDSLLEKLKSNMQEVRARGGELYVFADADSRIASGDGMHVIRMPEHYGMLSPI
FT                   LHTIPLQLLSYHTACARGTDVDKPRNLAKSVTVE"
FT   CDS_pept        complement(201731..202996)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0187"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40518"
FT                   /db_xref="GOA:A9HWN1"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWN1"
FT                   /protein_id="CAP40518.1"
FT                   /translation="MSSAPLSSDFQSSALAPRLLTAACMLMLLGSSLYLPPPLRPFHWG
FT                   LALIALAFCLDAPTRRSFLHSRALPAAVAVMLLVCVQAAWADNQPRYAQYAVILAISLS
FT                   YALLGEHLARQGNAYLRWLPWLVALWLLMALVPWFDLLTHSERFRARYPLTGGPWDNIN
FT                   NMATALVVANLLWLLARRRLSSALFAIAWLYCLVLNRRADLLGMGVLGAAYLLCLMQGS
FT                   WRRKAAMALAWAALSGAGLLWQQSVGPITRDLPRITLNDGEWELVAAEGDQSTNSRKAL
FT                   LMDMINQARYMPWWQWLAGMGAGQLNVMSLTRGELKPWGSPHFFWFEMLFYLGVAWPLF
FT                   MLWLLWRLDWLGRTCLLVVGIAGIAPSSMVYFQPFWFLLGVMLAQPSRRSMRTMALPLC
FT                   LATLDGSTVLGRRSGLQASRRC"
FT   CDS_pept        complement(202971..203708)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0188"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40519"
FT                   /db_xref="GOA:A9HWN3"
FT                   /db_xref="InterPro:IPR021260"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWN3"
FT                   /protein_id="CAP40519.1"
FT                   /translation="MLGAFRHAFPLAMTLLMLLVVASFSAIHLLEFLSYYARVAGSLAG
FT                   KAVTGYAIQNATTTVTRFFYLALMPMLGFLIDRSLPRQHYLYMGLGALFGATALSLLAY
FT                   SLRRRWIVLLANFITRNEGRPRLTLADLRGELDRGQHHAPASIMPLAAAVFFCYALGVL
FT                   LSYYFALVFHDYRSTISQLSGIINGAATVLLTFILEPRIARIVDSHAPGRVYAAVQRML
FT                   LGRLLAVGIAAPATFYVICSAFF"
FT   CDS_pept        complement(203669..204967)
FT                   /transl_table=11
FT                   /gene="wlbH1"
FT                   /locus_tag="Bpet0189"
FT                   /product="glycosyltransferase"
FT                   /function="Predicted glycosyltransferases"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40520"
FT                   /db_xref="GOA:A9HWN4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWN4"
FT                   /protein_id="CAP40520.1"
FT                   /translation="MGRNELPRRKLVAISNIEELRGTYPVAASKQIISLGLNHRRTYGM
FT                   EQCRVVQRTLRIPTRVALLGAANSIHTVRWANGLAERGIEVHVLTLHAPGRELSPQVHL
FT                   HRLRCRAPLGYALAAKRVRRLLAEIQPELLNAHYASGYGLLARLAKFQPLLLSAWGTDI
FT                   YKFPHKSALHRRLLTDNLRFATLVASTSRAMARRIAAIEPLPVTITPFGIDHTQFCPRH
FT                   RDDGQAHDDGQAIVVGTIKGLEPQYGIDTLLRAFQIVVSQLDRSHPEIARRLELRIYGK
FT                   GSQKKKLKKLACDLQLDERVVFAGFIPHAKVPEALANLDIYVALSRQDSFGVAILEASS
FT                   CGVPVVVSDADGPAEVVADNESGFIVPVDDPGFAAARIVDLVLNPELRAQMSARGREHV
FT                   LQHYTWDHSLDIMLEAYRKTLCLAHSGTRSHSP"
FT   CDS_pept        complement(205170..209459)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0190"
FT                   /product="autotransporter"
FT                   /function="Uncharacterized protein with a C-terminal OMP
FT                   (outer membrane protein) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40521"
FT                   /db_xref="GOA:A9HWN6"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWN6"
FT                   /protein_id="CAP40521.1"
FT                   /translation="MKRNVRNNRMQHTVLALALLAAFGHASDTMAINLTVETPYDLGDS
FT                   NMSNSTITVNNGGILTGDGASVSGSAYDLILVNTGGQLALDNVELSNDLDSPSGSNGRT
FT                   ITASGNGATATLNNATISISAHSTNPGADYAHAFTAGAGATGGGNVTLNGGTVTASGSK
FT                   RTVGIQANDGGSINATDVEIVTNNHFGHGVVAYRTPAAEELATEIDLDDVSITTHGENY
FT                   SVGIQSANKGAHVTARNSQIVTDGVGSFGLESFNGAAIDYTGGSITTSGAGAAAVRVYG
FT                   GELGAGTIHVDGTQILTTGDSAAGVVAADMVERTSGTAEIDNASIETRGAASSGLESSY
FT                   GSTLNSTGSSVQTSGEGSHGAYAHDGGTIVLNGDSLSAGGNHAYGMYAKDPGSAIDATN
FT                   VTVNTEGLYGFGARAENGGAITLKGGSISTDNATGQGTQDGDGSRAYALSADGANSSIS
FT                   AQDGVVISTKGQRAYGAYATNGGHIELGGGSVTTQGFMAYGLYASGNGSTVDANGVDIT
FT                   TSGGVGDGVWAYQGGTVNLNGGSVTVNGEPNANSPHETANGLVAVGGTGSAAAGTINAS
FT                   DLSIVTRGANSAGAKAGATVDTDNTYGVINLERSTITVQGQAAVAAEINYGSTLTATDS
FT                   TLVSEQGDGIVLNDNASVSLASTRVEAAGASLVSNLNAAGQTQNITVGSGSNLTQNNGT
FT                   LLQVNRGQEGMDGIVNLTLAAGSSSSGDVVDLDGLDQDSGLRDGGGKTNFTVAQGASWI
FT                   GIVRGINDLAAEDGGEIINVGGEPIAGNVTGGQDSTIVFQNGADIGGGFSVESGSQASF
FT                   NGNASIEGNVEATGSTVTFSGPATIGENASFASSSVAFGGPTQINKDLAGGSGSALAFS
FT                   DAATISGNLSGNNASFAFSQRDDVASRISGNVGLDNNATLKGGSLAAPILIEGNVDVTG
FT                   GATLGGNLTVNGSLNASGGTISPGNSVGTQTYASISNFGSAYVAEINAAGNSDLVIAQT
FT                   GDVDLAGTTLAVRQENGNGGYLVNHDYTIVQTIDGEVIGQFADAGLDDSFANTLVSLDP
FT                   VKYAAKDVKVSLSVDQAKVAGKRENLSSNQNHTLDGVISVAGRNSAADAALTSTDSQAA
FT                   LNQLSGEIHASTQSALLYSGNLVRQTLSDRLLANLGAGSAQGTYPLWAQVTGGEFSLDS
FT                   DGNAAKARTTSGGLFLGGDAEVGKGWRIGAALGYTDSSTKVKDRASSKADVDSYTAALY
FT                   GGKSWARSNGKVEFLAGAAYTHHSIDTRRNVNLGGNQTLKADYDAQSFQAFTELGYAFS
FT                   VGPDSQIGPYLGVAWLNQHTDGFSESGGDAALRGDSRTDTTVTTTLGVRGKTSFELAGT
FT                   QAYLNGGLGWRHANGDVDTRRTVAFITGAGSSFSVAGAPIAKDAAAVNLGLGVALGKRA
FT                   TMGVSYNGQFGDGQTDNNGSLYLNIGF"
FT   CDS_pept        complement(209514..210557)
FT                   /transl_table=11
FT                   /gene="mreB1"
FT                   /locus_tag="Bpet0191"
FT                   /product="rod shape-determining protein MreB"
FT                   /function="Actin-like ATPase involved in cell
FT                   morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40522"
FT                   /db_xref="GOA:A9HWN8"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWN8"
FT                   /protein_id="CAP40522.1"
FT                   /translation="MIGFMRSYFSTDLAIDLGTANTLIYVRGKGIVLDEPSVVAIRHEG
FT                   GPNGKKIIQAVGHEAKQMLGRVPGNIEAIRPMKDGVIADFTVTEQMLKQFIRMVHPRNM
FT                   LAPSPRIIVCVPCGSTQVERRAIRESALGAGASHVYLIEEPMAAAIGAGLAVSDASGSM
FT                   VVDIGGGTTEVAVISLGGMVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEPTAELIKKE
FT                   IGSAFPGSEVREIEVKGRNLAEGVPRSFTVSSNEILESLTDPLNQIVSAVKIALEQTPP
FT                   ELGADITDKGIALTGGGALLRDLDRLLQEETGLPVVVAEESLTCVVRGCGQALDQLERL
FT                   GEIFLRD"
FT   CDS_pept        complement(210571..211443)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0192"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40523"
FT                   /db_xref="GOA:A9HWN9"
FT                   /db_xref="InterPro:IPR041115"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWN9"
FT                   /protein_id="CAP40523.1"
FT                   /translation="MPCPAPLKPCVTMLSPRFARSCTSERLMPSCATGLAEFFEGPTAP
FT                   KRSAILRILKRKLMKDNQDSTLAMDEMVPLPEGARPRTEAEKLLLRMRISQKCRYNASV
FT                   RLRRSYRFRLFTSMMFAVGLMIIPLLQNSPIQLGFSASVMAMAQVLLAVGILVFTVIAG
FT                   KAGFEIRADRLNQEGDALKEISRRLTRYLAANASIRLEDYHHEYASLTSGKESHSRSDY
FT                   LLARVEMNEDFPMWPGKRVLLRALLLVSTLSNYIIPLVLILMEVAFISDMLTLTTFYPG
FT                   VLHLSVAAP"
FT   CDS_pept        complement(211480..215814)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0193"
FT                   /product="autotransporter"
FT                   /function="Uncharacterized protein with a C-terminal OMP
FT                   (outer membrane protein) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40524"
FT                   /db_xref="GOA:A9HWP1"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWP1"
FT                   /protein_id="CAP40524.1"
FT                   /translation="MSFTHSARDPFFAGKLNVPRATPVFAISALAAALLIAFPTAHADS
FT                   VSRKVVASNREDVNLRHGRSYEYLEAKRGGEISGRKNNVKGQAGELVNANSGGEIKLKD
FT                   ANIEASRASRLHDKEQGPAVSATGSHQHGHRGHDSVVKLEDGKVTTHNNNSPALRASQQ
FT                   GGKIYADGTELRTRGTGSDVVQALDGGQVFLRGTEIASEGRDSDGVKVYGRGASASVDR
FT                   SRILTRGRDADGVSVKHGGIAVVSKSSIQTSGRSADGISVSGERSLVVGDSLKISTKGE
FT                   NSHGVDVEDGGTLLLSRGDVESKGKDGRGVAIDDGGRAVIVGSKVSASGDRGIALHVDD
FT                   KDSQAIVIGSRLQSSGRSGQAVLIEDGADALIAGSTIVADGLGVQVQGKGSQLIGLDVD
FT                   IDAESEARYRQSREPALGLRVEDQAKALLVGGSIQAKGDQATGVSVGGSGSLVFAAGTD
FT                   IRATGDDSTGMRVSRDARAILVGSDIQGGGKGLDITKGGQAGTVGGTVTATDARGVALS
FT                   VSGRDSVAATIGTNLTADGQDGVAVEVRDAGRAYLIDSSLNARAVGLRAEGKDASVVSV
FT                   GSSITAGTEIVPVGRAYSEPAVGVASDTGATVILIGGDVTALGDNSVAAQATSGDMLIA
FT                   GTKIGTSGTNATAVLAQQPEQDGKRGRDWHATSSRIAVIGSTVSTTGAEAAAVKADGKR
FT                   SEILVAKSAVNTAGQGSHGVVVQDGGKVALVDSTVQVSGEQTAAARVQSEVSRYHRSVS
FT                   ELYINGTTLAATGENSAGIELDNSANVYLQESTVSATGASLVSTLSQRGQTQNITVGNG
FT                   ANLVENNGTLLQVNRSGDSGSSKVNLDLQDGSVTAGNIVDDLAVPLSGNGGTYVKLGAL
FT                   ATYDGKMIGVREVTTEGGNQKINFEGGSTIGNLSIDNKAVTSGGTTAQRILAEGDVTID
FT                   DATLGGNWKIDGKLTSKNGGIVKPGNSVGTVSTAGIDWQAGTVYQAEINEAGQSDLVEV
FT                   TGPDSADIANSSLVVSEENGAGRFRLNQDYTVLTAAGGVQGEFVSADWTGTAYPLIAMD
FT                   TLYSDNAVAVRMGVNRQALSTMDFTSNQRATGFGAASVAGANATVDEAFFSSDPAQAFD
FT                   QLSGEVHATARSLVFADMLSTNAALQSQMRANLGATLLPGQPMAASDGTPAGAQPKSAS
FT                   YPLWVRFNAASINNDGDGNTASAHYSTTRLLVGADAGIGGGWRLGAAGGASTGDFNVKD
FT                   RSSDGTINNYTFALYGGNSWILGPGKLNLLLGGGYTRHNIDTDRNVSLGAGQELSADYH
FT                   GSTWQLFGDLGYAIPWGETHHVEPYVNVSWFNQRMSGFSESGGDAALSSSASTAKLSSY
FT                   TLGLRSALVFPGKTNAFTVRTNLGWRHAGGDRSPTRSMQFIEGAGSAFSIAGAPIAKNS
FT                   LLVGLSGEVSLDSNFAMGLSYDGEFGSGNADNAGSLFMKVRF"
FT   CDS_pept        215832..216119
FT                   /transl_table=11
FT                   /gene="tnp1"
FT                   /locus_tag="Bpet0194"
FT                   /product="transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40525"
FT                   /db_xref="GOA:A9HWP2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWP2"
FT                   /protein_id="CAP40525.1"
FT                   /translation="MGNPRARYTQEFMLEAVRMVRGGQSMAAVAKILGISPKTLHNWVK
FT                   ADAAGKLNGAGKQVSPEQMEIARLRAELARVKMERDILGKATAYFAKVSA"
FT   CDS_pept        216116..217006
FT                   /transl_table=11
FT                   /locus_tag="Bpet0195"
FT                   /product="probable transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40526"
FT                   /db_xref="GOA:A9HWP4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWP4"
FT                   /protein_id="CAP40526.1"
FT                   /translation="MKYAWIELHSRQWPVSLSCQVLGVSPSGYHARKVRDVDTDRPRRR
FT                   ISNDALLVHIKAVHAESKGEYGWPRVWKQLLVQGIRVSKDRVQRLMKLHGIKAKTKRRF
FT                   KVTTDSKHSLPVAPDLLQRDFSPARPDQVWTTDITYIWTDEGWLFLTVILDLFSRQVVG
FT                   WSMQPHMRTELVSDALRMAWFRRRPQAGLILHSDRGSQYCSHDFQDLLKGYGMRSSMSR
FT                   RGNCWDNAPTESLWGSLKRARILGQRFATRREAMDEVIDWLSFYNHSRLHSTLGYVSPM
FT                   QFERDWYAAQNQRVA"
FT   CDS_pept        217249..218145
FT                   /transl_table=11
FT                   /locus_tag="Bpet0196"
FT                   /product="two-component response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40527"
FT                   /db_xref="GOA:A9HWP6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWP6"
FT                   /protein_id="CAP40527.1"
FT                   /translation="MEPRAVESDMSTAREGCSSMDTSVQKRSKNLCPGGDSLVNTEALA
FT                   RSVLQPADLKVVYLTLSSDSTARHSDDLRAFGFEVSVYSSVAAMRSAISVHAPAIVALE
FT                   AEPTTVHLAVAQLRLVLRRASIVVVSRFPDRLSRVGAMLSGADACVDAMPDSLELMAAL
FT                   LASKRRLQIEEELQSGVSSLINASAKPDAPEGKSDVTVEFGPNAQWHLAENGWILVAPN
FT                   GTRIDLNHSERKIMTWLLSNPKQPLTRVSQGASYDLHNGRITRRLDVAISRLRRKATAH
FT                   SLRLPIRSIRGEGYVFE"
FT   CDS_pept        218226..218492
FT                   /transl_table=11
FT                   /locus_tag="Bpet0197"
FT                   /product="putative transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40528"
FT                   /db_xref="GOA:A9HWP7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWP7"
FT                   /protein_id="CAP40528.1"
FT                   /translation="MKKSRFTDSQIIEAIKRVEAGLAVPELCRELGISSATFYKWRSKY
FT                   GGMDVSLMARMKELEAENARLRKMYVEEKLKAEIVTEALEKKW"
FT   CDS_pept        218513..219313
FT                   /transl_table=11
FT                   /locus_tag="Bpet0198"
FT                   /product="probable transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40529"
FT                   /db_xref="GOA:A9HWP8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWP8"
FT                   /protein_id="CAP40529.1"
FT                   /translation="MARRAVQDHGVSIRMACEAFSISQTCYRYIAKTDAENEEIANWLL
FT                   RLTDNHRNWGFGLCFLYLRNVRGLRWNHKRVYRIYRELELNLRIKPRKRLVRQAPEPLT
FT                   VPTQVNQVWSMDFMHDQLADGRSIRVLNVIYDFNREALGIEVDFSLPSERVIRTLKQII
FT                   GWRGKPSAIRCDNGPEYLSAAIVQWASTWGIKLEYIQPGRPQQNAYVERFNRTVRYEWL
FT                   SQYHWDDLDHVQRVATQWMWSYNHERPNMALGGFTPKQRLAMAA"
FT   CDS_pept        complement(219373..219705)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0199"
FT                   /product="putative dehydrogenase"
FT                   /function="Lactate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40530"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWQ0"
FT                   /protein_id="CAP40530.1"
FT                   /translation="MELSKHSSYFFGRRFDKTIYEAARRREVDATPLLSALESSRTLAC
FT                   GVASLLHVLRDHALTEDGSDEVKLIDHIHTDDLISLCIESMTLLNTKIEVLADQLCTRH
FT                   SEQVTD"
FT   CDS_pept        complement(219926..220336)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0200"
FT                   /product="putative DNA-binding protein"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40531"
FT                   /db_xref="GOA:A9HWQ2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWQ2"
FT                   /protein_id="CAP40531.1"
FT                   /translation="MGTIRRMETFGQRVRGARLRFGWTQKELASVSGLTQSAIGNYESG
FT                   QRTEPTSAALIKLAQALDVTPEWLRQGKEAKDGPSKKSLSYMPKARQQKGLAAGWPFHE
FT                   VGFDEFMALSLAEKRMLGTMVAAFVRSCLAQK"
FT   CDS_pept        220666..220932
FT                   /transl_table=11
FT                   /locus_tag="Bpet0201"
FT                   /product="putative transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40532"
FT                   /db_xref="GOA:A9HWQ3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWQ3"
FT                   /protein_id="CAP40532.1"
FT                   /translation="MKRSRFTDSQIMDALKRAEAGLAVPELCRELGISSATFYKWRSKY
FT                   GGMDMSMMARMKGLEAENARLRKMYVEEKLKAEIVTETLEKKW"
FT   CDS_pept        220953..221753
FT                   /transl_table=11
FT                   /locus_tag="Bpet0202"
FT                   /product="probable transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40533"
FT                   /db_xref="GOA:A9HWQ4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWQ4"
FT                   /protein_id="CAP40533.1"
FT                   /translation="MAERAVQTRGVSIRLACQAFSVSQTCYRYVAKTDAENEQIADWLL
FT                   RLTDNHRNWGFGLCFLYLRNVRGFTWNHKRVYRIYRELELNLRIKPRKRLVRQSPEPLT
FT                   VPAAANEVWSMDFMHDQLADGRSIRGLNVIDDFNREALGIEVDFSLPSERVIRALKQII
FT                   GWRGKPMAIRCDNGPEYLSSAIVEWAAKWGIKLEYIQPGKPQQNAYVERFNRTVRYEWL
FT                   SQYHWDDLDHVQRVATEWMWTYNHERPNMALGGFTSKQQLAMTA"
FT   CDS_pept        complement(222306..222647)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0203"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40534"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWQ7"
FT                   /protein_id="CAP40534.1"
FT                   /translation="MFRVLRTARVRHRLLHDLSRIAASGGWSPELQAAECASQASRIIR
FT                   ALPAGCWQADFVLEAYMQGLSAGFYDIAEEGMPQLLKQSLENNLETTAAALYIGYHHGS
FT                   SIRQAWNSR"
FT   CDS_pept        223521..223952
FT                   /transl_table=11
FT                   /locus_tag="Bpet0204"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40535"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWQ8"
FT                   /protein_id="CAP40535.1"
FT                   /translation="MKKTAAALIASIALVGSAGATDDDEAFRIPASVGRLILACTPNPI
FT                   ANTPGAECYALIALGIQAGGGMARLHTLDGMEGLTSAQRERLSHFDVRRGCAERADYAT
FT                   IARVALKRIKRMGYDDSEIALTALYRAFQEGPICGGTKE"
FT   CDS_pept        225573..227390
FT                   /transl_table=11
FT                   /locus_tag="Bpet0205"
FT                   /product="hypothetical protein"
FT                   /function="Predicted ATP-dependent endonuclease of the OLD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40536"
FT                   /db_xref="InterPro:IPR022602"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWQ9"
FT                   /protein_id="CAP40536.1"
FT                   /translation="MHKIGFIDIVGLRACHHVSIPLESFTPLVGQNNAGKSTILFALAW
FT                   VLKPSALEASDFAKEGEPIVVTARIDGITAEILEYVPEPKHQAAIAPFCNTGSMWIRVV
FT                   CTAPGPKGFTCEVFDVDQYAGEGIPKSWRSYPTGLSQAVSALLPEPLQIDAMEDLAEDL
FT                   GKAKAGSTLKSLLDLIMGPIIETHDELVSALQTFKDILSTDGASRSEHLKTFDDGATKA
FT                   LGDFFPGLAIELGMQTIEVKEFFKAGNLHVTDLETGDRRTFDKLGTGCQRAIQMALIRH
FT                   LADLKIGSKPLAARRLLLIDEPELYLHPQGVKRLRQALAALSQKGFQVVYATHSPLMLS
FT                   RENAADAVIIRKTKTDGTLARLPLRHAVASALHEAQAQSRTLFELGNLAEIYFCDLVVL
FT                   CEGKTEKRLLPLLYERLRGRHPELDQVAFVAVGACSDIPKALPVLAAMGIQACGIADLD
FT                   FAFTEARKGQQPMLPKHDETLVRSKDVLKKLKLQHEFPLGENGLPVKDKKTGWQAADTW
FT                   ALFAQHPEGIQLSAGLHNALLDQRVWIWRSGCLENVTGYEEKGEDAILTQELAIGVMEA
FT                   AAIQRSMPTIVECFEWLDRQRVVNLEGRR"
FT   CDS_pept        227593..228150
FT                   /transl_table=11
FT                   /locus_tag="Bpet0206"
FT                   /product="hypothetical prolin rich transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40537"
FT                   /db_xref="GOA:A9HWR1"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWR1"
FT                   /protein_id="CAP40537.1"
FT                   /translation="MATKRSQNKCRDCKYTWYPKGKNLSLKCPGCGGTNVGYAGMGLFG
FT                   QLGLGALVIGGFMIFSGGEKSVSSPSRDVKTPSGLSTSNPPVSASSITPPAPPNREVER
FT                   APDLTLGPVEYRNPAAGVVVQPGMAMSQVPAATSSSTGRTIRVYSSEEITSMEQAKGYQ
FT                   GNDPIVRRRLGLPSRETGQLIP"
FT   CDS_pept        complement(228224..229027)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0207"
FT                   /product="probable transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40538"
FT                   /db_xref="GOA:A9HWR3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWR3"
FT                   /protein_id="CAP40538.1"
FT                   /translation="MSVNRACHVCQQSRAGWYQKLKPKVLDAPLKARMHEIASTRVRYG
FT                   FWRIYVLIRRDGWHVNHKRIYRLYKEEGLNLRSKRPHRRRAAAHRLERPTLTAPDQSWS
FT                   MDFVSDALFNGQRFRALTVVDNFTRECLAIEAGQSLTGQDVVQALMRIATERGALPHRI
FT                   QADNGPEFVSLQLDKWAYDNGVTLDYSRPGKPTDNPFIESFNGSLRDECLNTTWFMSLA
FT                   DARNKLENWRQDYNYFRPHSALADTPPALFAKQFAVTPNLSDSPV"
FT   CDS_pept        complement(229078..229344)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0208"
FT                   /product="putative transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40539"
FT                   /db_xref="GOA:A9HWR4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWR4"
FT                   /protein_id="CAP40539.1"
FT                   /translation="MRKSKFTEEQIAFALHQADTGVSVEEVCRKVGVSQATFYAWKKKY
FT                   AGVGVSELRRLRQLEDENKKLKQLVADLSLDKVMLQDVLKKKL"
FT   CDS_pept        229877..230881
FT                   /transl_table=11
FT                   /locus_tag="Bpet0209"
FT                   /product="putative transposition protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40540"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWR6"
FT                   /protein_id="CAP40540.1"
FT                   /translation="MQNVPPLPNEHVLGHLVRVAGANAVKNLKALFRSTRSDDENEDIH
FT                   PLHWKHRYYGPLRYGNTTSLEEYRKHHTLTLFLTKPTQATQLANLGGFLSDAFVRHHIP
FT                   LGYSAEECISRIAWRFCSQCRDVARNKFGIGYWHRVHQVPGMDICPYHGVVLTRCKIQA
FT                   MFDDPTLSDAESFGTGGPDENLVTANMTPALHRYRTVIKEVLDHPLPEVRLRRAVLSLL
FT                   RSSRMRTEEDRRTIQMPRLAAVVSRREIPDVWLLEHIPRVRVWFNQHSHHAEPYWREEF
FT                   IKTCHHSTSKAGSDLWTLGLELLMVCLTIRNVAEIKDAIWPGVGRRRVARRLR"
FT   CDS_pept        complement(230905..232401)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0210"
FT                   /product="Tn7-like transposition protein D"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40541"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="InterPro:IPR032750"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXP6"
FT                   /protein_id="CAP40541.1"
FT                   /translation="MATNGRFGNDLEEICREHCVLGWYLPWRSRREVQLVLRIIAGEQG
FT                   GSVKSVLGLPSSRWGAGHPLKLCPRCVVADKATFGTSYWHLKHQYPGMARCPVHHTGLA
FT                   WCHEKVHYNKRDLWLLPEDCEVAIERDISAIPDSASFQHLLMSSAELPVGFEFDYSRLH
FT                   DAYMDELAVRSLVRRKKSISWPNLVRQYLDYLADLRGNADLRALPCTTEECASHLRRVL
FT                   YSSHPSRHPLPHLLFMSWLFGDWAKFWRTYTTPSQFRPVARSFCTGLSAPIGEVEEAAT
FT                   LARRGASCRQIAAALGIDVGTAQTWAAKCGVQAPIQRTTTRQKVVKALQRGDSKIAIAE
FT                   HFGVSVQTVTRVLRSEPGLADHWHKACYARARYSARSTWLREISRHPNFSTTQVRQRQQ
FT                   ATYAWLYRNDREWLLTHSPSKLPSTTSRGDRVDWFARDRDLSGRLMQAIHRLSARHNPL
FT                   SLQILYKAVPELSRYMPKLEKLNRTRAILDSHIKRRSSKT"
FT   CDS_pept        complement(232551..233441)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0211"
FT                   /product="probable transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40542"
FT                   /db_xref="GOA:A9HWP4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWP4"
FT                   /protein_id="CAP40542.1"
FT                   /translation="MKYAWIELHSRQWPVSLSCQVLGVSPSGYHARKVRDVDTDRPRRR
FT                   ISNDALLVHIKAVHAESKGEYGWPRVWKQLLVQGIRVSKDRVQRLMKLHGIKAKTKRRF
FT                   KVTTDSKHSLPVAPDLLQRDFSPARPDQVWTTDITYIWTDEGWLFLTVILDLFSRQVVG
FT                   WSMQPHMRTELVSDALRMAWFRRRPQAGLILHSDRGSQYCSHDFQDLLKGYGMRSSMSR
FT                   RGNCWDNAPTESLWGSLKRARILGQRFATRREAMDEVIDWLSFYNHSRLHSTLGYVSPM
FT                   QFERDWYAAQNQRVA"
FT   CDS_pept        complement(233438..233725)
FT                   /transl_table=11
FT                   /gene="tnp2"
FT                   /locus_tag="Bpet0212"
FT                   /product="transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40543"
FT                   /db_xref="GOA:A9HWP2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWP2"
FT                   /protein_id="CAP40543.1"
FT                   /translation="MGNPRARYTQEFMLEAVRMVRGGQSMAAVAKILGISPKTLHNWVK
FT                   ADAAGKLNGAGKQVSPEQMEIARLRAELARVKMERDILGKATAYFAKVSA"
FT   CDS_pept        complement(233904..234656)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0213"
FT                   /product="transposition protein, TnsC-related protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40544"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXP9"
FT                   /protein_id="CAP40544.1"
FT                   /translation="MQFLTQSAGATNLITKSLYQFSYLGVPVVFAANYGLWRSLLKRQE
FT                   QDTQRLLTSPIVLLPSEKGSEDWNRYLNGVENLLDGTFSVDIQAHSSTIYQLTAGLKRL
FT                   FIQLTRLAYSSVWKQGRRQVTIEDLANSYDSVSYASSRRQVAAMLTIHPTKQSAQYQCP
FT                   IPLPPIVSTRMKEYRESIRHRELTQAIQHDIRTPNERELAAKAAEITDPIKSTKPRKAN
FT                   RRKPLTAAELMQNGQMRRGLYPPPGRPE"
FT   CDS_pept        complement(234733..234945)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0214"
FT                   /product="hypothetical transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40545"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXQ0"
FT                   /protein_id="CAP40545.1"
FT                   /translation="MNQVPTALTDAAGLDAPILQARQRLYQQARQRHPARWSGKLRNWQ
FT                   PIGSVWLNPEPDQHEQDTDPVLEAA"
FT   CDS_pept        complement(234942..236006)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0215"
FT                   /product="putative transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40546"
FT                   /db_xref="GOA:A9HXQ1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXQ1"
FT                   /protein_id="CAP40546.1"
FT                   /translation="MTNAQDRRQAVALVDEARQAGARLQSACIELGIGLNTYRRWATGD
FT                   EDRRPHAIHATPSHALTDAERQAVLQACHRPEFASLPPAQIVVRLLDEEGRYLASESTF
FT                   YRVLRQADEQHRRGRARAPRHAGAPRRHCADAPNQLWSWDVTYLHTRIRGRFYYLYLIL
FT                   DIYSRKIVGAEVFESENMANSATIIQRAVLREQCQHRPLVLHADNGSAMKGSTLQVTLE
FT                   KLGITASHSRPQVSNDNAYSEALFRTCKYRPGYPIDGFASVQAARLWVHQFIHWYNHEH
FT                   RHSAIRYLAPAQRHAGLDAPILQARQRLYQQARQRHPARWSGKLRNWQPIGSVWLNPEP
FT                   DQHEQDTDPVLEAA"
FT   CDS_pept        complement(236003..236494)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0216"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40547"
FT                   /db_xref="GOA:A9HXQ2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXQ2"
FT                   /protein_id="CAP40547.1"
FT                   /translation="MKYSAERREAILKKLLAPHNRTVSDLAREEGISEATIYNWRKQAR
FT                   GQGRLLPDQASDSEGWSSQDKFNAVLESAALSEVELAEYCRRRGLYAEQLRRWRTSCEQ
FT                   ANAQSQSAARQEADALKAERRRTRDLERELRRKNAALAETAALLTLRKKARAIWGDEEE
FT                   "
FT   CDS_pept        complement(236552..237124)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0217"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40548"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXQ3"
FT                   /protein_id="CAP40548.1"
FT                   /translation="MNNTDSLWMARFKDLDEIEVRRRATLPGIKPNNLRAVDTYRISDV
FT                   ITQTLNSLYLPTDDDIAIIRQLIDIARSHSSKYYESRQRFLEALYSAKSPLDKEFQPPT
FT                   LLSGPAGVGKSSLMKALTRVLFPIESLDIGPGHAPVAYKPIWHIQVRDRASFSSMIHPF
FT                   VQSRLGNAKRVSSADLSELATKPPLSE"
FT   CDS_pept        complement(237117..239129)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0218"
FT                   /product="putative Tn7-like transposition protein B"
FT                   /function="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40549"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXQ4"
FT                   /protein_id="CAP40549.1"
FT                   /translation="MQVGTPLQAPEGYLNLERGITYYLLRNSRVRSRVLLVYFTTPPNM
FT                   VAILVLLDRHEFEGGLVRNLIMATPASGMPPHLEDFKGFNFEHVDSKRTNAKRTLRSYV
FT                   EHRLNTITPLLERESEILDAACPEREINRYCVTHGYNSQRVRTWFFLYVCFGRNIWTLL
FT                   PGFHRNGRWDRMTVGNGVKLGRPNNVRGRHAGCRMNAEIGALVVASFRRYAQVGKTLAD
FT                   VYAEAMCYAFRAKVDKDEKGVKRLIPTVTPIPTYHQYRYCLYKEHGMHRVQRDLYGAER
FT                   ARRRYAEHEGAFTANVANLYEVVEADAYYCEDLPRGYVDGDAVRPIVVTRCVDTVSGLR
FT                   LGIGFSYGKESSDGYNAMLFCAAISKVKFCSLFGIEISETDWPSIGLPARYITDRGPGI
FT                   KREPGASDAANSIPIRELTPSGQGQSKALVESAQRRRRSLEGPATRVLSELTAYQIVQR
FT                   EIHRLLMENSSADSRKRLTPEMIRAGVVPTPLGLWKYLDARARNVAESVPFEDAVRRFL
FT                   KRERVRVARDGVHFRTQRYDSDALRSTGLPAQVALRGTLHVDAYVFPFSIRYIWVEVEG
FT                   QLVEVEAKLAIRDDDSQLNRTLLDLESEAQSVRAFESVKRENRTAAQVESMLKLEQQTE
FT                   QRWYSTKRVSARSVKKSISQDAIEARHAFEGGGYE"
FT   CDS_pept        complement(239132..240109)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40550"
FT                   /db_xref="GOA:A9HXQ5"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXQ5"
FT                   /protein_id="CAP40550.1"
FT                   /translation="MARSSLRSLSRLQAIERRQCPPGWGSEYVPSMRATRDEAPKISRP
FT                   STVYSDKIGRDIHLMSLPERAACLLALYNPRLFDLHEQHMLSPYPTEHPLAGHTLAKSQ
FT                   QLPRLAGTIAVADRMNMIGKHPTVWDTDEAHRNEDSNRIPFPYIGDLLLFLADTQGAYC
FT                   VNWTVKKNAAQFGTPAASMRRGDTRFNKSSDDSRHRLEEQYFADGGIRTVRVSAEEIDA
FT                   NLIANLTLLVSRESAYRGMAGHIRETALQAYKEILESGLPPISVIAEMTRILDCSRNDC
FT                   LTLLYGAIWNRDLRVDLYVPVLPDRPLRRERSDVLTDYRHWFAR"
FT   CDS_pept        complement(240729..240956)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0220"
FT                   /product="IS511, transposase OrfB"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40551"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXQ6"
FT                   /protein_id="CAP40551.1"
FT                   /translation="MSGTALTERMKDMAAAKRRYGYRRIHVLLRRGGYVPLRELPQGDA
FT                   QQRRRAITFADTNAHGRGATNLLHGSGDDG"
FT   CDS_pept        complement(241075..241338)
FT                   /transl_table=11
FT                   /gene="orfA1"
FT                   /locus_tag="Bpet0221"
FT                   /product="IS511, transposase OrfA"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40552"
FT                   /db_xref="GOA:A9HXQ7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXQ7"
FT                   /protein_id="CAP40552.1"
FT                   /translation="MKRRFTEERIIGVLKEAEAGAKPAELCRKHGISEATYYSWKAKYG
FT                   GMTVSDAQRLKALEQENNRLSNLLAESVLDNAALKDLLSRRW"
FT   CDS_pept        complement(241480..245220)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0222"
FT                   /product="helicase, putative"
FT                   /function="Superfamily II DNA/RNA helicases SNF2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40553"
FT                   /db_xref="GOA:A9HXQ8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXQ8"
FT                   /protein_id="CAP40553.1"
FT                   /translation="MVFKLFKKKNSSSIAWQRTLSANGVVVHQSLGAMRLDSALLAGYL
FT                   AQLVDDGLALESEQEVTIPWDGIFTALQRPDYEDLISVLALPSLTTMRPVLQSRNALTD
FT                   ENFSILLAGWQDESGRTVDSKLVGPLLSSPGTDELVRPEHWPLLKEVFAFSKRPPEARH
FT                   DLEHRQAWGRIRALALEANARLDDFLRRTVVLTPERLDIGLRKIAIAEDQVIEITPSFE
FT                   GAPEGWLERFDALRSIPDRYDIPTPDGIVQVLIVPQVKSVLQEVKRLPYRRIAGSRAQA
FT                   FSLNPFATLGEDAKAVIDEEQFEQAREAAGIQFDRFTPVIERDAGGYPRKISLLIESAN
FT                   ASGLSFSESIELDDTELAEFIARLETAFNKSFQLLGWRGFDLELLGETPDYLAELKVAL
FT                   AQRQQDNALVRYEQVHDLSAYSSRIEGIGFEEPYYSPFIAKKDSGDWVPENVQVLIASN
FT                   AKGPQGALEGIPVTKEVLETLREAVAQAQAEGRPSVKVGGLSNDIPLDQAQDIVDSIDS
FT                   ALRDVQQGKDPTSREKTSTPTAPPRKTLILRPNIETVDYEESRREALLALPSAADIPNA
FT                   LNREFSLLPHQEQGLAWLQHLHKSRVEREVRGAILADDMGLGKTFQLLSLMAWLVERDP
FT                   SVAPMLVVAPVSLLENWAEEAGKFIRPGVLPLLTAYGDALAGLRVPRADIEERLKTEDG
FT                   LVRFLKPGWIGSAKVVLTTYETLRDLEFSFAAEHWSVMVCDEAQRIKNPAAMVTRAAKK
FT                   QNVDFKIACTGTPVENSLVDLWCLFDFVQPGLLGALNDFGTRYSKPIEAKTDEERARVE
FT                   ELRLRIKPQILRRTKAEVAKDLPQKIIVEACRHLALSSEQRKLYASAIESFKARKDPGA
FT                   ISPFKNMLGLLHYLRLICTDPRRHGLTAPNPEPLKQYREKSPKLDWLLEQLKLIQKKDE
FT                   KVIIFCEFRNIQRLLRHYIEEQFNIFPPIINGDTSATAGHADSRQRQIKKFQEAAGFGA
FT                   IILSPVAVGFGVNIQAANHVIHYTRTWNPAKEDQATDRAYRIGQKKDVYVYYPVVKADD
FT                   FATFDVKLDQLLTRKRELAGDMLNGSGDVRPGDFNMEDVVPPADRDSFNERITLSHTLS
FT                   MEPRHFEGLVAVLWGKQGYACYCTPQSRDQGVDVVGTHAEKGVLIQAKTSSSDGKRLGW
FT                   DAVKEVVAGAAFYQRKHQNVDFQKVCITNQFFNSQAQEQAAFNEVVLIDQTGLADLLLQ
FT                   YPATMLELDQFLYTEWSSLSH"
FT   CDS_pept        complement(245229..246905)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0223"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40554"
FT                   /db_xref="InterPro:IPR028943"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXQ9"
FT                   /protein_id="CAP40554.1"
FT                   /translation="MREGGLDKHLATLQQHVKAGSSPYEPEDLQAKAVRRFWETTRLDT
FT                   LKEARLVSFGMCLPSHPNGPCLLEDSKRFDAALSSDTGVDQWVKKPQWFRRCYQGLVRS
FT                   YFSYDDRKGKVAPDEGRKNWKKLREYLHDRSSNIIDPERINPDWAITAVENKGLFSENP
FT                   CLPYAKTALSGDMSSINRIREQLGITDDSWFTNELVLSQVRHAVASPYEEFKVQVPNLL
FT                   TMLASLARHGTKVRNRGLSLILDAYAQGSTPAIFEQLRDVSVDWWGNPWLPSTAAQWGG
FT                   VSPQAREMVSEWLRGEFIETFFTKLAQDGIGDRRRANFWLRYVKSMTNVQFALGPRALN
FT                   SPSRDFAVLLEKMKGLYTELKDSGSANNAFIMTLGNLVAVEFSATGHALYGYQKGVLPF
FT                   VFDSSEPLRLSGRAVNTLKDRNQTVIWLLHKDNIHGWNRWEDMYEATLRESFGILPDDA
FT                   LPRAPRATSPTRAASDTSRSEPNSRISLPTEPSPNSLISKYGSFAGHKLKALSKYRGFD
FT                   IADLRTKGGNIWAYTQSNDPELIQLFQSWGFQYKAGKGWWK"
FT   CDS_pept        complement(246971..247684)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0224"
FT                   /product="conserved hypothetical protein"
FT                   /function="Flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40555"
FT                   /db_xref="GOA:A9HXR0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXR0"
FT                   /protein_id="CAP40555.1"
FT                   /translation="MIGAKIIVKRGGREEAEKPFWISFADLMSALVVLFLVVMGVALLS
FT                   VTQTVTDIQTDEEIHSNNIQAILDRFESAASSYEGITIHRDRHAIDFGQRAQFAFGTWR
FT                   LNAQQESVLRQFVPEILTIANDELGKNILKRVVIEGYTDKTGSYLTNLNLSLQRSQKVL
FT                   CSMFATSGPNLLDDSQKADVRNLFFVGGYSFNAAKESDDESRRVEMRLEFRGLKEEPRP
FT                   TAINIDDNFGECALR"
FT   CDS_pept        complement(247687..249729)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0225"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40556"
FT                   /db_xref="GOA:A9HXR1"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXR1"
FT                   /protein_id="CAP40556.1"
FT                   /translation="MTEGLLAYLNQVGGWTIASLRLFAAYMPHVLGALALLSILFFLRG
FT                   LWYRARLGGVLRKLRKVDAKANREAIQHIFPTKRLRHLWQEYDQTLHAQYEERDGQLQI
FT                   GVIRSTIPAEMYFNDQYVVDSHLRTEFFKHLPGIFTGLGIVATFGGIIDGLKQFQVSED
FT                   TAVVRNSLEILMQSVGHAFLVSACAIALAMLYTLLEKLLLASLYRKTEDISQTIDAHFK
FT                   SGAGEEYLSRLVDASEASASQAKILKDSLVSDLKQVLQELTQSQIEAGMALHTQQLAAA
FT                   KEGNKTLGEVIASSIDQSLKTPLDEIASSVKSASGDQSKAAIDMLNDVMVHFSQRLNDL
FT                   FGGQISGINELNKETAQSMQDAVTALNTLLGKVEDSGKRATEEMALKMASSIQAMEERQ
FT                   ASINAQTQDFVDQIRKLVESSQSETQQKLQGTLESVGQQMTTILETLNTSQAQVFAQNQ
FT                   AREQAMADRASHTVSQMSGSVEAAIQEISAASKAMTESVSALSSATSTSVEKMNAGAER
FT                   LGIAASSFANAGERVAEVITQTTSIGNKLTEVSSSLSTSSTSLHEALGDYRVQREALAH
FT                   VLAEVREMIGLAGKEANITADALQRIEVSTTKLGLAQKAADEYLDGVSLVLEQSSDSFR
FT                   DAVVNTLSKVNYEFHEKLSSAVGLLATAVQELEGSLGTIAAPDRR"
FT   CDS_pept        complement(250097..250312)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0226"
FT                   /product="putative transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40557"
FT                   /db_xref="GOA:A9HXR2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXR2"
FT                   /protein_id="CAP40557.1"
FT                   /translation="MENAYIKSFNGKLREECLNKHWFLSLWQAKSLIEAWRVEYNTERP
FT                   HSSPGYLAPQQFAKSYQPEGIFNPGL"
FT   CDS_pept        complement(250361..250696)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0227"
FT                   /product="putative transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40558"
FT                   /db_xref="GOA:A9HXR3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXR3"
FT                   /protein_id="CAP40558.1"
FT                   /translation="MTVSDAQRLKALEWADNRLSNLLAESVLDNAALKDQLVDGFVADG
FT                   LAYGRRFRCLNVVDDYTRECLAIEVDTSLPGLRVAHDLDRIAAMRGLPRSFTVDNGPEF
FT                   AGKALDA"
FT   CDS_pept        complement(250693..250833)
FT                   /transl_table=11
FT                   /gene="orfA2"
FT                   /locus_tag="Bpet0228"
FT                   /product="IS1404 transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40559"
FT                   /db_xref="GOA:A9HXR4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXR4"
FT                   /protein_id="CAP40559.1"
FT                   /translation="MKKRFTEEQIIGVLKEAEAGAKAAELCRKHGISEATYYTGRRSTA
FT                   A"
FT   CDS_pept        251971..252402
FT                   /transl_table=11
FT                   /locus_tag="Bpet0229"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40560"
FT                   /db_xref="UniProtKB/TrEMBL:A9HWQ8"
FT                   /protein_id="CAP40560.1"
FT                   /translation="MKKTAAALIASIALVGSAGATDDDEAFRIPASVGRLILACTPNPI
FT                   ANTPGAECYALIALGIQAGGGMARLHTLDGMEGLTSAQRERLSHFDVRRGCAERADYAT
FT                   IARVALKRIKRMGYDDSEIALTALYRAFQEGPICGGTKE"
FT   CDS_pept        252558..252878
FT                   /transl_table=11
FT                   /locus_tag="Bpet0230"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40561"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXR6"
FT                   /protein_id="CAP40561.1"
FT                   /translation="MSEACVVYREMATQGSMMALLHEFNAEKDGLDPNSISRRMLRRYS
FT                   TPFSCPDGGDASYGEVRKVMIKRINARGYSEEHLALPRMMEALSKLRSARAQPNNQPER
FT                   ER"
FT   CDS_pept        253237..253503
FT                   /transl_table=11
FT                   /locus_tag="Bpet0231"
FT                   /product="predicted transcriptional regulator"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40562"
FT                   /db_xref="GOA:A9HXR7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXR7"
FT                   /protein_id="CAP40562.1"
FT                   /translation="MKIPLESPGDIGRVVRASRKAQKVRQDDAAGSIGVSENFLGKIER
FT                   GSDSVQWGKLFQVLEGLGVRVILDVPESVANYLAASDQGRNKQ"
FT   CDS_pept        253500..254810
FT                   /transl_table=11
FT                   /locus_tag="Bpet0232"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein related to capsule
FT                   biosynthesis enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40563"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXR8"
FT                   /protein_id="CAP40563.1"
FT                   /translation="MKGRSLLASINQTEVGTLQEVGGLWSFRYAPAWLDNPRRFPLSPY
FT                   LPLAPEALVDGASRRPVQWYFDNLLPEEGQRVLLAKDAKLEAADAFALLAWYGAESAGS
FT                   LTLLAPENAPQEPEPLRELPDDVLDSRIRNLPKAPLTHGAVKRMSLAGAQHKLAVVLRD
FT                   GVLFEPAGSTPSTHILKPDHPDADYPHSVVNEWFVMRLAKRLGLIVPEVYRRYVPAPVY
FT                   LIDRFDRTADPQGAWQRRHAIDACQLLGLDRTFKCAQGSMESLSALARACRGPALARPR
FT                   LFGWLVFNVLVGNADAHLKNLSFLVSHEGIELAPFYDLLSVAAYETPAFEKKGWPADTQ
FT                   LAWPILGARNFSQVDRQLLVEAGAALNIAKSTANRLLQSLTSRVIPEAEMLYEEIEAEN
FT                   AQILDARPDLAATMAGESRCLKTIIHSVIKEMARKTA"
FT   CDS_pept        255266..256564
FT                   /transl_table=11
FT                   /locus_tag="Bpet0233"
FT                   /product="NDP-sugar dehydrogenase"
FT                   /function="Involved in biosynthesis of a sugar nucleotide
FT                   precursor of a cell envelope polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40564"
FT                   /db_xref="GOA:A9HXR9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXR9"
FT                   /protein_id="CAP40564.1"
FT                   /translation="MKTVRFPVVKKIAVCGLGYVGLPVAVAFSKRFDVIGFDVDKRRIA
FT                   RLKEGHDWTGEIERDVLLASSMRFTDQVTELQGCDFFVVAVPTPVDERNNPDFSLLVRA
FT                   CQSIGPVLRPGCIVVFESTVHPGATEEICGPELEKASGLRCGVDFKLGYSPERINPGDR
FT                   QHPLEKIVKIVSGQDEASLEIIAGVYEKIIDAGVHRASSIKVAEAAKVLENTQRDINIA
FT                   LMNEMSKICDLVGIRTSEVLSAAGTKWNFLNFTPGLVGGHCIGVDPYYLTSKAQELGYH
FT                   PEVILSGRRINDGMASHVAARVVQTLARNGRLNASTRVGILGMTFKENVPDIRNSKVVD
FT                   LYNALGDYGITPVACDPMVDADQMEHEYGIKLVKRDEFRDMDVLILAVPHRETMDSIWD
FT                   DMPNLVKSGGMVCDLKSVLDSKRLQSDLVYWTL"
FT   CDS_pept        256603..259083
FT                   /transl_table=11
FT                   /locus_tag="Bpet0234"
FT                   /product="partial homologue to genes conserved in
FT                   polysaccharide synthesis clusters"
FT                   /function="FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40565"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXS0"
FT                   /protein_id="CAP40565.1"
FT                   /translation="MAAFTVAPIGTCRIHTPLRDAVGRYPIKLQLGRNYGFVHTSAEAL
FT                   QQARFMFGEREIPADVQRLIFRPSNGEQARQGTHKPADLYMVELSSRKLLTIDGYPIQS
FT                   NYVVRYFSEFFADRARTRMFWSLASADRFAERRALLEQDPVFKSLSQDDGDLLSRIVKR
FT                   DLTDDEIENEMHQLVGLLGKEKVVFVTHVNALTPDNTPIEQRGQLIAAVSAIAQRIDVP
FT                   CYDPTPLMNKIGQADAMENGGLDLTHYTPVFAERLCTEWFKNYMRPKMDTSTSQPAVPK
FT                   LGADDSAESIEKAWDAGDLRAASRRVRDVLRRYPGLPDHVLLFARIQEELGDYEGSLAL
FT                   LSGADGALASGSKAEQILMRNQFKLGRHDVAYSLAAGLLGDEIETPEIVRIAAVSARQL
FT                   GYVDEALVNWKQLFRISSPEDAGAVEAADTVLSMLQASDDMQAAIRWVHEVRAAIPSYG
FT                   RGFALLWRDRLMAADRAGLRALAAESPALDDPDTLELVKEASWRGCIVAAATLAVSCGL
FT                   VDSGQEDIRAWLLAQSSAWAEEGARAMEAGRLRDAAERICAHRLLNPNALAGVRAQRAL
FT                   ARAMRLDARAALLAGNYKEVIDLTDIAIDTHVDFPELDTMRGRAADALGDKKTAMQHLE
FT                   RAATSESAPLSTQLYFARVAFNGGWFGEAIDAYKMVLAHTSADQSAKDEAQRQLGRLGP
FT                   RAIRGAREILSAGDHQAAWNLLERVAKSWPQMAEIDHEKRRVLAVLYAEARTLDPSSTT
FT                   ERLALGERILKLVSDDPVGLRLAAVGAMRLHRFEQALPYWRLLKERSDNPEQFDHYIQR
FT                   CLAWIEKANRRKAA"
FT   CDS_pept        259080..261137
FT                   /transl_table=11
FT                   /locus_tag="Bpet0235"
FT                   /product="glycosyltransferase"
FT                   /function="Involved in biosynthesis of a cell envelope
FT                   polysaccharide"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40566"
FT                   /db_xref="GOA:A9HXS1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXS1"
FT                   /protein_id="CAP40566.1"
FT                   /translation="MNPALMTGRDHVASDLQRVHAQLEEIVTASGRVQIAQENLARAQA
FT                   LARDYMEDSKVRFLLLRLKESAGLNEGLSEQWSTLLQECPDDLQIVRYCATRLVKERHL
FT                   DEALSLVERHLPASTKSAAKLFARAKLLGDIRAHEQSDELFRRLISQHADRNMRVEFAK
FT                   RLRKRGLLADAFETIMPVADQLAPGSKAAELASELASDYAFYQDFEPEEELAGKDIRIV
FT                   SMKHAILHFRDRQIVDQPPERPVSVALVTGSLGPGGAERQLTRLAGELTRMAESPDHRP
FT                   ADVLMRPEKVEVLVKQHTEPSGNGKKQGLDFFLPVLAEAQIPVTEINRLPAVSVSHQSV
FT                   SDETLARLLEQLPPPVHYGVTRLAPVLRDNPFDVVSLWQDGTCLFGALAALLAGAPTIH
FT                   LVFRGLPPNIRKDRFREEYPELYQALAQVPGVYFVSNSVKAAQAYAEWLGIPIVRFHVL
FT                   YNGVPDLAIDASPGDKKKWLAFRKSTADATETVGGVFRLEPDKRPQLWIKLAAQYLKRR
FT                   PKARFVIVGDGRLHDNIVALARELRVTDRLLLVGLSNHVGYWYSQMDASVLLSRYEGLP
FT                   NVLIEAQLLGVPVVSTPAGGAGECFVENVTGHLLADVEHPDLNEACEKVASIVDQVRTN
FT                   EALREHSRHRAQKLFSLDAMLAKFLSLCVPVMPMSENDERMDMPMRRMLA"
FT   CDS_pept        261180..262337
FT                   /transl_table=11
FT                   /gene="wza1"
FT                   /locus_tag="Bpet0236"
FT                   /product="outer membrane protein involved in
FT                   polysaccharide"
FT                   /function="Outer membrane protein involved in
FT                   polysaccharide export"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40567"
FT                   /db_xref="GOA:A9HXS2"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXS2"
FT                   /protein_id="CAP40567.1"
FT                   /translation="MHTNVPASGPRRHAALTMVLLAAISLTGCQLPRSGPMLSEMTGAN
FT                   DDKDILVMPVSRELVQASKVPDVADFPAYYRDLTQAGFDRLVPGDGINVKVWERDGLGV
FT                   FAVDPSGVSDLGNQQIDRTGNIYFPILGKFHAAGLTLAQLHDAISARLSKLVLGSDVSV
FT                   TRVADTRGQMVTVQGNLTRPGMYPITQTSQRLSSALAQAAPVQTNPEQLVISLRRNSHV
FT                   ASVRLSDIYRNQKNDILLRPGDVITAYDAREYLTVLGAAGVQGRVAISKRNYSVLDALA
FT                   DSKGLDDKTADPRSVFLFTPAKAGVNGKPDSVPVVYQFDLTRPEQVALAREFSVHEGQA
FT                   IYISDAPFTQVQKVLSAFRVTMSAGFSATRAIDSDSGASSTNVTQ"
FT   CDS_pept        262345..263685
FT                   /transl_table=11
FT                   /gene="wzm1"
FT                   /locus_tag="Bpet0237"
FT                   /product="carbohydrate export ABC transporter transmembrane
FT                   component"
FT                   /function="ABC-type polysaccharide/polyol phosphate export
FT                   systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40568"
FT                   /db_xref="GOA:A9HXS3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXS3"
FT                   /protein_id="CAP40568.1"
FT                   /translation="MSNEDRIKSWRTRRSGGNYAVGSGVAAWRLDPAALFEEKAAPEVL
FT                   LKPLLARLQGEPHDSVAARRAVYEAIQAELDAEIARSGVDETLADFSRRRLRIIVRLLE
FT                   QDIRAGVDVFAPGYMPARLVADDERLAAAHARRVQRRKQDEARDARRHASRNDIALEIE
FT                   LPPDEAYDLAIFRSRLHVLHEQHHSRSASRGPATGRTLLAMFVYQLRVIHGESRIALLW
FT                   ALAGPVVLLTLISSLYILMGTHYILGMDVRSFSLSGATVWIMFRQIIFRSSSAYVSARG
FT                   LLNFQGVTPLMCALVQALIYLLVYLVAFAVLIFAGHALDFITLPQSWAGTILYVVLMGG
FT                   CGAAMGVLFGAIATFWHFYLRLAPVIERFLQIFSGVFFVSEQLPEQLRIWILWSPFAHG
FT                   MQLLRSAYFSAYTSQDASLGYFLTSLVFLMVLALAAERLARPNIQPM"
FT   CDS_pept        263695..264408
FT                   /transl_table=11
FT                   /gene="wzt1"
FT                   /locus_tag="Bpet0238"
FT                   /product="ATPase component of an ABC polysaccharide
FT                   exporter"
FT                   /function="Involved in export of a cell envelope
FT                   polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40569"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXS4"
FT                   /protein_id="CAP40569.1"
FT                   /translation="MIHLNGVTDDPYAFGSRQPLLANANLDIPVGRYALLSSAPELHRQ
FT                   IVDVLCCLRPPRQGFVKHDGKVSWAIGRQGFIRGKATGLSMIEFVSDMYEVDPDVTYEL
FT                   VADLVSDPKCLAKPMEHWPIYARQEFSFALALAPAFDVYVIEGAIPFEPCRFTRLWQAL
FT                   FEERLVGRTLILSSYRHNQMADYCFKGLIYERSVLNIEDDLDQCIRRFPPRRSRSETGA
FT                   GDDVFGGGFEDGLGL"
FT   CDS_pept        264530..265558
FT                   /transl_table=11
FT                   /gene="kpsE1"
FT                   /locus_tag="Bpet0239"
FT                   /product="MPA2 protein component of an ABC-type
FT                   polysaccharide export system"
FT                   /function="Capsule polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40570"
FT                   /db_xref="GOA:A9HXS5"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXS5"
FT                   /protein_id="CAP40570.1"
FT                   /translation="MFCIATPRYEAESRFFVQSGSGQQGGGGAASLITTGSMGGALGGF
FT                   VDGWAVNDFLKSRDCMRQLDEKVGLRQYLTRAGIDPLNHLSADSSEDELYRAYQASVDV
FT                   SFNALEQIDVLRVSAFSSEDAEILSKALIGLAENFVSSMNEKGVADKLKVSEESVRLAE
FT                   KKALAAREDLTSWRTAHGNIDPTATVAMLLNLSSQLEAELSTAQINLDKIRALGNNDHF
FT                   MLRPAELQVVALKKRITALRHRLSGEGNTEAKQLKEYEALRNAQAFADSNLTLAQQSYQ
FT                   QALTDALRLQRYLSIIAQPVPTDRPSSPRTVILLLQALAIGFALMFITRVTIALLRGLR
FT                   HG"
FT   CDS_pept        265551..267455
FT                   /transl_table=11
FT                   /locus_tag="Bpet0240"
FT                   /product="conserved hypothetical protein"
FT                   /function="Possibly involved in biosynthesis of a cell
FT                   envelope polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40571"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXS6"
FT                   /protein_id="CAP40571.1"
FT                   /translation="MVNAATESHRREADAAAGLRDVIKKIHASADPVPEMAALGPALAQ
FT                   VADGWRDVRRLLVSPFVREGRLVPAIAALETLVAAYPARAEERRLLASLLGRTGQWARA
FT                   IAEADAAAGIEPDAMALHAARIQLRMQAGRVADAAEIARATMGMAASEPGEAHFWLLAL
FT                   ARNGDVAEAADIAAALDADNLPNERVATAAVRALIDDGRAEAAIRLGDAALSAGHDCPA
FT                   LRSSLGVSHLRRGTEEDRKVHALAHFEAGLRAAPADVRLLSLYGETLLRAGRYKEAVPP
FT                   LKQAIDLAPDLEQTRGLYARALRYTLQYDEAADQLVKLVEKSPEKLLWQRSAIGALSQA
FT                   GRAQDAEALFKQYLAKRSMHLPKTFQEAMGRLEERLDTAPIPQARLDWAWSLRGEADTD
FT                   RAQWERRARWGHLVDHLLLDWLECREDSAEEAMHLLGELDTGERFFAPLLAAGRGVVVA
FT                   TAHVGPMYAGLMALELLGIPSRWLATAPSIAQSSYAAALISTSDQTEAQVAKACIRALG
FT                   AGYVLCLAVDGAANPAAPRTAFEGQEVTYSSFASHLAHRLGVPSVFYAPRWDNGRVAYT
FT                   LEMLPAATPGEDADAYSRRWQAAYFERLKEHLAGPPENLRLSGGIWRHVQPVDRSTQR"
FT   CDS_pept        267468..268676
FT                   /transl_table=11
FT                   /locus_tag="Bpet0241"
FT                   /function="Pectate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40572"
FT                   /db_xref="GOA:A9HXS7"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR018082"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXS7"
FT                   /protein_id="CAP40572.1"
FT                   /translation="MISVLNAVRGLFLLAALHGGAAAADELCKSPDEHCPFVSSLLQLR
FT                   EGYGAKATGGLGGRLVVVTSDQDAGPGTLRAALAQARKGPAWIRFASDMTIVLNSQLRV
FT                   PSNITIDGRGKHVTLIDDGLGVYGSKNVILTHLTIDGRLNRLTQAVNVANGSRDVWVNH
FT                   LDLSRMSDRLLNVKNGSTDVTISWTKFHDSNKVMLLNNITSKNLFKNYGRDSIARVTLH
FT                   HNYFFNTVQRNPRGQFGTFHVFNNLLENWDFYGMSFSLEAKALVEGNIFSNVTQRKCVE
FT                   PEFFPTVEGINVNYCRYIPVASGRSALENGASDRGAYEKRKAQYGYTREYKAFLRVKDN
FT                   LYLGDAEPVLQDYRPEAAPVPPYCYGYERPTPELAERIRQFAGNTAGRTPRPEPRAGTG
FT                   CPG"
FT   CDS_pept        complement(268723..269592)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0242"
FT                   /product="probable dehydrogenase"
FT                   /function="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40573"
FT                   /db_xref="GOA:A9HXS8"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXS8"
FT                   /protein_id="CAP40573.1"
FT                   /translation="MEIGLIGLGAMGRAMAANLVAAGHSVKCWNRSGGQVDGVTMVAAP
FT                   ADAFAADAVLTMLSDDAAIRGALLDTGVLKQARPGVVHVVSSTISVAFSRELAEHHRQA
FT                   GVAYVAAPVLGRPDVAAKGELNILAAGAPAALERVRPMLEAIGKRTWLLGEQPAGAHAA
FT                   KVACNMMIAMAIEAMAEAASLTDANGVPRADFFELILGTLFGSRSYQVYSNLINEGEYQ
FT                   PGFKATLGLKDLRLAREAAQALAAPLPMLAAVHEQMRQAVEAGGAERDWSIMADYTLRS
FT                   AGGQAGRT"
FT   CDS_pept        complement(269794..271281)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0243"
FT                   /product="transcriptional regulator, GntR-family"
FT                   /function="Transcriptional regulators containing a DNA-
FT                   binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40574"
FT                   /db_xref="GOA:A9HXS9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXS9"
FT                   /protein_id="CAP40574.1"
FT                   /translation="MGQIKLPPGRSPGPTGAGRRIYDLLRAQIADGTLAAKGRMPSTRA
FT                   LAIELGVSRTTVTAAYEQLAAEGFLVTSPGRAARVAARLAAAAPSVSAGKSRSRPPPRL
FT                   SQFGRRVAALDLPRLPSAQAPVAIDFRYGAVASRDFPTLAWRRAYQAELLRPPRSLSYI
FT                   APEGDGSLRRAVQGYLARARGLSCDAAQIVVVHGSQQAIDLCARLLLEAQDTFVFEEPG
FT                   YPMARRCFEATGARLLAMPVDEHGLDTASLPGDSRARLAYVTPSHQFPLGGVLPVGRRM
FT                   ALLQWAQRHQAWIIEDDYDGEFRYGQRPIDALRSIDVNDRVIYIGTFSKTLSPQLRLGY
FT                   LVLPAELVAFFRQAKQLADRHAPVLDQRVLASLIDSGAYERHVRRVRRENDQRRAALLD
FT                   AVARHLGDCARITGTAAGLHAVLWLRGLAAEDEPALVAACHGQGVGIYPVSPLFTEPPP
FT                   APGGRPAGLIMGYAGLAPQEIERGIRILATIVKHWRG"
FT   CDS_pept        271379..272014
FT                   /transl_table=11
FT                   /locus_tag="Bpet0244"
FT                   /product="negative transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40575"
FT                   /db_xref="GOA:A9HXT0"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXT0"
FT                   /protein_id="CAP40575.1"
FT                   /translation="MYIPEHFAETRPEVLHRIIREHPLGVLVTHGPDGLDANHLPFEID
FT                   PDQGPHGLLSAHVARANPVWQSCPTGTPVMVVFRGAEAYISPNWYPSKHKAHRQVPTWN
FT                   YEVVHAHGILTIRDDERFVRGIVARLTRRHEAAEPRPWKMGDAPPDFIDDMLRHIVGIE
FT                   ISITSLVGKLKLSQNKDARDRLGAVQALDARGSHELAASMRDAGREND"
FT   CDS_pept        272165..272497
FT                   /transl_table=11
FT                   /locus_tag="Bpet0245"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40576"
FT                   /db_xref="GOA:A9HXT1"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXT1"
FT                   /protein_id="CAP40576.1"
FT                   /translation="MIIAKRFIQVVFAGALALGAGATAQADDQARNTIIGAGLGGVAGA
FT                   LLSDGDPLVTLGGAAAGGVLGNIITDDDRGRHRHHWDRDRSYKRASYRDHDRHHGNKHW
FT                   RKHRRH"
FT   CDS_pept        complement(272531..273757)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0246"
FT                   /product="probable MFS transporter"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40577"
FT                   /db_xref="GOA:A9HXT2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXT2"
FT                   /protein_id="CAP40577.1"
FT                   /translation="MTRAAPTWLMPVVAIFTLQTTSSFLNRLIPIVAPAMSDEFGWSGS
FT                   SIGFLTASNSLGGLAILVAGSALLKQIGGMRTLQLTLVLGAAGMAFLLFPSVGIALAAC
FT                   FIMGLSNGAANPAGSEVLQRFSPPGMRNLIFSIKQAGVPLGGVIAGLLVPVLVTLTSWR
FT                   IALFFCAVAVVLPTALTWRLSANLDETPPRKRRALATPTLHSLRTLTVPLASLAHNPGL
FT                   MKMSVVGSLFAVSQSCWFTFTVIYLIDRLGFSLSLAGAVFAVMQAGGVIGRVVLGWLSD
FT                   RLHSAAATLSIAAILSAATTALLGLTTPAWPLWAIVVLAFVAGSSAASWNGVQIAEVAR
FT                   RSPAHLISETAAGSSILVNLTNMVAPTLFAAYVAIGGHYDYAFIFTGACSLLVLACLPR
FT                   DEAAARKRA"
FT   CDS_pept        274032..274334
FT                   /transl_table=11
FT                   /locus_tag="Bpet0247"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40578"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXT3"
FT                   /protein_id="CAP40578.1"
FT                   /translation="MKVMRALWVGMFGAVIATPAIAAGGKIFFTGSIVVPADCRTDLQV
FT                   QGRQPTATLDCGARAGAPERRPPAIPVAEVAVRPLHDGAVSPDGIRRYVVDVTYR"
FT   CDS_pept        complement(274350..274907)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0248"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40579"
FT                   /db_xref="GOA:A9HXT4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXT4"
FT                   /protein_id="CAP40579.1"
FT                   /translation="MTSKETRKVLAHWREAVPHDRLAHLIKDATRALVRGLQMRLSDHN
FT                   VSFGHWAFLRILWEQDGLTQRELSEQAGVMEPTTYAAMKAMEALGYIERKHLPGNNKNI
FT                   HVFLTRNGRALKKKLIPLAEEINAIGTRGLTAAEIKTARKVLLTIIANLADDEASMENA
FT                   ERRVPSTRELSRRINETAESQA"
FT   CDS_pept        complement(275001..276203)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0249"
FT                   /product="putative oxidoreductase"
FT                   /function="Predicted dehydrogenases and related proteins"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40580"
FT                   /db_xref="GOA:A9HXT5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXT5"
FT                   /protein_id="CAP40580.1"
FT                   /translation="MGTSVLNLGVIGLGRAFSLMLPSFLGDARVRLVAACDPRPAARTQ
FT                   FASDFQCPVYESAEALARNPDVQAVYIASPHQHHAEHTRIAAAHGKHVLVEKPMALSLE
FT                   ECDAMISACDAAGVHLVIGHCHSFDTPYLRCRELIAQGTFGSVRMVHALNYTDYLYRPR
FT                   RPEELATREGGGAVFSQAAHQVDIVRMLVGRRPTRLRCALGNWDPQRPTEGAYSALLWF
FT                   EGGAYASLNYNGYAHFDSDEWMDWTGEMGHAKNPDDYGAARRKLERLGSPRDEAALKAA
FT                   GTYGGPSYTAPAAPAPGAPPARHQHFGAIVVSCEHADLRPLPHGIMVYGDANRDFLPLP
FT                   PPAAPRLEVVGELHDAIYLDRAPLHDGRWAKATLEICLAMLQSNDSGADATLHRQIDAA
FT                   S"
FT   CDS_pept        complement(276225..277196)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0250"
FT                   /product="Phthalate dioxygenase reductase"
FT                   /function="Flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40581"
FT                   /db_xref="GOA:A9HXT6"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXT6"
FT                   /protein_id="CAP40581.1"
FT                   /translation="MTEPTSGPETLMPLRIASIADAADGIRSFELRDAGGGELPPFTPG
FT                   SHVKVRVPNGEMRKYSLCNNPAERDRYVITVKRDAHGRGGSVSLVDQAAVGDVLPTSLP
FT                   DNAFALVDNPDSLIFIAGGIGITPILSMIRSLDERPEIGWKLYYLSQSPATTAFLDELA
FT                   CPELQGRVRIHHDHGDPAQSLDLWPVLEKPNRGHVYCCGPRGLMEAVRDMSGHWSPGRI
FT                   HFESFLEGGGKQPDDQPFTVELARSGGEFVVPVGKSILSVLLQAGVRVGHSCESGTCGS
FT                   CRTGLLAGTADHRDMVLLPDEHDSQIMVCVSRATCDKLVLDL"
FT   CDS_pept        complement(277225..278187)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0251"
FT                   /product="4,5-dihydroxyphthalate decarboxylase"
FT                   /function="ABC-type taurine transport system periplasmic
FT                   component"
FT                   /EC_number="4.1.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40582"
FT                   /db_xref="GOA:A9HXT7"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXT7"
FT                   /protein_id="CAP40582.1"
FT                   /translation="MGDYDRNRALYDGAVQIDGVNPTYMLLSPEEMFFRAFRFQDFDIS
FT                   ELSFSSYLVKHARGDCPYIALPIFLSRAFRHTSIYVRKDRIRSPQDLKGKRIGIPEYQL
FT                   TANVWARALLEDDYGVKPSDVTWVRGGIDQPGRPEKIKLQLPADVKMIDAAPSTTISDM
FT                   LDRGEIEGFMAPRAPFGAARANPDVGWLFDDPTAVAKDYYKRTGIFPIMHVVGLRKTLA
FT                   EQHPWLPGALLKAFEQSKAAALAKLEDTSATKVTLPFVEEQLKAARETLGENYWAYGVE
FT                   ANRPTLEAFTRHHHAQGLSPRHVAVDELFHPGTYETYKI"
FT   CDS_pept        complement(278230..279549)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0252"
FT                   /product="putative dioxygenase"
FT                   /function="Phenylpropionate dioxygenase and related ring-
FT                   hydroxylating dioxygenases large terminal subunit"
FT                   /EC_number="1.14.12.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40583"
FT                   /db_xref="GOA:A9HXT8"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXT8"
FT                   /protein_id="CAP40583.1"
FT                   /translation="MLTTEENELLCRVVGDAPMGQLMRRHWTPVCLSEEVSEPDCDPVQ
FT                   ARVLGEDLVVFRDTDGRVGVMDEYCPHRRVSLVYGRNEECGLRCLYHGWKMDVEGTVIE
FT                   MVSEPAASTMAQKVKHKAYKVQEWGGVIWAYMGAQDDIPPFAPPPWAPTADTKVSIAKV
FT                   IIPCNWAQILEGAIDSAHSSSLHSSDFVPARVGGAEATDKNWLRPSTDKAPRLQVQRTP
FT                   FGFRYAAIRRPITNAAQNDYVRSTVFVAPGTVLIPPNNLYNVANVNVPQDDTSTAFYFI
FT                   AWGEKATTPDTETWRRFLGTSVGVDLDERYRPHRNPENRFWQDRQAMKAGNFTGIRGFP
FT                   NQDIAMWITMGPLANRAEERLGASDLAIVEFRRQMLEAVQAFQKGEAAIGTGDLRIPAG
FT                   VCSFQAIVPKTTDWREFSAHPAGAQPGNDPELAGNYQTTA"
FT   CDS_pept        complement(279641..280654)
FT                   /transl_table=11
FT                   /gene="bug5"
FT                   /locus_tag="Bpet0253"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40584"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXT9"
FT                   /protein_id="CAP40584.1"
FT                   /translation="MIHIRSALRRQGCSVVLASLLSASLGLALPAAAHAEQASQYPSRP
FT                   IRFIVPYAAGGLPDTVARVVAQGLTLSMGQPVVVENKPGANGVVAAQALASSPADGYSY
FT                   LVTDGSMMSINPSLYKDLPYDPKRDFVPVSLVATSPLFLAASTQTGIASLQDFIKRVKA
FT                   KPGVMNYGSSGVGSSHHLTMEAMKVDLGLDINHVPFRGSGQSVPAMIGNQVDVVFAALP
FT                   SLSGFADKGQAKILATNAGKRSALAPDIPAISEVIPGFNFAVTVGALAPTGTPDFAVQK
FT                   LSAAIAQAVKAPAVVKQFNTLGIEPVGGTPAEYEAAIDDETKRYQSAIKAAGVKAD"
FT   CDS_pept        complement(281019..281609)
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="Bpet0254"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /function="Protocatechuate 34-dioxygenase beta subunit"
FT                   /EC_number="1.13.11.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40585"
FT                   /db_xref="GOA:A9HXU0"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXU0"
FT                   /protein_id="CAP40585.1"
FT                   /translation="MSVLKQTPSQTIGPFFAYGLCPEQYNFDLKSLFTPVLAERHAAGE
FT                   PITIEGRVYDGSGQAVDDAVIEMLQADAAGEYARSLEGIAASGFKGFARVGTGADPQSR
FT                   FVVETIKPGALGPASAPHIEVIVMMRGMLLHAYTRIYFEDDAAAHAQDAVLAAVPPERR
FT                   GTLIARRLPYAGRTAYQFDIHLQGPHETVFFDV"
FT   CDS_pept        complement(281613..282329)
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="Bpet0255"
FT                   /product="protocatechuate 3,4-dioxygenase beta chain"
FT                   /function="Protocatechuate 34-dioxygenase beta subunit"
FT                   /EC_number="1.13.11.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40586"
FT                   /db_xref="GOA:A9HXU1"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXU1"
FT                   /protein_id="CAP40586.1"
FT                   /translation="MDGSTPPHTILTPRDWDSHPPYRHPEYKSSVLRSPTLPLIPLDEA
FT                   LKNRQAPVYGASCLGPLDHDLTRNAAKNGAPLGERIVVTGRVLDEGGRPVRNTLVEIWQ
FT                   ANAAGRYVHKGDQHDAPLDPNFLGAGRCLTDEQGRYRFLTVKPGAYPWGNHGNAWRPNH
FT                   IHFSLFGDYFGSRLVTQMYFPGDPLLQLDPIFQGTPAHARERLISRFSLDATQEGFALG
FT                   YEFDIVLRGARQTPTE"
FT   CDS_pept        282435..283385
FT                   /transl_table=11
FT                   /gene="pcaQ"
FT                   /locus_tag="Bpet0256"
FT                   /product="transcriptional regulator of pca Genes,
FT                   LysR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40587"
FT                   /db_xref="GOA:A9HXU2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXU2"
FT                   /protein_id="CAP40587.1"
FT                   /translation="MENLFQSGRIKLRHIQCFLAVAQLNNLQRAAERLSITQPAVSKTL
FT                   SELESVLGVRLFERGRRGAELTRDGRIFAPYAHNCLGSLRDGIGRLAQADDGASVTVAL
FT                   GILPTVASVLLPAALHAFRQAWPMASLRIHTGRNAELLERLKAADIEFAVGRLGEPDAM
FT                   AGMSFEHLFREPLTVVVRAGHALLGDEALAPMAMARHLLIVPPEGTLIRQSAESVISAF
FT                   GLPRHVARVESLSVSLSLELTLRNDAVWFVPSSLVERGVADNTLARLPMPFGGTDEPMG
FT                   LLRRTDVAPSPAALSLLDALRRVGLQREQARVAPG"
FT   CDS_pept        complement(283382..283837)
FT                   /transl_table=11
FT                   /gene="pcaC2"
FT                   /locus_tag="Bpet0257"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /function="Uncharacterized homolog of gamma-
FT                   carboxymuconolactone decarboxylase subunit"
FT                   /EC_number="4.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40588"
FT                   /db_xref="GOA:A9HXU3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXU3"
FT                   /protein_id="CAP40588.1"
FT                   /translation="MSDSLPDDALERGLANRRKILGDAWVDRSVGNANTLNVEFQRLIT
FT                   CYAWDSIWSRPGLDPRTRRIMVLAITASMGRWEEFELHVRTGLQAPADAPDAAALDLDT
FT                   IREVLLQTAVYAGVPAGNTGMAIVLKVLAALDRSPPKADFWSGEPAA"
FT   CDS_pept        complement(283830..285239)
FT                   /transl_table=11
FT                   /gene="pcaB2"
FT                   /locus_tag="Bpet0258"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /function="Adenylosuccinate lyase"
FT                   /EC_number="5.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40589"
FT                   /db_xref="GOA:A9HXU4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXU4"
FT                   /protein_id="CAP40589.1"
FT                   /translation="MSTDKPAMAASLIDQCLDPAGDIGLFSDQQWLDALLRFEAALARA
FT                   QASAGLVPASAAAAIARACASIELNRADFVERARGTGAFGIGLVDPIRAFLASHDPAAL
FT                   PCLHWGTTTQDAVDTAHAVLTKTALAALLDELQKLAAALRALAHAHAATPMMARSLLQP
FT                   AQVTSFGFKCAQSAGALQRSASQLCTLAPHALCVQLGGAVGNRAAMGHRAAQVELVLAA
FT                   ELGLWASGQSWHTQRDAWMRLAMEASVCAGSLSKLARDWSLMSQFEVGELAEAPRGRTS
FT                   SAMPHKRNSVHCMQAIALTQPVPGLAASLLGAMTQAHERAMGEWQAELSVWAPLWRRVH
FT                   GAAAALRLAADGLRVDAARMQSHIDALYQVIFSEACTDALAPITGREAAQQAIEHLAPQ
FT                   ALAQRQPLSALLQHWVATTRGAEPARAAAHALATATDPQRAVQASAACCHELLRALDAS
FT                   EPSSSLEPHHV"
FT   CDS_pept        complement(285236..286234)
FT                   /transl_table=11
FT                   /gene="bug6"
FT                   /locus_tag="Bpet0259"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40590"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXU5"
FT                   /protein_id="CAP40590.1"
FT                   /translation="MSRTAPSCPSRRHALAAALGLAAVSITPAWAQGAGAAMRIIVPFA
FT                   PGGGNDVLARQLAHGLNDMFKLDVIVENKPGAGGNVGTEQVVRAAAQSNTFLLGHTGTV
FT                   SINPALYKNLKFNASKDLQPVAMFASSALLLVVPAESPIQSVAQLAEALRAKGSDMDYA
FT                   SSGTGTGGHLTGEMFLQTLGAQAVHVPYKGTAPALADVAGGQVDFSFSVIPAAMALVKS
FT                   GKLRALAVTSAKRMHLMPDVPTMIESGVPELADFESTLTYGILAPKAVDAQVVQQLQAR
FT                   ILDVAATPDFQSRLAVEGAEPMLGNTAEYTRRIQEESRKWGHVIAVSGASA"
FT   CDS_pept        286352..287248
FT                   /transl_table=11
FT                   /locus_tag="Bpet0260"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40591"
FT                   /db_xref="GOA:A9HXU6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXU6"
FT                   /protein_id="CAP40591.1"
FT                   /translation="MDIRYLNHFLKVVAVGSMSEAARQLGLSPAAVAQQMRALERELDV
FT                   SLLVRQGRSVRPTAAGQRLVERGQALVQDADALRDWVATDEDEGELRLGTVNTALHGFL
FT                   PDILQAFTEHYPRVRIALRIGITPALYSALVQSELDAALCLKLSFDLPKTVCWTPLRHE
FT                   PLVVLAHARDAGRDPLELLRNEPLVRYDRQLAGGSLAQRYLQAHGIRPHERMELNSIMA
FT                   IALLVERGLGVGLVPDIGQGLAGQHLRKLAVPPMPAEGGDLTPPPRELGLLWRDQSQRG
FT                   RWVRTLLQCAQEIVRAP"
FT   CDS_pept        287393..288496
FT                   /transl_table=11
FT                   /locus_tag="Bpet0261"
FT                   /product="putative transmembrane sensor histidine kinase
FT                   transcription regulator protein"
FT                   /function="Putative regulator of cell autolysis"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40592"
FT                   /db_xref="GOA:A9HXU7"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXU7"
FT                   /protein_id="CAP40592.1"
FT                   /translation="MALPDSPSALFSSASQELSRGESSAGFWRAQVVGWLFLAIIGFCI
FT                   RLAVFGSAPAAFWLTLTLEPLAFLLTSAAAVWHGRRASSKHSPLLVLACSVLLCVAASA
FT                   LLASIAYAIHQLFPPQSLRVMPENQYRLGFLYYMGILSIWTLVYFGVAAELAARTERIS
FT                   KMKAETLALRLELEHLQSQIEPHFLFNALNTIVAEIEARPAIAEEMTRRLADYLRYSLD
FT                   RRGQGLCGLDEEIEAAQDYVRIQALRFDRQLEYRCHIDPASLAWQIPHMTLQGLVENAI
FT                   KHGMRSDNESFRINLRTRIQDDELVVAVDNPGQLRAPYDLAKGGGGLGNLCRRLALCYP
FT                   GRNRFSLHQQDDRIVAEIRLRGDPVAP"
FT   CDS_pept        complement(288500..289573)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0262"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40593"
FT                   /db_xref="GOA:A9HXU8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXU8"
FT                   /protein_id="CAP40593.1"
FT                   /translation="MKGPLAGLRVLELEAPGPVPWAGMMLADMGATVIRIERPAPADMG
FT                   IPRDARFELTARGKQAVAADLKTEAGRQMVLDLAAEADVLLEGLRPGVMERLGLGPDAC
FT                   WARNAALVYGRITGWGQTGPLAQTVGHDINYLAASGVLHSIGPETGPPVVPLNLIGDFG
FT                   AGGMLLLTGVLAALLESRQSGKGQVVDAAMVDGALSMLAPILGRWQRGQWQDRRASNLL
FT                   DGGAPFYTTYATSDDKAVAVGAIEPRFYAALLTGLGLDAGSLPDQHDQASWPDMRARLA
FT                   RIFARHPRDHWAGVFQDTEACVTPVLSLAEVPRHPHFVARSSFQQINNVLHPAPAPRFS
FT                   RTPGEISAPPTGRARPG"
FT   CDS_pept        complement(289570..290586)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0263"
FT                   /product="Alcohol dehydrogenase III, mitochondrial
FT                   precursor"
FT                   /function="NADPH:quinone reductase and related Zn-
FT                   dependent oxidoreductases"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40594"
FT                   /db_xref="GOA:A9HXU9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXU9"
FT                   /protein_id="CAP40594.1"
FT                   /translation="MSMLQQPDSFQALVTRRIDGNVQSAIETVTLPQLSAGEVVVRTRY
FT                   AGINYKDCLSIRGKAKIITDYPRIAGIEAVGRVAASADDAFAPGDEVLVHGFQTGIAFD
FT                   GGFSEWMQVPARHLQKLPPGLSAREAAILGVPGFTAAMALARFESYGLAPAEGPVAVSG
FT                   ANGAVGMLAISILARAGYHIAAITRRPEQADTLRRLGAAEIVDVRTALDSTRPLESARY
FT                   AAAIDNVGGNVLAWLLRSMKDEGLVASVGNAGGNHYEGSVLPFIMRRVHLFGIVANAGW
FT                   PERQRLWQKLAAEWRPGFEALEPHVHAITLPELPAHADRQLQGATSGRTLVDFGETP"
FT   CDS_pept        complement(290599..291810)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0264"
FT                   /product="Predicted acyl_CoA transferase/carnitine
FT                   dehydratase"
FT                   /function="Predicted acyl-CoA transferases/carnitine
FT                   dehydratase"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40595"
FT                   /db_xref="GOA:A9HXV0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXV0"
FT                   /protein_id="CAP40595.1"
FT                   /translation="MTLTPSSSGALAGVRILDMATVLAAPSGATLCADHGADVVKLELP
FT                   DGSDALRHMQPIKDGSPLWWKVANRGKRGITLDVRKEQGRQILLSMLPSFDVLVENFRS
FT                   GSMDRWGLDIETLHRANPRLIVVRLTGFGQTGPYRSRAGFARVFEAMSGFTNLTGEAGG
FT                   SPLHSNFPLGDSIAGIFCAFAIAAEVARLRGNPELPGAEVDLAATEALFRMLDPLPVEH
FT                   EQLGQVRRAAGNRTTYTSPSNMYRSKDGVYFSLVASSQAVYVRLCNAVGKPEWITDPRF
FT                   DTLPKRVQNMDALDGALAQWFASHAFADICAQLEPHEIPFTKVYDIEDIKADPHFQARN
FT                   AIIRLPDPDHGSLPAPCIVPRVIGRDMPAPRSGPSVGEHNAEVYAEFGITADQLAELRE
FT                   QRVI"
FT   CDS_pept        291937..292776
FT                   /transl_table=11
FT                   /locus_tag="Bpet0265"
FT                   /product="transcriptional regulator, IclR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40596"
FT                   /db_xref="GOA:A9HXV1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXV1"
FT                   /protein_id="CAP40596.1"
FT                   /translation="MPAPTQRNRKVSAISLPGLVNPHDLSSDRQFSMNLARGLEVLRAF
FT                   TASAPLLGNREIADRTGLPKPTVSRLTYTLTLLGYLSRDPQLQKYRLGPGVLALGHPLL
FT                   ASMHVRQLAKPVMEALARTTGCTVNLGIRDRDNVVYIDSVRADSANQHLPDIGTSRPLL
FT                   ASSIGRALILAYPAAERTAILNYLKVQNRAYFEQYRGVWEADLKRFAAGGYCHSKGDWQ
FT                   KDIHAVAVPIRRPHGEPPLALNCTIAAHRVQKDKLVHEVVPLLKEAVHKLAFEQGLN"
FT   CDS_pept        292800..293954
FT                   /transl_table=11
FT                   /gene="acd2"
FT                   /locus_tag="Bpet0266"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /function="Acyl-CoA dehydrogenases"
FT                   /EC_number="1.3.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40597"
FT                   /db_xref="GOA:A9HXV2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXV2"
FT                   /protein_id="CAP40597.1"
FT                   /translation="MIRDPIKFEAMLNEVREFLRAECLPIEQQVDENDVIPEPVVQRMR
FT                   DLGLFGHSIPQEYGGAGLTTEELARVNIEVSQVATAFRARFGGNTGIASESLVADGTPE
FT                   QKRQYLPLLASGQITGCFALTEPEAGSDATALKTRAVRDGAYYEISGRKCFITNAPIAD
FT                   LFTVFARTDPDSRGSAGISAFLVERDTPGLATPPAYRKLGQHGSPVGEVVLDRVRVHES
FT                   AIVGGTEGRGFRTAMKALNKQRINLAGLCVGPAIRLVREMVRRAHERKQFGQAIGEFQL
FT                   VQQMIAESNTAVHAARALVLETARKRDDGVDVTLEASMCKLFASEMCGQVADRAVQVFG
FT                   GAGYIAGNVVERFYRDVRVFRLYEGTSQIHIANIAKRTMAAMPG"
FT   CDS_pept        293991..294962
FT                   /transl_table=11
FT                   /locus_tag="Bpetpseudo_01"
FT                   /product="pseudogene"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpetpseudo_01"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40598"
FT                   /protein_id="CAP40598.1"
FT                   /translation="MKITHLLAACALAMLVPASAMAQGDYPTRTIKIVVPFSAGGIVDS
FT                   VARLIGDKLATRYGQAVVVENRTGAGGAIGTDYVARAPADGYTLLLVSPSHAVAPILKK
FT                   NIAWNPVRDFKAIAGFGIVPNIIVVHPSVPAKTMAELIALAKKSDPPMTYSTAGVGTSN
FT                   HLSGELLAQEAHIKLTHVPYKGQTDALNDLLAGRVEMMPLTAALAIQQVQAGKLRGLAV
FT                   TTAKRASAVPDLPTVAEAADLPDYAVGTWFGLVAPAATPAEVREKLARDVSEIIAMPDV
FT                   QAKFASLGMELAPQSPAEFDAFVAAEFDKWGKVFKQAGIEAN"
FT   CDS_pept        294964..296067
FT                   /transl_table=11
FT                   /locus_tag="Bpet0267"
FT                   /product="conserved hypothetical protein"
FT                   /function="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40599"
FT                   /db_xref="GOA:A9HXV4"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXV4"
FT                   /protein_id="CAP40599.1"
FT                   /translation="MSRIRTPICDLLEIRHPIFGFSHEPDVVVALAQAGGFPVLGLGRD
FT                   EPARIPDIVSEVESRLKGLPYGIDLMLPANVPEQADLAGLRASLPQEHVEFVDGLRRRF
FT                   GIKPPLKPSFFTSHARSEALFEAQIDAVLQSNARVVATAIGLRPGLLQEARRRGKLSFS
FT                   LVGSVRHAQKALALGVDVLVAQGYDAGGHTGPVGTMSLLPQVIAAANGKPVLAAGGIAT
FT                   GGQVLGCVGMGAQGAWLGTLWMAARENHTPAALLQRLVASGSEDTLISRAHSGKPCRVV
FT                   RSEWIDAWEADGSPAPLKMPLQQVLTGDVFASLHEHGEPRLIYEAAGQSVFGIDGETCV
FT                   ADQMRKLVREMDEAWDCLAALSQPAAS"
FT   CDS_pept        296144..297022
FT                   /transl_table=11
FT                   /locus_tag="Bpet0268"
FT                   /product="hypothetical protein, probable enoyl-CoA
FT                   hydratase/isomerase family member"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40600"
FT                   /db_xref="GOA:A9HXV5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXV5"
FT                   /protein_id="CAP40600.1"
FT                   /translation="MNTPIFHAASLVIENGIAEFTHNHPASRNAMSTALRADYARMLDA
FT                   VAADGSVRALILRGAGGSFCAGGDLHEMADRLRDPAEGSPAATRRRIGASAPWLRRLLE
FT                   LDAIVIAAVEGPAAGAGFSLALHADLVIASQDARFSMSFPRIGAVADFGAHYLLPRIVG
FT                   LSAARGILLTGRTLDAREARALGIVHALHPAGRLTQAAHALAQQICRGPADALAMSKRL
FT                   LNLSFDTDYATMANMEALSQAVAMAAPVHRDAVRRFVEKQAQSYDWDRDGQATGLGRRA
FT                   GVTPSVTPGGR"
FT   CDS_pept        complement(297032..297778)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40601"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXV6"
FT                   /protein_id="CAP40601.1"
FT                   /translation="MIWQVCQGPQHIGPVGGTLYRLVESQEQIATLSYVDTLEEQAVLE
FT                   SLIDSIKPPYPEADAGYHYLLKTPFRYPPLPWGSRFGRTHEPGIFYGGCSIGTTLAESA
FT                   YYRFVFWHSMDAPPPKAQIHSQHTLFSVGYKTPQGVRLQAPPFDAYRAELAHPARYQAA
FT                   QQLGTDMRQAGVQAFEYYSARDPAGGCCVGLFTLDAMAQKRPRDASPWLCQASAETIAF
FT                   KQAGGREVATYPISGFLYQGKLPIPA"
FT   CDS_pept        complement(297778..298761)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0270"
FT                   /product="putative DNA-binding protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40603"
FT                   /db_xref="GOA:A9HXV8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXV8"
FT                   /protein_id="CAP40603.1"
FT                   /translation="MGGLRFRIGTRRCRRGAHVRKIYTTGQAPAASLALHGSHYGARAA
FT                   MVAMLAQVNALPCAETKPAIANGNAQAGPEQAGLQVRGQVVAAFISVPVIRFVFGHRVV
FT                   EITLEIGPHGGIGVFVDRERRRSVLDEQVQQAHLEAPQLGQPGQDFVCHQMEAAPARGQ
FT                   RQRFLYPHSCLPVVARAPGVRNCSYCTLQLLYVQYAHKGSLMTALHRTAPSPDAVLAKA
FT                   VLRAADQLGLRQADLAAVLGIHRTAVSRLKQNLSLEPTSKQGELALLLVRMARALYTLA
FT                   GGDPDWIRHFMHTPNKVTGGVPARQIETIQGLMTVLRFVDAIRGKV"
FT   CDS_pept        298760..299461
FT                   /transl_table=11
FT                   /locus_tag="Bpet0271"
FT                   /product="putative transferase protein"
FT                   /function="Demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40602"
FT                   /db_xref="GOA:A9HXV7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXV7"
FT                   /protein_id="CAP40602.1"
FT                   /translation="MTTPQDASAFQALAGVTTATLTTILLKKGLRNVWIRGAFPLAPGL
FT                   PRKVGRAFTVRFIPAREDLATPESWSSPKSTRAAIEHMPEGCIAVVDANGVKDAGFWGD
FT                   ILCARMAKRGVAGLVSDGAVRDLAGVLSTGLPIWASGAAAPPSVAGLTFVDWQQPIGCG
FT                   GVAVFPDDVIVADQDGAVVIPAALLGEVVALAVEQERLEGWIMDEVRGGAALPGLYPPN
FT                   AENKARYEASK"
FT   CDS_pept        299580..300932
FT                   /transl_table=11
FT                   /locus_tag="Bpet0272"
FT                   /product="probable sodium/alanine symporter"
FT                   /function="Na+/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40604"
FT                   /db_xref="GOA:A9HXV9"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXV9"
FT                   /protein_id="CAP40604.1"
FT                   /translation="MQFLDTLVNSLNGLVWGPPMLVLILGTGLFLMLRLGFMPLTKIAA
FT                   GFRLAWRSRTRKDDDSGEISPFQALMTSLAATVGTGNIAGVATAIFLGGPGALFWMWVT
FT                   ALVGMATKYSEVLLAVHYREKDPRGEFTGGPMYAIRNGLGPKWAWLGVLFALFGGLAGF
FT                   GIGNMVQVNSMSDALQASFGVPDWVTGVVTMVLIGLVVLGGIRRIGAVAEALVPFMCIA
FT                   YIVASVAALVLMADAIPAAFQLIFTHAFSPVAATGGFAGAAVMAAMRYGVARGIFSNEA
FT                   GLGTAGIVQAAGASKSAVRSGMIGMIGTFIDTIIICTMTGLVIVCSGLWTSGDSGAVLS
FT                   SSAYEAALPGIGNYVIAIALAIFAFTTILGWSYLSERCWEFLVGVRAILPFRIVWVIAV
FT                   PFGAIAQLDFAWLLADTLNGLMAVPNLIALVMLSPVVVKLTREHFARHPSE"
FT   CDS_pept        complement(300945..301928)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0273"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40605"
FT                   /db_xref="GOA:A9HXW0"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXW0"
FT                   /protein_id="CAP40605.1"
FT                   /translation="MKWQDLPDIAWGAFSALFVVRASVEGTIGEATGRILGALIGIALG
FT                   VSLVLLTNFAQLAPGWGIACGVGLAGYVSIRWPMLSYSLVTVTILTVTPGNDIVAGAMH
FT                   KTIAIAIGSASGIVAAAAVLPLSAHRNVCVNLAASVDAYGDLLAQWATAFGRGGRRPRL
FT                   YSKATMEQARRRARDMSSQAHTFPLDLLYRHTLVYQLHDRVERLWRTAALMERAGSLPL
FT                   SEPVREQLAPALEKVAAAAGSQIDVLAQALRQDGRATMPGRQRAPLRRLDEVIDATAQR
FT                   QTLDAADREAIEVIRWAWWEVCGELNSLADHLNSLHARARRPGKNQ"
FT   CDS_pept        302094..303254
FT                   /transl_table=11
FT                   /locus_tag="Bpet0274"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40606"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXW1"
FT                   /protein_id="CAP40606.1"
FT                   /translation="MSASRSKRCAWRGRISRMPRAALASVPMRYARWAGALLLAVLAGC
FT                   ATQVPEEPTRGASVIRADLQRLLPAQVSDREGWARDIAVAFTAQGLDSSRTNLCAVIAV
FT                   TEQESSFRADPAVPGLPDIARREIQRRTQAMHVPTFLVNAALNLKSPTGKTYNQRLDAV
FT                   RTERQLSEIFEDFIGMVPMGRQLFGGLNPVRTGGPMQVSIAFAQAHAQDYPYEVDGSIR
FT                   HEVFTRRGGMYFGIAHLLGYPARYDSVLYRFADFNAGWYASRNAAFQAAVSRLSGIELA
FT                   LDGDLLIRGSIDPSRTERAVRAIRRRLDINEARIRPDLEKGDTLEFESTRLYRRVFELA
FT                   DRDAGQRVPRAVLPGIKLSSPKITRNLTTAWFANRVHGRWKQCMAR"
FT   CDS_pept        303461..304186
FT                   /transl_table=11
FT                   /gene="otsB"
FT                   /locus_tag="Bpet0275"
FT                   /function="Trehalose-6-phosphatase"
FT                   /EC_number="3.1.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40607"
FT                   /db_xref="GOA:A9HXW2"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXW2"
FT                   /protein_id="CAP40607.1"
FT                   /translation="MPHPGRIALFLDLDGTLAAIQPDPDLVMVPPATIDVLRRVEQALD
FT                   GALAILSGRPGIDLDRLLHPLLLPHAAGHGAERRDRHGVVVQAPVAPGLGAARAQLRQR
FT                   VAGWQGVWIEPKGHGLAVHYRAAPGMAARVESAVRETAARHAPAFDVQPGKMVFELRPH
FT                   GIDKGSALRAFMREAPYAGRVPVMVGDDLTDEAGFIAARQAGGYGIKIGAGPSSAMWRL
FT                   PGPEALADWLRRLGSAPTP"
FT   CDS_pept        304210..305586
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="Bpet0276"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase"
FT                   /function="Trehalose-6-phosphate synthase"
FT                   /EC_number="2.4.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40608"
FT                   /db_xref="GOA:A9HXW3"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXW3"
FT                   /protein_id="CAP40608.1"
FT                   /translation="MGRLIVISNRVALPSGARAPGGLAVGLYDALRDSGGMWLGWNGEI
FT                   AGPDADGALSTVTRDNITYATFPLAQHDYDCYYRGFSNAVLWPVFHYRPDLARYRRADH
FT                   EGYLRVNREFAQRLAPMLRPDDVVWVHDYHLLALGRYCRDLGVRNRIGFFLHIPFPAAE
FT                   VFRTIPPHQALAQAMCAYDVVGFQTDTDAEAFSDYCEKHLRTGREAGGLRMPERRLRVG
FT                   TYPIGIDVDDVAAMAGKKGSSQEVALKLGLADRKLIISIDRLDYSKGLLERFAAFEQLL
FT                   EIEPDHGSHVSFVQLAQSSRSDVQGYREIRRELDRAAGRINGKWGELGWAPLRYINRSY
FT                   ARATLMPLMRASQVGLVTPLRDGMNLVAKEYVAAQPPDDPGVLVLSQFAGAAREMRDAA
FT                   LIVNPYDTEGMALALDQALRMPLAERVERHRSLLQGLRTHDLAAWKNRFLADLRAPAKR
FT                   "
FT   CDS_pept        305682..306899
FT                   /transl_table=11
FT                   /locus_tag="Bpet0277"
FT                   /product="ABC transporter, substrate binding protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40609"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXW4"
FT                   /protein_id="CAP40609.1"
FT                   /translation="MKNSASRRAAAWLACLALGAAGMARANDADGVKIGVLTDMAGVTA
FT                   DATGKGSVEAARMAIEEMGGKVLGKPVALVVGDHQHKPDIGSSMARQWYDADGVDVIVD
FT                   VPNSSVALAVQAVAREKKKLVMFSSPGTTALTQAQCSPYGVQWTYTTYALSRGTANAVV
FT                   QEGNKTWFILASDYAFGKQLAADTSAVVAANGGKVVDTVYHPLNASDFASFLLQAQASK
FT                   AQIVAVANAGGDTIMAIKQAAEFGIGQGGQKLAAMLLLLTDVHSLGLQAAQSTYLTVPS
FT                   YWDMNDGTRAFSKQFQARVGHPPTFLQAGVYGAVRHYLKSVRAAGTTDSEAVMAKMKSL
FT                   PIDDAFSLNAHIRADGLVVRDMLLAQVKAPGQSSQPWDYYRVVRTIAGQALAWPLPESQ
FT                   CPLVKP"
FT   CDS_pept        306896..307900
FT                   /transl_table=11
FT                   /locus_tag="Bpet0278"
FT                   /product="Hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40610"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXW5"
FT                   /protein_id="CAP40610.1"
FT                   /translation="MTRPLELADFGSFFAGGRPVRITGEPVRDVAFTRTASLQYDPNGH
FT                   YHFEQAYVQYFVPARRRQPLPLVLLHGGGMTGAMWETTPDGRPGWLQHLLGLGHAVYVV
FT                   DNVERGRAGWAPFGSVWPDAPIIRNAEESWSLFRFGAPAAYAQRRGFDGLRFPLAAFDT
FT                   FIQHAVPRWLGNNDAALRALCAVIDRVGPCVVVAHSHGGEVAFRALHERPAQVRGVVAI
FT                   EPSGFAEPVRAPAVAGKPFLFVYGDYLDATPLWQRLAAAGRQYADALAAQGGHVEMWRL
FT                   ADMGIRGNSHMLMMDDNSDEIARRVSGWLCEAAARGGFNPAPPGTSGRAPGDG"
FT   CDS_pept        complement(307851..309065)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0279"
FT                   /product="L-lactate dehydrogenase"
FT                   /function="L-lactate dehydrogenase (FMN-dependent) and
FT                   related alpha-hydroxy acid dehydrogenases"
FT                   /EC_number="1.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40611"
FT                   /db_xref="GOA:A9HXW7"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXW7"
FT                   /protein_id="CAP40611.1"
FT                   /translation="MTLPAEPSPPSASPRSAYAPPRPLRRFLSLHDFEAAARRRLPRPI
FT                   FEYVAGSVEDRQAERDNRQAFSRYGFRTRVLVDVSSRRQDVELFGQRYASPVGIAPMGI
FT                   AALTAYRGDIVLARAAQAANVPCIMSGSSLIRLEEVMDAAPGTWFQAYLPGDDSHIGAL
FT                   IDRVAAAGVQTLVLTVDTPVQANRENNVRAGFSTPLKPGLGLAYQGLSHPRWLLGTFLR
FT                   TLVRHGMPHFENNYATRGAPILSKRVLRDFSDRGYLNWTHAAQIRRRWQGPMVIKGILG
FT                   TDDARRAREQGMDGIIVSNHGGRQLDGAVSPLRVLPEILEQAGGMTVMLDSGVRRGTDA
FT                   MKALALGAHAVFVGRPFNYAASVAGEDGVRHALQLMRDEIARNMGMLGITRLQELDRSF
FT                   LVALD"
FT   CDS_pept        309187..310086
FT                   /transl_table=11
FT                   /locus_tag="Bpet0280"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40612"
FT                   /db_xref="GOA:A9HXW8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXW8"
FT                   /protein_id="CAP40612.1"
FT                   /translation="MTLKQLEAFYWAATCKNFSVAAGRLNISVSSLSKRIGELEAAIGA
FT                   DLFNRDNRSAVLTPLGDRLLAHARDVLRSAEHFMRRASDARALSGRCRFGVGELTSLTW
FT                   MPRLISLIQRTHPNLSVEPHANLGQVLEPRLEDGELDFAIIAGPSTRTAIASHSIGQVQ
FT                   FVWVAAPGLYRGAQPLRAQDVAGQTLVTLPNSAGTVRILDEWLVEHQVTAGRRMTCENL
FT                   GAVAGMLKEGLGIGFLPRAWAAELVRRGHLAELGRLPPLRPLAYTYQWRRDDTRPMVQQ
FT                   LRELAAQAADFEMLPCLM"
FT   CDS_pept        310390..311829
FT                   /transl_table=11
FT                   /locus_tag="Bpet0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40613"
FT                   /db_xref="GOA:A9HXW9"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXW9"
FT                   /protein_id="CAP40613.1"
FT                   /translation="MRVFSAGLGTETNTFAPMPTSLASFRDRDYYPAGTHPDSVTFAGA
FT                   PLYVARLRGKPLGWELHEGMVSSAQPGGITTRAAYETLRDELLADLRRALPVDIVLLGL
FT                   HGAMVADGYDDCEGDILARVREMVGPGVVVGAELDPHAHLTPLMVEQADVLVLFKEYPH
FT                   TDIRERAEELVTLCVAAHEGRIAPKAALVDCEMIVPMHTSRDPARGFVRRIQEMEGRDG
FT                   ILSISVAQGFATGDVPEMGTKVLVYSDGDARAAARLARQLADELIGLREQLMVPYRTID
FT                   EALDEALAFEGGPVVLADRPDNPGSGAPGDSTFVLRRLLERGIDNVALGPLWDPVAVRI
FT                   AFDAQPGATLPMRLGGKIGPLSGDPVDTTCTVKALKRDLVMTGLSGAPAPMGDCALVET
FT                   QGIEIVLTSIRNQAINVDLFAQLDCDLPAKKIVVVKSAQHFYASFSTVARHVIYVGGRG
FT                   VATPDWKTLPYKKIRLPKWPL"
FT   CDS_pept        311898..313481
FT                   /transl_table=11
FT                   /locus_tag="Bpet0282"
FT                   /product="probable ABC transporter, periplasmic binding
FT                   protein"
FT                   /function="ABC-type dipeptide transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40614"
FT                   /db_xref="GOA:A9HXX0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXX0"
FT                   /protein_id="CAP40614.1"
FT                   /translation="MKKNRLLTAFAATALAAACVIAPAAAQAEGKTLRIVPHADLKVLD
FT                   PTFTTAYITRNFGYMVYDTLFAMDAKGEPQPQMVDSYKASEDKKTWTFVLRDGLKFSDG
FT                   QPVKAADCVASLQRWTARDNIGRALTAAGGKWQAVDDKTFTLTLERPFGLVLDGLAKVS
FT                   SYPAFILPERLAKMPADRPLTEVVGSGPYLFKRDEWLPGSKVVFVRNPDYVARSEAPSG
FT                   LAGSKRSHVDRVEWVVLPDSNSAVAALKNKEVDMIEQTPPDYIEPLRAEAGIKVGVIEQ
FT                   NQAYMVLNQALPPFNNIKARQAVAHMIDQAKFVAAMGYPPDLRRDYCATFFICGSTNDT
FT                   DAGSKPYAKPDLAAAKQALGESGYKGEKIVVMLPTTPTYLNSATLVAVQALQELGMNLD
FT                   IQSMDWASMTARRSKKSPLDQGGWNVFLSSASEFNVNSPLNNTYLAATCGNTLPGWPCD
FT                   KELDELRVQWIAAVDPAERKQLLDRFQERAYQAFPNIPVGQFSRTYSADKSLKNLDLAW
FT                   SVPNVWVLDK"
FT   CDS_pept        313516..314451
FT                   /transl_table=11
FT                   /locus_tag="Bpet0283"
FT                   /product="putative ABC transporter permease protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40615"
FT                   /db_xref="GOA:A9HXX1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXX1"
FT                   /protein_id="CAP40615.1"
FT                   /translation="MGYLIRRVLSVVPVMLVVAVIAFLLIHLSPGDPAALIAGDFATAE
FT                   DIARLHTALGLDEPLWRQFALWAGRLLQGDLGTSIFTHVPVTQLLAQRVEPTLSIAALT
FT                   MTLSILVAIPLGVLAAYRAGSWVDRLVMVFAVLAFSVPVFLVGYLLIYGFAVKLQWLPV
FT                   QGYTSLSHGVWPWLRNLILPCVNLALVYIALITRMTRATVLEVLHEDYIRTARAKGLAV
FT                   LPVLEHALRNAAIPIATTVGVGIALLIGGVVVTETVFAIPGLGRLVIDAVEHHDYPVIQ
FT                   SVLLISAGTYVLINLLIDLSYRLFDPRIRY"
FT   CDS_pept        314473..315369
FT                   /transl_table=11
FT                   /locus_tag="Bpet0284"
FT                   /product="probable ABC transporter permease"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40616"
FT                   /db_xref="GOA:A9HXX2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXX2"
FT                   /protein_id="CAP40616.1"
FT                   /translation="MSDSTISSVNSPVVVHQALSAGALRWRWIRKHPTLLLGLLLLLLV
FT                   AAISLAAPWIATHDPLAINPLQRLKPPSAEHYFGTDALGRDIYSRAVWGGRVSLVVAIC
FT                   VAALASVLGVVLGLLAGFVRWADAVIMRIMDGMMAIPDILLAIALMAVIRASLTTVIIA
FT                   ITVPQIPRVVRLVRSLALTLREQLFVEAAHAIGTRLPVILWRHVLPNTITPLIVQATFI
FT                   AATAVLTEAVLSFLGVGVPAQVPSWGNMMAEGRNFVAVAFHTILYPGILLAVTVLAINL
FT                   MGDGLRDALDPRLANRL"
FT   CDS_pept        315379..316410
FT                   /transl_table=11
FT                   /locus_tag="Bpet0285"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40617"
FT                   /db_xref="GOA:A9HXX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXX3"
FT                   /protein_id="CAP40617.1"
FT                   /translation="MAVSSAPPAAAGTPLLEVDNLSTYFDTVSGTVRSVDGVSYRVEAG
FT                   RTLGVVGESGCGKSVTALSILRLVPTPPGRYAGGQVRYRGTNLLALTEKQMRQIRGNRI
FT                   SMIFQEPMTSLNPVLTVGRQIAETVMVHQGASRRDAYRRAEEMLRLVQIAEPERRVHEY
FT                   PHQLSGGMRQRVMIALALACNPEVLIADEPTTALDVTIQAQIIDLLRSLQQKLGMGIVM
FT                   ITHDLGVVAECCDRVVVMYAGRKVEEAPVAELFDRPLHPYTRALMASMPSMNTSAERLA
FT                   EIPGMVPAPSELGQGCSFAPRCAYATERCRRETPGLDAHGADHVVACFEAGRIAVELQG
FT                   AAV"
FT   CDS_pept        316473..317435
FT                   /transl_table=11
FT                   /locus_tag="Bpet0286"
FT                   /product="oligopeptide ABC transporter ATP-binding protein"
FT                   /function="ABC-type oligopeptide transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40618"
FT                   /db_xref="GOA:A9HXX4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXX4"
FT                   /protein_id="CAP40618.1"
FT                   /translation="MRDLKMHFAGRRGLLRRPERVIQAVDGVSFSVARGETLALVGESG
FT                   CGKTTTGKSVLRLIQPTSGSVKLDGEEILSLPPEQLRQRRRDMQIIFQDPYASLSPRMS
FT                   AGQIVAEPMRNFPDLQRARSRRDELAWLFSKVGLRPEAMDKFPHEFSGGQRQRLGIARA
FT                   LALRPKLIVCDEPVSALDVSVQAQVINLLMDLQRELGIAYLFVAHDLAVVRHISHRVAV
FT                   MYLGRIVEVADRDTLFSRPLHPYTEILLSAVPVPDPHRPAQRRLLPGDPPSPANPPSGC
FT                   RFHTRCPLAQPVCREQQPALTPRPAGAPQPVQWVACHFR"
FT   CDS_pept        317459..318370
FT                   /transl_table=11
FT                   /locus_tag="Bpet0287"
FT                   /product="probable ornithine cyclodeaminase"
FT                   /function="Predicted ornithine cyclodeaminase mu-
FT                   crystallin homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40619"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXX5"
FT                   /protein_id="CAP40619.1"
FT                   /translation="MLFISDDQVAQSITMRDAVAAMRALFEDLGRHAGVIQERVRVHDA
FT                   GVSLSMMGGIHTSAGVMGAKVYPTVKGQFNFIIPLFSCDDGRLLCTVAGNALTRLRTAA
FT                   VTRVAADCLRPGPGRRVAVYGSGVQAEAHVEAFALDGYATEFRLCSRGDATALAEQWQQ
FT                   RYGVPVTCADAADAAAWADVIITATRAAEPLFDGKLPRPGTLVAAIGSSKPVTREVDDE
FT                   VLRRASMIVVEAAGQAAREGGELVMAGPDTGARDKLVELGALLPRADTARAAGDLLVYK
FT                   SVGIGLEDVALANHIYQRVAAA"
FT   CDS_pept        318442..320235
FT                   /transl_table=11
FT                   /locus_tag="Bpet0288"
FT                   /product="amidase family protein"
FT                   /function="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40620"
FT                   /db_xref="GOA:A9HXX6"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXX6"
FT                   /protein_id="CAP40620.1"
FT                   /translation="MVESDIATLQALMTQGVLSSQALVRAYLRRVAAYDQQGPALNAIA
FT                   ALHPDALRQARELDAERAAGRLRGPLHGIPVLVKDNFHVAGLPTSAGTLALADWGPGPE
FT                   AGVVRRLRAAGAVILGKTTLHELACGIINISSLTGQTRNPYAPGRAPGGSSGGTAAAVA
FT                   GSFAAAGLGSDTSGSIRVPAAANNLVGLRPTRGLASRAGIVPLSETQDTPGPLARSVPD
FT                   LALLLDAIVGVDADDPATARAARSLPRSFHDALRPDGLAGLRIGVLDALFGTLPGEEDV
FT                   SRVAYEALAAMERLGASLAGVDIPMLAALLPGSSLTPYEFRHAFANHLAAQGGAPVSGL
FT                   ADILRQGLHHEQLDAVLRQREALRDDDGSGRAAVLRVRNRLRRAVLACMKRHGVDVLAY
FT                   PALRCRPASIGDVQAGANSQLAAATGMPALSLPAGFTRDGLPVGLELLARDHAEQQLLD
FT                   CARHWELAMQPRRAPFTTPALRRGRAPAAHRGTLRLQAAGQGSARVRYEIDLPGAVLRF
FT                   DAAADVQADDAVIALALHAPPSGQAVRGPIVAHLLRGQGRARGTLPLRADLVQALQGPG
FT                   LELRLYTRRFPLGAAQGALTL"
FT   CDS_pept        complement(320258..321181)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0289"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted phosphoribosyltransferases"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40621"
FT                   /db_xref="GOA:A9HXX7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXX7"
FT                   /protein_id="CAP40621.1"
FT                   /translation="MSAPRAAFPYDYARVEQVVAEYVPRWRGMRFDAVVAIARGGLPAA
FT                   LIACTALDLPLHALSYHRPTRRVSWFTAQIPPAGARVLLVEDIAGRGTTLSDSIDFLAV
FT                   SGYEFKVFTLAYDTESRVRPDFGVEIPPGLRAWFPWERESITPAYDATRNLPRLPADAY
FT                   SSWAIDLDGILLPDLSPDLYVTDLAGTLAQRDMLLPCELLPARDLSRLTIITGRPEQDR
FT                   ARTQAWLHRHGFHGKLIMRDETRHQAAQTAEHKAQAIVAGCHTHFIESDMAQALEIARR
FT                   VPVVRVYWWNGRTALSVYASHAAELG"
FT   CDS_pept        complement(321422..322576)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0290"
FT                   /product="putative ABC-2 type transport system permease
FT                   protein"
FT                   /function="ABC-type transport system involved in multi-
FT                   copper enzyme maturation permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40622"
FT                   /db_xref="GOA:A9HXX8"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXX8"
FT                   /protein_id="CAP40622.1"
FT                   /translation="MMSMWWRRATIACWPKTTCAPMPRARSCRRAATCIACRSTCPAWT
FT                   PSTTATSTTPKPAPRRTTMQKRKGSPWKGLGAVTLKEFADHLSSARMRVLEWLIVLTAA
FT                   AALYGALQQIRSTTAEDPFVFLRVFTTARAPMPSFASLLGFLIPLMAIGLGFDAINGEY
FT                   SRRTMSRLLSQPIYRDALLLGKFLAGLATLAISLLCLWLIVIGVGLLALGVPPSGQEVA
FT                   RSLLFLLMALAYAGVWLALSMLFSVLFRSAATSALVSLGLWLFLALLWPLLSSALAQAI
FT                   APPDLASQLLGQPSLPTLEWQHALQRLSPAQLFNESIIAVLSPMTRAIGPIFLDQLEGA
FT                   VMGAPLALGQSIQIVWAQAVGLIAGVILLFALTYVVFQRQEVRA"
FT   CDS_pept        complement(323333..324493)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0291"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted membrane protein"
FT                   /EC_number="3.2.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40623"
FT                   /db_xref="GOA:A9HXX9"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXX9"
FT                   /protein_id="CAP40623.1"
FT                   /translation="MRKALSFLALAAAMLLSTPVLAQGGNIKGLYLVTDYPAVTAQPGT
FT                   TSTVRLQLRNYGLPPERLGLAIDGVPDGWTATLLGGGQPVAAAMPSTDDSVSLQLQLKV
FT                   PADAGTQPRTLTVVASGDGQRIELPVHIMLAKELPTKLTLDTKLPAIKGGAQSSFDYSL
FT                   TVKNDSGKDLTVSFAAKAPQYFDTRFTEGYGSQQISALPIKAGESKDIKLTVRPPSSTE
FT                   PGSYPVQVVASADGIEASSQLKLDIVGQPRLQLAGRDGLMSGDAQAGKASTIPVVIRND
FT                   GGAAADNVALSGSGPSGWKVEFEPKTIEHLAPGQQVEAQASITPSERSLAGDYMTHLSA
FT                   SANGQSASGDFRITVSTSSLWGIVGVIILAIAALILVGAVARFGRR"
FT   CDS_pept        complement(324774..325499)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0292"
FT                   /product="transcriptional regulator, GntR-family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40624"
FT                   /db_xref="GOA:A9HXY1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXY1"
FT                   /protein_id="CAP40624.1"
FT                   /translation="MRLALAPLPGRIVQTGPAVTLAGQAYELIKRDLFEFRLLPGDDFT
FT                   EGELVARFGVSRTPVRQALYRLEREGFVLLRQRSGWRVRPFDFERFEALYDVRIVLEQA
FT                   SVTRLCGLPDMNASGDLPALKRIWLVPPAERLRSGKQVAELDEAFHCGLVAAAGNPEMA
FT                   QIHRDITEKIRIIRQLDFTKDYRVDATYMEHAAILRAVLARRADEATRMLKSHIEISKA
FT                   EVRQITLHRLQLARAEGLR"
FT   CDS_pept        complement(325501..329130)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0293"
FT                   /product="urea amidolyase subunit 2"
FT                   /function="Biotin carboxylase"
FT                   /EC_number="6.3.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40625"
FT                   /db_xref="GOA:A9HXY2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXY2"
FT                   /protein_id="CAP40625.1"
FT                   /translation="MFHTVLIANRGEIAVRAIRSLKRLGIKSVAVYSDADRNAAHVRQA
FT                   DAAVALGGNTAAESYLRIDSILAAAQATGAQAIFPGYGFLSESAEFAEACAAAGIAFIG
FT                   PTPLQLREFGLKHRARELAAAAGVPMTPGTGLLRDADDALAQADRIGYPVMLKSTAGGG
FT                   GIGLARCADADALKAAYAAVQHQGETFFRDSGAFLERYVDQARHVEVQIFGDGNGQVVA
FT                   LGERDCSVQRRNQKVIEETPAPGLPPATRAALLRAAVMLGESVAYRSAGTVEFIYDGAR
FT                   DEFYFLEVNTRLQVEHPVTEAVTGLDLIECMLRVAAGDPLDWASLRRAPEGAAIEVRLY
FT                   AEDPARDFQPSPGVLTCVQFPAEARVDGWMDTGTEVPPFYDPMLAKLIVHGADRGDALR
FT                   KLGDALARTQLHGIATNLDFLRQVVADPRFQAAALSTRFLDGFEYQPTALEVLEAGTYT
FT                   SVQDYPGRVGYWNIGVPPSGPMDDYAFRLANRIVGNAPQAAGLECTLIGPTLKFHSDAI
FT                   IALTGARMDALLDGQPIAMWQPVAVRRGQVLATGRAATGCRSYLAVRNGLDVPSYLGSR
FT                   ATFALGQFGGHAGRCLRAGDMLPLAQPGLPASLTPPPEAPPAAVDAALVPEYSNDWQIG
FT                   VLVGPHGAPDFFTTESMAQFFSTDWEVHYNSNRLGVRLLGPKPAWARQDGGEAGLHPSN
FT                   IHDCEYAIGSINFTGDSPVILTRDGPSLGGFVCPATIAKAELWKVGQVRPGDRIRFVPL
FT                   SVADAADLQARQDAAVATLRAPSSGALPAAAPQALSPIVASLPATAARPLVTYRQAGDS
FT                   YLLLEYGDNVLDLALRMRVHLLMQALSAAPVAGVLEFSPGVRSLQVQYDSRVISQDALV
FT                   ARLLQIEETLPDVASLKIPTRVVYLPMAFEDSATLGAVQRYQETVRAHAPWLPNNVDFI
FT                   QRINGLATRDDVRRIVFDASYLVLGLGDVYLGAPCAVPIDPRHRLLTSKYNPARTFTAE
FT                   GTVGIGGVYMCIYGMDSPGGYQLVGRTLPIWNKFLKNPVFQNGEPWLLRFFDQVRFYPV
FT                   SEAELAVLREDFREGRATLRIEHEDFDFAEHRRFLAEHAADIEAFKANQQAAFEAEVAL
FT                   WQAEESAAIEPPPQEEAALQLSATERAVCADLCGNVWKIPVSVGQRVQAGDTLVIVEAM
FT                   KMELSIKAAFPGTVTAIRCAQGKAVNSGDALVVIDAEADCPVA"
FT   CDS_pept        complement(329130..330992)
FT                   /transl_table=11
FT                   /gene="uahA"
FT                   /locus_tag="Bpet0294"
FT                   /product="Urea amidolyase subunit 1"
FT                   /function="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /EC_number="6.3.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40626"
FT                   /db_xref="GOA:A9HXY3"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXY3"
FT                   /protein_id="CAP40626.1"
FT                   /translation="MKANDVISQPQGWTLAEWQAAYRRGAQPADLLGRLIDSLDPGDPA
FT                   WICRADAPRLQTQLSDLARLLDSAGGDVARLPLYGVPFAIKDNIDAAGWPTTAACPAFS
FT                   YLAQQDADVVRRLRAAGAILIGKTNLDQFATGLVGTRSPHGAVPNTFDPAYISGGSSSG
FT                   SASVVARGLAAFALGTDTAGSGRVPAGFNNIVGLKPTKGWLSTRGVVPACRTLDCVSIF
FT                   ALTVNDADAVAMAAGGLDPQDPYSRAAPAMPGGLPRQPKLAIPAQPEFFGDAQAQAAYD
FT                   ASLQVLRNMGATLQAVDFSVFRELADLLYQGPWVAERYAAVRSLYERAPGEIDPVVRGI
FT                   IEQAAQYNAVDAFEAEYQRAELARRIQQCLAGFDAMVVPTAPSIYTIAQLRADPVALNT
FT                   RLGTYTNFANLADLSALALPGGLRADGLPSGITLIGPAWHDRALAEFGRRWEAAQGGTL
FT                   GATGRDRRAAIAEAANTVPAASAGTPVQVAVVGAHLQGMPLNHQLTSRGARFLEATQSA
FT                   AAYRLYALAGSTPPKPGLVHTGDGAAIALEVWELAPAAFGEFVAEIPAPLGIGTLELID
FT                   GRTVKGFICEPRGIAGARDITEFGGWRAYLRHLQDAAAHQGEKS"
FT   CDS_pept        331448..332698
FT                   /transl_table=11
FT                   /locus_tag="Bpet0295"
FT                   /product="putative substrate-binding periplasmic transport
FT                   protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40627"
FT                   /db_xref="GOA:A9HXY4"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXY4"
FT                   /protein_id="CAP40627.1"
FT                   /translation="MKRRLVLKQLTAASLMALAGWAPGVMAADTIKVGILHSLSGTMAI
FT                   SETSLKDVALMTIEEINAQGGVMGKKLEPVVVDPASNWPLFAEKARQLITQDKVAVVFG
FT                   CWTSVSRKSVLPVFKELNGLLFYPVQYEGEELEKNVFYTGAAPNQQAIPAVEYLMSEDG
FT                   GGARRFVLLGTDYVYPRTTNKILRAFLHSKGVKDDDIQEVYTPFGHSDYQTIVANIKRF
FT                   AAGGRTAVVSTINGDSNVPFYKELGNAGLKATDVPVVAFSVGEEELRGVDTKPLVGHLA
FT                   AWNYFQSIKNPVNTAFIEKWKAYAKAHNLPNAATAVTNDPMEATYIGIHMWKQAVEKAG
FT                   TTDVDAVIGAVGGQTLQAPDGFTVEMDKTNHHLHKPVYIGEIKADGQFNVVWKSKGPIR
FT                   AQPWSPYIPGNEGKQGL"
FT   CDS_pept        332720..334345
FT                   /transl_table=11
FT                   /locus_tag="Bpet0296"
FT                   /product="Branched-chain amino acid transport system,
FT                   permease component"
FT                   /function="Branched-chain amino acid ABC-type transport
FT                   system permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40628"
FT                   /db_xref="GOA:A9HXY5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXY5"
FT                   /protein_id="CAP40628.1"
FT                   /translation="MRSAFLARLLLRLALAWLAGAWMPAATAAGLDPALLAPLADDDTG
FT                   VRLEAIARLGLEPTPQAAAVLEALGSDRLYAAPDGRLLIDTGAGAVDAATGQPAALPPE
FT                   AGTVSVNNRLRRAIAAALAASRLHAPDAAQRLAAAKRLQRGTDATALPMLEKALSEERD
FT                   GEVRAALEIAVATLQLQSDDPGVRRQAAKTLGHSGNAAFRPVLEAMLQQDAQGRYAEPD
FT                   AQVRAAAGAALHSIERHLATVAWVGNLFYGVSLGSVLLLAALGLAITFGLMGVINMAHG
FT                   ELLMIGAYVTYAVQALFRLWFPQWLDAYVIAALPAAFVVTALVGMALERTVIRWLYGRP
FT                   LETLLATWGISLMLMQAVRTLFGAQNVEVGNPSWMSGGITVLGNLVLSYNRIAIVAFAV
FT                   LVVVFVWLLLNHTRLGLFVRAITQNRRMADCVGVPTGRIDMLAFGLGSGIAGLAGVALS
FT                   QLGNVGPDLGRAYIVDSFMVVVLGGVGQLAGTVVAALGLGAVTKFLEPYSGAVMAKITI
FT                   LALIVLFVQKRPQGLFAPRGRSAE"
FT   CDS_pept        334342..335463
FT                   /transl_table=11
FT                   /locus_tag="Bpet0297"
FT                   /product="Branched-chain amino acid transport system,
FT                   permease component"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   system permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40629"
FT                   /db_xref="GOA:A9HXY6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017778"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXY6"
FT                   /protein_id="CAP40629.1"
FT                   /translation="MNAADLNPALARRPLFSARAWAGLAIATALLAALPCLNLVFPPGH
FT                   ALHVSAYAVALLGKFMCYALAALALDLVWGYAGILSLGHGLFFALGGYAHGMYLMRAIG
FT                   RDGVYQSDVPDFMVFLNWKAYPWYWAFTDHFWYAMLLVVLVPGGLAFLFGYFAFRSRIK
FT                   GVYFSIITQALTFAAMLLFFRNDTGFGGNNGFTDFKRILGFDITAPATRAGLYWVTLAV
FT                   LFGALVLARAVTQSKLGRVLTAVRDAESRLRFIGYEPLGFKLFVWTLSAVMCGVAGALY
FT                   VPQVGIINPGEMSTENSIEMVIWVATGGRGTLIGPIIGAGAVNGLKTWFTSVFPEFWLY
FT                   ALGLIFVLVTLLLPQGIVGLVRRWMARREEHAA"
FT   CDS_pept        335460..336311
FT                   /transl_table=11
FT                   /locus_tag="Bpet0298"
FT                   /product="putative ABC transport ATP-binding subunit"
FT                   /function="Uncharacterized ABC-type transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40630"
FT                   /db_xref="GOA:A9HXY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017781"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXY7"
FT                   /protein_id="CAP40630.1"
FT                   /translation="MSTESRNRAAAALDDDGGPSGQASYGRVNPPGVDTTHGAILYLDG
FT                   ITVSFNGFKALNDLTLDIGVGELRCIIGPNGAGKTTMMDVITGKTRPTAGTAFFGQNID
FT                   LTTLNEAQIAHAGIGRKFQRPTVFEQHTVFENLELAMKTDKRVRPTLFARLTSEQADRI
FT                   AETLALIRLGDAAQRPAGLLSHGQKQWLEIGMLLMQEPQLLLLDEPVAGMTDAETERTG
FT                   ELLNELRGRHSLMVVEHDMDFVSRIADGGKVTVLHEGSVLAEGTMAQVQADPRVVEVYL
FT                   GR"
FT   CDS_pept        336313..337011
FT                   /transl_table=11
FT                   /locus_tag="Bpet0299"
FT                   /product="putative branched-chain ABC transporter,
FT                   ATP-binding protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40631"
FT                   /db_xref="GOA:A9HXY9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXY9"
FT                   /protein_id="CAP40631.1"
FT                   /translation="MLEVQAIDQYYGGSHTLRGVSVSLRQGECLGLLGRNGVGKTTLLK
FT                   CLMGVLPVAGGKVMFDGHDISRLPPHRRAALGIAYVPQGRDIFARLTVEENIVMGMARF
FT                   PGARARRIKEEVFELFPVLRSMLARRGGDLSGGQQQQLAIARALVAEPRLIILDEPTEG
FT                   IQPSIIKDIGRVIRLLRQRGDIGILLCEQYFDFARELADHFVVLSRGEVVARGSRAEMD
FT                   GEEVRRHLSV"
FT   CDS_pept        337080..337844
FT                   /transl_table=11
FT                   /locus_tag="Bpet0300"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40632"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXZ0"
FT                   /protein_id="CAP40632.1"
FT                   /translation="MFPVLVIYAHTLSVPVISTLSVSPAAPRRPRAAAAWRHAGAALCA
FT                   GLLMLLAACSSTKVGPGYYRVQSGDTLSKIAREHNTSVAELMRLNNLSNPNRISKGQML
FT                   RVSAKGRAAAASSASSPPPSAAASAAAVRGIKLVWPADGTITHRYNGNSSKGITIVNKT
FT                   GTPVRAAAAGSVVYAGNRLRGYGNLVIVQHAGDFLSIYAHNNRMLVKEGQKVSQGQQIA
FT                   EMGNTDRSGPALYFELRYRGKPVNPAGALPPR"
FT   CDS_pept        complement(337936..338466)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0301"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40633"
FT                   /db_xref="GOA:A9HXZ1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXZ1"
FT                   /protein_id="CAP40633.1"
FT                   /translation="MGQGHPRQQDHRQLSRWRAAPATPMPTRSSDTLPALERFLTYRMH
FT                   VVNKVSDRDSNRAYQETCGLPLGEARCLAAIGRYAPLSVNDLARAANLNKGQASRSAQA
FT                   LVDRGLVNKAACENDARGVLLAPTRAGQALYERVVALIARRNDEIFGCLSEQEQAQLGA
FT                   MLDRVIAHVGREG"
FT   CDS_pept        complement(338424..339392)
FT                   /transl_table=11
FT                   /gene="bug7"
FT                   /locus_tag="Bpet0302"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40634"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXZ2"
FT                   /protein_id="CAP40634.1"
FT                   /translation="MNRYLKAAATLLLAAGALQAQAADYPARAIEWVVPYPAGGGTDIV
FT                   ARTLAEKMTTSLGQPLVIANKPGAATAIGADYVARAQPDGYTMLSGDTATLAANPALYP
FT                   QLSYNPATDLKSVGLMARFAMILVVNPSVPAKTLGELEAWIKSQANGVDYATPGSGSPH
FT                   HLATELFRLRTGLNLVHVPYRGAAPAVQDVIGGQVPMMFVDSATGQQYIASGRLRAIAV
FT                   ASAKRLDSMPDTPTLMELGLKDFEAYAWQGLLVPKGTSDAIVDRLNTALRGALDSAEVR
FT                   EKFKSMGLEAIPSTPQEMTAYAASEREKWGKVIRDSKITVN"
FT   CDS_pept        complement(339505..339684)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0303"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40635"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXZ4"
FT                   /protein_id="CAP40635.1"
FT                   /translation="MTESDLDQAYTQLAQALTRVGAAQAPLFLSALCLSLISRQEDAAP
FT                   VLALIEQAEHATRA"
FT   CDS_pept        complement(339677..341296)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0304"
FT                   /product="putative 2-polyprenyl-6-methoxyphenol
FT                   hydroxylase"
FT                   /function="2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40636"
FT                   /db_xref="GOA:A9HXZ5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXZ5"
FT                   /protein_id="CAP40636.1"
FT                   /translation="MTHPAPLPGHVPVLIAGGGPVGLTLAALLAEYGIASLTVEADDGY
FT                   CTGSRAICISRRSQEILAWIGADRPLVEKGLPWSSGRSYYRNQEVLRFEMPGDPTQRYA
FT                   PMVNIQQFYIEEYAHQALQRGRATAQVAWASRVARVRPDDAGVTVHIENAAGSHRVRAD
FT                   WVVACDGGRSTVREQLGLALQGMQYEGRYVIVDIEQASSRPTERLAWFDPPSNPGSTLL
FT                   MHRQPDNVWRIDYQIRDDEDAQAAVLPENVLPRVQSHLDMIGETAPWKPLWISMYNAKC
FT                   LTLDSYRHGRVLFAGDAGHLVPIFGVRGLNSGLDDAGNLAWKLAWVLRGHASEALLDTY
FT                   SQERVHATRQNLSYGAKSTEFMAPPDYGFRLLREATLRLSLTDATVRSLINPRQSSPIS
FT                   YQGSALNAADGLPEAGPLAAPGEPAPEALLRQAGAPRHLTSCFGGAFTLLAFECDPAAL
FT                   AQLDDLARAATPLRVLHIGQGANAALHDANGQARQRYGASAGALYAIRPDGYVLGRWRQ
FT                   DDMPAVRRALTPYHPVTEIRHD"
FT   CDS_pept        complement(341516..343021)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0305"
FT                   /product="putative membrane protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40637"
FT                   /db_xref="GOA:A9HXZ6"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXZ6"
FT                   /protein_id="CAP40637.1"
FT                   /translation="MELLEHLALGFSVAFTPENLLYALLGCILGTLVGVLPGLGPVPTI
FT                   AMLLPITYVLPPVAGLIMLAGIYYGTQYGGSTTAILVNLPGETSAVVTVLDGHQMARNG
FT                   RAGAALSLAAVGSFFAGSVTTMLIAAFAPPLAEVAFKFGPAEYFSLMTLGLIGAVVLAS
FT                   GSLPKAICMILLGLLLGMVGTDVNSGVARYDFGIPELQDGIDFAIVAMGVFGFAEILSN
FT                   LEQKENRVELQDKIGSLYPNRQEIREATPAIVRGTALGSMLGILPGGGSVLSAFASYTL
FT                   EKKLSKEPERFGKGHPAGLAGPESANNAGAQASFIPLLTLGIPGNAVMALMVGAMTIHN
FT                   IQPGPQVMTSHPDLFWGLIASMWIGNLMLVVLNLPLIGLWVKLLKVPYRILFPAILVFC
FT                   TIGVYSLNYNTFDIYTTAVFGVVGYFWAKLKCEGAPLLLGLVLGPMMEENFRRALLLSR
FT                   GDFFTFVERPLSASLLAAAAVLVVLVALPSIRKKRQETFVEED"
FT   CDS_pept        complement(343043..343507)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0306"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40638"
FT                   /db_xref="GOA:A9HXZ7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXZ7"
FT                   /protein_id="CAP40638.1"
FT                   /translation="MQLRNKQDFWSGVMFTLIGLGFALGATQYNMGTSARMGPGYFPFW
FT                   LGICLAILGATVALGAMSPKATETTVEKFDFKILFIIIGSVVLFGLLLRPLGLYVSLFL
FT                   LVLLSSIASYEFSWKVAVVNAIFLVVFCWLAFIKGLGLIFPLWPSFLGMN"
FT   CDS_pept        343774..344178
FT                   /transl_table=11
FT                   /locus_tag="Bpet0307"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40639"
FT                   /db_xref="GOA:A9HXZ8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXZ8"
FT                   /protein_id="CAP40639.1"
FT                   /translation="MQPADFATLAEFRYALRRFTVFSEAEAHGQGLSPQQHQALLTIKG
FT                   SGAQALTVGELAEKLCVKHHSAVELISRLARMGMVARSVDPADGRRVRVALTPLAEAKL
FT                   QALSAVHLEQLRRIRPLLIKLLDKFGPATR"
FT   CDS_pept        complement(344360..344872)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0308"
FT                   /product="putative acyl-CoA thioester hydrolase"
FT                   /function="Acyl-CoA hydrolase"
FT                   /EC_number="3.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40640"
FT                   /db_xref="GOA:A9HY00"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY00"
FT                   /protein_id="CAP40640.1"
FT                   /translation="MQEPASHQLSMTILMTPDMANFAGNVHGGTILKYLDQVAYACASR
FT                   YAGHYVVTLSVDQVVFRQPIHVGELVTFLASVNYTGRTSMEIGIKVITEDIRRQVVRHA
FT                   NSCYFTMVAVDDNGQPTAVPQRELRTLEDRQRYEAARERRELRQAMEKHHHDIKQRVQD
FT                   PSADPVA"
FT   CDS_pept        345030..345734
FT                   /transl_table=11
FT                   /gene="aqpZ"
FT                   /locus_tag="Bpet0309"
FT                   /product="Aquaporin Z"
FT                   /function="Glycerol uptake facilitator and related
FT                   permeases (Major Intrinsic Protein Family)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40641"
FT                   /db_xref="GOA:A9HY01"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY01"
FT                   /protein_id="CAP40641.1"
FT                   /translation="MSSLSKRCTAELIGTFWLVLGGCGTAVLAAGFPELGVGFVGVALA
FT                   FGLTVLTMAYAVGHISGGHFNPAVTVGLAVGGRFPMREVVPYAVAQVIGAVIGAAVLAW
FT                   IASGKPGFDLVASGFAANGYGEHSPGNYALSAALVCEVVLTFGFLFVILGATDKRAPAG
FT                   FAPIPIGLALTLIHLISIPVTNTSVNPARSTGPALFVGGWALEQLWLFWVAPIAGAIIA
FT                   GLAYRCLGREDR"
FT   CDS_pept        345765..346691
FT                   /transl_table=11
FT                   /locus_tag="Bpet0310"
FT                   /product="putative secreted Dienelactone hydrolase"
FT                   /function="Dienelactone hydrolase and related enzymes"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40642"
FT                   /db_xref="GOA:A9HY02"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY02"
FT                   /protein_id="CAP40642.1"
FT                   /translation="MHNGFRPRAGGPSRRPAMSRDSQFDSLLPPLRLDRRAFVATALAT
FT                   GFTAATGHAAAATAITTPSAGLDAGPVQIPVAGGSMPAYRAAPQGAKALPTVLVVNEIF
FT                   GVHEYIQDVCRRLAKAGYLAVAPELFARQGDASKYTEVAKLVAEVVNKVPDDQVMADLD
FT                   ATAAWAAQHGGDPKRLMVTGFCWGGRIVWLYAAHNPHLRAGAAWYGHVRNTTSPIKPAD
FT                   PIQLVDRLAAPVLGLYGAADAGISVADVEQMREALGKGPEAARKSEIRLYKDAPHGFHA
FT                   DYRPSYRKEAAEDAWRRMLDWFERYGG"
FT   CDS_pept        complement(346704..347705)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0311"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /function="Zn-dependent hydrolases, including glyoxylases"
FT                   /EC_number="3.5.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40643"
FT                   /db_xref="GOA:A9HY03"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY03"
FT                   /protein_id="CAP40643.1"
FT                   /translation="MRFPACFPPRRTLGALVLSAATLLAGGPALAAAPIQAAQAPGFYR
FT                   MALGDFVVTALYDGYVDLDPSILSGASAQDIQTLLAAMFVPVDPGVQTAVNGYVVQNGK
FT                   QVVLVDTGAGPCLGPTAGGLAGNLRAAGFQPEQVDAVLLTHLHPDHACGLLTPEGAALF
FT                   PNADVYAARAEADFWLSTTVAAQAPADVQPMFKMSRDAAAPYQAAGKFLTYQPDDTLLP
FT                   GVQAVPTHGHTPGHTSYLFTSGKQRLLVWGDIVHSHAVQFARPEVAIEFDVDSAQAIAS
FT                   RKKVFADTARDGLWVAGAHLPFPGLGHVRADGQGYAWVPAEYAPLRQRPARP"
FT   CDS_pept        complement(347757..348800)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0312"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40645"
FT                   /db_xref="GOA:A9HY06"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY06"
FT                   /protein_id="CAP40645.1"
FT                   /translation="MAVPGRRAARKPRTKKMTRPAPLNVEAYDCSTDFHASFACVYRMP
FT                   YPLSKLPSLDLVRGFVAVGRRMSITAAAQDLHVTQSAVSRQIRALEAHLGVTLLSRGFR
FT                   SVSFTAEGAQLFRMADPWLTQLGELAGQWRAPERRTPVTVTTTIGVASLWLLPRLGEFQ
FT                   AAHPAVDVRVAADNRVLDIDRDGVDIAIRYSPREAAPDGALWLFGEAVVPVAHPSLGIA
FT                   RLDAGTLPGLVLLEFDDPTRPWLQWAEWLQVCELGNARPKGMLRFNQYDQVVHAALAGH
FT                   GVALGRRALVEPLLAQQRLVAVGDALQSAARHAYWMIRGTQPRSAEVDIVADWLAAQAR
FT                   ATARVLD"
FT   CDS_pept        348799..349059
FT                   /transl_table=11
FT                   /locus_tag="Bpet0313"
FT                   /product="conserved hypothetical protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40644"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY05"
FT                   /protein_id="CAP40644.1"
FT                   /translation="MATAPIRLYCIMGMSLALSGRTAVRLRQARGLRILCESGTVWVSQ
FT                   DRCREDHVLGAGETVRLRGNRDIVLSGLPDARVAFILEPPA"
FT   CDS_pept        349056..349676
FT                   /transl_table=11
FT                   /locus_tag="Bpet0314"
FT                   /product="putative 2-hydroxychromene-2-carboxylate
FT                   isomerase protein"
FT                   /function="2-hydroxychromene-2-carboxylate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40646"
FT                   /db_xref="GOA:A9HY07"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY07"
FT                   /protein_id="CAP40646.1"
FT                   /translation="MNAPALPCEMWFDFASPYSYLAIERVGPLARQAGVSVALRPFLLG
FT                   PIFQAQGWNDSPFRLFPGKGAYMMRDIARLADKYGLAYRRPSQFPRMSVLSARVALLGQ
FT                   DQPWGRDFCLAVFRANFVDDQDIQDEAVVGAILDRLSLDRPALLAQARQESTKEALRRQ
FT                   VDRARELGIFGAPSLMVGREMFWGNDRLEDALQWAARGPAAQA"
FT   CDS_pept        349714..350463
FT                   /transl_table=11
FT                   /locus_tag="Bpet0315"
FT                   /product="short chain dehydrogenase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40647"
FT                   /db_xref="GOA:A9HY08"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY08"
FT                   /protein_id="CAP40647.1"
FT                   /translation="MPDKVMIVTGASRGIGAAVALLAARRGYAVCVNYRQRRDAADAVV
FT                   AAIQAEGGRAVAMAGDVADEAQVVRLFQAVDRELGRVDALVNNAGVLDTQMRLEDMDAA
FT                   RVSRILATNVVGALVCCREAVRRMAPRHGGRGGAIVNVSSMAARLGSPGEYIDYAASKG
FT                   ALDTLTIGLSKEVAADGIRVNAVRPGAIYTEMHASGGEPGRVDRVAGSIPMQRGGTPQE
FT                   VANVVMWFVSDEASYTTGSFIDVSGGR"
FT   CDS_pept        complement(350518..350715)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0316"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40648"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY09"
FT                   /protein_id="CAP40648.1"
FT                   /translation="MRWIADRRFTMKPRLFLLPLLAAVLLAAGCASGDHQPGPPHPGAV
FT                   NPYSNGGFHDAGPNYPNTGR"
FT   CDS_pept        complement(350740..351528)
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="Bpet0317"
FT                   /function="Indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40649"
FT                   /db_xref="GOA:A9HY11"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HY11"
FT                   /protein_id="CAP40649.1"
FT                   /translation="MNDILAKILAVKAEEVATARQMRSEAELLREAQARQDVRGFAQAI
FT                   EDKIAQGKAGVIAEIKKASPSKGVLRENFDPAAIAATYAVHGAACLSVLTDVQFFQGSH
FT                   DNLRRARAACPLPVLRKDFVIDPYQVISARAMGADCVLLIVAALAPSQLRELETLAMEL
FT                   GMDVLVEVHDAKELDIALSLKTPLLGINNRNLRTFETSLQNTLNLLPQIPAGKRVITES
FT                   GILSPEDVKLMRSHQVHAFLVGEAFMRAEDPGVELARLMG"
FT   CDS_pept        complement(351525..352556)
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="Bpet0318"
FT                   /function="Anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40650"
FT                   /db_xref="GOA:A9HY12"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HY12"
FT                   /protein_id="CAP40650.1"
FT                   /translation="MTITPAEALTRCIEHREIFHDEMLHLMRMLMRGEMSPQIASALLM
FT                   GLRVKKETVGEITAAAQVMREFATPVVTPNPQDLLDMCGTGGDGSHTFNISTTAMFVAA
FT                   AAGVPIAKHGGRSASSSSGSADVLEALGANLTLSPEQVAECIQATGIGFMFAPAHHSAM
FT                   KNVAPVRKELGVRTIFNILGPLTNPANAANQLMGVFHPDLVGIQVRVLQRLGSRHVLIV
FT                   HGKDGMDEASLGSATLVGELKDGEIREYEIHPEDYGLSMVSNRGIKVANREESRELVIQ
FT                   ALDNVEGVARDIVALNAGLAIYAGNKTDTIGQALSLAFETISNGSARAKLEEFCAYTRK
FT                   FQK"
FT   CDS_pept        complement(352572..353138)
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="Bpet0319"
FT                   /product="anthranilate synthase component II"
FT                   /function="Anthranilate/para-aminobenzoate synthases
FT                   component II"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40651"
FT                   /db_xref="GOA:A9HY13"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY13"
FT                   /protein_id="CAP40651.1"
FT                   /translation="MLLMLDNYDSFTYNLVQYFGELGEDVRVARNDQITLDEIAALKPD
FT                   RICVSPGPCSPAEAGVSVALIQRFAGQVPILGVCLGHQAIGAAYGGDIVRAQQIMHGKT
FT                   VQITHQGTDVFAGLPSPYTAIRYNSLTIAPDTLPDCLEVTATAPDGDIMGVRHKTLPLY
FT                   GVQFHPESVLSEHGHDLLRNFLNIR"
FT   CDS_pept        complement(353190..354710)
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="Bpet0320"
FT                   /product="anthranilate synthase component I"
FT                   /function="Anthranilate/para-aminobenzoate synthases
FT                   component I"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40652"
FT                   /db_xref="GOA:A9HY14"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY14"
FT                   /protein_id="CAP40652.1"
FT                   /translation="MTEIEFNALAAQGYNRIPLVAETYADLDTPLAIYLKLAHSGPQGG
FT                   RMSCLMESVVGGERFGRYSFIGLPARVVIRASGTTTEVLRDGQVVETHQGDPLAFIEQY
FT                   QARFKVALRPGMPRFCGGLAGYFGYDTVRHIEPRLGPAVKPFPAGMDGGTPDIMLMHVD
FT                   ELVIVDNLAGRTYLMVYADPTQPEAYSRAQRRLLDLRGRLRRPVEIPYSHASMQTEEQR
FT                   DFKKEDYLAAVRRAKEYIAAGDLMQVQVGQVISKPFRDAPLSLYRALRSLNPSPYMYFW
FT                   NFGDFQVVGSSPEILVRQEQVHDNGEAKSQVTIRPLAGTRKRGSTPEQDLALAEELRAD
FT                   PKEIAEHVMLIDLARNDVGRVAEVGSVKVTDTMTIERYSHVMHLVSNVAGNLNPGMSSM
FT                   DVLRAAFPAGTLTGAPKVRAMEIIDELEPVRRGIYGGAAGYLSYGGEMDVAIAIRTGVI
FT                   KNGMLYVQAAAGIVADSNPELEWAETEAKARAVLRAAEQVQHGLDEPI"
FT   CDS_pept        complement(354921..355634)
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="Bpet0321"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted phosphatases"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40653"
FT                   /db_xref="GOA:A9HY16"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY16"
FT                   /protein_id="CAP40653.1"
FT                   /translation="MTVFHAVLLDLDGTLLDSIPDLAHAANAMRIELGMPALREEVVAT
FT                   FVGKGVDNLVRRALAGSLHDADPDPALFAQARESFYRHYHLVNGDKATVFDGVIDGLKA
FT                   MRDQGLKLAVVTNKPTEFTLPLLQRTGLAGFFQEVVCGDTCARRKPDPDQMLYACERLG
FT                   VTPGQAVAIGDSINDAQAGRAAGMQVLAVPYGYNEGQDVHGLDVDGIVANIAEAAQWIA
FT                   LWNADRQNLLQKPAK"
FT   CDS_pept        complement(355642..356373)
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="Bpet0322"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /function="Pentose-5-phosphate-3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40654"
FT                   /db_xref="GOA:A9HY17"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY17"
FT                   /protein_id="CAP40654.1"
FT                   /translation="MPAETPNIMPSVSPAATRIAPSILSADFARLGEEVRNVVAAGADW
FT                   IHFDVMDNHYVPNLTIGPMVCAAIRPHVQVPIDVHLMVEPVDELVPQFAKAGADIITFH
FT                   PDASRHVHRTLSLIRDHGCKAGLVFNPASSLDAMDHVMNLLDVVLLMSVNPGFGGQSFI
FT                   PATLHKLRDARARIDRWMQAGGQPILLEVDGGVKVDNIAQIRAAGADTFVAGSAIFGHP
FT                   DYAAVIQSLRGEIAKAGTLSA"
FT   CDS_pept        356406..356852
FT                   /transl_table=11
FT                   /locus_tag="Bpet0323"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein affecting Mg2+/Co2+
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40655"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY18"
FT                   /protein_id="CAP40655.1"
FT                   /translation="MPPGPALPAARHAAQPPSAHRERPLKPYDLTVTVVPRFVPEQSDP
FT                   AEQQYVFAYTVRITNTGEHPAQVISRHWIITDGNQRVQEVRGLGVVGQQPLLAPGETFE
FT                   YTSGCPLNTPVGTMRGTYHCVGENGIPFEVPITEFLLAMPRTLH"
FT   CDS_pept        356885..358177
FT                   /transl_table=11
FT                   /gene="mltA"
FT                   /locus_tag="Bpet0324"
FT                   /product="putative membrane-bound transglycolase"
FT                   /function="Membrane-bound lytic murein transglycosylase"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40656"
FT                   /db_xref="GOA:A9HY19"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY19"
FT                   /protein_id="CAP40656.1"
FT                   /translation="MKRFLSLLCLPPLLAACSLSEVPPESGLPGQPGAAAPAPAGPLVV
FT                   PPLSALRDTPARALGGRFQRVGWADLPGWSNDDLSQFWPLFIRNCKGLMRPTSGNLAAP
FT                   ARATPRAWQPVCAAAADPARAPGDAAAMRQFLQTYLQPWRLNGADNRPAANTVTGYYEP
FT                   LVRGSRRQGGPYQWPLYAVPDDLLTIDLGAVYPELAGKRVRGKLVGKRVVPYDTRAAIE
FT                   SSGKRPPAIVWIDDPVDNFFLQVQGSGRVLLTDGPDAGTTIRVAYADHNGQPYASIGRW
FT                   LIAQGELRADQASMQNIRAWAQRNPDRVPEMLNANPAVVFFREEAVVDPELGPKGAYGI
FT                   PLAPRRSIAVDTGFVPLGTPVYLATTWPASDRPLQRLVFAQDTGAAIRGAARADFYWGY
FT                   GEEAGAQAGRMKQRGQMWVLWPKQAGEPSAR"
FT   CDS_pept        358174..359343
FT                   /transl_table=11
FT                   /locus_tag="Bpet0325"
FT                   /product="putative monooxygenase"
FT                   /function="2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40657"
FT                   /db_xref="GOA:A9HY21"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY21"
FT                   /protein_id="CAP40657.1"
FT                   /translation="MTHQIIVCGAGIVGLASALALARRGQRVALLAPAATVPAADPDAY
FT                   HPRVYAISPASQRFLAELGVWDAMPAARIMPVQAMEIHGDADGRVDLSAWQAAQPQLAW
FT                   IVESGEIERVLMQAVRMFGIPWLPERCVGYRDGAIETSSGEWLRAELFVGADGAASPLR
FT                   TAAGMPHTSTPYQDTGLVAHFDAERAHHGTAFQWFRDDGVLALLPLPDTSAGPQVSMVW
FT                   SMRNAQAQPLQSLAPDAQAAQLEQMLAHASHGRLGRLRMRSKLHGFPLTLEQARMTAPG
FT                   IALAGDAAHRVHPLAGQGLNLGLGDVEALARVVAGREPYRAAGDARVLRRYQRARAESV
FT                   FAMRLATDGLYRLFGARAAPLAWLRNAGMQWVDASPFLKRHLIDGASRN"
FT   CDS_pept        359363..360169
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="Bpet0326"
FT                   /product="putative thiol:disulphide interchange protein
FT                   (periplasmic)"
FT                   /function="Protein-disulfide isomerase"
FT                   /EC_number="5.3.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40658"
FT                   /db_xref="GOA:A9HY22"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY22"
FT                   /protein_id="CAP40658.1"
FT                   /translation="MNSRFPALLARALCAAGLILASGAWAGQDPATKDQVYSTVPGASA
FT                   PAGKSYSTESVSDPVAQAVKERFAQRFSELSVTAVRRTPYGIFEVQLGGDLVYTDEKVT
FT                   WVMEGPLIDAMTRRDVTRERQEKLGSVAFDELPLDLAVKLVRGDGSRKIAIFEDPNCGY
FT                   CKQLHKTLQNEDNLTIYTFLFPILAPDSKTKSRDVWCAKNPAQAWEDWMLRGKTPATAE
FT                   CEAPIQQVLALGQKLMVRGTPAIFFQDGTRLNGAAPLEMIQARLGK"
FT   CDS_pept        360231..361154
FT                   /transl_table=11
FT                   /gene="serA1"
FT                   /locus_tag="Bpet0327"
FT                   /product="putative 2-hydroxyacid dehydrogenase"
FT                   /function="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40659"
FT                   /db_xref="GOA:A9HY23"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY23"
FT                   /protein_id="CAP40659.1"
FT                   /translation="MAERYADWTTLGPQVQVQSFRDYLPEGERAAALQSFDVIVAMRER
FT                   TPFPAQLVEALPRLRLLVTTGLRNLAIDLDACSRQGIVVCGAPGSSDANTATAELAWAH
FT                   ILALFKNLTVEDANMRRGLWQTGMPRPLAGKCLGVLGLGKLGTAVAQVGKAFGMQVQAW
FT                   SPNLTAERAEAAGAQFVSKHELFANADVISVHLILSERTRNVVDAAALAAMKPTAFLVN
FT                   TSRAGLVDQAALLDALRKGRIAGAGLDVFAEEPLPPTDTLRALDNVVLTPHLGYVSPEN
FT                   FTAFYRSALEAVQAWMAGKPVRVLNA"
FT   CDS_pept        complement(361394..361621)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0328"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40660"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY24"
FT                   /protein_id="CAP40660.1"
FT                   /translation="MAPRPLRVEHPHLMDRGLFDFAGLKPTGRPDANGDTAFDPIDPED
FT                   PREDAGDACASSPADGDAAMAEQKVVFARL"
FT   CDS_pept        complement(361814..362788)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0329"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40661"
FT                   /db_xref="GOA:A9HY25"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HY25"
FT                   /protein_id="CAP40661.1"
FT                   /translation="MQDLIDSPTAARTPAEEKIRHEGNKLSKRLARETTRAIADYNMIE
FT                   AGDRVMVCLSGGKDSYALLDILLSLRKRAPFSFDIVAVNLDQKQPGFPPEVLPNYLTSL
FT                   GVPFHIETQDTYSIVTRVIPEGKTMCSLCSRLRRGILYRVAGELGATKIALGHHRDDIL
FT                   ATFFLNLFYGGKAKAMPPKLVSDDGRHTVIRPLAYVPEHDLVAYAKFKQFPIIPCNLCG
FT                   SQENLKRQEVSRMIQEWDRRHPGRSWNVFNALSRIVPSHLMDRDLFDFAGLKPTGRPDA
FT                   NGDTAFDPIDPEDPREDAGDACASSPADGDAAMAEQKVVFARL"
FT   CDS_pept        complement(362797..363165)
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="Bpet0330"
FT                   /function="Dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40662"
FT                   /db_xref="GOA:A9HY27"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY27"
FT                   /protein_id="CAP40662.1"
FT                   /translation="MPTRRIILSGLALDARIGILEHERRATQPLHIDAEFDVDITRSVD
FT                   DHDIHSVLDYRRLREAIVEECTQAHVNLIETLTERVAARLLRDFDEVRALRLRISKPMA
FT                   FSDCAAVGVEIQLNRQAG"
FT   CDS_pept        363249..364175
FT                   /transl_table=11
FT                   /gene="trxB2"
FT                   /locus_tag="Bpet0331"
FT                   /function="Thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40663"
FT                   /db_xref="GOA:A9HY28"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY28"
FT                   /protein_id="CAP40663.1"
FT                   /translation="MALPYGIQQTMQQYDAVIVGGGPAGASCAIWLARLGLAPLLVEAG
FT                   PRLGGLATDNPFADDWIAVLPGVTGQQVAANIAASVQAAGVPARLGTAVRQARRVSGGF
FT                   DVELDAGGVAATVRGRALVIASGVRARGLPDYPADAAWPGVFVGPGSSIMAHNYTGLSV
FT                   AVLGGGDNAFENFVYVRNRGARSVHLYARSVRAQQQWVSRAGREGVHVGPYRVDPAART
FT                   VDGQAYDLILVFYGWEPQAAFADGLGLRRDQRGYICTDTATAEASVPDVYAIGEVAHRM
FT                   HPCVVTSLADGVVAAKAIQRRWERGAG"
FT   CDS_pept        complement(364206..365969)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0332"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted protease with the C-terminal PDZ
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40664"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY29"
FT                   /protein_id="CAP40664.1"
FT                   /translation="MDTPVIYRLEPSDPAGHRYRITLTVPHPDPAGQRLALPAWIPGSY
FT                   LIRDFSRQVETLQARAAGRPVAITKLDNHTWQAAPCAGPLQVDYTVYAWDLSVRGAHLD
FT                   ESHGFFNGTSVFLRVEGREDAPCLLDLAPPRGIAGWKVYTSLPEARGHAGAARRHGFGL
FT                   YLAPDYDALIDHPVEMGTPQVARFSAHGAEHELVFTGVAPRLDLDRIAADARRICETQI
FT                   AFFEPRSKRAPFLDSSDRYVFMTMVVGDGHGGLEHRASTALMASRKDLPVLGQQGQGEG
FT                   YRGFLGLVSHEYFHTWNVKRIKPAAFAPYNLQKPDLTRLLWVFEGFTSYYDDLMLLRSG
FT                   AIGLTDYLRLLGKTITSVARTPGRRKQSVAESSFDAWTRYYKQDENSPNALVSYYTKGA
FT                   LVALGLDLTIRRESRGARSLDDVMRLLWQRYGRDFYRGKAQGLPEDALPALVREATGVD
FT                   VRRFVARHAYGTADVPLAELLAPHGVGLQWKPTVNIPSLDVRTRKQGEALGLATVLEGG
FT                   AGHKGGLSAGDVLVAIDGLRVDAPAGLDLLLAQYRPGDRVTVHVFRRDELRAFTVRLAP
FT                   PAALDCILSVK"
FT   CDS_pept        366016..366792
FT                   /transl_table=11
FT                   /locus_tag="Bpet0333"
FT                   /product="enoyl-CoA hydratase"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40665"
FT                   /db_xref="GOA:A9HY30"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY30"
FT                   /protein_id="CAP40665.1"
FT                   /translation="MSESFVLVETRGRVGLLTLNRPKALNALNDQLMNELGAALLAFEA
FT                   DDGIGAVVITGSEKAFAAGADIGAMKDWSYMDVYGSEYITRNWETLKRIRKPVIAAVSG
FT                   YALGGGCELAMMCDIIIAADTAKFGQPEIKLGVIPGAGGTQRLPRAVGKAKAMDLALTA
FT                   RMMGAEEAERAGLVSRVVPADKLMDEAIEAATVIASMSLPSVMMAKECVNRAFESSLNE
FT                   GLLFERRVFHSLFATEDQKEGMAAFVEKRPPVFRHK"
FT   CDS_pept        366995..368557
FT                   /transl_table=11
FT                   /locus_tag="Bpet0334"
FT                   /product="putative exported protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40666"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY31"
FT                   /protein_id="CAP40666.1"
FT                   /translation="MHSRLFPPSRRWPRAVLAGALSAGFACASLAQPQPSMRLVSETPT
FT                   AASSPAMTAEELRDIAVDAYLYAYPLVLMEATRRAATQVQTPLAGKAPMNQFGHRTVYP
FT                   DPGATDIAWPSTDMLYSSLWFDVSRQPLIVRVPASGGRYYALSLLDMWTDEFASRGTRT
FT                   TGNGEQTFAIVGPHWQGTAPVGVDIVRSPTGSGWLIARIQTGGPNEYGAVNQFQAGMTA
FT                   SPMAAPPVPLVTPPRRGAAKPATWPQSPASPGYVPVGAAPMMPPPVPSVTWDTQGSPGQ
FT                   QVAGMDPATFFTVFSDLLAANPPHANDNAILTRMRRIGLAGPQPFSYSRLDPAVQQALA
FT                   EARPVAGRRIADAVARLGKPMNGWNTVLHGIGTYGTDYTRRAAIAYAGLGANTPQDALY
FT                   PVTTIDDDGEPLRSDEEYVLHIDKGQLPPVNASWSLILYNDNQGLAPNPIGRYAVRSTD
FT                   PLRYNADGSLDIYIQRGDPGPNKSANWLPAPHQGNFMLNMRLYWPKDLALDGHWAPPPV
FT                   REN"
FT   CDS_pept        368737..369165
FT                   /transl_table=11
FT                   /locus_tag="Bpet0335"
FT                   /product="putative inner membrane protein"
FT                   /function="Thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40667"
FT                   /db_xref="GOA:A9HY33"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY33"
FT                   /protein_id="CAP40667.1"
FT                   /translation="MQSLVEQNPVLTDADRAALDAQACRGLLWVLAAQGAMGLAAATIA
FT                   GIIAGAAAGLSALAGAGAYFIPNALFALRLLVNVLKSGRTSPVTFFLGEMVKLLMTALL
FT                   LWLLSRVAQNWLVWPAVLLGLIFTLKGYLLLLMFRKLS"
FT   CDS_pept        369234..370115
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="Bpet0336"
FT                   /product="ATP synthase A chain"
FT                   /function="F0F1-type ATP synthase subunit a"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40668"
FT                   /db_xref="GOA:A9HY34"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HY34"
FT                   /protein_id="CAP40668.1"
FT                   /translation="MAAASDVSPQSAYIQHHLVHLNNIGEKQSVIAQFNVINYDSVFWS
FT                   ALTGLVVVLFLWLAARRASAGVPGRFQAFVEMIVDMVDEQAKGIVTNAKSRLFVAPLAL
FT                   TVFLWIILMNALDLIPVDLMPTVWRWTGLGAHHGDPLYYHRILPTADLNVPMGMSLGVL
FT                   LLMFYYGIKIKHPGGFVKELFTAPFHAHGIAALFLAPANLLLNLIEYAAKSVSLGMRLF
FT                   GNMFAGELVFMLIALLGGAWTGLNAASVGLGIGHVLAGSVWAIFHILIVLLQAFIFMML
FT                   TLVYIGQAHEGH"
FT   CDS_pept        370228..370470
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="Bpet0337"
FT                   /product="ATP synthase c chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40669"
FT                   /db_xref="GOA:A9HY35"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY35"
FT                   /protein_id="CAP40669.1"
FT                   /translation="MTNVAFVALACGLIIGLGAIGACIGIALMGGKYLEASARQPELMN
FT                   ALQTKMFLLAGLIDAAFLIGVGIAMLFAFANPFVG"
FT   CDS_pept        370619..371089
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="Bpet0338"
FT                   /product="ATP synthase B chain"
FT                   /function="F0F1-type ATP synthase subunit b"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40670"
FT                   /db_xref="GOA:A9HY36"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HY36"
FT                   /protein_id="CAP40670.1"
FT                   /translation="MNLNATIFFQMLVFFVLGWFTMKFVWPPLTKAMDERRQKIADGLA
FT                   AAEKGKADLAQAQARVSLIEASAKSENHARIIEAEKQAASLIEQARREAEAERARIVAQ
FT                   AAQDAAQEVQRARDALRDDVAALAVKGAEQILKREVDARAHAELLNQLKAQL"
FT   CDS_pept        371102..371641
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="Bpet0339"
FT                   /product="ATP synthase delta chain"
FT                   /function="F0F1-type ATP synthase delta subunit
FT                   (mitochondrial oligomycin sensitivity protein)"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40671"
FT                   /db_xref="GOA:A9HY39"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HY39"
FT                   /protein_id="CAP40671.1"
FT                   /translation="MAELSTVARPYAEALFSAARDDKAGLPAWADLIGELAQVAGNPDV
FT                   REAMTDPRLGDAQRIELFTGLVKTQLPQAVRNFIELLVANDRLLLLPVIAKQFVALKNR
FT                   HEGTAQAEITSAFELSDAQVKELIEALETKFGLKLKPSVTVDKSLIGGVRVAVGDQVLD
FT                   TSVQAQLARLRDTLAA"
FT   CDS_pept        371681..373222
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="Bpet0340"
FT                   /product="ATP synthase alpha chain"
FT                   /function="F0F1-type ATP synthase, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40672"
FT                   /db_xref="GOA:A9HY40"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HY40"
FT                   /protein_id="CAP40672.1"
FT                   /translation="MQLNPSEISELLKSRIEGLGASADIRTQGTVVSVTDGITRIHGLS
FT                   DVMQGEMLEFPNNVFGVALNLERDSVGAVILGDYTGVSEGDQVKTTGRILEVPVGPELK
FT                   GRVVNTLGVPIDGKGPIDTKETDIIEKVAPGVIARRSVSQPLQTGIKAIDSMVPIGRGQ
FT                   RELIIGDRQTGKTAVAVDTIISQKGKGVTCVYVAIGQKASTINNVVRKLEEHGAMEYTI
FT                   VVAASASDSAAMQYLAAYAGCTMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVNEEYVEKFTNGAVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLETDLFNAGVRPAINAGISVSRVGGAAQTKVIKKLSGGIRTDLAQ
FT                   YRELAAFAQFASDLDDATRRQLERGKRVVELLKQPQYQPLQVWELAVTLYTVNNGYLDD
FT                   VDVAQVLAFEKSLKDQLKAKHAALIQRIEDTKELSKDDEAELAAAIQDFKKHGAF"
FT   CDS_pept        373322..374227
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="Bpet0341"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   gamma-subunit"
FT                   /function="F0F1-type ATP synthase gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40673"
FT                   /db_xref="GOA:A9HY41"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HY41"
FT                   /protein_id="CAP40673.1"
FT                   /translation="MPGIKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQDRMRAGRPY
FT                   ATKVREIAAHLMQANPEYSHPYLVEREIKAVGVVLVTTDKGLCGGLNTNISRVTLAKLK
FT                   EFDQRGIRVQATAFGNKGLGLLTRIGANLVSHEVQLGDKPDLDRLLGAIKVQLDAYLSG
FT                   EIDALYVAATRFVNTMKQEPVFLRLLPLASGLDDPFQTGAETLADGAEVKSNYSWDYIY
FT                   EPDAKSVIDDLLQRYVEGLLYQAVAENMASEQSARMVAMKAASDNAKKVIGDLQLVYNK
FT                   TRQAAITKEISEIVGGAAAV"
FT   CDS_pept        374271..375671
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="Bpet0342"
FT                   /product="ATP synthase beta chain"
FT                   /function="F0F1-type ATP synthase beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40674"
FT                   /db_xref="GOA:A9HY42"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HY42"
FT                   /protein_id="CAP40674.1"
FT                   /translation="MSNGTIVQCIGAVVDIQFPRDQMPKIYEALTLADDTSQFAEKGLT
FT                   LEVQQQLGDGVVRTIALGSSDGLRRGMKVVGTGAPISVPVGHGTLGRIMDVLGRPIDEA
FT                   GPIESDEKRAIHQTAPRFDELSPSVELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTV
FT                   NMMELINNIAKQHSGLSVFAGVGERTREGNDFYHEMEESKVLDKVAMVFGQMNEPPGNR
FT                   LRVALTGLTMAEKFRDEGRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEM
FT                   GVLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFQHLDSTVVLSRDIAALGIYPAV
FT                   DPLDSSSRQLDPQVVGEEHYAVARGVQQTLQRYKELRDIIAILGMDELSPDDKQAVARA
FT                   RKIQRFLSQPFHVAEVFTGSPGKYVPLAETIRGFKMIVDGECDALPEQAFYMVGTIDEA
FT                   FEKAKKLQ"
FT   CDS_pept        375681..376106
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="Bpet0343"
FT                   /product="ATP synthase epsilon chain"
FT                   /function="F0F1-type ATP synthase, epsilon subunit
FT                   (mitochondrial delta subunit)"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40675"
FT                   /db_xref="GOA:A9HY45"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HY45"
FT                   /protein_id="CAP40675.1"
FT                   /translation="MATLQVDVVSAEEAIFAGEAKFVTLPGEAGELGILPGHTPLISRI
FT                   RPGTVKIVRADGGEENIFVAGGILEVQPGMVTVLADTAIRAADLDEARAVAAREKAEEA
FT                   LRNAKDKADIAVVEAELAMLAAQAVAARKLRQTRNTH"
FT   CDS_pept        376342..377208
FT                   /transl_table=11
FT                   /locus_tag="Bpet0344"
FT                   /product="hypothetical protein"
FT                   /function="Response regulator containing CheY-like receiver
FT                   AAA-type ATPase and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40676"
FT                   /db_xref="GOA:A9HY47"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY47"
FT                   /protein_id="CAP40676.1"
FT                   /translation="MWQLRISPCCLDAYACISCVCFKEPVLRETLDCAVLMTPGHEAWV
FT                   QDWAGRQNDQQGRLRLYPQALSELAPGAPDTRLLARARLALRRFDGCLVPVAPASLSWV
FT                   RTVLANAGSEPRTPLVALVFDITAPAILDLLALGVADFIRAPACPDELRARLLRLRRTA
FT                   RSAAAPAPSGTQGGAAGALYALREPVALYGARTGTRRAATRARLESALAALHAQEAAQA
FT                   DEPFRQAKARVVEGFEREYLRRALSRHAGNVAQAARAASKHRRAFWALMRKHRIDAAPY
FT                   RSAADSS"
FT   CDS_pept        complement(377255..378751)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0345"
FT                   /function="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40677"
FT                   /db_xref="GOA:A9HY49"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY49"
FT                   /protein_id="CAP40677.1"
FT                   /translation="MTTKKPATPPSTTGAGAPSPSDRHSLTIGANGPILLHDVHFLEQM
FT                   AHFNREKVPERQPHAKGAGAFGVFETTADVSAYTRAALFQKGCKTEMLARFSTVAGEAG
FT                   SPDTWRDVRGFSLKFYTDEGNYDLVGNNTPVFFVRDPMKFPHFIRSQKRLPDSGLRDNH
FT                   MQWDFWTSNPESAHQVTYVMGDRGLPRTWRHMNGYGSHTYMWVNAQGDRFWVKYHFHTR
FT                   QGMQFFNNEQAKNMAGSDADFHRRDLFDAIARGDYPVWTLSVQIMPYEDAKTYRINPFD
FT                   LTKTWSHKDYPLVEVGTMTLNRNPENFFAQIEQAAFSPGNTVPGIGLSPDKMLLGRAFA
FT                   YNDAQRNRIGANFHQLPVNKPKVPTNTYMFDGQMAYEHSGNQPVYAPNSGGRPWSDPSG
FT                   KVDDGWEADGEMVRSAYTLRAEDDDFGQAGTLVRKVFDDAQRERLVETVAGSLLGGVRS
FT                   PVLERAFEYWKNIDADVGKRIEEKVRKGQAPEPAAGMSEA"
FT   CDS_pept        378982..380058
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="Bpet0346"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /function="Uroporphyrinogen-III decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40678"
FT                   /db_xref="GOA:A9HY51"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HY51"
FT                   /protein_id="CAP40678.1"
FT                   /translation="MSAAALKNDVFLRALLRQPVPYTPIWLMRQAGRYLPEYNATRARA
FT                   GSFMGLAQNPDYAAEVTLQPLARYDLDAAILFSDILTVPHAMGLGLDFAPGEGPRFARP
FT                   LRTEDDVARLAVPDMESLRYVFDAVAVIRRELDGKVPLIGFAGSPWTIACYMVEGRGSD
FT                   DYRLIKTMLYARPDLLHRILEVNAQATLQYLNAQIQAGAQAVMLFDSWGGVLADGLFQQ
FT                   FSLAYTRKVVAGLIREHQGRRVPAIVFTKGGGQWLEAIAACGCDAIGLDWTVNLGQARQ
FT                   RTGDAVALQGNLDPMTLFGGSEAIRAEARRTLDAFGPVGTGGHVFNLGHGISQYTPPEA
FT                   VAELVDEVHTYSRALHAK"
FT   CDS_pept        380406..382487
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="Bpet0347"
FT                   /product="primosomal protein"
FT                   /function="Primosomal protein N (replication factor Y) -
FT                   superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40679"
FT                   /db_xref="GOA:A9HY53"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY53"
FT                   /protein_id="CAP40679.1"
FT                   /translation="MPEAPDGDGSHANAWVRVALDVPLAGLFDYRAQGAVPAGTRVIVP
FT                   FGRRKLVGVVVDNPAQPSVDAAQVRDVEHVLQDLPPLPADWLRLARFAADYYQRPLGEV
FT                   MLPAMPPPLRKPSAYLGKRSGQGPVARQDARKARPAAAPTPPDQAPELNADQQAAVEAV
FT                   AALAGFKPVLLHGVTGSGKTEVYLRAAQRVLAAGRQVLLLVPEINLTPQLEGALRARLE
FT                   SVLGAEGLAVMHSGLSDGERLQAWVRAQRGQARMLLGTRMAIFAPLSELGLIIIDEEHD
FT                   ASYKQQDGLRYSARDLAVWRARDLDIPVVLGSATPSLESWHHALRGHYLRLGLPGRARA
FT                   SSLPTVRLIDTRRLAMRQGMSPQLTDAIGQRLERGEQSLVFLNRRGYAPVLHCASCAWV
FT                   SHCPRCSAFTVLHRAAGRGHRLHCHHCGYQAPVPRACPECGDQDLEPMGRGTQRVEEHL
FT                   AELFPQARISRIDADSTRLKGSAQTLFAAVHAGEVDILVGTQMVAKGHDFARLGLVGVL
FT                   NADSMLFAHDFRAPERLFAQLMQVAGRAGRHNGGGEVLIQTGYPEQPVYQALLRHDYAG
FT                   FARHALEERETTGLPPFAYQALLTAEARELAQALAFLQQARALAADSDFPGIAALTLYD
FT                   PVPLRVVRVANIERAQLLLESASRPALQAFLAAWSAYLPAMAAEARVRWQLEVDPLEI"
FT   CDS_pept        382490..384547
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="Bpet0348"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="Superfamily I DNA and RNA helicases"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40680"
FT                   /db_xref="GOA:A9HY54"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY54"
FT                   /protein_id="CAP40680.1"
FT                   /translation="MSDSAPIGHGLNPAQKEAVLYLDGPCLVLAGAGSGKTRVITQKIA
FT                   YLLRECGYMGRNVVALTFTNKAAREMDERVKTLVDRKLAKGLTISTFHSLGVRMLREEA
FT                   RHAGLKPQFSILDADDAMAIIQELLATTDRGRLRAVQSIISLWKNALLGPDDAARTAAT
FT                   PGEVEAANVYRNYSATLAAYQAVDFDDLIRIPAQLLENNEEVRTRWQNRVRYLLVDEYQ
FT                   DTNVCQYRLVQLLCGDRAMFTAVGDDDQAIYAWRGATIENLAKLTTDYPQLKLIKLEQN
FT                   YRSVQRILAAANTVIEKNPKLFEKKLWSDLGVGEPIVVSPMENDEHEAQSIAMKISAAR
FT                   FERQAQWRDFAILYRGNHQSRILEQALRNLKIPYTIAGGQSFFDKAEVRDILAYLRLIA
FT                   NDDDDPAFIRAATTPRRGIGQATLQVLGQYAAQREVSLLAAVAESGLESLLQPRQLDSL
FT                   RTFAEFIRRIQWRAGRGRTDGAGSAEPAGAILDDMLGAIQYERYLYDTLEEKPAQTRWE
FT                   NVLELTGWLKRKADEDGMSLFDLVQHVALITMLERGEEEEPDAVKLSTLHASKGLEYPH
FT                   VYLAGVEEGLLPHLGKDDEDGDPARAAESLATRIQEERRLMYVGITRAQRSLNLSWCKK
FT                   RRRAREDMVREPSRFIEEMGLGDVAIQEDEATKAMSPKERLGMLKALLKK"
FT   CDS_pept        384852..385835
FT                   /transl_table=11
FT                   /locus_tag="Bpet0349"
FT                   /product="transposase for IS1663"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40681"
FT                   /db_xref="GOA:A9HVM8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A9HVM8"
FT                   /protein_id="CAP40681.1"
FT                   /translation="MFFLGIDVSKAKLNCALVGAEGDKRKTKVVANTVAGIQALLGWCA
FT                   KQGAQPEQLHVVLEPTGPYHEQAGTALHEAGATVSMINPAQARDFAGALAVRTKNDELD
FT                   SYVLARYGQALCPPAWQPAPLHARQLRALLARHEALAKDLQRELNRQEKAQFGQSPEPV
FT                   TGSIDKSVAFLTEQIKRLERAINDHIDRHPDLKEDRDLLTSIPAVGPQTGNALLSIMHN
FT                   RRIESPQALAAYLGLVPVQRQSGTSLNGRPRLSKTGPARVRATLYMAAVVAVRHNPHIQ
FT                   ALYARLLAAGKSKMAALGAAMRKLAHLCFGVLKNRTPYRSDYALPA"
FT   CDS_pept        complement(386183..387310)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0350"
FT                   /product="putative peptidase"
FT                   /function="Acetylornithine deacetylase/Succinyl-
FT                   diaminopimelate desuccinylase and related deacylases"
FT                   /EC_number="3.4.17.11"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40682"
FT                   /db_xref="GOA:A9HY59"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY59"
FT                   /protein_id="CAP40682.1"
FT                   /translation="MSLPSTEALVAGIQSWVQCESPSNSPQGVAAMASLVEAQARAAGL
FT                   TVEVTPLGADTGPLLYATNRAAGDTRPGILVLAHLDTVHPIGTLQDNPCRIEGDRLYGP
FT                   GSYDMKGGIYLALAALSTLAQPDSTRLPVDFLMVPDEEIGSHASRASIERYAANAKYGL
FT                   VCEPARPNGGKCVTARKGTGMLRLNVKGRPAHAGMQHEKGRSAIREMAHQVLALESMTD
FT                   YERGVTVSVGTIAGGTVTNTVPAQCRCVVDFRVPDMGAAEDVLRRMRNLCAVGPDVELD
FT                   IDVELNRPPMVRTDAAAALLELAQGYAREAGFDLEEAPMTGGGSDANFTSAMGVPTLDG
FT                   LGADGDGAHTLHEYILVSTLQTRAKFWQLLLRELA"
FT   CDS_pept        complement(387345..388247)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0351"
FT                   /product="conserved hypothetical protein"
FT                   /function="Poly(3-hydroxybutyrate) depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40683"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY60"
FT                   /protein_id="CAP40683.1"
FT                   /translation="MKAEMSNADRIARELGHAGRNAIAYVDDDRNADRPFTLQTYRPYG
FT                   YTPDRPVVMVQHGVLRNGDDYRDFWIPAADKHNVLIVAPTFSNDIWPGVDSYNNGRVFS
FT                   AGGNPRHIDGWTYALVAKVFADLRAAGITEVEQAHLFGHSAGGQFVHRLMSSQPHAPFC
FT                   AVTAANPGWYTLPTFDHRYPEGLDGVGLTEEHLVRLLAYPMTILAGDQDIATDDPNLPS
FT                   DPAALRQGPHRYARAHHYFEAGQREAQRRGVPFGWKLQTVPGIGHDGRAMSAACASLWF
FT                   EGKLPSDAELARLAGQQVA"
FT   CDS_pept        complement(388262..389263)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0352"
FT                   /product="putative oligopeptide transport ATP-binding
FT                   protein"
FT                   /function="ABC-type oligopeptide transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40684"
FT                   /db_xref="GOA:A9HY61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY61"
FT                   /protein_id="CAP40684.1"
FT                   /translation="MTPQETPVIELRNVHKRFEHHPDLAQRMLALAGKPIDRRTVHAVN
FT                   GVDLAIQRGEVLGLVGESGCGKSTLGRVVAGLHRQTEGELLYQGRSTASLRGADLLAYT
FT                   LGVQMIFQDPQASLNPRQRLRQILGEALKVHKLAPPAEIPARIDRALSEVGLDREYRDR
FT                   FPHQISGGQRQRIGIARALMVSPKFLVCDEPVAALDVSIQAQVINLFMDLREQHGFTYL
FT                   FISHDLGVVKHISDRVAIMYLGKIVERAPAAEIFTRANHPYTQALLAEVPDVSRRGRKF
FT                   TPIQGEIPSPLNPPPGCTFHPRCPHAMPRCREQAPALKEIAPGHWSACHLNP"
FT   CDS_pept        complement(389260..390243)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0353"
FT                   /product="putative oligopeptide transport ATP-binding
FT                   protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40685"
FT                   /db_xref="GOA:A9HY64"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY64"
FT                   /protein_id="CAP40685.1"
FT                   /translation="MSDVILQVRGLRTAFHTEAGAWPAVDGVDLTVRRGEILGLVGESG
FT                   SGKSVTGFSLLGLIDPPGEVVSGEVLFKGQDLRMLDEEGMRRLRGNRIAMIFQDPLMTL
FT                   NPVLRIGEQMMEAILTHEAVPAAQARERCREALAMVGIPAPEKRLDSYPHEFSGGMRQR
FT                   VAIAIAMLNNPDLIICDEPTTALDVTIQGQILYRMQEICRKNDTALIWITHDLGVVAEL
FT                   ADHVAVMYAGRIVEAGPVEQVLDAPRHPYTRGLLDSMPANAAPGARLHQIEGMAPSLAG
FT                   RPAGCAFRPRCPNAITRCAEQAPAAVQEGPRSFRCYVPIAREAATA"
FT   CDS_pept        complement(390240..391211)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0354"
FT                   /product="putative ABC-transporter permease"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40686"
FT                   /db_xref="GOA:A9HY65"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY65"
FT                   /protein_id="CAP40686.1"
FT                   /translation="MPRSTRACSSSLPHSNAMAHSSSPGRTRTIQPLAETPRRAAILKK
FT                   LRGRPTVTGSAIALIILMVVVLAAPFFAPQNPYDLANLNLLDGRLPPGAASMDGKIYLL
FT                   GTDDQGRDMLSAILYGLRISLMVGLSAVGLATAIGSMAGLVAAYVGGFVDTMLMRIVDF
FT                   ILGFPTILVALVLLAMMGRGVDKVILALVVVQWAHYARIMRGRALQERRKEYVEAAANL
FT                   GFPAWRIMVFHLLPNCLGPVMVFATIQIATAIALEATLSFLGVGVPITEPSLGLLIANG
FT                   FQYLLSGDYWISMFPGVALLLLILTINIVGDRLREALDPRRA"
FT   CDS_pept        complement(391165..392142)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0355"
FT                   /product="putative ABC-transporter permease protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40687"
FT                   /db_xref="GOA:A9HY68"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY68"
FT                   /protein_id="CAP40687.1"
FT                   /translation="MVLFTLRRLLQSLFVMLAVSVVVFFAVYAVGDPIELLVSPEATVE
FT                   ARAATIARLGLDQPIWQQYFTFLWRALHGDLGTSFVHGIPAIELIVQRIPATFELVVVA
FT                   ITLTCLIGIPLGLVAGLYRDRPLGRGIMATSVLGFSLPNFWQGMMLILLFAVWLGWLPA
FT                   SGRGETVSVLGVPLSILTANGWSHVIMPAVNLALANIALVLRLTATGVAEAQSQEYVKF
FT                   ARAKGVRPGRIVRRHILRNILIPVVTVVGMEFGSLIAYSTITETVFAWPGMGKLLIDSV
FT                   YQLDRPVVVAYVMLVTLIFVIVNFIVDILYAALDPRVQLVAPAQ"
FT   CDS_pept        complement(392185..393807)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0356"
FT                   /product="putative extracellular solute-binding protein"
FT                   /function="ABC-type dipeptide transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40688"
FT                   /db_xref="GOA:A9HY69"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY69"
FT                   /protein_id="CAP40688.1"
FT                   /translation="MHASCIRAAAMAALFGLAAGAQAQSLKIALASEPTAMDPHYHQAT
FT                   PNNAMASQIFETLVAQDAKMSLVPGLATSWKALDDTTWEFKLREGVQFSNGQPLTPQDV
FT                   IFTFCRAMNNEESIAGSYAAVVKKFADVQATDAHTLRIKTLKPYPLLANDLTRTGILWS
FT                   GIVEHGPITFDLENKCGVTGPWPKVADFNSGKDAIGTGPYKMKSYVKGAGIELERNDGY
FT                   WGDKPEWRSVTFVPVPNAGSRLTGLLAGDFDVIESPAARDVQRIKSTPGFGYVVTPSVR
FT                   VVYFQFDVGRDASPLVKAPNGKNPLQDVRVRRAISMAIDRKTIVARIMDGMATPANQFL
FT                   PDGMFGTLPHPPELKYDPEGAKKLLAEAGYPDGFEMTLSSTNDRYINDGQITQAVAQYL
FT                   SRVGIKAHVDAMTRSVYFPKRAKREFSFAMGGWSSETGEASSFLQYWVTSYAPDLGMGT
FT                   SNYGRYSNPELDKVFRQAVTTVDDAKREKLLQQALTIALADLPSIPLHFESSIWAFRKG
FT                   LTYEGRADQYTLATSVKPVKAAQ"
FT   CDS_pept        complement(393855..394844)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0357"
FT                   /product="hypothetical protein"
FT                   /function="Predicted deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40689"
FT                   /db_xref="GOA:A9HY70"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY70"
FT                   /protein_id="CAP40689.1"
FT                   /translation="MSTPDAAASLRPFELACPDLSAERLGNTGTPGVWHFDSGAPGRRV
FT                   MLTALIHGNELCGAWALKTFLASGLQPRHGTLTLAFCNLAAFDRFDPANYLPARFVDED
FT                   MNRVWSDDKLADPSSQERRRAAALQPWVAQADWLMDFHSMSNSEVPLQLTGLQPRNIEL
FT                   ALQLGTPANIIADAGHAAGVRMRDYGRFGADGDDTRSLLIECGFHGAPQARDVAIDQMA
FT                   RFLVAAGAFARGDLPAAWFAPDAPRQQALRVTHAIAARSADVRFAQPWRGLEQLPQAGT
FT                   LLGWNDGEPFVTPYDNCVLIMPSLANVRPGVTVLRLAQPITQAPGRPA"
FT   CDS_pept        394929..396086
FT                   /transl_table=11
FT                   /locus_tag="Bpet0358"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40690"
FT                   /db_xref="GOA:A9HY71"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY71"
FT                   /protein_id="CAP40690.1"
FT                   /translation="MPIPPGKGGPERQPGTLFPLSEQPAAGWRDADSYLEADSRSGSAF
FT                   STIRIFAKLFAFLAKQPWRPTPVSSHRYHTMHGIALKYFVAVAQAGSLSAASKQLHVAV
FT                   SAISRQIARLEEEVGAPLFERAPRGMALSEAGRLLLAHARRTQMESDEVLRQIAGLQGT
FT                   PHDEIRVGASEGPAQGFLPVAMVDFRRRYPRTRFSLHVLTPPESMRQLANGDIDVAVSF
FT                   NVEPAQGVAVAHSWRAPVYAVMAATHPLAGRSRLRLEDVLAYPLALTDDKSTARRLLNR
FT                   TCALEDMQLQAALISNYSPALHGFVRHSNAVMFAGYISVAWRLKQDGLVALPVVSAELQ
FT                   SRNLQIQTMEGRLLPPGVARFIEHLKARIDEVEATVSDTLRESDT"
FT   CDS_pept        complement(396635..398251)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0359"
FT                   /product="Putative binding-protein-dependent transport
FT                   protein"
FT                   /function="ABC-type dipeptide transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40691"
FT                   /db_xref="GOA:A9HY74"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY74"
FT                   /protein_id="CAP40691.1"
FT                   /translation="MKLRTSLALLAASAGLAAAPAALAQTLTIALSSEPTSADPHYHKQ
FT                   TQNDAFAAHVYDSLIYRSADMKLKPGLATSWKNLDDLTWELKLREGVKFSNGEPFTSQD
FT                   VLFSVCRTLNNKTNISQSYMTVTKLLTDVQTPDAHTVILKTAEPFPLMPAELARQLPII
FT                   WNGIVEHGALKFTPKEGCGVTGPWPTVADFNSGKDAIGTGPYKLKSYVKGTGIELERNE
FT                   GYWGDKPQWKTVKFVPVPNAGPRLTGLLSGDFDVIENPAARDLPRLKENGNFGYVATPS
FT                   TRLIFFQPDVGRNPSPFVKSPDGKNPLQDLRVRRAINMAIDRKTINARIMDGLSTPAYQ
FT                   YMPDGMFGALPKAPEIKYDPEGAKKLLAEAGYPDGFELTLSSTNNRYVNDGQVTQAVAQ
FT                   YLSRIGIKTHVDAMTASIYFPKRAKREFSFAMGGWPAETGEASALFQLWVASTDSARSL
FT                   GTSNYGGFSNADFDKVYEQAIVTVDPEKREKLLQQSTQIALDNLPLIPLHFESSIWAFR
FT                   KGLTYEGRRDQYTLAMSVHSK"
FT   CDS_pept        complement(398522..398755)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0360"
FT                   /product="hypothetical protein"
FT                   /function="Superfamily II DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40692"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY75"
FT                   /protein_id="CAP40692.1"
FT                   /translation="MSELTLNPNARLTDALERDLLRGAMESQPNAHPLVLLKQAGNAIA
FT                   RGVVAFVDYVAEVNDAMNRARAASARYAGSQW"
FT   CDS_pept        complement(398852..399712)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0361"
FT                   /product="Conserved hypothetical protein"
FT                   /function="Predicted sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40693"
FT                   /db_xref="GOA:A9HY78"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY78"
FT                   /protein_id="CAP40693.1"
FT                   /translation="MSAAPATMPAPILRQNLPALFAPRPADAHKGTCGTVAVVGGGAGM
FT                   AGAVLLAARAALKTGAGKVLAGFAQASCPLACDPLQPELMLRDAASLFQAGLPVDAWVA
FT                   GCGLGTDAQARATLDALFAQRGDAPLVLDADGLNLLAGGALPAWGTGPVILTPHPAEAA
FT                   RLLGTDTGAVQADRPSAARALASRHGAWVVLKGAGTLVCRSDGLCLRNITGNAGLATAG
FT                   TGDVLAGMLGSLVAQGIALDQAVPGAVWLHGAAADALVAARIGPIGLTAGELADAARQL
FT                   RNGHG"
FT   CDS_pept        399793..400626
FT                   /transl_table=11
FT                   /locus_tag="Bpet0362"
FT                   /product="conserved hypothetical protein"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40694"
FT                   /db_xref="GOA:A9HY79"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY79"
FT                   /protein_id="CAP40694.1"
FT                   /translation="MSEPSLDHYARYQALKLRRHPQGILEIVMGARGGVPGKLSTADEG
FT                   LHRELADIWRDVDTDPDTRVVVIRGEGKGFSGGGDLELVQQMADDFEVRARVWREARDL
FT                   VYNVINCNKPIVSAMHGAAVGAGLVAGLLADVSIAARDARIIDGHTRLGVAAGDHAAIV
FT                   WPLLCGMAKAKYYLLLCEAVSGEEAERIGLVSLCVDEAELIGKAFEVAGKLASGSQTAI
FT                   RWTKYALNNWLRLAGPSFDASLALEFMGFAGPDVREGIQSLRERRPPAFKPDAPF"
FT   CDS_pept        complement(400862..401650)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0363"
FT                   /product="hypothetical protein, putative enoyl-CoA
FT                   hydratase/isomerase family member"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40695"
FT                   /db_xref="GOA:A9HY80"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY80"
FT                   /protein_id="CAP40695.1"
FT                   /translation="MSAPDTSHGASQAASAPPDSLRVERDGSILTLTINRPQRRNALDV
FT                   ATYLALAEQLRQATADASLSAVILTGAGEHFTAGNDLHDFQGGRPAGDSAGMTFLRALI
FT                   ATDLPVIAAVEGYAIGIGVTLLQHCDFVYAGRTATLRIPFVALGLCPEGASSLLLPRLA
FT                   GARKAAQWLLQGKAFGADEAMQAGLVTAVTEPGQALAAARATAADLAAQPRSALRLTKA
FT                   MLKRADRDAINETLDFEATQFRARLHTQEAQEAFARFLNK"
FT   CDS_pept        complement(401647..402729)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0364"
FT                   /product="conserved hypothetical protein"
FT                   /function="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /EC_number="1.13.11.32"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40696"
FT                   /db_xref="GOA:A9HY82"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY82"
FT                   /protein_id="CAP40696.1"
FT                   /translation="MPLNGRQLITGHPVGNYTHAFRSLSTFRLFMNARDATQPQVLVNQ
FT                   LYAQMTLPVICSPMFIVSNPKLVVAQCASGVMGSFPALNARPQTLLDEWLAEVQEGLAA
FT                   RRQADPAAVVAPFAVNQIIHKSNDRLEHDLDLCGKHRVPFIITSLRAPGDLVAGIHAWG
FT                   GKVFHDVTTVRHAEKALEAGVDGLILVCAGAGGHAGTLSPFALVSEVRRFYDGPLILSG
FT                   AITSGQGILAALALGADFAYMGTRFIASAEANASDGYKQAIVDASASDILYTPFFTGIP
FT                   GNYLKASIVAAGLDPANLPAPEAAASNFGSTRVKPWKDIWGAGQGVGGIDSVRPAADII
FT                   ATLRQEYAQAQARLAGRAFA"
FT   CDS_pept        402747..403409
FT                   /transl_table=11
FT                   /locus_tag="Bpet0365"
FT                   /product="transcriptional regulator, TetR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40697"
FT                   /db_xref="GOA:A9HY84"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY84"
FT                   /protein_id="CAP40697.1"
FT                   /translation="MRAAMHARQASHPPMPDSPVPAKRPRAGRPPTLQAPRERILEEAA
FT                   RLFARSGYENSSVADLAAALGVSKAAIYHYYTTKQDIYDAIILEVVGGLTVAVSQAVAQ
FT                   ADTASGRLRQFMLAHARYFEEHHPEFVTMLVGYSGMAIPERDDAARLRDGYERMLRGIL
FT                   ADGMASGEFRAMDVASTGRAVLSMLNWMARWYQPGGAQTAESIAAGYFDLLRGGLAT"
FT   CDS_pept        403451..404599
FT                   /transl_table=11
FT                   /gene="acd3"
FT                   /locus_tag="Bpet0366"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /function="Acyl-CoA dehydrogenases"
FT                   /EC_number="1.3.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40698"
FT                   /db_xref="GOA:A9HY86"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY86"
FT                   /protein_id="CAP40698.1"
FT                   /translation="MALDTETLTLLLDAVRRFVTDRLVPAEEALAHTGEIPPDIVAEMR
FT                   ELGLFGLSISPDYGGLGLTMEEEVRVVFELGQTSPAFRSLAGTNIGIGSQSIVLAGTDE
FT                   QRSHYLPKLASGELIGSFALTEPDAGSDAMSLRTSAVRDGDHYVLNGTKRFITNAPVAG
FT                   LFSVMARTAPERKASSISCFLVDAGTPGLTLGKPDKKMGQAGALTCDVVFDNCRVPATA
FT                   LLGGEEGTGFRTAMRVLDKGRLHISALCVGIAERLVRDAVKYATERKQFGQPIAEFQLV
FT                   QAMIADSQAELYAARSMVLDAARKRDRGENTTLEAACCKLYATEMVGRVADRAVQIHGG
FT                   AGYISEYAVERFYRDVRLFRIYEGTSQIQQLVIARETIKAYS"
FT   CDS_pept        404738..405967
FT                   /transl_table=11
FT                   /locus_tag="Bpet0367"
FT                   /product="Predicted acyl-CoA transferase/carnitine
FT                   dehydratase"
FT                   /function="Predicted acyl-CoA transferases/carnitine
FT                   dehydratase"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40699"
FT                   /db_xref="GOA:A9HY88"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY88"
FT                   /protein_id="CAP40699.1"
FT                   /translation="MSQRPAPLTGIRVLDLTRVLAGPWCTQNLADLGAEVIKIERPGAG
FT                   DDTRAWGPPYLKDAAGADTTEAAYYLSANRNKYSVALDIASPRGAELVRELARQSDILV
FT                   ENFKVGGLRKYGLDYDTLKADNPGLIYCSITGFGQTGPYASRPGYDFMIQGMGGLMSIT
FT                   GERDDLPGGGPQKAGVAVADLMTGMYSTVGILAALHERGRSGLGQHIDMALLDCQVAMM
FT                   ANQNLNYMTSGQAPRRAGNAHQNLVPYQVFAASDGHLIVAVGNDSQFRNYCRVIGLPEL
FT                   SADPRFATNPQRVQNRDALVPLLAERMATGERDHWLAELESAGVPAGPINTLDQVYQDP
FT                   QVQAREMRRELPHPTAGTVPIAASPLKLSGSPVQYRRPAPLLGEHTRQVLAERLGLSDE
FT                   EIQALAQPRA"
FT   CDS_pept        406004..407527
FT                   /transl_table=11
FT                   /gene="paaH"
FT                   /locus_tag="Bpet0368"
FT                   /product="putative 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /function="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40700"
FT                   /db_xref="GOA:A9HY90"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY90"
FT                   /protein_id="CAP40700.1"
FT                   /translation="MTDIQTIAVVGAGAMGRGIAQIAAQAGVQVRLYDTSADAIASARE
FT                   SLRQLWDKLSQKGKLSAADAQAALERVQPAATLEALAGCQLVVEAIVERLDVKRDLFAK
FT                   LEPIVGPDCILASNTSSLSITAIAAACERPQRVAGFHFFNPVALMKVVEVIDGLRSDPA
FT                   AGDALAALARRMGHTPVRAKDMPGFIVNHAGRGMNIEGLRVAQESVASFAQIDAIMREQ
FT                   AGFRMGPFELMDLTALDVSHPVMESIYRQFFDEPRFRPSPITTVRLAGGLIGRKAGAGF
FT                   YAYPDGQKQAPAEPAVPAAQTGLRVWISPAHEEGHARAQALLESLDANIADTAEPPEQA
FT                   LIVVTPYGEDVSTCAYQQGLDAARTVGLDTLHGLSAGKRRTLMLSPATQATWRDAAHAL
FT                   LAADGAPVSVIQDSPGFVAQRIVAAIVNVASEIAQQGIATPADIDRAVTLGLGYPMGPL
FT                   AMGDALGGARILEILRNLQRVTGDMRYRPSLWLQRRVQLGLSLLAEPAA"
FT   CDS_pept        complement(407614..408519)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0369"
FT                   /function="Cytochrome c5"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40701"
FT                   /db_xref="GOA:A9HY91"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY91"
FT                   /protein_id="CAP40701.1"
FT                   /translation="MSNEQEHNEEHASPIKTPKQLIVTVVLAFLVPIIVIIMLVNMVSS
FT                   GTKVGAGSDTLTEEAVARRIAPVAGFELVDANAPKVFKTGEQVFQAVCTACHTAGVAGA
FT                   PKVGDKAAWAPFIKSGFESMLNVALHGKGAMPAKGGNPALSDYEVARAVVYMANQSGGS
FT                   FDEPAAPAQEGEGVKAEAPKQAAAAAPAPAAAPAAAAAEAPKAEAPAPAAAPKAEAAVN
FT                   PAGEKLYKSTCFACHGTGVAGAPKFGDKAAWEPYIKTGIDAMVKVALTGKGAMPPKGGA
FT                   ANASEEDIRAAVEYMVNAAQ"
FT   tRNA            408729..408803
FT                   /gene="b_petrii_trna_02"
FT                   /locus_tag="Bpettrna_02"
FT                   /anticodon="(pos:408762..408764,aa:Arg)"
FT   CDS_pept        408887..409309
FT                   /transl_table=11
FT                   /locus_tag="Bpet0370"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40702"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY93"
FT                   /protein_id="CAP40702.1"
FT                   /translation="MEVDQIIATLGMERHPEGGWFVETFRDTRGDARACSTAIYYLLEA
FT                   GDSSHWHRVRDAAEVWHFYAGDPLLLTLSDGDTTTRITLGTDFAQGERPQAVVPANVWQ
FT                   AARPLGRFTLVGCTVAPGFEFSSFELAPSGWSPRSD"
FT   CDS_pept        complement(409405..410394)
FT                   /transl_table=11
FT                   /gene="bug8"
FT                   /locus_tag="Bpet0371"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40703"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY95"
FT                   /protein_id="CAP40703.1"
FT                   /translation="MLNSRLFRTRLIRRAAVALLAAGFALPAMAEYPTDRPVQFISPYA
FT                   AGGANDFLTRLMARYMGEEMKANIVVDNKSGANGMIGAAYVAKAKPDGYTLLMGNSATH
FT                   GTNPTLYQKQQSYDANKDFTPVAMVASVPIVMVVNASLGIDNVKELLQYGKTHRLSFGS
FT                   SGVGGTGHLTGEAFKAATGLDMVHVPYKGDSPAVTDAMGGQVDLAFVGTASATAQQSSG
FT                   RIKILAVAHPTRSRALPDVPTMAEAGFPGLEFSQWYALFAPAGTPKAVVAQLNTANKAA
FT                   LANPEVQKSLDAQSAESTYRTPEQLEAFYQSEIKRFGDLIHKLNLSTE"
FT   CDS_pept        complement(410635..411555)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0372"
FT                   /product="transcriptional regulator, IclR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40704"
FT                   /db_xref="GOA:A9HY96"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY96"
FT                   /protein_id="CAP40704.1"
FT                   /translation="MRAMAASTMQTIDICMRAITCCQGDLMTTPSAAAGKAAPGTQSLQ
FT                   RAVALLRIIGANNRAGSRLVDLYRRTGLERPTVHRLLQGMVAEKLIRQDSATKRYHLGS
FT                   LAYELGLAAAPKVAMRDICLPYLEAVAEHTGDTVFLTVRSGFDGICVARADGSFPIKMF
FT                   VHDVGRHRPLNVGASGLALISALPDEEIDRICRINVERTRRKNPRFTEAALRASIDSTR
FT                   RRGYATNKVMDEPPVHSVGMVIRSPDGTPAAGVSVSTLASRLGQDRLEMVVRCLGDTVT
FT                   AIEAELRNHVDRDRVPYAMPSLALA"
FT   CDS_pept        411694..412530
FT                   /transl_table=11
FT                   /locus_tag="Bpet0373"
FT                   /product="hypothetical protein, probable enoyl-CoA
FT                   hydratase/isomerase family member"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40705"
FT                   /db_xref="GOA:A9HY99"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9HY99"
FT                   /protein_id="CAP40705.1"
FT                   /translation="MAHEQELITQVEAGVLWLTLNRPERRNALSPTLYEALLESLACAA
FT                   NDAAVGAVVLTGAGASFCAGGDVARMNRQSQAQAAPAAPAERVAAMRRRTRIVECLHGM
FT                   PKPTIAMIRGAAVGAGLSLALACDLRYGDSSAKLRTGFANVGLPGDFGGHYFLPRIVGP
FT                   AKARELYLRSPMLSAAQALELGLLNEVFSPEQLESEVTGIARGLAAGPQPAIAHTKANL
FT                   NDALVLELAEVLDRECARHVECADSPDHKEAVRAFMEKRAPVFQRPSAAIAGGGKH"
FT   CDS_pept        412556..413455
FT                   /transl_table=11
FT                   /locus_tag="Bpet0374"
FT                   /product="probable short-chain type
FT                   dehydrogenase/reductase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40706"
FT                   /db_xref="GOA:A9HYA0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYA0"
FT                   /protein_id="CAP40706.1"
FT                   /translation="MSRLCEGRVVIVTGAGRGIGREYALQLAREGARVVVNDLSVSRSG
FT                   EGTEESTAEAVASEIVAAGGQAIANHENVADFAGAKRMIDAAVEHFGALHVLINNAGIL
FT                   RDRTLCNMTEQEWDAVINVHLKGSFAPCHHAAAYWRDLYKQTGTPVNARIINTSSSSGL
FT                   YGNIGQINYGAAKAGIAAMTIIAARELKRYGVTVNAINPHAQTRMTEGIRERSAEEIAS
FT                   RHPRWIAPAVVWLASADSQDVTGRIFELGGGHLAAMEGWRRGPAAEPIDDAARIGPVMR
FT                   DLAQRARRNVDMKGHELD"
FT   CDS_pept        413470..414150
FT                   /transl_table=11
FT                   /gene="pcaI3"
FT                   /locus_tag="Bpet0375"
FT                   /product="putative 3-oxoadipate CoA-transferase subunit A"
FT                   /function="Acyl CoA:acetate/3-ketoacid CoA transferase
FT                   alpha subunit"
FT                   /EC_number="2.8.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40707"
FT                   /db_xref="GOA:A9HYA2"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYA2"
FT                   /protein_id="CAP40707.1"
FT                   /translation="MIDKRVSSLAEAVAGIEDGAVILVGGFGSSGRPADLMEALLDLGV
FT                   RDLTIVANNATVGDDIVAELMSAGRIRKVVCSFPRGLKGRTIFDELYATGKIELELVPQ
FT                   GTLAERIRAGAAGIGGFFTRTAAGTRLAQGKETRVIDGQTYVLEAPIKGDVALLKGLRG
FT                   DRWGNLVYHRGARINNPVMAGAARLVIAQVREIVPLGTLDPEHIITPGVFVDRLVEVPN
FT                   ERKA"
FT   CDS_pept        414134..414817
FT                   /transl_table=11
FT                   /gene="pcaJ3"
FT                   /locus_tag="Bpet0376"
FT                   /product="putative 3-oxoadipate CoA-transferase subunit B"
FT                   /function="Acyl CoA:acetate/3-ketoacid CoA transferase beta
FT                   subunit"
FT                   /EC_number="2.8.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40708"
FT                   /db_xref="GOA:A9HYA4"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYA4"
FT                   /protein_id="CAP40708.1"
FT                   /translation="MSAKLSRQDIARVAADDIPDGACVNLGIGLPTLIADYVPEGRELM
FT                   LQSEQGLLGLGPAPAPGEEDYDVINAGKFPVTLLPGASVFSHSESFLMIRGGHIQIACL
FT                   GAFQVAANGDLANWTVDAPNQIPGVGGAMDLAAGAEKVWVLMEHCTKDGQPRILEQCTY
FT                   PLTAPHCVDRIYTDLAVIDVTDTGLVVRRLAPGWTLPALQALTGAALTLAPDWSVYGQS
FT                   ATQGE"
FT   CDS_pept        414840..415799
FT                   /transl_table=11
FT                   /locus_tag="Bpet0377"
FT                   /product="possible 2-nitropropane dioxygenase"
FT                   /function="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /EC_number="1.13.11.32"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40709"
FT                   /db_xref="GOA:A9HYA6"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYA6"
FT                   /protein_id="CAP40709.1"
FT                   /translation="MLGIEHPIVQGGMQWVARAELVAAVSNAGALGVLTALTQPSPEDL
FT                   RREILRVREMTDRPFGVNLTFLPTLKPVPYVEYRDAIIESGVKIVETAGNNPHEHMPAL
FT                   KAAGVRVIHKCTTPRHARKAQDIGVDIVSIDGFECAGHVGENDIPGLILIPATVAQVSI
FT                   PVIASGGFGDARGLVAALALGAEGINMGTRFMCTQESPVHPAIKEAITRSSETDTRLIL
FT                   RSLRNTSRVWRNGLSGQVVSLEKEGAGIDQIGPLVAGAKGRGVYESGDVEGGIWTVGMI
FT                   QGLIDDVPTCGDLVRRIVDQAHALVSGRLASLTLSGTE"
FT   CDS_pept        415796..416263
FT                   /transl_table=11
FT                   /locus_tag="Bpet0378"
FT                   /product="acyl dehydratase, MaoC family"
FT                   /function="Acyl dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40710"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYA8"
FT                   /protein_id="CAP40710.1"
FT                   /translation="MMLTVDTPYDLEAYVGQVLGQTGWIEITQQMIDDFARISGDNNWI
FT                   HVDTERAARELPDGKTIAHGMLTFSLMSGMGGEIVQVRERGRGINYGSNKVRFTSPVQV
FT                   GSRIRLERSLVAFERMEGGVRLTYGNVMRREGQERPVMVAETLNLMYEKGK"
FT   CDS_pept        416263..416661
FT                   /transl_table=11
FT                   /locus_tag="Bpet0379"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted nucleic-acid-binding protein
FT                   containing a Zn-ribbon"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40711"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYB0"
FT                   /protein_id="CAP40711.1"
FT                   /translation="MHTDEKPGNGAPYARYVQHLRAGELAYQFSPVAGRAVFFPRVRCP
FT                   WSGQDCLEWRISAGIGTVYSTSVVYPRKGDPYNVALIDLDEGFRMMSRVDGADPLQVAI
FT                   GQRVRFQAVTDEGLDDPIPVFTLLEAEQ"
FT   CDS_pept        416658..417815
FT                   /transl_table=11
FT                   /locus_tag="Bpet0380"
FT                   /product="putative thiolase"
FT                   /function="Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40712"
FT                   /db_xref="GOA:A9HYB2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYB2"
FT                   /protein_id="CAP40712.1"
FT                   /translation="MSIDFRPGRAVIVGAAESDLGAVGDAFSAIDLMAQGVYRALDDCG
FT                   LSIGDVDGLFCATSQSRLAGLALAEYLNLPEAYIDSTSTGGSSFMGHLARAEAAVAAGL
FT                   CKVAVVAYGSTQRSLGRKNTSRPEWNPYESPFKPFLPPTAYALAAARHMHEFGTTREQL
FT                   AEVAVAARQWALLNPVAWEKDPLTVEEVLASRMVSYPLTIRDCCLVSDGGGAVVVTTPA
FT                   RARSLAKPPVYLLGSGHCTTHLTISNMPDLVNTGARVSGEMAYAQAGLTSSDIDVVGLY
FT                   DAFTINPILFLEDLGFCAKGEGGAFVSGGRIAPGGTLPVNTNGGGLSYCHPGMYGIFLL
FT                   IEAVRQLRGECGRRQVDGAEVALAHGNGGVLSSQYTVILGGASTC"
FT   CDS_pept        complement(417805..419031)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0381"
FT                   /product="putative membrane protein"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40713"
FT                   /db_xref="GOA:A9HYB4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYB4"
FT                   /protein_id="CAP40713.1"
FT                   /translation="MSNAAASLNDPATELSRREQRGNIARLTIAQALAGANSVVVYATG
FT                   AIIGDMLAPNKTLATLPISIFVVGMAACILPMGAIARRYGRRTAFLAGTVCGVLVGLLA
FT                   AAAVVMGSFWLFCLATFFGGAYAAVVLSFRFAAADGVAPSLRARALSFVMGGGVVAGIV
FT                   GPTLVTYTMYLWSPHLFAATFLVQALVAAISAAVLAGVRLPTLTAAQVAGGRPIGVIAR
FT                   QPLFITAVICGAVSYMLMNFLMTAAPLAMHLCGHSQESANLGLQWHVIAMYAPSFFTGR
FT                   LITRFGAGKIVSAGLLLTGISATVGLTGIDVAHFWLTLILLGLGWNFGFVGASALVLEC
FT                   HRPEEKTRVQSLNDFIVFGTMAVGSFASGSLLAAYDWNTVLWVSFAPLALAVVALVVAA
FT                   RYRNAAASR"
FT   CDS_pept        complement(419093..419590)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0382"
FT                   /product="probable acetyltransferase"
FT                   /function="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40714"
FT                   /db_xref="GOA:A9HYB5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYB5"
FT                   /protein_id="CAP40714.1"
FT                   /translation="MPSTTPRFRQAIPSDTDRCYQIEISAYEGDEAATREKIALRIAQY
FT                   PEGFLVMELDGQVAGFINSGCAREVVMSDEAFKELVGHDASAPNVVIMSVVLDPAFQGK
FT                   GYSTLLMREFVQRMRGMGKTSIHLMCKQRHIELYRRLGYRYVRPSASDHGGMSWHEMTM
FT                   EV"
FT   CDS_pept        complement(419595..420533)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0383"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40715"
FT                   /db_xref="GOA:A9HYB8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYB8"
FT                   /protein_id="CAP40715.1"
FT                   /translation="MHDIQTLLALYGGWLVFLNVLVEQAGLPVPAYPMLIAAGALAGGT
FT                   GGWLLVCLVAALACVLADTAWYVAGRRYGGRLLELVCKVSLSQDSCIRQTQKLYLRVGV
FT                   RSLLVCKFMPGAGALSTAMAGLTGTPYRRFLAYDLAGSLIWVSSALLLGALFRDVVGDV
FT                   LALLNTYGPLGLALLAFVLLVYVLTRGLRRWVLVRRLRRIPRLHPEELLRWQAAGRAPI
FT                   VLDVRPGIDATLPRIPGAIAVDLAAPLTDLPLAGQAGEIVVYCACPNEISAARLAARLR
FT                   AAGYSGIWALQGGYDAWARMAHETPDLSVPK"
FT   CDS_pept        420700..421626
FT                   /transl_table=11
FT                   /locus_tag="Bpet0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40716"
FT                   /db_xref="GOA:A9HYB9"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYB9"
FT                   /protein_id="CAP40716.1"
FT                   /translation="MVIYAFCIFCVFLTMKIALLGCGEVGHCYAQAWLAAGFSVPAICE
FT                   LRQDPDMQARARAHGAALHAAPGPWLAEADLVVSAVYGHAALAVAEQAIPHMWGDALYA
FT                   DFTTAGAADMRAAAAVASRHGVPFADVAIMGAIALLGARTPLLCAGTAAPAIVEFAQGC
FT                   GIPAQAIAGQAGDAVQLKLLRSILTKGMESLAVECLVAAEQLGLREALYGVLGDMDRTP
FT                   LTTFLDSFVCSHVLHAPRRLAEVREAREQLALAGLQPLVLDGVERLFARTTQGIEAERA
FT                   AHGGAPLDVPDTVQARLAWLTPLARQD"
FT   CDS_pept        421676..422644
FT                   /transl_table=11
FT                   /gene="bug9"
FT                   /locus_tag="Bpet0385"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40717"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYC0"
FT                   /protein_id="CAP40717.1"
FT                   /translation="MQVLKKIMAAAMLASCAAAAGASGLGAAPITFISPFPPGGGTDTL
FT                   TRMMATAIGQDTGWNIVVENKPGAGGNLALDATARAKPDGRTLVMAQTDNIVLNPWLYK
FT                   KLSYDTFKDFKPVGLVASSPSVFVVLPDSPFKTVDDVVQAAKSKPGQVSLGIPGIGGSG
FT                   DLIGHLWRKAAGMELMHVPYRGWSQAFPDLMSGRIDIYTGSVASLLPQIRSGKVRALAV
FT                   VADARAPALPDVPTFVESGFKTINQTIWWGLMAPGQTPDDVVATLNAAVNHALGRPELA
FT                   QKLQQAGYSVMKGSPQDLNRRHRIDHDVFGKVVQEAGIPRQ"
FT   CDS_pept        422675..423352
FT                   /transl_table=11
FT                   /locus_tag="Bpet0386"
FT                   /product="putative transferase"
FT                   /function="Demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40718"
FT                   /db_xref="GOA:A9HYC3"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYC3"
FT                   /protein_id="CAP40718.1"
FT                   /translation="MIGFAIHSRQRAVSAELVEQFRRIPVANVSDCMSRMAAGGARLRP
FT                   MHDGTLMAGPALTVRCRPGDNLLVHKALDLAAPGDVIVVDAGGDLTNAIIGEIMTSYAA
FT                   TRGIAGIVINGAIRDSGAIRRNAFPVYAAGVTHRGPYKDGPGEINRTVALDGMTIEPGD
FT                   LILGDEDGLLCVPYDQAQELYQQAAAKHAAEEQTLAQIAAGKLDTSWVDARLRAQGCDP
FT                   AAA"
FT   CDS_pept        complement(423357..424019)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0387"
FT                   /product="transcriptional regulator, GntR-family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40719"
FT                   /db_xref="GOA:A9HYC4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYC4"
FT                   /protein_id="CAP40719.1"
FT                   /translation="MASARDLVYAELRRRLMSGAFLPGERLREEHIASELAVSRTPVRS
FT                   AIERLVEDGLVAREGRRGAVAMGWLDRDINEAFDLRLLLEPYAARAAASRASADQIDEL
FT                   EQINEHMLRAVQSGDPDHVAQVQHYNNRFHHALLAAAQSARVRSLVENLLDMPIIIGSF
FT                   YFYSRDDMLRSVEQHRQIIAALRARDPDFAETAMRFHLSATRRLFRDQRKPAPETRA"
FT   CDS_pept        424412..425230
FT                   /transl_table=11
FT                   /gene="gdH"
FT                   /locus_tag="Bpet0388"
FT                   /product="glucose 1-dehydrogenase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40720"
FT                   /db_xref="GOA:A9HYC7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYC7"
FT                   /protein_id="CAP40720.1"
FT                   /translation="MRHVADLSGRVAVVTGANSGIGRGVALELAAAGARVVVNHRPEED
FT                   SRRRAAEVVDAIAQAGGAAVAAAADISREDDVEQLFRVARDHFQGVDILVNNAGIEQPA
FT                   AIQDMTLAQWQRVIDVNLTGQFLCSRAAVRAFLGRQPKPPPDAAAGKIIFISSVHEVIP
FT                   WAFQANYAASKGGVSLLMQSLAQELAPMKIRVNSVAPGAIRTPINAPAWNTPESLAALL
FT                   KLIPYGRIGEPEDVARAVAWLASDDSDYVTGSTLFVDGGMTLYPAFRGAG"
FT   CDS_pept        425236..427056
FT                   /transl_table=11
FT                   /locus_tag="Bpet0389"
FT                   /product="putative Glucoamylase"
FT                   /function="Glucoamylase and related glycosyl hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40721"
FT                   /db_xref="GOA:A9HYC8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYC8"
FT                   /protein_id="CAP40721.1"
FT                   /translation="MSKPIEDYGLIGNMLSAALVARDGSIDWLCLPHFDSPACFAALLG
FT                   DESHGRWLLAPGQPGAQTTRRYLPDTAVLETRHTTATGAVRVYDFMPLSDSDERADVVR
FT                   IVRGESGSVEMQMELTLRFNYGQAVPWVRRRDYGLSAIAGPDAVELHTAVPLEGRDMKS
FT                   VACFTVQEGQTVPFTLSYHRSHRTPHFVPDRMESMDRTIAWWQEWAKRCRWENGSAMRR
FT                   DAVVRSLITLKLLTFQPTGGIVAAPTTSLPEQLGGSRNWDYRHCWLRDSALTLYALLNA
FT                   GYREEAEAWRQWLLRAAAGHPSQIQIMYGIAGERWLPEHEIGWLPGYEGSAPVRIGNGA
FT                   AGQMQLDVYGELVETLHAGRMADLAPLAEAWRMQKVLLKPLEQLWNQPDHGIWEMRGAR
FT                   RAFTHSRLMCWVALDRTIKSCERFGLEGPVECWRKLSETIRRDICTHGYDAHRNTFVQY
FT                   YGGTALDASLLLIPQVGFLPPGDARVAGTIAAIERDLLRDGLLLRYSTEHSDDGLPGDE
FT                   GVFLACSFWLADAYIMQGRIDDAERLFEHLLALRNDLGLLAEEYDVVRKRLVGNFPQGF
FT                   SHIGLVNTAYNLSAAGGPANQRSSSDAPRE"
FT   CDS_pept        complement(427073..428056)
FT                   /transl_table=11
FT                   /gene="bug10"
FT                   /locus_tag="Bpet0390"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40722"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYD1"
FT                   /protein_id="CAP40722.1"
FT                   /translation="MLALPYLLRRPAAAFAVACLAAAPLAATAAGDFPTRAITMVVPYP
FT                   PGGPTDTVSRLVAAEMSKTIGQNVVVENKPGASGMIGADLVARADPDGYTFLANASLHV
FT                   INPYLYKSMRYDAFKDFAPITQLADVPLVLVVPESSSVHTVQDLVKLGKTRPLNFGSAG
FT                   TASAQQLAGESFKVRSGLAMQHVPYKGSAPALTDLVGGQIQLMFDSMPSAMPFIKSGKL
FT                   RAVAVTTTRRVDELPDVPTMVEAGYPGFDISTWYGLWAPAGTPPEIVAKLSQHAARALQ
FT                   QPDLVRQYASLGAKPVGSDPQTFARFTETEGKKWRDIVDAAQIQPQ"
FT   CDS_pept        complement(428068..429072)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0391"
FT                   /product="Zinc-binding dehydrogenase family protein"
FT                   /function="NADPH:quinone reductase and related Zn-
FT                   dependent oxidoreductases"
FT                   /EC_number="1.6.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40723"
FT                   /db_xref="GOA:A9HYD2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYD2"
FT                   /protein_id="CAP40723.1"
FT                   /translation="MMRALLCERHGPVQDVTLRDIDDAPAPGPHEVTIGIDHASVSHAT
FT                   RLLIEGSYQSRPPLPFVPGTEAVGRVLARGSAVTRLAVGDRVVAVSRWGCYAQRLTLPE
FT                   YTVYPLPDGVEPLAALPVPISYGTAYTALLWRAALQPGDTVLVLGAGSGVGLAAVEIAA
FT                   LLGATVIACASTAAKRQAALDAGAAHALAADDDLAAQVKSRTGGLGADIVFDAVGGAAF
FT                   ERSVRAAAANARMLSIGFASGQVPAVPLNLLLVKNIALHGFFYGRYLGWTPADERIAHA
FT                   PALQRAMRTLLDWTRDGRIRPAVTAVYPAADLAAALAALETRRVIGKVALKIE"
FT   CDS_pept        complement(429069..430472)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0392"
FT                   /product="Predicted acyl-CoA transferase/carnitine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40725"
FT                   /db_xref="GOA:A9HYD6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYD6"
FT                   /protein_id="CAP40725.1"
FT                   /translation="MFDRVMPQRCAAALRLRDSTMATNSRTRFRSGRLSNIVHHSRHKS
FT                   IHCRTGRGCLPSVDTPTFLLQPMSASPSAIPSLPFAGLRVLDISQGIAGPYCAQILWQQ
FT                   GADVVKVEPPDGDWGRHVGVVRGAHSALSIAYNAGKRGLCLDARAPRGKALLGQLARRA
FT                   DVVIQNFRPGVAARIGVDYAELAAERPGLVYVSISGYGPTGPYANAPASDSVMQADSGL
FT                   MAANQSPDGEPRRIGLLMADIATALYAAQAVSAALYRQARGGGGSHVELSLFQACAALQ
FT                   VNDIVAHGMAGERVAGPVSAPNGVFDTADGRLSVLALNNDQFARLCRALDRPQWLADPA
FT                   YADNASRMARRDALHAELAAQLRQHPTDYWTERLAREDVLHARVRNYDDLAAHPQARHV
FT                   GLLEPLAQAGGAPLPYSRLPGVAHPRPLTAAPGIGEHSTQVLADWGVPAADIDALLRAG
FT                   VVRQAEQPA"
FT   CDS_pept        430363..431304
FT                   /transl_table=11
FT                   /locus_tag="Bpet0393"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40724"
FT                   /db_xref="GOA:A9HYD5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYD5"
FT                   /protein_id="CAP40724.1"
FT                   /translation="MFDNLPDLNLVRLFVAMVESRNLSAAAQRCGMTRSNMSHRLKRLE
FT                   LALGAQLLRRTTRHVELTQAGRLLYQHGVRLLDEMRAAQSNIDSLGGTVRGDVRVRLPT
FT                   GLGHLYLAPVLLEFTRRYPDIALRVHINDNIGDLVSAEVDLALKITSAPPEDHVARRLC
FT                   AIQWSLCAAPEFLLDGRPVQTLEQLGRCSMIAPQSLGRRFDLRLKHAHGDPLILRVAPR
FT                   LQSGDYPFLREAVLAGLGVALLPRYAVWTQLRDGQLREVLPEFEPEGVGNAIYLLTAPN
FT                   RFPSMATRALAGFVQEHIERRHRDWLRPAPSA"
FT   CDS_pept        complement(431323..431835)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0394"
FT                   /product="putative outer membrane lipoprotein"
FT                   /function="Bacterial lipocalin"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40726"
FT                   /db_xref="GOA:A9HYD8"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYD8"
FT                   /protein_id="CAP40726.1"
FT                   /translation="MPRHFVCTLLAALGLAGLAHAAPPPKAVAIDPQRYAGKWYEIARL
FT                   PTPLQRRCVGDVTVEYTVAPQSALHIDNRCRTKHGDVAAMSGLAVPREQAAGAQYRAEF
FT                   LQPTPDYWIIGLDSEYRWAVVGSPDRKTLWILSRTPQLPASLLEQARQAARAQGYRLDE
FT                   LRYTPQR"
FT   CDS_pept        complement(431953..433536)
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="Bpet0395"
FT                   /product="glutamate--cysteine ligase"
FT                   /function="Gamma-glutamylcysteine synthetase"
FT                   /EC_number="6.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40727"
FT                   /db_xref="GOA:A9HYE0"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9HYE0"
FT                   /protein_id="CAP40727.1"
FT                   /translation="MTVTDTAASRLSRLKAHADLLAQSLRGIEKEGLRVDAQGKLAVTP
FT                   HPSGLGSALTNEHVTTDYSEALLELITGTHGRVEPLLAELENTHRFVYSVLDGEYIWNQ
FT                   SMPATLPPEADIPIAWYGRSNTGMLKHVYRRGLAERYGKAMQCIAGVHYNFSLPDALWE
FT                   ILDPGAADPQTRRSRGYIGLIRNFTRYSWLLMYLFGAAPALSRSFMGDRPHPLQALDAD
FT                   TLYLPHATSLRMSDLGYQNNKAQAQLKLCYNDLDTFLARLYGAVTQPWPEYQAIGTHRD
FT                   GQWIQLNTNVLQIENEYYSSIRPKRATGRCERPVTALAERGVQYVEVRCLDIDPQQPVG
FT                   IAADTARFVDAFLLFCAVSDSPYFPQNGYCQRSADNFSVVVKEGRKPGLMLDRDGVAIS
FT                   LPDWGRELLDHIAPYAALYDQALGGDAYARALQAQHAKLGHADDTPSARLLAELRDQGV
FT                   PFHEYSLQLSRRHADALRAQPLPADVAAGYAEAARQSHAEQARLEQSDDVDFDTYVARY
FT                   QAALKAPGSR"
FT   CDS_pept        433672..434232
FT                   /transl_table=11
FT                   /locus_tag="Bpet0396"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40728"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYE2"
FT                   /protein_id="CAP40728.1"
FT                   /translation="MPTGDRNIMISKLFRLLSARLPHVLGAALLLAACTPSYNWREIEV
FT                   ADGHARAAFPDRVHTQARDISLGGHTLRFTLAMSEVDGAMFAVGHAPLPPALAADPAGR
FT                   DALGRALMQSLYANLGVQPAQVLPAYGDEIEVHGQAGHKPGWLLARVWVTDTMLIDAVA
FT                   AGTPDSLPKERAQEFVRAVKLNR"
FT   CDS_pept        complement(434222..434437)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0397"
FT                   /product="transcriptional regulator, LuxR-family"
FT                   /function="DNA-binding HTH domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40729"
FT                   /db_xref="GOA:A9HYE4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYE4"
FT                   /protein_id="CAP40729.1"
FT                   /translation="MPAKPLSNREHECLHWSAMGKTSWEIAVILGVSERTVNFHIGNAC
FT                   SKLGVYNRRAAVAIALSQGLLPALNG"
FT   CDS_pept        complement(434589..435545)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0398"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40730"
FT                   /db_xref="GOA:A9HYE5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYE5"
FT                   /protein_id="CAP40730.1"
FT                   /translation="MLFMVPRALTKVKLLIIFSRPSFSYICAMSSIRQFRTALAAARLG
FT                   SFVAAGRHVGLTQAAVSLQIKNLESELHTQLFERRAQAAVPTPQGRRMLAELEELVARY
FT                   EQLQAQSGDTLRGSLRIGTLVSSLMGTFGTVLARVKHDYPDLHITLLAGQSADFAARVA
FT                   AGELDAAVVTEPPHGVEPALVWAPLYQEPLVLIAAARLRHKSVASLLATEPFLQFDRSL
FT                   WTGHLITEALSRHGAAPNTILELNSIEAIAELVRQDYGVAVVPLLANANWRASKQLAVK
FT                   PLPGPAIMRRVGMLERRRHGKQAITQTLRGVFAQAAP"
FT   CDS_pept        435567..436364
FT                   /transl_table=11
FT                   /gene="frdB"
FT                   /locus_tag="Bpet0399"
FT                   /product="fumarate reductase iron-sulfur protein"
FT                   /function="Succinate dehydrogenase/fumarate reductase, Fe-
FT                   S protein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40731"
FT                   /db_xref="GOA:A9HYE8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYE8"
FT                   /protein_id="CAP40731.1"
FT                   /translation="MPRQDPTSGVLQVSVWRGGADGGFQVFEVPRRDNQTVLDVATHIQ
FT                   RHLDSTLSYRYACRVGMCGSCAMTVNGVARWTCRTHVSRVARNGRIELAPLSNLPIVKD
FT                   LVTDMAPFFDKWQRAQGRYTGPAGRHDPVARVDPSSPRRRAADAGIECIGCGVCYASCD
FT                   VVSWKPQFLGPAALNRAWTLVNDERDTGGARRLAAVAGDAGCHSCHTQGSCTVRCPKGI
FT                   APTAAIAGLKRMAARAALRGELPEADEAEGPAAHADGLTGVAP"
FT   CDS_pept        436361..436702
FT                   /transl_table=11
FT                   /locus_tag="Bpet0400"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40732"
FT                   /db_xref="GOA:A9HYE9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYE9"
FT                   /protein_id="CAP40732.1"
FT                   /translation="MSAAGAARRWYWQRVSAMAMALFVLAHLVIITLAVRGGLSAAEIL
FT                   GRTRGSLAWMTFYGIFVALVALHAAIGLRNVLDEWAPARKAAGPLAMAAGVLLLALGWR
FT                   AVAAVTFGG"
FT   CDS_pept        436704..437057
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="Bpet0401"
FT                   /product="succinate dehydrogenase cytochrome b-556 subunit"
FT                   /function="Succinate dehydrogenase/fumarate reductase
FT                   cytochrome b subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40733"
FT                   /db_xref="GOA:A9HYF2"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039023"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYF2"
FT                   /protein_id="CAP40733.1"
FT                   /translation="MRRNDRRARTHASWLAFAAHRISGLLLLAFLPVHFWTLGLALQGE
FT                   AALDGALRWYEAPVFKFGEWALVLCLAVHLAGGLRLLWIEFAPWGGLRRGWIAAGTAAS
FT                   LAVSLLFVANMLG"
FT   CDS_pept        437061..437939
FT                   /transl_table=11
FT                   /gene="ttdA"
FT                   /locus_tag="Bpet0402"
FT                   /product="fumarate hydratase alpha subunit"
FT                   /function="Tartrate dehydratase alpha subunit/Fumarate
FT                   hydratase class I N-terminal domain"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40734"
FT                   /db_xref="GOA:A9HYF3"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYF3"
FT                   /protein_id="CAP40734.1"
FT                   /translation="MSEIDYAQVEDAARELYIRALKRLPDDIKQGFERLRGAESSDRAR
FT                   SILDTMTTNIAVAEAHDNLLCQDTGIPIYNVLVGRRVALDGWRLKQAIRAGCERATREH
FT                   PLRSSVVHPISRKNAHTSCGPGVPVIHVDFCEDDERFEIEMIPKGSGSENNSFLRMAIP
FT                   AEGLDAVKTFVIDCVMQAGGKTCPPTIVGVGVGGTSDLCVHLAKQAATRPLGSRCDDPL
FT                   GAQLEQELSAAVNQLGVGPQGLGGDATAFAVHVELAATHITMNPVAVNMQCHSARRARA
FT                   TLTPNGVQYGF"
FT   CDS_pept        437960..438571
FT                   /transl_table=11
FT                   /gene="ttdB"
FT                   /locus_tag="Bpet0403"
FT                   /product="L-tartrate dehydratase, subunit B"
FT                   /function="Tartrate dehydratase beta subunit/Fumarate
FT                   hydratase class I C-terminal domain"
FT                   /EC_number="4.2.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40735"
FT                   /db_xref="GOA:A9HYF7"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYF7"
FT                   /protein_id="CAP40735.1"
FT                   /translation="MTHHNLDMPITETQARALRVGDTVTLQHTLFGIRDASYIALFDQG
FT                   RATRFDMNGHAVIHTAPNVRKVAVSARNPAGYESVCIGTTTSARMERFTGQLMRQCGVR
FT                   LIVGKGGMQQGSRQAFMEQGGAYLAIVGGTAALETTWIESIEDVDLDDLNPESLWKFRI
FT                   RDFGPLLVAMDSHGGSLYDQVAEDVAARRQAVLASLGVAR"
FT   CDS_pept        438568..440301
FT                   /transl_table=11
FT                   /locus_tag="Bpet0404"
FT                   /product="putative succinate dehydrogenase flavoprotein
FT                   subunit"
FT                   /function="Succinate dehydrogenase/fumarate reductase
FT                   flavoprotein subunits"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40736"
FT                   /db_xref="GOA:A9HYG0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYG0"
FT                   /protein_id="CAP40736.1"
FT                   /translation="MSTNDLQQRQTDVLILGSGGAGLFAALHAHDAAPGLDITVAVKGL
FT                   LGKCGCTRMVQGGYNVALAEGDSPERHFMDTIEGGKWLPDQELAWTLVNTAVERVHELE
FT                   NELGCFFDRNADGTLHQKAFAGQTFDRTVHKGDLTGIEIINRLAEQVWARRIHRMEEHR
FT                   AVALVPARDGRRIAGVLMIDIRTGGFVLVRAKAVLLATGGGPTMYRFHTPSGDKSCDGL
FT                   SMALHAGLGLRDMEMVQFHPTGLLAGADTRMTGTVLEEGLRGAGGYLLNGAGERFMQAV
FT                   DPRGERATRDIVSRGIYAEMRAGRTSPNGGVYIEMAHLGPDKVRRQFKGMVERCADCGF
FT                   DLAGGRVEVVPTAHYMMGGVVFQPDCRTALEGLYAAGEDTGGVHGANRLGGNGVANSTV
FT                   FGGIAGDAMARWTPGQDWAEPDPAALQAALARAQAPLARRGGDLNALRERLSSVMWDDA
FT                   GIVRDAAGLNRALAALRELRGELDRIGVTEATRAYNMAWHDWLNLDSLVHVSEAIVRAA
FT                   LAREDSRGAHFRADFPEVRDLEHSWFSVVAQQDGVMQVSRRPVEFTRVQPGQTLLQQAA
FT                   A"
FT   CDS_pept        440340..441338
FT                   /transl_table=11
FT                   /gene="bug11"
FT                   /locus_tag="Bpet0405"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40737"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYG3"
FT                   /protein_id="CAP40737.1"
FT                   /translation="MAIRATLWRLLVAAAWLAGSMALAGSGAAQPYPERAVTLVTPFSV
FT                   GGDADLAARNLAAAAQRYLGQPLVVLNRAGANGAIGSQYVKEAAPDGYTLLMARVGSQA
FT                   ILPALQQSLSYRWDDFTFLGLLELNPYVCAVPKSSPYRSLADLAAAIKAKPGVLNYANS
FT                   GPATVLNLGPQLLFSVLGLPPTAAMPITYKGSGDAVVATLSEQVDFVCTNYAPIAGPLN
FT                   DGRLRALVTTTPARLPTLPDVPTAREAGFPQLEVITGWSALYGPPGMDPAAARKWAEVL
FT                   RGVSSDRGWNDGTRQLGSVPDVRSAAATREFVQAQVQAYQKLGRATGISLK"
FT   CDS_pept        441406..443019
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="Bpet0406"
FT                   /product="acetolactate synthase large subunit"
FT                   /function="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase pyruvate dehydrogenase (cytochrome)
FT                   glyoxylate carboligase phosphonopyruvate decarboxylase]"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40738"
FT                   /db_xref="GOA:A9HYG5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYG5"
FT                   /protein_id="CAP40738.1"
FT                   /translation="MAVSARGADSLARSIKAAGINRLFTLSGNHIMPVFDAALSAGIEL
FT                   VHVRHEASAVHMADAWARLTGEPGVALVTGGPGHANAVSALYTAQMSESPVVLLSGHAP
FT                   NRQAGWGAFQEMDQAAMAAPVTKASWAAGSAAGLAADFVRACRVARSGRPGPVHLSLPI
FT                   DALEQPADGPLPAARDYAQLPMPLDGGQAAALAARLARAERPLVLVGPRGLTDAGRVRV
FT                   AALRQAWGLPVVATESPRGANDPALGAFAPVLARADCVLLVGKRLDFTLQFGQAFDSAC
FT                   VFMQIDADEREWARTRRAVGERLHDTLLADTHAALDGLAQLVVRGQPDWLAEVEAALAY
FT                   RPPAWNDARGTDAGLHPAELCRAVQQVLDSHPDSVLVCDGGEFGQWAQACLRAPHRVIN
FT                   GAAGAIGSALPMALAGRLAHRGAPVVAMMGDGTFGFHCAELDTAVRYGLPFICVVGNDA
FT                   RWNAEYQIQLNNYGAERLVGCELLPTRYDRVAEGFGAHGAWVAKAGELAPALQAAVRAT
FT                   LPTCVNVSLAGLPAPVVRQH"
FT   CDS_pept        443035..443778
FT                   /transl_table=11
FT                   /locus_tag="Bpet0407"
FT                   /product="hypothetical protein"
FT                   /function="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40739"
FT                   /db_xref="GOA:A9HYG8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYG8"
FT                   /protein_id="CAP40739.1"
FT                   /translation="METWLLLALGACVAAFVQGLAGFGFGLVSMAFWSWTLPPVLAAPA
FT                   VVFGSLIGQLLAVRSLRHGIDWRRLTPFLLGGLAGVPVGVALLRYVDPAAFRLGVGVVL
FT                   LVYCPAMLLAAELPRIKHGGRVADAAVGWLGGAMGGFGGLPGPATTLWCVLRGWPRDQQ
FT                   RAVFQSFNLAMHAITFAGYAAAGVLTAQTVPVFAIVGAAVLGPTLAGVHLYRRFSDATF
FT                   RRLVLGLLTVSGVALVVAGARGFWS"
FT   CDS_pept        complement(443775..444782)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0408"
FT                   /product="probable malate/L-lactate dehydrogenase"
FT                   /function="Malate/L-lactate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40740"
FT                   /db_xref="GOA:A9HYH1"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYH1"
FT                   /protein_id="CAP40740.1"
FT                   /translation="MATVDLKSLHELAAAALRGAGANPDMADSTAHALVYADSQGLASH
FT                   GVSRVPSYAAHVRNGRALGNAVPRIARERGGAVLVDAGAGLAFPACALAVRETATRARS
FT                   HGVAFAGVTNSHHFGVAAYHLDGLARQGLVGLALGNSPAAMPAWGGKRALFGTNPIAAA
FT                   FPRRDGDPLVIDLSLSEVARGKLMVAAREGREIPPGWALDAQGNPTTDPKAGLAGSMLP
FT                   MGGVKGAMLALIVELLACALTGAHFGFEADSFFTEAGNQARIGQAFLAIDPDALAGRDV
FT                   YLERVETLIAAMLVDSDVRLPGARRAALQRRAGEEGVEIPDALLAQLRDLAGQA"
FT   CDS_pept        complement(444974..445897)
FT                   /transl_table=11
FT                   /gene="serA2"
FT                   /locus_tag="Bpet0409"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /function="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40741"
FT                   /db_xref="GOA:A9HYH3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYH3"
FT                   /protein_id="CAP40741.1"
FT                   /translation="MHIVISEFMDEAAVAALRADFDVRYEPDLVDRRDALLAALPQADA
FT                   LIVRNRTRVDAALLAAGPQLKAVGRLGVGLDNIDVPACEARGIAVLPATGANARAVAEY
FT                   VIAAALMLLRGAYLSSAQVAAGAWPRTDLSNGLEAEARTLGIVGFGGIGRLTARLAQGL
FT                   GMRVAAHDPLLRDDDPAWRDTGVQALPLDALLACADVLTLHIPLTDATRNLMDAARLAA
FT                   MKPGAVLVNTARGGILDEAALAAALRSGQLRGAAIDVFQDEPLPAGSPLADAPNLVLTP
FT                   HIAGLTQEANTRVSSMVAQRVAQALK"
FT   CDS_pept        complement(445960..446967)
FT                   /transl_table=11
FT                   /gene="bug12"
FT                   /locus_tag="Bpet0410"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40742"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYH6"
FT                   /protein_id="CAP40742.1"
FT                   /translation="MRNDRHACPDAQRRKTLGLLGAGALALAPLTRGLAATQGWPQRPI
FT                   SYIVPFSPGGLTDVAARQVSQALATGEGWNVVVENKPGGSANIGASLVARANADGYSWL
FT                   AITMTHAANATLFAGKAGYDLKKDLVPLAGLASSAMMVVVNAKSPIRSLAELTAAAKAK
FT                   SLSAGSSGNGTPPHLTLALYQKLTGTSLLHVPYKGGAPSLTDLIGGQLDVIFSNYPESL
FT                   PHVKSGALRALAISTKERSPDLPDVPTVGEAGLPDLIVENFTGVLGPAGMPDELVLRIG
FT                   GAIEKQVSQPAMQQSLQRLGFIPRPRGPVAFKQYLDSEVDRWGKIIREAKIQVG"
FT   CDS_pept        complement(447014..447895)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0411"
FT                   /product="ABC transporter permease protein"
FT                   /function="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40743"
FT                   /db_xref="GOA:A9HYH8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYH8"
FT                   /protein_id="CAP40743.1"
FT                   /translation="MADLDVNPAAGRAERYLEPVADEAFGVVQKPLSAWERLYNIGALR
FT                   KLFLLALLALAWELYARSINNPLLFPTFGATVGALYDGLVHGTLLLKAWTSIRVLLVGY
FT                   AAGISLAALLTVLAITTRLGTDLLETLTSMFNPLPAIALLPLALIWFGLGEGSVVFVLI
FT                   HSVLWAVALNTHSGFLSVSMTLRMVGRNYGLSGFGYVRRILIPAAFPSILTGLKIGWAF
FT                   AWRTLIAAELVFGVSSGSGGLGWFIYENKNLLEIPNVFAGLFTVILIGLLVENVIFRTV
FT                   EIHTIRKWGMQH"
FT   CDS_pept        complement(447888..448685)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0412"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40744"
FT                   /db_xref="GOA:A9HYI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYI1"
FT                   /protein_id="CAP40744.1"
FT                   /translation="MTDARTAAPLLDVRGVTLQYKTPEYLITATYRVDFQVLQGDRFIL
FT                   LGPSGCGKSTLLKAVGGYLPPVEGEIRLKSEVVTRPGPDRMMVFQEFDQLLPWKTVRQN
FT                   VAFALVASGRLGAREADERAMHYIEKVNLAKFADNYPHMLSGGMKQRVAIARGMAMEPD
FT                   ILLMDEPFAALDALTRRKMQDELLQLWDDTHFTVLFVTHSIPEAIKIGNRILLLSPHPG
FT                   QVKAEINSVPRGEHDAARHQELEDKINAMLFSDRIEEEGQHHG"
FT   CDS_pept        complement(448743..449756)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0413"
FT                   /product="putative periplasmic subtsrate-binding protein"
FT                   /function="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40745"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYI4"
FT                   /protein_id="CAP40745.1"
FT                   /translation="MKRFTRIASAACLSAGMLLGATAHAEVSELTVAVQPGISYLSLMV
FT                   MQDEKLIEKHAKAAGIDDLTVKWSRFAGGNVMNEAVLSGSLHFASGGVGPLVTMWARTR
FT                   GNLNVKAVSAINAMPLYLNSRDPNVKSIKDLTDKDRIALPAVRVSIQAVTLQMAAEQAF
FT                   GEGQQNRLDKLTVSLSHPDGMTALLSGSSEITAHFTSPPFQDFELKQPGIHRILSSYEV
FT                   LGGPATFNLVWTTEKFHKENPKVYAAFVAALQEATDKINKDKTWAAKAYLRLANDQRTK
FT                   LEDVVEILNNPDISYTLTPNNIMKYVNFMHKVGSIKVMPDSWKDLFFPNAQTLQGS"
FT   CDS_pept        complement(449915..451090)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0414"
FT                   /product="Altronate hydrolase"
FT                   /function="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40746"
FT                   /db_xref="GOA:A9HYI6"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYI6"
FT                   /protein_id="CAP40746.1"
FT                   /translation="MAIVNASTTFRGYRRDNGRVGVRNHVIVLPVDDISNAAAEAVANN
FT                   IKGTLALPHPYGRLQFGEDLELHFRTLIGTGSNPNVAAVIVIGIEEGWTKRVVDGIAAT
FT                   GKPVAGFSIELHGDHDTIMRASRQAKEFVHYATGLQRTECLISDLWVSTKCGESDTTSG
FT                   CGANPTVGNAFDKLYALGSTLVFGETTELTGGEHIVAERCANDAVRERFMFMFNRYQEV
FT                   IDRWKTSDLSESQPTKGNIAGGLTTIEEKALGNIQKIGKKCRIDGVLDKAEVPTGKGLW
FT                   FMDSSSAAAEMVTLCAASGYAVHFFPTGQGNVIGNPILPVIKICANPRTVRTMSEHIDV
FT                   DTSGLLQREIDLDQAGDKLLECMLATANGRWTSAEALGHREFVLTRLYESA"
FT   CDS_pept        complement(451134..451415)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0415"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40747"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYI9"
FT                   /protein_id="CAP40747.1"
FT                   /translation="MIHAVLHDAKDTVAVAVVEGLKAGTELNAWIMDEDKIIHLKALQD
FT                   IPIGHKVALKDMAVGDTVFKYGTDIGKVVEPIKAGQHAHVHNIKTKRW"
FT   CDS_pept        451517..452344
FT                   /transl_table=11
FT                   /locus_tag="Bpet0416"
FT                   /product="transcriptional regulator, GntR-family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40748"
FT                   /db_xref="GOA:A9HYJ2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9HYJ2"
FT                   /protein_id="CAP40748.1"
FT                   /translation="MSCMIMPAAHRAATIRPPQSGYAMKNTSTTTVPLGSPLYAQVKQA
FT                   VLAALARGEWKQGEAVPPEKTLAERFGVSIGTLRKAIDELAAENILVRHQGRGTYVAVH
FT                   TRNNHFFKFFRILRQDGHKSYPSTELLRFRRARANAATREHLGLATGAYVYEFTNVLSL
FT                   NGDVVMVDDICLPESRFPGMAEQHLRERPSTLYALYQDVFGVNVIATDERLRVCLADAA
FT                   HAGWLDVAEGAPLLEIRRVAYSYNRQPVEWRISRVNTEAYEYLGQEPGAAVTS"
FT   CDS_pept        452516..453790
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="Bpet0417"
FT                   /product="homoserine O-acetyltransferase"
FT                   /function="Homoserine acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40749"
FT                   /db_xref="GOA:A9I0E6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I0E6"
FT                   /protein_id="CAP40749.1"
FT                   /translation="MTTPVPVPNGGPAPAAVPAAAEPGSVGIVTPQLIRFDTPLPLASG
FT                   QSLQSYELAVETYGTLNAGRTNAVLVCHALNASHHVAGLAADDPNDVGWWDNMVGPGKP
FT                   LDTNRFFVIGVNNLGSCFGSTGPASINPATGHPWGAAFPVLTVEDWVHAQARLADHFGI
FT                   ERFAAVMGGSLGGMQALSWAITCPERVAHCIVIASTPRLSAQNIGFNEVARRAIITDPD
FT                   FHGGDYYAHNTVPRRGLSVARMIGHITYLSDDDMAEKFGRTQREPAEGGAYRYGYDVEF
FT                   EVESYLRYQGEKFSRYFDANTYLLITRALDYFDPARGTGGDLARALKPAQADFLLVSFS
FT                   TDWRFPPERSREIVRALLKNGSPVTYAEIDAPHGHDAFLLDDARYHAVVRGYYERIARE
FT                   LGLDEPAAGAAPAAAEPACAEGCAA"
FT   CDS_pept        453787..454404
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="Bpet0418"
FT                   /product="Methionine biosynthesis protein MetW"
FT                   /function="SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40750"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0F0"
FT                   /protein_id="CAP40750.1"
FT                   /translation="MNPVTARAGRTAGMRPDLVRIASWIEPGSRALDLGCGDGALLAYL
FT                   RDQRQVRGAGVEIDDNHVIACVGRGVEVIQQNLEDGLALFDDKQFDTVVLSQTLQSMHR
FT                   TEHILREMARVARYGIVSFPNFGYWPHGWSILRGRMPVTGQMPYQWYNTPNIHLCTLRD
FT                   FERLAQDLGLRILERATFHEGREITVLPGWRSTLAVYRYAAD"
FT   CDS_pept        454432..455718
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="Bpet0419"
FT                   /product="AmpG protein"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40751"
FT                   /db_xref="GOA:A9I0F4"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0F4"
FT                   /protein_id="CAP40751.1"
FT                   /translation="MPCPAPRRLCCQELLISAASHVYFSRRVAPLLVLGFASGLPLALT
FT                   GGTLQAWATVDGVSLEEIGFLTLVGTAYTLKFLWAPLVDRYVPPLLGRRRGWMLVTQVL
FT                   LAASIMLMGTLSPASALLPLALLAVAVAFFSATQDIAFDAYCTDVLHREERGAGAAIKV
FT                   LGYRLAMIVSGGLALILADQWLGWGATYVLMGGLMLACALATLWAPEPERPAAAPRNLG
FT                   LAVVEPFREFFSRRGAYTVLALIVLYKLGDAFAGALSTTFLIRGAGFDPTEVGTVNKVL
FT                   GLAATIVGALAGGSLMARWGLYRSLMAFGVLQAISNLGYWVIAVSPKNIWLMAAAVGIE
FT                   NLCGGLGTASFVALLMALCQQRFSATQFALLSALSAVGRTYLAGPLTPPLVHWLGWPGF
FT                   FMLTVAIAVPGLLLLWSQRRTIDALEPQA"
FT   CDS_pept        455742..456380
FT                   /transl_table=11
FT                   /locus_tag="Bpet0420"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40752"
FT                   /db_xref="GOA:A9I0F7"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0F7"
FT                   /protein_id="CAP40752.1"
FT                   /translation="MHAETSTLLLHALYLVAIVAEAMTAALAAGRRDMDWMGVCIIACV
FT                   TALGGGSLRDVLLGHYPLTWVVHPEYLGMTAGAALLTALGAPLMRRLRSLFLLLDAVGL
FT                   VAFTIIGCKVAQQMELPVSIALISGMITGCAGGVLRDVLCNDVPLLFRKELYASVSIVT
FT                   GGLYMGLLAAGLSANAAVPAALAVGLAFRLLALRFNWQMPRFVYRDDWH"
FT   CDS_pept        complement(457020..458363)
FT                   /transl_table=11
FT                   /gene="gdhA1"
FT                   /locus_tag="Bpet0421"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /function="Glutamate dehydrogenase/leucine dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40753"
FT                   /db_xref="GOA:A9I0G0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0G0"
FT                   /protein_id="CAP40753.1"
FT                   /translation="MKLQSLDDFLRQVAARDPQQPEFMQAVHEVMSSLWPFLQQHPHYA
FT                   EYALLERLVEPERVIQFRVCWTDDQGNSRVNRAFRVQHSSAIGPFKGGMRFHPSVNLSV
FT                   LKFLAFEQTLKNALTTLPMGGGKGGSDFDPKGKSDAEVMRFCQALMLELHRHLGPDTDV
FT                   PAGDMGVGAREVGFMAGMMKKLSNSAASVFTGKGLTFGGSLIRPEATGYGTVYFAEEML
FT                   KREGLSFDGLRVSVSGSGNVAQYAIEKAMTLGARVVTVSDSDGTVIDEAGFTHEKLAAL
FT                   MHLKNDLRGRLAEYAGQFKLTYAAGKRPWHVPVDVALPCATQNELEIDDARTLIANGVK
FT                   CVAEGANMPSTLEAAKTFIEAGVLYAPGKASNAGGVAVSGLEMSQNAIRLAWTRDEVDQ
FT                   RLHAIMRDIHESCVRHGQGRGNTVNYLDGANIAGFVKVADAMRQQGLY"
FT   CDS_pept        complement(458794..459582)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0422"
FT                   /product="putative endonuclease"
FT                   /function="Exonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40754"
FT                   /db_xref="GOA:A9I0G4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0G4"
FT                   /protein_id="CAP40754.1"
FT                   /translation="MLRITSINLNGIRSAFRKGLQPWMQTHSADVLCLQEIKISDADLT
FT                   DDLRHPPGYTGHFCHAIKKGYSGVGMYLRNTAERVQAGLNCEEFDAEGRIIRADWKNLS
FT                   VISAYLPSGSSGDERQQAKYRFLDVFGPWLDELMREHKKTGREFVICGDWNIAHKEIDL
FT                   KNWKSNQKNSGFLPEERAWLTEVFDKRGFVDVFRRLDERPEQYTWWSNRGQAWAKNVGW
FT                   RIDYQIATPGLAARARSASIYKDERFSDHAPLTIDYDTAL"
FT   CDS_pept        459736..460413
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="Bpet0423"
FT                   /function="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40755"
FT                   /db_xref="GOA:A9I0G7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I0G7"
FT                   /protein_id="CAP40755.1"
FT                   /translation="MAAASATSTDFVRFALDEGVLRFGSFKVKSGRTSPYFFNAGLFNS
FT                   GASVGRLAQFYAQALVDSGIAFDMLFGPAYKGIPLATATAVALAGHPAMQGRDVPFAFN
FT                   RKEAKDHGEGGTLVGAPLQGRVVIIDDVITAGTSVRESVEIIRAAGAEPAAVLIALDRQ
FT                   ERAGPDDALSPHSAVQDVAKTYGMPVVSIASLADILALLQGDAQFAGNREAVLAYRGKY
FT                   GVV"
FT   CDS_pept        complement(460661..462118)
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="Bpet0424"
FT                   /product="glutamyl-tRNA(GLN) amidotransferase subunit B"
FT                   /function="Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog)"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40756"
FT                   /db_xref="GOA:A9I0H0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I0H0"
FT                   /protein_id="CAP40756.1"
FT                   /translation="MNWEIVIGLETHTQLSTDAKIFSGSSTRFGAAPNTQANVIDLALP
FT                   GSLPVMNRGAAERAIRFGLAVGGKVAPRSVFARKNYFYPDLPKGYQISQYELPVVLGGS
FT                   LSFFVGEQEKTVNLTRAHLEEDAGKSLHDDFALASGAPASGIDLNRAGTPLLEIVTEPE
FT                   MRSAAEAVAYARALHSLVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRTEIKNVN
FT                   SFRFLERAILFEARRQIELIEDGGTVVQETRLYDADRDETRSMRSKEDAHDYRYFPDPD
FT                   LPPLVISPEWVEEVRANMPELPAALRERFQRDYGLSAYDAAQLSASRGLASYFEDVARA
FT                   LPAGQAKQAANWIMGEVTATLNREEKDIADAPVQAPALAALIGRIIDGTISNKIARDVF
FT                   SAMWAGEHGGQPDAIIEARGLKQISDTGAIGAMIDEVLAANPAIVAEYRAGKQKAFNSL
FT                   VGQIMKAAKGKANPQQVNELLKQKLEG"
FT   CDS_pept        complement(462115..463653)
FT                   /transl_table=11
FT                   /gene="gatA2"
FT                   /locus_tag="Bpet0425"
FT                   /product="glutamyl-tRNA(GLN) amidotransferase subunit A"
FT                   /function="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40757"
FT                   /db_xref="GOA:A9I0H5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I0H5"
FT                   /protein_id="CAP40757.1"
FT                   /translation="MTTSPLHTRFGGIAELRAALAGRQVSARELARSALDAAQAAGDLN
FT                   TFLHIDPDLTLAQADAADAALAAGTAGPLAGVPIAHKDAFVTRGWRTTAGSKMLEGYAS
FT                   PFDATVVQRLQAAGAVSLGKLNCDEFAMGSANENSAYGPVRNPWDPNAVPGGSSGGSAA
FT                   AVAARLVAAATGTDTGGSVRQPAALCGVSGIKPTYGTVSRYGIVAFGSSLDQAGPLAPS
FT                   SRDLLELLDPMSGFDPQDATSLETCDGAPNAPGRIRAAYDAAQAACDAAGSQPLKGLRI
FT                   GVPQEYFGAGLAPDVAAAVEAALAQFEALGAQRVAVSLPRTELAIPAYYVIAPAEASSN
FT                   LARYDGVRYGHRAAEYADLNQMIARSRAEGFGDEVKRRILIGTYVLSHGYYDAYYLQAQ
FT                   RVRRLIAQDFQRAYAGQCDVIMGPVAPTVAKNIGDNRDDPTADWLADVYTLGVSLAGLP
FT                   AMSIPAGFGNGGRPVGLQIIGNYFDEGRLLAIADRYQQVTDWHRRVPGQQGTEQ"
FT   CDS_pept        complement(463657..463965)
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="Bpet0426"
FT                   /product="glutamyl-tRNA(GLN) amidotransferase subunit C"
FT                   /function="Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40758"
FT                   /db_xref="GOA:A9I0H9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I0H9"
FT                   /protein_id="CAP40758.1"
FT                   /translation="MALNEQDVARIARLARIELTPDQRSRAQDELNGILHLIERLQAAD
FT                   TEGVEPLAHPLSAHQDIALRLRPDAVTETPSEDRRAELLANAPDARDGLFLVPKVIE"
FT   CDS_pept        464190..465233
FT                   /transl_table=11
FT                   /gene="mreB2"
FT                   /locus_tag="Bpet0427"
FT                   /product="rod shape-determining protein MreB"
FT                   /function="Actin-like ATPase involved in cell
FT                   morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40759"
FT                   /db_xref="GOA:A9I0I2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0I2"
FT                   /protein_id="CAP40759.1"
FT                   /translation="MFGFLRSYFSSDMAIDLGTANTLIYVRGKGIVLDEPSVVAIRHEG
FT                   GPNGKKIIQAVGHEAKQMLGRVPGNIEAIRPMKDGVIADFTVTEQMLKQFIRMVHPRNM
FT                   LAPSPRIIVCVPCGSTQVERRAIRESALGAGASHVYLIEEPMAAAIGAGLAVSDASGSM
FT                   VVDIGGGTTEVAVISLGGMVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEPTAELIKKE
FT                   IGSAFPGSEVREIEVKGRNLAEGVPRSFTVSSNEILESLTDPLNQIVSAVKIALEQTPP
FT                   ELGADITDKGIALTGGGALLRDLDRLLQEETGLPVVVAEDPLTCVVRGCGEALEHLEKL
FT                   GAIFIND"
FT   CDS_pept        465313..466197
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="Bpet0428"
FT                   /product="rod shape-determining protein"
FT                   /function="Cell shape determination"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40760"
FT                   /db_xref="GOA:A9I0I5"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0I5"
FT                   /protein_id="CAP40760.1"
FT                   /translation="MQRQGTPPLFRRGPPAEVRLLVMVALSLALLVLDSQFHVLEPLRR
FT                   AVAVGMYPFQRAVMAPRDLVQQFNEWINAANRIRTENEALQRQRIELSQVATHAAQLAA
FT                   ENAQLRRLLGVTDTVEQAAVVVEVLYEPANTFQQRLVFNKGSQAGLAPGMPVIDEGGVV
FT                   GQIVRVTPMASEAALVTDERVSVPVQVLRNGLRLIAFGSNTPGRIEVRYLAANADIKEG
FT                   DTIVTSGVGGLFPAGLPVAKVLTVERDTASGFARAICEPLAHPERYRHFLVLQVDVARA
FT                   QSDLQEADTGGSQ"
FT   CDS_pept        466184..466747
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="Bpet0429"
FT                   /product="rod shape-determining protein MreD"
FT                   /function="Cell shape determination"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40761"
FT                   /db_xref="GOA:A9I0I9"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0I9"
FT                   /protein_id="CAP40761.1"
FT                   /translation="MDRNNPTAQPARRLGTPSNVRPERLARPAHGAFVWGTLLLAWLLS
FT                   LLPWRVWEGAPDILALVLAFWCVHEPRRVGLVAAFCFGVLMDVHDASVLGGHALSYTLT
FT                   AYGAVALHRRLQRFDLWSQAMHMLPVFFLARLVQQMVLAWLAGKWPGWDWTLGVLLTVA
FT                   IWPLAGWVLHLPQRGTDDVESSSV"
FT   CDS_pept        466772..468883
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="Bpet0430"
FT                   /product="penicillin-binding protein"
FT                   /function="unclear"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40762"
FT                   /db_xref="GOA:A9I0J2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0J2"
FT                   /protein_id="CAP40762.1"
FT                   /translation="MFEFKKTGQQQKQRFRLRAWVGGLVALACFGVLVGRFWYLQVDRY
FT                   EGLSERADRNRIAVVPIAPRRGEILDRNGEVLARNYRTYTLEVVPAQAGKIDTLLERLT
FT                   PIVYVSPGDLRRFKRRVAESSRYASLVLRNNLNETEASWFAAHAYEFPGVELRARWVRE
FT                   YPQGATAGHVVGYIGRIADNDIEALENAGQLGNYRGTDVIGKKGIEKSWEEQLHGQTGV
FT                   EEVEVTASGRPVRTLRRRDPVPGSDIMLSIDLELQRIAEEAFGDQRGALVALDPNTGEV
FT                   LAFVSQPSFDPNLFIDGIDVENWRLLNESPDHPLINRPLYGTYPIGSTYKPFVALAALE
FT                   LGVRSATERIADPGYYEFGGQRFRNAGGAAYGMTDMHRAIVVSSDTYFYSLGPEIGVNA
FT                   LHDFSKQFGFGQITGIDLDGERAGVLPSTEWKRKAYKGRERQRWYAGETISVAVGQGYN
FT                   SFTLLQLAQATSTLADNGAYRRPHLVHAVRDTRSGKVAVTPSKPEYRIPLKQQNVDIIK
FT                   SAMADVVRQGTARRAFAGAPYQAAGKTGTAQVFSLRGSQYRASELDERLRDHALFMGFA
FT                   PYDRPRIAVALLVENAGWGASVAAPIARKVFDFWLAKTAPVGPIPPAADSSEDAPATSG
FT                   PAPAATAAPVPVTAAPPAPEPAPRPRPAPRATPAPKPPAMPSRRAPSTAPALSDLTDLF
FT                   QSPATGDKP"
FT   CDS_pept        468880..470016
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="Bpet0431"
FT                   /product="rod shape-determining protein"
FT                   /function="Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40763"
FT                   /db_xref="GOA:A9I0J5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0J5"
FT                   /protein_id="CAP40763.1"
FT                   /translation="MKRLGILLARVFLAFDWPLLVILMLFAALGLTVMHSAVGSTDWRF
FT                   AEQSRNFLIAFCAMWVVALVPPKMLMRLALPFYVLGVLLLLGVEFFGETSKGATRWLDL
FT                   GITRIQPSEMLKIAVPLMLAWYFQRHEGEVRIRDFLVAAAMLAAPFGLIVLQPDLGTAL
FT                   LVFGAGFCVIYFAGLSFKLLAPLAVIGVLGIGTLIYYEDTLCQPEVDWVVLHDYQKQRV
FT                   CTLLNPSSDPLGKGFHTIQSMIAVGSGGLYGKGYMKGTQTHLDFIPERTTDFIFAVYAE
FT                   EFGLYGGVAMLVLYALLIARGLTIAVRASSQFGRLLAGALTMMVFIYVFVNVGMVTGIL
FT                   PVVGVPLPFMSYGGTALFTMGIACGILMSISRHRGEKT"
FT   CDS_pept        complement(470841..471413)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0432"
FT                   /product="transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40764"
FT                   /db_xref="GOA:A9I0J8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0J8"
FT                   /protein_id="CAP40764.1"
FT                   /translation="MASKPGERKTQILQTLAEMLEQPHAARITTAALAARMQVSEAALY
FT                   RHFASKAQMFEGLIEFIEVSLFTLVNQIAAAEPHGLGQARKTVSMLLAFSERNKGMTRV
FT                   LTGDALVTEDNRLQERINHINDRIEASLKQSLRVAVSDGDLAPDANISAHASLLTHLVL
FT                   GRWLRYAQSGWRVTPTAHLDEHLRVVL"
FT   CDS_pept        complement(471444..472190)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0433"
FT                   /product="putative hydrolase"
FT                   /function="Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40765"
FT                   /db_xref="GOA:A9I0K1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0K1"
FT                   /protein_id="CAP40765.1"
FT                   /translation="MQVHRHLLRPAARQRRSRRTATGVPERLWLFDLDNTLHDTSYAIF
FT                   PRIDQGMTEAVAESLGVDIDTANQLRAQYWRRYGATVIGLVRHHGIDAHAFLRRSHDFD
FT                   IKPLVRAEKFLAAKLRQLPGRKVLLTNAPFHYARAVLRRLGILRHFDSLWAIEHMRLHG
FT                   EFRPKPSAALLRYVLAREGVPAARAVLVEDTLLNLRGARRVGLRTVHVYHPGTPFARGA
FT                   NHRPGYVDLRVNSVSDLLLRRRPLRG"
FT   CDS_pept        complement(472190..473092)
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="Bpet0434"
FT                   /function="Acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40766"
FT                   /db_xref="GOA:A9I0K4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I0K4"
FT                   /protein_id="CAP40766.1"
FT                   /translation="MTDTPDPAAVSSPAIKAAVLSEALPYIRRFHGKTIVVKYGGNAMT
FT                   EERLQRSFAHDVVLLKLVGLNPVVVHGGGPQIDDALRRIGKQGTFVQGMRVTDAETMEV
FT                   VEWVLGGQVQQDIVMMINEVGGKAVGLTGKDGMLIQARKKLMANKENPQEPIDIGFVGD
FT                   ITQVEPAVVKALQDDQFIPVISPIGYGEDGTAYNINADVVAGKMAEVLGAEKLLMMTNT
FT                   PGVLDKSGKLLRSLSAQTIDELFADGTISGGMLPKIASSLDAAKNGVNSVHIVDGRVPH
FT                   CLLLEILTDQGVGTMISSH"
FT   CDS_pept        473341..474126
FT                   /transl_table=11
FT                   /locus_tag="Bpet0435"
FT                   /product="putative exported protein"
FT                   /function="ABC-type metal ion transport system periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40767"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0K9"
FT                   /protein_id="CAP40767.1"
FT                   /translation="MRFLLARTALLASAFFLAGAAHAEKLVVGATQVPHAEILEVVKPV
FT                   LAKEGVELDIKVFSDYVQPNLQLADKELDANFFQHKPYLDTFNKDRGTHLVSVGLVHVE
FT                   PFGGYSRKIKSLAELPSGATVAIPNDPSNSGRALLLLQKQGLLKLKDPSNIVATPLDIA
FT                   ENPKKLKFRELEAAMLPRALDDVELALINTNYALEAGLVPTKDALFIEGADSPYANLVA
FT                   ARPDNQNSPAIKKLVDALHSSAVKQFILDKYKGAVVPAF"
FT   CDS_pept        complement(474224..474718)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0436"
FT                   /product="predicted thioredoxin"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40768"
FT                   /db_xref="GOA:A9I0L2"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0L2"
FT                   /protein_id="CAP40768.1"
FT                   /translation="MKKLILTLAVVVAAGIGAWFVWRPAPPAPDVAFTTIEGKTFSMHD
FT                   LRGKVVLVKFWATSCVTCVKQMPGAIDTYNEYAPKGYETVAVAMSYDPPNYVLNFAETR
FT                   KLPFPVALDVKGELARSFGDVKLTPTAFLIDKQGRIIKRYLGEYDPAEFHAAIEKALAA
FT                   G"
FT   CDS_pept        complement(474718..475458)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0437"
FT                   /product="putative exported protein"
FT                   /function="Predicted periplasmic or secreted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40769"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0L4"
FT                   /protein_id="CAP40769.1"
FT                   /translation="MMPDAKTVARPLLLAALLGTAALSLSACAPLVVGGAAATTAVVIT
FT                   DRRTSGAQLEDQNIAFKAERQISEKLGDAARVNAMSYNSVVLLTGDVPSEAAKAQATTV
FT                   AQGIQHVKSVVNQLNVGPAASFATRSNDTWLTSKVKTALLNTKYVPSATIAVTTDRSVV
FT                   YLMGLVTEAEGNYAATAASEVGGVAKVVKLFEIISRDEALRLSGPGTQPQGSQSSGGGA
FT                   QQHAAPIESGGGGTVNGVQAIPIK"
FT   CDS_pept        complement(475455..476057)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0438"
FT                   /product="prob. Phosphoheptose isomerase"
FT                   /function="Phosphoheptose isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40770"
FT                   /db_xref="GOA:A9I0L8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0L8"
FT                   /protein_id="CAP40770.1"
FT                   /translation="MPAMDMTSRMTSHFRDAMAVCEQSMHALAGPLAGAVDLLFAALAN
FT                   NGKILACGNGGSAADAQHFIAELVGRFERERLPLAGVALNTDTAILTAVGNDYGFEEIY
FT                   ERQVSALGQPGDVLVAISTSGNSANVIRAIQAAHEREMSVIALTGKGGGVVSELLTAHD
FT                   VHLCVPHDRTMRIQEIHGLLLHALCDGIDALLLGDTE"
FT   CDS_pept        complement(476078..476566)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40771"
FT                   /db_xref="GOA:A9I0M2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I0M2"
FT                   /protein_id="CAP40771.1"
FT                   /translation="MSDTFLEIAYERARQAQQRQMKRRRAAAHRAARGPAPARAPRASP
FT                   TQRTGTAHEDQALRLLAGAGLVPLARNLHCRAGEIDLVMRDGATLVLVEVRARANPRYG
FT                   GAAASVGRAKRARLLRCAALLLPDLARRHWGGRIPPVRFDVVAFEAGRADWLPAAFTL"
FT   CDS_pept        476669..477607
FT                   /transl_table=11
FT                   /locus_tag="Bpet0440"
FT                   /product="putative tetrapyrrole methylase"
FT                   /function="Predicted methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40772"
FT                   /db_xref="GOA:A9I0M5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0M5"
FT                   /protein_id="CAP40772.1"
FT                   /translation="MNQNVPPATIGDAWSRMAERVSGQHWPEAALYVVATPIGNLGDLG
FT                   LRAWQALARADVIAAEDTRSSRSLLEAWGISTPLMAAHRHNEAAAAQDICQRLAQGQRV
FT                   ALVSDAGAPAVSDPGARVVRAVRAAGYAVIPVPGPSAVIAALMGSGVTSDENPAYAFAG
FT                   FAPPKTAARQRWLRSWCALPAPVVLFESPHRLGACLADLLEVCGPARMLTIARELTKRF
FT                   EQIATLPLSQAAEWLAADSHRAQGEFVLIVHAAEADAGAAAGPDDPATTALLDALLESL
FT                   SVRDAARVAAKVTGQPRDALYALALARKESA"
FT   CDS_pept        477604..478167
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="Bpet0441"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /function="Methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40773"
FT                   /db_xref="GOA:A9I0M8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0M8"
FT                   /protein_id="CAP40773.1"
FT                   /translation="MKRLAANEAVAYLDTDTPLGGLRLAASDDALRGAWFLDQWDLPPP
FT                   SPAWRLAPGHPVLGQARDELAQWFAGQRREFEVALDPQGTAFQQAVWQALLRLPFGATC
FT                   SYGDLAQSIGRPKSVRAAAQAIGRNPISIFIPCHRVIGRDTSLTGFGGGLARKQALLSH
FT                   EGHRYPGRGARTRRVDDGQAELPW"
FT   CDS_pept        complement(478214..479182)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0442"
FT                   /product="putative lipoprotein"
FT                   /function="unclear"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40774"
FT                   /db_xref="GOA:A9I0N2"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0N2"
FT                   /protein_id="CAP40774.1"
FT                   /translation="MSRSRLILAPVLLGLAVLIAGCSSTGTRKAGGYYQDDGPGANPPA
FT                   NLDNIPDAVPRLEPLASGANRPYTVFGKRYVPIADNDHAYKERGIASWYGKKFHGQRTS
FT                   IGEIYDMYAMTAAHPTMPLPSYARVTSSINGRTVIVRVNDRGPFHSNRIMDLSYAAARK
FT                   LGIIGPGSGEVTVERILPEEIRLAQSQGRSLAGSPSPAAARPAALASADPAALPEAGQL
FT                   TMTELAPASAATAPAAAPPPAGQGVYLQMGAFSQPANAQSLMHRVNSQLDADAGMPAAM
FT                   VQQAGSLYRVRIGPYNDRAAALGAARQVADRTGILPSLAAP"
FT   CDS_pept        complement(479179..480195)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0443"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted P-loop-containing kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40775"
FT                   /db_xref="GOA:A9I0N5"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I0N5"
FT                   /protein_id="CAP40775.1"
FT                   /translation="MLIKRGQTPRRYKVTLSGRKAQERSCSSRSSEGIARAFRRQNHAT
FT                   IKTMLKVVLITGISGSGKSVALRMLEDAGYTCIDNLPVRFLSEFVAGARDDGLERVAIA
FT                   IDVRSPGELAELPGVITAMRAMGTSLRVVFLDANTHTLAQRYSESRRRHPLTDRLSRGG
FT                   QTPSLLDCIALERDLLAPLRDQEHVIDTSDLTPGQLRAWIRDLVQADRPPLVLTFESFA
FT                   YKRGVPSDADLVFDVRCLPNPYYDRTLRPLTGRDEPVATWLAGFEIVGQMIDDIAGYLR
FT                   RWLPQYTQDTRNYLTVAIGCTGGQHRSVYVVEQLALRFAEHDPLLVRHRTQLPDEST"
FT   CDS_pept        480217..480966
FT                   /transl_table=11
FT                   /locus_tag="Bpet0444"
FT                   /product="probable cytochrome C"
FT                   /function="Cytochrome c553"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40776"
FT                   /db_xref="GOA:A9I0N8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0N8"
FT                   /protein_id="CAP40776.1"
FT                   /translation="MSAIPLFYYMSRTRRYLAALAAAGAALAWPAGPAAAQAATLQPDT
FT                   MQARVAACTACHGEQGKAGPDGYYPRLAGKPADYLYHQLLNFRDGVRQYRPMAHLLVGL
FT                   PDAYLREIAAYFADQHVPYPPPAAPAASAGMLEQGRVLATQGDPARGLPACVACHGAAL
FT                   SGLAPAIPGLLGLPRDYIGAQIGGWKNGLRRAAEPDCMGDIAAKLTPQDIGALSAWLSS
FT                   RPVVEPYVPDPAGSTNLPAECGSQAQR"
FT   CDS_pept        480976..482265
FT                   /transl_table=11
FT                   /locus_tag="Bpet0445"
FT                   /product="cytochrome C"
FT                   /function="Cytochrome c mono- and diheme variants"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40777"
FT                   /db_xref="GOA:A9I0P1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0P1"
FT                   /protein_id="CAP40777.1"
FT                   /translation="MKRIIAYSLLAVLLACAAALAALYWMGTRDDAVPAATTAPADAAG
FT                   MVEQGRYLARLGNCMACHTAQGGKAYAGGTPIPTPFGTLYGPNITPDPQTGIGGWSADD
FT                   FWQALHNGKSKDGSLLYPAFPYTEYTRISRADADALFAYLRTIEPVEQPSRSHELAFPY
FT                   DQRGLLAFWRALYFRPGVHQPEAGESEPWNRGRYLVEGLGHCAACHAPRNRLGATRAAD
FT                   GLAGGLIAGLDWYAPPLGNDPATGLGRWSAQDIATLLQTGMARHSTASGPMAEVVLGSS
FT                   QYLSDADALAMGTYLKSLPATPAAGSEQPPAQPSAALMDLGGKLYQQHCSQCHQEQGQG
FT                   SGTAWPALAGNPTVTAPSAVNAIRMVLDGGYAPATAANPRPHGMPPFAPVLADNDVAAL
FT                   VSYIRSSWGNQAGRVTPFEVKRVRDASTLN"
FT   CDS_pept        complement(482311..483237)
FT                   /transl_table=11
FT                   /gene="ptsO"
FT                   /locus_tag="Bpet0446"
FT                   /product="Npr serine kinase/phosphatase"
FT                   /function="Serine kinase of the HPr protein regulates
FT                   carbohydrate metabolism"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40778"
FT                   /db_xref="GOA:A9I0P4"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I0P4"
FT                   /protein_id="CAP40778.1"
FT                   /translation="MLTVQELVDDNADNIPFNWIAGHGAAERNIRDDGMAAADLVGHLN
FT                   LIHPSRIQVFGQEELAYYSRFDLRRRTHHMDELLIGGVPAILLADGLSPPQDLIDQCDQ
FT                   HQVPLLSTPVAAAQLIDLLRIYLGKKLAPTTTVHGVFMDVLGLGVLITGESGLGKSELA
FT                   LELISRGHGLVADDAVEFSRIAPGMIEGHCPPLLQNMLEVRGLGLLDIRTIFGETSVRR
FT                   KMRLKLIVHLVRATAQDKFERLPLQDITQDMLGMPVRKVMLQVAAGRNLAVLVEAAVRN
FT                   TILKLRGIDTLGEFMERQAMAILQSSK"
FT   CDS_pept        complement(483257..483721)
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="Bpet0447"
FT                   /product="Nitrogen regulatory IIA protein"
FT                   /function="Phosphotransferase system mannitol/fructose-
FT                   specific IIA domain (Ntr-type)"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40779"
FT                   /db_xref="GOA:A9I0P9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0P9"
FT                   /protein_id="CAP40779.1"
FT                   /translation="MTRMNHLSRILPAGNVVLDMHATSKKRAFEQAGLLFENHHGLART
FT                   IVFDSLFARERLGSTALGQGVAVPHGRVKGLAEPLAAFVRLAQPVPFDAPDGQPVAMLM
FT                   CLLVPETATQQHLDILAELAQLMSNKALREALATETDPAEVHRMLTTGQR"
FT   CDS_pept        complement(483961..484299)
FT                   /transl_table=11
FT                   /gene="rpoN2"
FT                   /locus_tag="Bpet0448"
FT                   /product="putative sigma-54 modulation protein"
FT                   /function="Ribosome-associated protein Y (PSrp-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40780"
FT                   /db_xref="GOA:A9I0Q2"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0Q2"
FT                   /protein_id="CAP40780.1"
FT                   /translation="MNLSICGRHLDVTPAIREYVMNKLARVLRHFDHVIDTQVMLSVEP
FT                   LRHKAEITMRLRGKDIHCEAVDENLYAAIDLLADKIDRQVLKHKDKVQSHTAESVKRQA
FT                   AAAAQQTQ"
FT   CDS_pept        complement(484552..485343)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0449"
FT                   /product="Sulfate/thiosulfate import ATP-binding protein
FT                   cysA"
FT                   /function="ABC-type spermidine/putrescine transport
FT                   systems, ATPase components"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40781"
FT                   /db_xref="GOA:A9I0Q5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0Q5"
FT                   /protein_id="CAP40781.1"
FT                   /translation="MTQNPTPSPAQSASGAKQGSLRATGLRKVYNGRTVVQDVSLSVVS
FT                   GEVVGLLGPNGAGKTTSFYMIVGLVPADAGRIEIDDTPITSMPIHKRARMGLSYLPQDA
FT                   SVFRRLTVEQNIRAVLELQVDAQGKTLTEPQIKEQLEALLDELQIGHIRGNAAISLSGG
FT                   ERRRVEIARALATHPRFILLDEPFAGVDPIAVIEIQRIVRFLKGRGIGVLITDHNVRET
FT                   LGICDRAYIISEGKVLTDGQPDEIVGDPAVRRVYLGEHFRM"
FT   CDS_pept        complement(485378..486019)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0450"
FT                   /product="putative exported protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40782"
FT                   /db_xref="GOA:A9I0Q9"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0Q9"
FT                   /protein_id="CAP40782.1"
FT                   /translation="MTQSRTPLASTRRFAAGPWQAVIGALLLGTVACAHAQQQKPAEEP
FT                   STLILSDTLHYDDVKRQSIFTGNVVLTRGLMKLTADRLEANEDAAGNQFGTATANKGKL
FT                   VTIRQERPETFEVIEGKGLRAEYNSTKGEFDLIGQALVTRYICGKPFDTIRGERVRYNE
FT                   KTGVYQAQGGPNSSAPGGRVRSFAAPRAKADAAIAECRAAKGGASAKQGG"
FT   CDS_pept        complement(486016..486738)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0451"
FT                   /product="putative membrane protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40783"
FT                   /db_xref="GOA:A9I0R3"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0R3"
FT                   /protein_id="CAP40783.1"
FT                   /translation="MLRPAAGRAGPAGRLHDGARAARPGRHPVTRPPPGMKERFPALIA
FT                   LTLLIALVAGTWWAADYAQRAIPIDPPRRLTHEMDSWSRDFVMLRTDPTGKPINRLEGK
FT                   YAEHFPDDDSYHVTAPRAIGQQEANPITVGTSDTAIMEHGGKRIVMNGNAHVHRQQDAK
FT                   NDALDVRSEQLIILPDDDVIYTDLPAVVLKGNSRMSGTGMRYNNSTRQLQVSASTDVEI
FT                   ASSETGKRPSGGETRNSP"
FT   CDS_pept        complement(486651..487253)
FT                   /transl_table=11
FT                   /gene="kdsC"
FT                   /locus_tag="Bpet0452"
FT                   /product="3-deoxy-manno-octulosonate-8-phosphatase"
FT                   /function="Lipopolysaccharides (LPS) biosynthesis: Provides
FT                   the 8-carbon sugar KDO by dephosphorylation of
FT                   KDO-8-phosphate. KDO is a precursor required for the
FT                   biosynthesis of the LPS lipid A component."
FT                   /EC_number="3.1.3.45"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40784"
FT                   /db_xref="GOA:A9I0R6"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0R6"
FT                   /protein_id="CAP40784.1"
FT                   /translation="MTTSRSSTHPAEALVLARIAPAVRERAAAVRLMVFDVDGVLTDGS
FT                   LYYSESGELFKRFHALDGHGLRLLLEGGLKVALVTGRSGPIVDRRAAELGIAEVMQGVR
FT                   DKGAALAELAQRNGVELNQTGYMGDDIIDLPALQRAGFAASVANAPGYIAQAAHWVASQ
FT                   PGGSGAVRECCDLLLAAQGRLGAFMMAPGLLGPGAIQ"
FT   CDS_pept        complement(487256..488245)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0453"
FT                   /product="NDP-sugar epimerase"
FT                   /function="sugar nucleotide interconversion"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40785"
FT                   /db_xref="GOA:A9I0S0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0S0"
FT                   /protein_id="CAP40785.1"
FT                   /translation="MTDHPPSPSGAALESARRTLHIEAQAIADLSARLDDSFARVVDML
FT                   LACRGRVVVSGIGKTGHIARKIAATLASTGTPAFFVHAAEAIHGDLGMITRDDVLIAIS
FT                   HSGSGQELLTILPAARRMGAGLVAITGNPASELARLADLHLDTSVAQEACPLNLAPTAS
FT                   TTAALALGDALAVACLEARGFGPEDFARSHPGGTLGRRLLTHVRDVMRQGAALPTVSEQ
FT                   SALFPALEEMSAKGMGMTIVLDAAGKPTGIFTDGDLRRLIERHGDIRNLTVAQGMTRMP
FT                   RSIGPDALAVEAARQMDEQRLNQMLVLDSDGALLGALHMHDLMAAKVV"
FT   CDS_pept        488359..489573
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="Bpet0454"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /function="Formate-dependent phosphoribosylglycinamide
FT                   formyltransferase (GAR transformylase)"
FT                   /EC_number="2.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40786"
FT                   /db_xref="GOA:A9I0S3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0S3"
FT                   /protein_id="CAP40786.1"
FT                   /translation="MSSVPAPVLGTPLSDSALRVMLLGAGELGKEVTIALQRLGVEVIA
FT                   VDRYADAPGQQVAHRAHVIPMTDPAALRKVIEQERPAVVVPEIEAIATGALVEIEAAGI
FT                   ARVTPTARAAQLTMNREGIRRLAAETLGLPVSPYQFVDSEAGLRQAIDDGIGYPCVVKP
FT                   VMSSSGKGQSVIHGPDDIAAAWQYSQEGGRVGAGRIIVEGFIRFDYEITLLTVRARGAD
FT                   GAIHTHFCEPIGHLQADGDYIESWQPHPMQPVALERARDIARAITDNLGGMGVFGVELF
FT                   VAGDQVWFSEVSPRPHDTGMVTMISQVQSEFELHARALLGLPVDTSLRQPGASSVIYGG
FT                   VDARGVSFHQVAQALAEPGTDIRLFGKPESYVKRRMGVALATAPDIEAAREKAKRVSKA
FT                   VVVKA"
FT   CDS_pept        489682..490227
FT                   /transl_table=11
FT                   /locus_tag="Bpet0455"
FT                   /product="putative transcriptional regulator"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40787"
FT                   /db_xref="GOA:A9I0S6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0S6"
FT                   /protein_id="CAP40787.1"
FT                   /translation="MPLSPQTERFVLHFGEMGSRWGVNRTVGQIYALLFLSPHPLHADD
FT                   IAEALGFSRSNVSMGLKELQSWRLVKLVHQVGDRRDYFETPHDVWEIFRILMEEKRRRE
FT                   IDPTLTLLRETLLEPPAGDSEVHAQQRMSEMLELIELCTGWFDEVHQLPPETLQSLMKL
FT                   GAKVQKVLGFAGKLRGRE"
FT   CDS_pept        490359..491936
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="Bpet0456"
FT                   /product="Cytochrome D ubiquinol oxidase subunit I"
FT                   /function="Cytochrome bd-type quinol oxidase subunit 1"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40788"
FT                   /db_xref="GOA:A9I0S9"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0S9"
FT                   /protein_id="CAP40788.1"
FT                   /translation="MIDLDVVNLSRFQFAATVMYHFIFVPLTLGLSFILAIMESVYVMT
FT                   GRDIWRRMTMFWGTLFGINFALGVATGVVMEFQFGMNWSYYSHYVGDVFGAPLALEGLM
FT                   AFFLEATFVGLFFFGWNRLSKVGHLAVTWLVAFGTNFSALWILIANGWMQNPVGAVFNP
FT                   DTMRMEMTDFAAVVFNPVAQAKFVHTVSAGYVAGAMFVMSISAWYLLRRRHVDLAKRSM
FT                   AVAASFGLASALSVVVLGDESGYLTTEHQKMKIAAIEAMWHTEPAPASFNLFAIPNQAE
FT                   RKNDFAIEIPYVMGIIGTRSLTTPLLGIDDLVRRAEVRIREGLVAYDAMQRIRANPGDT
FT                   EARMTLDRTWPQLGYALLVKRHQPDLSKATDADIAQAAADTIPHVAPLFWAFRIMVAVG
FT                   LYLILFFAVAFWLASRGKLDSRPALLKVALWSLPMPWIAIEAGWFVAEYGRQPWVIEGV
FT                   LPTYYAASGLTLVDLAISLTIFLTLYTTLLVIGVKVMLHAIKAGPKSDLPAPRPSPADP
FT                   VAAAVDAY"
FT   CDS_pept        491952..493106
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="Bpet0457"
FT                   /product="Cytochrome D ubiquinol oxidase subunit II"
FT                   /function="Cytochrome bd-type quinol oxidase subunit 2"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40789"
FT                   /db_xref="GOA:A9I0T3"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0T3"
FT                   /protein_id="CAP40789.1"
FT                   /translation="MESLIPFDYATLRVIWWALLGVLLIGFAVMDGFDLGVAALLPVVA
FT                   RTDVERRVVINVVGPVWEGNQVWLITGGGAIFAAWPLLYAASFSGFYLAMMLVLVALIV
FT                   RPVGFKYRSKMEGTRWRGTWDHVLCASGVVAALVFGVAMGNLIVGVPFGFDAAALRPEY
FT                   HGHFYQLFSPFALLAGLLSVAMLIMHGAVLLAWRTDGAVAARARRAGRLAALLTAALFA
FT                   AGGFWVANGIDGHVITGALDGMAPSDPLLKTVVAQPGAWMGNFARWPLAWIAPALGVGG
FT                   ALLVAAMLGGRRHSLTFIVSSLSIVGVILTVGLALFPFLMPSSSDPRFGLTIWDASSSR
FT                   LTLWIMLVATAFFLPIITLYTSWVYRVMRGKVTSESVDGTPNSY"
FT   CDS_pept        493119..493241
FT                   /transl_table=11
FT                   /locus_tag="Bpet0458"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40790"
FT                   /db_xref="GOA:A9I0T7"
FT                   /db_xref="InterPro:IPR011724"
FT                   /db_xref="InterPro:IPR012994"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0T7"
FT                   /protein_id="CAP40790.1"
FT                   /translation="MWYFSWILGLSLACAFGILNAMWFELREGGEHDPARPGGA"
FT   CDS_pept        493238..495022
FT                   /transl_table=11
FT                   /gene="cydD"
FT                   /locus_tag="Bpet0459"
FT                   /product="ATP-binding component of cytochrome-related
FT                   transport"
FT                   /function="ABC-type transport system involved in cytochrome
FT                   bd biosynthesis ATPase and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40791"
FT                   /db_xref="GOA:A9I0T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0T9"
FT                   /protein_id="CAP40791.1"
FT                   /translation="MSGTPGLAPDPAAAQGPAQREHTRWLAAQARAVRAPLALAAAAPL
FT                   LGGALLLVQAWLLAHVLDAAIAGHAPRAELAPAIGAIAGLILARAGLAWLGERAGARAA
FT                   ETIKQRLRLALFDQLLARGPAWSRGQVSGELASAIVDQVEALDGFFSRYLPAAVAAAVL
FT                   PVAFAAVLLPVDWIAGLLLLVTAPLIPLFMALVGWGAEAASRRHLRAFARLSGFFADRL
FT                   RGLSTLKLYGRAEAEAQSVALASETVRRRTMAVLRIAFLSSAVLEFFAALGVAGMAVYF
FT                   GLTYLGFLDLRGSPLTLQAGFFCLLMAPEAYAPLRQFAAHYHDRAAARAAVSQVAAAFD
FT                   GLPDLDAQAGDGNVAPLMGCQTPDEDGASSRRAAPPASLVAHGLTVRAAGRPNPVLDDA
FT                   RLALQPGMHAALMGPSGSGKTTLLETLCRLRADAGAVSLDGVPLADWNDADLRARVVLV
FT                   GQRPYLFAGSIADNIRLGRPDASDEQVRAAARRACVDEFTQALPAGLDTPLGSRGAGLS
FT                   GGQAQRVALARLFLRDPGLILLDEPTSHLDEATQARVLDEILAFARGRTLLLATHAHAV
FT                   ARRLPHRVRLAHGKLDQA"
FT   CDS_pept        495019..496701
FT                   /transl_table=11
FT                   /gene="cydC"
FT                   /locus_tag="Bpet0460"
FT                   /product="ATP-binding component of ABC transporter"
FT                   /function="ABC-type transport system involved in cytochrome
FT                   bd biosynthesis fused ATPase and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40792"
FT                   /db_xref="GOA:A9I0U4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0U4"
FT                   /protein_id="CAP40792.1"
FT                   /translation="MRALLHLLPLYRRRAGGLAAALLLALLTVAAGVGLLGVSGWFLSA
FT                   AALAGAATAFNLFVPSALVRMLSFARIAARYAERLVGHAATLRLLTDLRASVFGALVGL
FT                   TPRQLARYQAGDLVARLTGDVDALDTVFLHVLAPMATAGLAATLLAVVVGHWAPAAGWT
FT                   LAWAMLAACLLVPAWLAWAARRPGQAMQASHAELRAATLEAVEGHADLVAWHAAAQVRL
FT                   AYAAHCAHAARAREGQVKAAAGGLWMLQALAGASLVAMLWFGLDALQRQRLDGPLLAGL
FT                   VLAVIGVFEVAGPLMRGAARLGGAIAAARRIQAVARQAPDQRDPPEPRALPLEGAIEFR
FT                   SVRFAYPAPAGQSGGPVLDGASLRIAPGERVAITGPSGAGKSTLLHLLLRLEDPQAGSV
FT                   CFGGVDVREAAQAQLHRRVAWLAQDAPVFLGTLRTNLLIGDPGADDAALWGALDAAGLG
FT                   DFVRGLPDGLDTWAGETGASLSAGQARRLCLARALLAPAPVLALDEPTAGLDETAQAAF
FT                   FNDLARATRGRTVLLVTHAALPPGAVHRTLVLRGGRLAAADLA"
FT   CDS_pept        496759..497307
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="Bpet0461"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /function="Adenine/guanine phosphoribosyltransferases and
FT                   related PRPP-binding proteins"
FT                   /EC_number="2.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40793"
FT                   /db_xref="GOA:A9I0U7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I0U7"
FT                   /protein_id="CAP40793.1"
FT                   /translation="MQTDTAELIRRTIRSVPDWPRPGVVFRDITPLLQDPRTFRVLIDL
FT                   FVYRYMRQRLDLVAGVDARGFIIGSVLAYELNLGFVPVRKQGKLPYRTVAESYTLEYGN
FT                   SSVEMHTDSVRTGQRVLLVDDLIATGGTMLAAIKLLQRLGANVVEAAAIIDLPELGGSG
FT                   KVAATGTPLFTVCSYDSAE"
FT   CDS_pept        complement(497363..498280)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0462"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40794"
FT                   /db_xref="GOA:A9I0V1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0V1"
FT                   /protein_id="CAP40794.1"
FT                   /translation="MDIQLNDIALFVEVAKRKNFSHAAEALNMPASTLSRRVSELEQNI
FT                   GMKLLNRSTRRIELTEAGLVYFERCRPIVEEARVAHDQLLDMAAQPKGRLRVSMPSSLA
FT                   QLFLPAVIREFRTQHPDIECDFDLNMQHIDPISNPFDLVLRFGRQPDSSLVARQIMLMK
FT                   HRLYASPQYLERHGVPRVPSDLGHHECLRPAMSEAFSYWVLHSGEKVERVAVSGRLAAN
FT                   NVGILSRLASQGLGIAPLLVFDAIGQPIRNRGLVPVLPDWSLTPIPLFALMPSRTIPAK
FT                   TRAFLDFIQPRLAEPGSWAMSEAA"
FT   CDS_pept        498539..498919
FT                   /transl_table=11
FT                   /locus_tag="Bpet0463"
FT                   /product="putative exported protein"
FT                   /function="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40795"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0V4"
FT                   /protein_id="CAP40795.1"
FT                   /translation="MMKALLAALMATTLTVTGMSAHAEGKTRAQVRAELAAAKAAGEVS
FT                   FGELDYPPEQRVTTHKTREQVRAELAQARAAGELSSGELDYPPEQRPATHKTRAQVRAE
FT                   LAAAKAAGEVSFGDLDYPPSDR"
FT   CDS_pept        499235..500353
FT                   /transl_table=11
FT                   /locus_tag="Bpet0464"
FT                   /product="outer membrane porin protein precursor"
FT                   /function="Outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40796"
FT                   /db_xref="GOA:A9I0V5"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0V5"
FT                   /protein_id="CAP40796.1"
FT                   /translation="MKKTLLAVALAAGFAGVAQAETSVTLYGLIDAGIGYNQVKGSNGD
FT                   KASRIGAVDGVNSGSRFGLRGVEDLGDGLKALFTLEGGFSPNNGTSSQGGRLFGRQATV
FT                   GLQSDSWGQLDFGRQTNLASKYFAGIDPSGISYDQATMGTSFSSANTVRLDNMVLYQTP
FT                   SFSGFKFGVGYSFNADDNATTGGGFRTNNNNRVVTVGARYQNGPLDVALSYDNLRADSS
FT                   RTKGQYDTDNVQSYIIGAAYDFEVVKVSAAFGQTFDGWFVGTNIDGLSDVDGTGLGSWK
FT                   LADGSRVNSYLLGISAPIGGASNIWASWQRADINNSRLAGDDATSNTFSLGYTYDLSKR
FT                   TNLYAMGSYGDNWAFQEDQRSTAVAVGLRHRF"
FT   CDS_pept        complement(500501..502009)
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="Bpet0465"
FT                   /function="Threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40797"
FT                   /db_xref="GOA:A9I0W0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0W0"
FT                   /protein_id="CAP40797.1"
FT                   /translation="MSADYLKRILTSKVYDVAVESPLESAPLLSQRISNTVLLKREDTQ
FT                   AVFSFKLRGAYNKMANLAPAARSRGVIAASAGNHAQGVALAAARLGCRAVIVMPTTSPQ
FT                   VKIDAVRRLGGEVVLAGESFSDAYAHAQTLEKKEKLTFVHPFDDPDVIAGQGTVGMEIL
FT                   RQHPGPIDAIFVAIGGGGLVSGVAAYVKQLRPEIKIIGVQTEDSDAMLRSVRAGRRVQL
FT                   NDVGLFSDGTAVKMVGAETFRLTRQYVDDFVVVDTDAICAAIKDVFQDTRSVLEPAGAM
FT                   AVAAAKQYAAQHKLKGKTLIAIACGANMNFDRLRFVAERAEVGEMREAVFAVTLPEQRG
FT                   SFRRFCELVGHRSVTEFNYRISDAQRAHVFVGLQVNSPAESDKIAANFRRNGFDTLDLT
FT                   HDEMAKTHLRHMVGGRSALASHELLYRFEFPERPGALMRFLNAMNPDWNISLFHYRNQG
FT                   ADYGRILIGIQVPPSDKKQFKTFVAELGYPHWNETDNPAYKLFL"
FT   CDS_pept        502405..503352
FT                   /transl_table=11
FT                   /locus_tag="Bpet0466"
FT                   /product="hypothetical protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40798"
FT                   /db_xref="GOA:A9I0W3"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0W3"
FT                   /protein_id="CAP40798.1"
FT                   /translation="MAFAAALGGRECRPRKIFFPSPPGGPKCKNRDRPGDAPIILHCES
FT                   WRGGASAAAPRGRVRARGAPGRHREAKALAPPRRDARRKTTPRKPDPPANPTPPQTRPP
FT                   RTTRTPRTTSPHDPRPEPAKLPPIMEQSLLNAVHWLLALVALPEVGLPAIFVISMVSAT
FT                   LLPLGSEPAVFGFVKLAPDMFWPAVLVATVGNTVGGAISYAMGLGAHRALERWREKHPH
FT                   PAGAEPDHPAARPGGPADRMRGRWHLHAHDWLHRMGPPALLLSWLPAVGDPLCAVAGWL
FT                   RLAFWPSVLYMAIGKFARYTVMTAGLLWFFPQPV"
FT   CDS_pept        503433..507392
FT                   /transl_table=11
FT                   /locus_tag="Bpet0467"
FT                   /product="FAD/iron-sulfur cluster-binding domain protein"
FT                   /function="FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40799"
FT                   /db_xref="GOA:A9I0W6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0W6"
FT                   /protein_id="CAP40799.1"
FT                   /translation="MNAPLASQILSAAIPPAATARLREIPYNYTSFSDREIVGRLLGDD
FT                   AWQWLSDLRGERRTGRSARMLYEVLGDIWVVRRNPYLQDDLLDNPKRRKLLVGALHHRL
FT                   GEIDKRREPDSPTPEGHDPQRDAKVVELLARARSAVAAFESEFDQTQHLRKQALKTLGR
FT                   ITARDNIKFDGLSRVSHVTDATDWRVEYPFVVLTPDSEAETAALVRACIELGLTIVPRG
FT                   GGTGYTGGAIPLTWKSAVINTEKFDSLGPVESCILPGLTEPAAVIHAGAGVVTKRVAEA
FT                   AEQAGFVFAVDPTSAEASCVGGNIAMNAGGKKAVLWGTALDNLAWWRMVDPDGNWLEVT
FT                   RLEHNLGKIHDVDVARFELKWFDGAAKPGEKLLKTEQLEIAGRVFRKEGLGKDVTDKFL
FT                   AGLPGVQKEGCDGLITSARWVLHRMPRHTRTVCMEFFGQARDAIPSIVEVKGYLDGEGR
FT                   ARGAILAGLEHLDERYLRAVGYATKSKRGTLPKMVLIGDIVGDDEDAVAAAASEVVRLA
FT                   NTRHGEGFVAVSAEARKKFWLDRSRTAAIARHTNAFKINEDVVIPLSRMGEYTDHIERI
FT                   NIELSTRNKLKLLDALDAFLAVPLPVGKAEDAEDEATRAEALAEHTRQAVEVLALVRKR
FT                   WQWLLDNLDLPLHQALPDLPGLGMTPLQGALADRVAAQPDATLFNVLQDRTVRVSWKTE
FT                   VLAPMQAIFSGATGKHILDEFKAIHARVLKSRVFVALHMHAGDGNVHTNIPVNSDDYEM
FT                   LTEAHQAVARIMQIARDLDGVISGEHGIGLTKYEFLTDAELAPFQEYKRRVDPRGHFNA
FT                   GKLMPGADLRHAWTPSFNLMGHESLIMQQSDIGAISESIKDCLRCGKCKPVCATHVPRA
FT                   NLLYSPRNKILATSLLVEAFLYEEQTRRGVSLKHWEEFEDVADHCTVCHKCYNPCPVDI
FT                   DFGDVSMSMRALLRRMGRKSFNPGTSAAMFFLNAKDPATINATRKAMVGVGYKAQRLAH
FT                   DLLSGFVRKQTAHPPATVGKPPLREQVVHFVNKKMPGGLPKQSARKLLDIEDANYVPII
FT                   RDPKATTADTEAVFYFPGCGSERLFSQVGLATQAMLWHAGVQTVLPPGYLCCGYPQRGN
FT                   GMNDKAEQIITDNRVLFHRVANTLNYLDIKTVVVSCGTCYDQLAGYEFDKIFPGCRLID
FT                   IHEYLLEKGIKLEGAKGVRYMYHDPCHTPMKLQDPMKTVRSLVGEGAIKTDRCCGESGT
FT                   LAVSRPDVSTQVRFRKQEELQKNQAALRQDGYAGDVKVLTSCPSCLQGLTRYEGDTAME
FT                   ADYIVVEMARHILGEQWMEEYVKRANSGGIERVLV"
FT   CDS_pept        complement(507461..508465)
FT                   /transl_table=11
FT                   /gene="bug13"
FT                   /locus_tag="Bpet0468"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40800"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0X0"
FT                   /protein_id="CAP40800.1"
FT                   /translation="MKTAAFHLGRLGRAAGLAAIAALATLFVLNAAPAQAAPYPDKPVT
FT                   VIVPFGAGSATDQLARALSASATPLLGQPVVVENRPGASGMIAAQHAARAAPDGYTVLI
FT                   TTNTTQVANPHLFKKLPYDPRADFTPLTGLGAGGMVLVVREDAPYRTVDDLVRQAREHP
FT                   GKLTFGSGNSSSRIAGEMFKQLTGTDIVWVGYNSNPNALNDLLGGHIDMMVIDTVTGLS
FT                   QIAAGKLRPLGASTSRRLPQLPDVPTLQEAGIDGYDMSYWFAAYVPAGTPPEIADKLAQ
FT                   TLTQAEASPQARDFFQNSATQAWTTSRAELAAFQDSELAKWGKVIRAAGIQPE"
FT   CDS_pept        complement(508540..509388)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0469"
FT                   /product="enoyl-CoA hydratase"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40801"
FT                   /db_xref="GOA:A9I0X3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0X3"
FT                   /protein_id="CAP40801.1"
FT                   /translation="MMHPHELPPPVDSLPSRTLVRQDCASGVLTLSMDAPETGNAISTH
FT                   MAEALAQALERANTRPDVHCVLLRSTGRHFCTGGNVKDMERGADLMQGSPADIHSRLKQ
FT                   SLHRITLALRSLQVPSIAAVNGAAVGAGCDLALMCDLRVASDRATFAESFLRLGLVSGI
FT                   GGAWYLTRIVGTAKALELTLTSEFIDAPTALRLGLVNQVVAPDELDAYSRNLALRIASN
FT                   PPQALRMAKRLVLDAAESSLPAALENAAALQAILLTGQEHKTVVRQFLQQRAQRATPTT
FT                   A"
FT   CDS_pept        complement(509406..510611)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0470"
FT                   /product="Predicted acyl-CoA transferases/carnitine
FT                   dehydratase family protein"
FT                   /function="Predicted acyl-CoA transferases/carnitine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40802"
FT                   /db_xref="GOA:A9I0X6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0X6"
FT                   /protein_id="CAP40802.1"
FT                   /translation="MFQQSLRGLKVIDFSHVLAGPVCTMMLADMGADVIKIEPPGGELG
FT                   RQIGPPWIGGESAVYLSVNRSKRGIVLDLKCAQGREVAQRLARGADVVVENFRPGVMKG
FT                   LGLDYPTLAAINPRLVYCSISAYGQQGPLRDRAGVDGIIQAAGGLMSTLGEPDGAPVKV
FT                   SIPVTDMVTGYLATIAILAARASAQQRGHGEHLDISLYNATLMLQQIGFASYFATHTVP
FT                   ARTGSAAPYAAPNEAYQTRDGWIMVAAYHPQRWHALCTALGANELERDERFASNASRVA
FT                   HRQALRQALEPLFRQKDTDAWVQLLAAHDILCAPVATYDEVVRSPEYAASGIDSWVDHP
FT                   IAGPVRLPAFVPGPAHAIPGTRAATAAPILGEHTRQILEECGYNAHAIETLENAGALGL
FT                   PA"
FT   CDS_pept        complement(510770..511654)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0471"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40803"
FT                   /db_xref="GOA:A9I0X9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0X9"
FT                   /protein_id="CAP40803.1"
FT                   /translation="MAHRDLLPPLNPARAFEATGRLLSITKAADELCVTPAAVSRQVRA
FT                   LEQFLGTALFVRARGGLELTPAGARYLSDLIPLFATLRAATLAVTGRHTASNTLRIRSP
FT                   ATFAVRWLIPRLAGFHQQHKHIDVQVTTSFLPLDFQREDIDAGIQLGDGQWPGMRTLQL
FT                   MRNELVPVAAPTLRLRFKKQLASQTLLHSMARSDDWMLWLRAAGVRDVNPAQGMKYETS
FT                   LLAYQAAIEGHGVAIAQKALIEKELADHTLVAPLSPTLDRGGYTYYFAWPSGKPPSAAL
FT                   RAFHDWLAGMVEA"
FT   CDS_pept        complement(511721..513100)
FT                   /transl_table=11
FT                   /gene="gabD1"
FT                   /locus_tag="Bpet0472"
FT                   /product="Succinate-semialdehyde dehydrogenase"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40804"
FT                   /db_xref="GOA:A9I0Y3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0Y3"
FT                   /protein_id="CAP40804.1"
FT                   /translation="MIEVVNPADGSRVGVVPHMDAAQVKAAIDRTCDAFPAWSRRLAKE
FT                   RGDLLRRWFELVRDDKQAFAEIMVQENGKCLAEALGEIDYGLGFIEWYAEEAKRVYGDT
FT                   IPSHAPHATVMVMKTPVGPTAAITPWNFPFMMITRKVATALAAGCTMIIKPSEETPLTA
FT                   YKLLEYARKAGIPEGVFEMVTGNPPEIGALFTGDERIRKISFTGSTAVGRLLAQASGAT
FT                   LTKMTLELGGNAPFIVFDDATLEQAAAGLVAAKLRNSGQVCISPNRIYVHDGIYDRFVQ
FT                   EVAERVARIPVDQGMRPDFVVGPLINQAGLQKVDQLVQDSRRDGATVVLGGRPHAKGGL
FT                   FYEPTVLTGLNDDMRIARTEIFGPVFPFYRFSTEDEVVRRANQTEYGLVAYAYTRDVGR
FT                   AFRLARDIEAGMVILNSGSVGTASVPFGGVKQSGYGREGSHHGIEEYVDVRYVLAAGQD
FT                   V"
FT   CDS_pept        513187..514236
FT                   /transl_table=11
FT                   /locus_tag="Bpet0473"
FT                   /product="transcriptional regulator, AraC family"
FT                   /function="AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40805"
FT                   /db_xref="GOA:A9I0Y6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0Y6"
FT                   /protein_id="CAP40805.1"
FT                   /translation="MAANLVFLPDSMNIQKRCVVRAHGAAAASMASFPHSNPGDAPALR
FT                   QRMVALLERLAPCEGYNLTALPDIRLLRSNRPMKNVPVLYDPGIVIVCQGRKRGYFGNQ
FT                   LYLYDDQHYLAVAVPVPFTMETDASAEEPLLAVYMHLDFKLAADLMLQIDQLGGTAPAR
FT                   PRGMVSTPLDRRMGESVVRLLEALGEPLEAPILGPALVREIYFHALTGEQGASMRAALA
FT                   MQGQFGKIARALRRIHASFHAELSVEQLAREAGMSVATFHTHFKTVTRSSPVQYLKSVR
FT                   LHQARLHMVRNGMTAAAASAEVGYDSPSQFSREFKRLFGRSPVQEVRRMKAEFAVPPAR
FT                   PASPFVSSH"
FT   CDS_pept        complement(514275..515111)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0474"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized proteins homologs of lactam
FT                   utilization protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40806"
FT                   /db_xref="GOA:A9I0Z0"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0Z0"
FT                   /protein_id="CAP40806.1"
FT                   /translation="MRSPNCRTRWPRCARCSTLEDIRMSSAIDLNCDMGESYGAWHMGN
FT                   DEAVLEFVSSANVACGFHGGDPSTMRKTVAAARSRNVAVGAHPSLPDLVGFGRRAMQIT
FT                   PQEAYDMVVYQVGALAAVAASQGVRLHHVKPHGALYNMAAKDAALAQAICRAVRDVDAS
FT                   LVLYGLAGSHLVSEAEQLGLTAAHEVFADRSYQDDGSLTPRSQPGAMIEDVDTSLAQVL
FT                   RMVQEGVVRAASGRDVPVRADTLCIHGDQPNARVFAQALRAALAKAGIAVRTVPQA"
FT   CDS_pept        complement(515053..516054)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0475"
FT                   /product="conserved hypothetical protein"
FT                   /function="Allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40807"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0Z2"
FT                   /protein_id="CAP40807.1"
FT                   /translation="MSITVLKPGLLSSFQDTGRTGSQHLGVPVCGAMDARAHRLANLLA
FT                   GNEADHATLEITLAGPSLRFEAPACFAIGGADLRATLNGSAVPCHRPLVARAGDVLAFG
FT                   TAPPDGGIRAYLAVHGGYALAPVLGSASTYLRGGFGGHAGRALARGDTIGLAAALPGEP
FT                   AALERLARALWQQRIYLPATLAPRPRSHLRVLPGIHWDEFDAESHRHLLHAEFRISVQS
FT                   DRMGYRLDGPPLSMTAPRQILSEAASYGTMQVPAGGQAIVLMADRQTTGGYPKLAQVIS
FT                   ADLPALAQRGPGQVLRFARIELDEAQQLDGEREDAFAQLQDALAPLRALLHT"
FT   CDS_pept        complement(516051..516773)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0476"
FT                   /product="conserved hypothetical protein"
FT                   /function="Allophanate hydrolase subunit 1"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40808"
FT                   /db_xref="GOA:A9I0Z5"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0Z5"
FT                   /protein_id="CAP40808.1"
FT                   /translation="MNTIPPASPAAWRIQPQGDRCLLVYFGDGIDINTGRLCLAAARML
FT                   RQAQLPGVTDVVPSFVAVAVHYRPAGSQGPRYPQLAAQVEQILAQGVTTDAQAGRRIDI
FT                   PVCYGGEYGPDLDEVARHAGISADEVVQLHAGPDNLVFMLGFAPGAPYLGVHDERLNIP
FT                   RRASPRTAVPAGSVAVANRQSVLYPSQLPGGWNIIGATPVALFDPAREPAALLQPGDTV
FT                   RFVPITPAEFGRLREAAR"
FT   CDS_pept        complement(516798..517229)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0477"
FT                   /product="probable dioxygenase"
FT                   /function="Predicted dioxygenase of extradiol dioxygenase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40809"
FT                   /db_xref="GOA:A9I0Z9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9I0Z9"
FT                   /protein_id="CAP40809.1"
FT                   /translation="MTASTSLPPFHLAFPVRDLAEARAFYGELLGCPEGRSSAEWVDFN
FT                   FYGHQIVAHLSPDECGHKSTSSVDSKDVPVRHFGAVLPMADWEALAKKLTDAGTKFVIE
FT                   PYIRFKGEVGEQATMFFLDPSGNALEFKSFKNMDSLFAK"
FT   CDS_pept        517406..518278
FT                   /transl_table=11
FT                   /locus_tag="Bpet0478"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40810"
FT                   /db_xref="GOA:A9I103"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9I103"
FT                   /protein_id="CAP40810.1"
FT                   /translation="MIREFKTFIAVARDGTFTGAGRQLGLTQSAVSAQMRRLEDYLGVA
FT                   LFERTAKSAVLNAAGREMLPQAEELVALAERMASSAGAGHVSGLLRIGAIASAQQGLLV
FT                   DALAQFRIAFPDVRVRVVPGVSLSLLGQVDAGEIDMAVLIRPPFALPPELAWRPLLREP
FT                   VLLAAPAGLPVQPWRELLAGQPFIRYDRSSFGGRLVDVFLKKHRVAVREAVELDEMEAI
FT                   ANLVRRGLGVALLPRTRQFDDAGLRLYDLGEAGFNRDIGLAARLPHDPASPAGHLAECL
FT                   QQAAQLAGA"
FT   CDS_pept        complement(518971..520170)
FT                   /transl_table=11
FT                   /gene="serA3"
FT                   /locus_tag="Bpet0479"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /function="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40811"
FT                   /db_xref="GOA:A9I106"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9I106"
FT                   /protein_id="CAP40811.1"
FT                   /translation="MAQIVLFENIHPSAREVFNAAGYTDIATHAGALPPAELREALRDA
FT                   QVAGIRSRTHLDADALAAAPELRVVGCFCIGTNQVDLNGAMQRGVPVFNAPFSNTRSVA
FT                   ELVLGEAILLLRRIPEKNARVHLGHWDKSAAGAFETRGKTLGIVGYGNIGSQISTLAES
FT                   IGMRVVFFDVEAKLPLGNARAAGSLHELLEQADVVTLHVPGGKSTENIINAEALARMRR
FT                   GSILINASRGTVVDIQALHAALASGHLAGAALDVFPTEPKSVDEPLASPLIGMPNVLLT
FT                   PHIGGSTQESQENIGREVAEKLVRFLQAGTTKSAVNFPELPYLERVGAARILHVHRNAP
FT                   GALGALDNLLAEQGLNIVSQSLQTRGQIGYVITDVDGEVSDIVMAALRSHPITVRCDLV
FT                   "
FT   CDS_pept        complement(520267..521565)
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="Bpet0480"
FT                   /product="phosphate regulon sensor protein"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40812"
FT                   /db_xref="GOA:A9I110"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9I110"
FT                   /protein_id="CAP40812.1"
FT                   /translation="MIWLRTLFLVALWAAVALFMQWLAGDPVGWVIFCAALLAMLFWRS
FT                   WRLRAVSYWAHHPETSPPASVGPWDDILAPLYRYTRARARELAETRETVQGMLAAAQAL
FT                   PDGVVTLNEDFQIEWCNRVARHHLGLSLPADRGHNLLNLLRAPEFVAYAHRDDWPEPIL
FT                   VRLAHAGQERVMMMHLAAYASNRRLLITRDVTQIEKLETTRRDFVANVSHELRTPLTVL
FT                   AGFLETLRDMPADALDDEQREQYMSMMHEQAQRMQAIVEDLLTLSTLESSPGTDPRAVN
FT                   LPGLLRTARQQIEALSAGRHDFAWHIDESLDVLGAETELASAMSNLLTNAVRYTPDGGR
FT                   ITVRWQGEADGAARFSVQDTGIGIAALHLPRLTERFYRVDRGRSRAAGGTGLGLAITKH
FT                   IAIRHDAELLITSEVGKGSVFALHFPAERVVAA"
FT   CDS_pept        complement(521578..522276)
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="Bpet0481"
FT                   /product="response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40813"
FT                   /db_xref="GOA:A9I113"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9I113"
FT                   /protein_id="CAP40813.1"
FT                   /translation="MSSTILVVEDEPAIQELIAVNLSFAGHKVLRAFDAEQAHTLIRAE
FT                   LPDLILLDWMLPGTSGLTLARKLRDDERTRAVPVIMLTAKGAEQDKVEGLEAGADDYIT
FT                   KPFSPKELMARIKAVLRRRAPQLTDDIIDVGGLKLDPVTHRLSGHEQALSIGPTEFRLL
FT                   HFFMTHPERVFSRSQLLDQVWGDHVFVEERTVDVHIRRLRKALEPSGHDAHVETVRGSG
FT                   YRFTAQLPAR"
FT   CDS_pept        522473..523243
FT                   /transl_table=11
FT                   /gene="ubiE1"
FT                   /locus_tag="Bpet0482"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /function="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40814"
FT                   /db_xref="GOA:A9I116"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9I116"
FT                   /protein_id="CAP40814.1"
FT                   /translation="MQQHSTPASDSDASTTHFGFQSVPENEKARKVAEVFHSVASRYDV
FT                   MNDLMSGGLHRAWKAFTIGRAAIRPGMKVLDIAGGTGDLAKAFARRAGATGEVWLTDIN
FT                   DSMLRVGRDRLTDAGLLLPTAVCDAERLPFPSGYFDRVSVAFGLRNMTHKDRALAEMTR
FT                   VLKPGGKLLVLEFSRVAKPLAPVYDWYSFNILPWLGKKVAGDEASYRYLAESIRMHPDQ
FT                   DTLADMMRTAGLERVQYFNLTAGVVALHEGVRLG"
FT   CDS_pept        523404..524402
FT                   /transl_table=11
FT                   /locus_tag="Bpet0483"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40815"
FT                   /db_xref="GOA:A9I121"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A9I121"
FT                   /protein_id="CAP40815.1"
FT                   /translation="MSRPGITRLLAAALIAVAGTAMLAVSFDAEARRMGGGGSFGRQSS
FT                   NITQQRQATTPSTATTTNRSTAPATGAAAGTAAAGTAAKSGMSRWLGPIAGIAAGLGIA
FT                   ALLSHLGLSGAFAEFLSSMLLIGLVVFAVLFIVRRLRGVGPRHATQGAYGAARQEHAGQ
FT                   GQQPMWRQSAGASAGSAASPAAAAAPAPAAGLPAADDDNNWYIPGDFNTTEFLKKAKEQ
FT                   FVQIQAIWDSGDTDRLREFLTDDLIAELKQQLAERGAAPNQTEVVLLNAELLGIETVSD
FT                   GHLASVRFSGMLREAPGTEAFRFEEIWNLFKPQQGGWLLAGIQQIPVEYAS"
FT   CDS_pept        525013..526740
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="Bpet0484"
FT                   /product="probable ubiquinone biosynthesis protein"
FT                   /function="Predicted unusual protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40816"
FT                   /db_xref="GOA:A9I124"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A9I124"
FT                   /protein_id="CAP40816.1"
FT                   /translation="MCPNTWPKSAACWLARRCWPNGSKTWLNSAGTAMPWRGGQPTWTR
FT                   GWPVWPGSGAPEAMPSFLRVLRIMYVAFRFGLDDLVLSGLDHPLARGLRWLIRLGMRPR
FT                   APRGLRLRRALESLGPIFVKFGQVLSTRRDLVPADIADELALLQDRVPPFPSAQAAACI
FT                   EAALGAPPAQLFAQFDVDPVASASIAQVHFAVLHDGREVAVKVLRPGMRQAIERDLSLL
FT                   RIVARIVERTGPDGRRLKPREVVAEFDNYLHDELDLVREASNCSQLRRNFDAASGRGDL
FT                   LIVPEVIWEYTTSTVFTMQRMYGIPVGQIDRLRAAGIDIPTLARSGVDIFFTQVFSDGF
FT                   FHADMHPGNIYVSDRPETLGRYIALDFGIVGSLSEFDKNYLAQNFLAFFHRDYRRVAQL
FT                   HIESGWVPPDTREEELEGAVRAVCEPYFDRPLAEISLGQVLLRLFQTSRRFNVEIQPQL
FT                   VLLQKTLLNVEGLGRQLDPNLDLWKTAKPYLENWMRQRMGLDGLRKSLAKEATQWSQML
FT                   PALPRLVHERLSRPDVAPQLLLEMTRLRQAQEQGNRLLAALAAVLALAVGVALWALTR"
FT   CDS_pept        526907..527791
FT                   /transl_table=11
FT                   /locus_tag="Bpet0485"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="1.14.19.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40817"
FT                   /db_xref="GOA:A9I126"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:A9I126"
FT                   /protein_id="CAP40817.1"
FT                   /translation="MLYPELFKTMEAVRWNMASDIPWDDFDRSKLSDEQAYTIKMNAIT
FT                   EWAALPATEMFLRDNRGDSDFCAFMSVWFFEEQKHSLVLIEYLRRFCPELVPTEEELHK
FT                   VRFEFDPAPELETLMLHFCGEVRLNHWYRRAADWHTEPVIKAIYQTISRDEARHAGAYL
FT                   QYMRRALHDRGQSISEQARLSFSKIGVLMASASRTAQAMHPTNLHVNKALFPNDTVQSR
FT                   LPEPGWLEHWLDTQIRFDGAWEQKVASRILHILSSLMGRSFETVKDLNRYRKEIASLAA
FT                   AGTQSDLVVPAGA"
FT   CDS_pept        527841..528326
FT                   /transl_table=11
FT                   /locus_tag="Bpet0486"
FT                   /product="putative sugar nucleotidyltransferase"
FT                   /function="unclear"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40818"
FT                   /db_xref="GOA:A9I130"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A9I130"
FT                   /protein_id="CAP40818.1"
FT                   /translation="MPATRFESKILTREACAAAIARGALPRPLVFTNGVFDILHRGHAT
FT                   YLDQAAQLGASLVVAINTDDSVRRLGKGSDRPLNRQEDRAALLAALGCVSAVTLFHEDT
FT                   PVEIIGELRPDLIVKGGDYDMETLPETALVKTWGGRALAIPFEFERSTTALVKKIRG"
FT   CDS_pept        complement(528343..529677)
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="Bpet0487"
FT                   /product="outer membrane export protein"
FT                   /function="participates in type I protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40820"
FT                   /db_xref="GOA:A9I136"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:A9I136"
FT                   /protein_id="CAP40820.1"
FT                   /translation="MRAGSLAATLVLALAASLSAPAGAAQDLLQIWRQALASDPLYAAA
FT                   RASYRASIEQLPQARASLLPAVNAELLGAYDETRATRNMSSRSRDGTRGAWDLVLTQPL
FT                   YDWSRWQRYEQAKLGVADAELQLQQAYQDLLLRVADAYFNVLAAQDTLAATEGEKAAVA
FT                   AQLESAKRNFELGNSTITDTYEAQARYDLVVAQELLQQHALDVLRDELGKIIGQPPGAL
FT                   AELPRSVPLPPPQPARLADWSTQAEAASLEVARAQLHTQIAQRDIQVARSGHYPTLSLR
FT                   ATSGSAEGSHRDAAGGRAVDSSIGLVLSVPIYSGGGVSSQVTEKVQLEQKARKEYEAAR
FT                   RQAVQSARQHYTGVISGLQRIAALEAGEKSSRAAVRANQTGYEIGVRINLDVLNAQQQL
FT                   YATQRDLAQARYNTLLNGLRLKAVGGILSEADLEAVNRLLRLPAP"
FT   CDS_pept        529676..530482
FT                   /transl_table=11
FT                   /locus_tag="Bpet0488"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40819"
FT                   /db_xref="UniProtKB/TrEMBL:A9I134"
FT                   /protein_id="CAP40819.1"
FT                   /translation="MRRWLELELRNRGPAQRLDDGFEQVDGLEAGGRGARDATGRHDGR
FT                   LPHDDHQAAADAQLVFQGVGHRGHRAGDQDGVVFGGAPAVAAVAGFDLDVGDVVHLQVL
FT                   LRERHQAVVDFYRGDLLRQVRQQRGLVARARADFQHAVGGGELQFLGQASFDLGRQHDL
FT                   AGIDRVDLQRDFQVGKGQGAQRRRHELLAAHREQGVKHLGVEHIPGADLLLNHVEAGFF
FT                   YVGQGRSVHDGKGKIRKNQRHIVLIRRLSGRPAPPEPGGSYHQPWK"
FT   CDS_pept        complement(529688..530368)
FT                   /transl_table=11
FT                   /gene="pcm1"
FT                   /locus_tag="Bpet0489"
FT                   /product="putative protein-L-isoaspartate
FT                   O-methyltransferase"
FT                   /function="Protein-L-isoaspartate
FT                   carboxylmethyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40821"
FT                   /db_xref="GOA:A9I139"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9I139"
FT                   /protein_id="CAP40821.1"
FT                   /translation="MNASTLPDVEKARFNMVEQQIRPWDVLDPKVLDALFAVRREQFVP
FT                   PALRALAFSDLEIPLQINAVDTRQVMLAPKVEARLAQELQLTPTDCVLEIGTGSGYQAA
FT                   LLAHLAQQVTSVEIDNRLVAFAQQNLQMNNVTNVKVETGDGRNGWGTTEYDAILVTGSV
FT                   PAVPDALKYQLRVGGRLVVIVGQAPIMTACRITRTTAASFETVNLFETVVKPLRGATVS
FT                   QFKF"
FT   CDS_pept        complement(530461..531306)
FT                   /transl_table=11
FT                   /gene="thiD1"
FT                   /locus_tag="Bpet0490"
FT                   /product="putative phosphomethylpyrimidine kinase"
FT                   /function="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40822"
FT                   /db_xref="GOA:A9I142"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9I142"
FT                   /protein_id="CAP40822.1"
FT                   /translation="MNASRQPPAGQRPIPNTLSIAGVDPSGGAGVLADVKAMSALGAYG
FT                   CAVIAALTAQNTQGVTAIAPVPPAFVGQQIDTLFADVRIDAVKIGMLGQQPVTVVVAEK
FT                   LAKWLPVHVVLDPVMVAKSGDLLLEREAVGALREALLPQATLLTPNLPEAGVLLDERPV
FT                   ETVKEMRRVAERLRNIMAHSGQRWVMVKGGHLPGNDTIDLLHDGDRMIELPGHRIETRN
FT                   THGTGCTLSAALAALLPQTADVPEAARRAKAYLADALRHADRLQVGSGHGPTHHFHGWW
FT                   "
FT   CDS_pept        complement(531303..532112)
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="Bpet0491"
FT                   /product="thiamine biosynthesis protein"
FT                   /function="Uncharacterized enzyme of thiazole biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40823"
FT                   /db_xref="GOA:A9I146"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A9I146"
FT                   /protein_id="CAP40823.1"
FT                   /translation="MTTPDTLTIAGREYSSRLLVGTGKYKDFAQTRAALDASGTQIVTV
FT                   AIRRTNIGQNPGEPSLLDYVPPSQFTLLPNTAGCYTADDAVRTLRLARELLDGHDLVKL
FT                   EVLGDSHTLFPNMPETLQATKTLVADGFKVMVYCTDDPIQCRMLEDLGAVAVMPLASLI
FT                   GSGMGILNPWNLRLIIDQARVPVVVDAGVGTASDAAIAMELGCDAVLMNTAIAAAQDPV
FT                   LMAGAMKKAVEAGREAFRAGRMPRKLYSGAPSSPTEGLITAAPAQPR"
FT   CDS_pept        complement(532194..533348)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0492"
FT                   /product="putative vitamin B12 transport system
FT                   substrate-binding protein"
FT                   /function="ABC-type Fe3+-hydroxamate transport system
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40824"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A9I149"
FT                   /protein_id="CAP40824.1"
FT                   /translation="MPTPTAARAKCVAERLARTLARSLPRCLTPAGCQTPTRAATAPRT
FT                   GARPLQKTGVWHLRSQTPATLAIPTTLATPTTPTPPAPPATPALRWPRQLAAALAAALA
FT                   ATAAHAAGPITVRDDQGRTITLAAAARRAITAAPHATELVYAAGAGRYLAGAARGSDYP
FT                   PEARTLPSIGDSLRPSLERAAALRPDLLIAWQPAVPDPLGDLMRRLGVPVYYSDPRTLA
FT                   AVADAVEAMGRLFGTEEQAAPAAAALRARLAVLSARYAGRAPVRVFIQAGLQPVYTLNG
FT                   ASIVSDAVRLCGGVNVFAGAAILAPQVSVESVLAARPDAVLLGAVDPADAQASLQAWRE
FT                   RGLPAARRGHVFSVDADALYRPGPRLIDATERLCAALDAARPPD"
FT   CDS_pept        complement(533348..535363)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0493"
FT                   /product="TonB-dependent outer membrane receptor"
FT                   /function="Outer membrane receptor proteins mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40825"
FT                   /db_xref="GOA:A9I152"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A9I152"
FT                   /protein_id="CAP40825.1"
FT                   /translation="MKSRLFRRTAGMLACAVPALAAAQQNSPGNAIPQLDAITVTASRV
FT                   PIEARDQPVQVSVLTAEQIRTSSAQTVQELLSTQSGVHVINSTGAAEQAAVDLRGFGLT
FT                   GPSNTLILIDGIPQNNNDLSAPSLGTVPLDRIERIEIVRGSGSVQYGGGTTGGVINIIT
FT                   KRGNTNGKPVSASVTGTVGNYGLHQLDAAIGLQNEHLTVDVYGQTLRTDNYRDNNRESR
FT                   DSGGVSLGLRHDGGTVRLYARTTRQKLGLPGPRRVDPATGLDEYEDDPRGTSNPDDYIE
FT                   TRTDAFGAQIEQRLGAGTLYADLGQRDKSLTGFSGSAFGDTTRTQDLAETTGSLRYHLP
FT                   VAQRHALTLGMDMLDSNLDAANAYSFSPVGDRWRAEQRQHGVFAEAQVQATDSTRITLG
FT                   GRRQYARDRLETLSGFSGNSDETRHLGAWQLALRQEAGTGFSFYGKVGRSFRLANSDEV
FT                   LYVATPLKPQTSVDKELGILWQSEASSARLSWFRYDLTNEIQYNPVTFSNVNLAPTRRQ
FT                   GVELEGHHALTRTLTMDANVTWLQARFRSGNDNGVDLAGNTVPLVPKWMANLGATWRPD
FT                   DKLFISLAAQYVGKARMDNDQANEFDKQLDDYVLVNGKLGYAFTENVSGTLAVNNLFDR
FT                   EYATYGIRSGSTGSTGAYNLYPAAGRNVQAALTIRY"
FT   CDS_pept        535686..539459
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="Bpet0494"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /function="Methionine synthase I cobalamin-binding domain"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40826"
FT                   /db_xref="GOA:A9I155"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A9I155"
FT                   /protein_id="CAP40826.1"
FT                   /translation="MPYPRLPYPPSSYTRGGDFARLLGQRILILDGAMGTMIQRYKLSE
FT                   ADFRGERFADHGKDLKGDNELLSLVRPDIIDEIHRQYLEAGADVIETNTFGATSVAQGD
FT                   YDLPGLAYELNLASARLARAACDAYSTPERPRFAAGALGPQPKTASISPDVNDPGARNI
FT                   TFDELCEAYTEQLNGLLDGGIDIVLIETIFDTLNAKAAIFAVESVFEARGERLPVMISG
FT                   TVTDASGRILSGQTVEAFWNSVRHARPITIGLNCALGAALMRPYVAELSKICDTYVCVY
FT                   PNAGLPNPMAETGFDEAPADTSGLLEEFARAGLVNMSGGCCGTTPDHIRAIADKVASLT
FT                   PRAVPEIPVKTRLSGLEPLNIDEESLFVNVGERTNVTGSKMFARLIREEKYDEALAVAR
FT                   QQVENGAQIIDINMDEAMLDSVACMRRFLNLIASEPDIARVPIMIDSSKWEVIEAGLKC
FT                   VQGKAVVNSISMKEGEEAFRHHARLCRRYGAAVVVMAFDEQGQADTLERRKEICARAYK
FT                   ILTEQEQFPPEDIIFDPNVFAVATGIDEHNHYAMDFIEGVRWIRQNLPHARLSGGISNV
FT                   SFSFRGNEPMREAIHTVFLYYAIREGLTMGIVNAGQLGVYADLEPRLRDLVEDVILDRA
FT                   EPVGKEGAADERTPTERLVQFADSVKGSGAKKEEDLAWRAGTVEERLSHALVHGITTFI
FT                   VEDTEEVRQKIAARGGRPIEVIEGPLMDGMNIVGDLFGAGKMFLPQVVKSARVMKQAVA
FT                   HLIPFIEEEKRQIAAAGGDVRAKGKMVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGV
FT                   MVPCAQILEKAKEEQADIVGLSGLITPSLEEMAYVASEMQRDPYFRERKIPLMIGGATT
FT                   SRVHTAVKIAPNYDGPVIYTPDASRAVGVAANLVSEQAQAYIDEVAQEYADVRRRHANR
FT                   KATPLVSLAEARAARPQIDWSAYVPPRPKFIGRRSFKSYDLAEIARYLDWTPFFQTWSL
FT                   FGQFPAILEDKVVGEQAQKVYADGQAMLKRIIEGRWLTANGAVAFYPANTVNDEDIEVY
FT                   ADESRSEVLFTYRNLRQQGVKREGVSNKCLADFIAPKSSGVADYIGMFAVTAGLGIEKK
FT                   EAEFQAALDDYSGIMLKAMADRLAEAFAECLHARVRQDLWGYAADEALSNDEMIAEKYV
FT                   GIRPAPGYPACPEHVVKRDLFRVLDGDDIGMLLTDSYAMYPASSVSGFYFSHPQSQYFN
FT                   VGTIGADQLADYIARSGRSEEDVRRTLASSLG"
FT   CDS_pept        complement(539530..540300)
FT                   /transl_table=11
FT                   /gene="ubiE2"
FT                   /locus_tag="Bpet0495"
FT                   /product="putative methyltransferase"
FT                   /function="SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40828"
FT                   /db_xref="GOA:A9I163"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9I163"
FT                   /protein_id="CAP40828.1"
FT                   /translation="MTAPVSHDQAVDRQFGPRAAAYLTSAVHAQGADLDQLAELAREHP
FT                   GTRVLDLGCGGGHVSFHVAPCAARVVAYDLSQSMLDVVAEQAARRGLDNLSTRQGKAER
FT                   LPFADGEFDLVLCRYSTHHWQDAGQALREARRVLKPGGIAAFADVVSPGEPLLDTWLQM
FT                   LEVLRDNSHVRNYSVSEWLRLLAEAGFALRSCTPRRITLEFDSWVERMRTQAPLVQALR
FT                   HMLADAPAPVHRHYAIAPDGSFSSDTATLVAQRG"
FT   CDS_pept        540299..541228
FT                   /transl_table=11
FT                   /locus_tag="Bpet0496"
FT                   /product="predicted transcriptional regulator"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40827"
FT                   /db_xref="GOA:A9I159"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:A9I159"
FT                   /protein_id="CAP40827.1"
FT                   /translation="MVFLSMGGMAAMGGCTACGGKIDIPSYAYKTTAYPGMNASTQAGA
FT                   PGTHESSTRRRHALGEFVRAARARITPQMAGLPEGTRRRTPGLRREEVAQLCGISVTWY
FT                   TWIEQGREVSVSPAVWARIAGVLQLARAERAYLFELAECADPQHPRDDASEAPGLLREC
FT                   VDAVNAPAYVLDRAWNVLVHNGPMRDLFDDWPVRDPRPNLLRYIFLDPAARQLVVDWDQ
FT                   RARRVVAEFRADAGAHLDEPDVLALLDELNRDSEVFAHWWTRHAVVEREGGLREFQHPR
FT                   RGRLAYRQTTFRLATHPDLKLVMLLEGA"
FT   CDS_pept        complement(541625..542683)
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="Bpet0497"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /function="A/G-specific DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40829"
FT                   /db_xref="GOA:A9I166"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A9I166"
FT                   /protein_id="CAP40829.1"
FT                   /translation="MDFAPRIVAWQASHGRHDLPWQRTQDPYRIWLSEIMLQQTQVATV
FT                   IPYYQRFLERFPDVSALAAAQQEEVMPYWAGLGYYARARNLHRCAQAVMSEWGGRFPAA
FT                   AEQIATLPGIGRSTAAAIAAFAYGERAPIMDGNVKRVFTRHFGIEGDPARREVEQRLWA
FT                   LAEAQVANAPALDMAAYTQGLMDLGATLCTRGKPACDRCPVAATCIARRDARQAELPTP
FT                   KARKAIPERQTGMLVLQRDGAILLQQRPAPGIWGGLWSLPEFEAGGDPTLASRQLGLEP
FT                   LQRYELAAFAHTFTHYRLHVKPWYLPVKPGAALAEPSLPQRWAGPAELPGMALPAPIRK
FT                   LLDGLLAAGLPD"
FT   CDS_pept        542817..546608
FT                   /transl_table=11
FT                   /gene="iorA1"
FT                   /locus_tag="Bpet0498"
FT                   /product="putative indolepyruvate ferredoxin oxidoreductase
FT                   chain alpha"
FT                   /function="Indolepyruvate ferredoxin oxidoreductase alpha
FT                   and beta subunits"
FT                   /EC_number="1.2.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40830"
FT                   /db_xref="GOA:A9I170"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A9I170"
FT                   /protein_id="CAP40830.1"
FT                   /translation="MKDREPREAARKQTEQPQLASAPDPGYNLIRTNGTCARSHPPRFH
FT                   KNRQAQPARASKTLGVDMNAPLTSAQRAALASVQLDDKYTLETGRAWMSGIHALVRLPM
FT                   MQRVRDQRAGLNTAGFISGYRGSPLGGVDTNMWKAAKYLKAHHIEFQPGINEDLAATAV
FT                   WGSQQVNLFPGARYDGVFGMWYGKGPGVDRCGDVFKHANAAGTSPHGGVLVVAGDDHPA
FT                   KSSTLPHQSDHILKACMIPALFPSSVQEVLDYGLHGWAMSRYAGVWVGMKCITDIVEVS
FT                   ASVDVDPNRVSIILPDDFQMPPDGLNIRLPDTPLAQEARLLDYKLYAALAYARANKLNR
FT                   ELWHVPQSQARFGIMTSGKAYLDTRQALADLGLTEDICRRIGLRLFKVGMVWPLEATGV
FT                   QQFAEGLDEILVVEEKRQVLEYQLKEELFSWIGTGKKIPRVVGKFDDKDGGEWSVPQGN
FT                   WLLPAHYEFSPAMVAKAVGARLLRFALPDDVRAGIEARLAFIAEREQALARPRVTAERK
FT                   PWFCSGCPHNTSTRVPEGSRGMAGIGCHYMVTWMGRNTQAYTQMGGEGVPWLGQAPFTD
FT                   EKHVFANLGDGTYYHSGLLAIRAAVAAKAPITYKILFNDAVAMTGGQPVDGPIDVPMIT
FT                   RQMAAEGIEKIVVVTDEPQKYRGATGLAPGVPVHHRDELDAVMRELREYPGVSILVYDQ
FT                   TCATEKRRRRKRNAYPDPARRVVINERVCEGCGDCSEQSHCLSVEPLETEFGRKRTINQ
FT                   SSCNKDYSCLKGFCPSLVTVEGGRLRKPQPLAQEGAIDAGLPEPAPASLAQPYGVFVAG
FT                   VGGTGVVTIGQLLGMAAHVEGKGCSVLDMAGLAQKGGAVFSHVVLAPTPDGLLNTRVAM
FT                   GEADLVLAGDLVVAASPESVARMRAGRTRLLLNSDVAPTAAFVHDPDWRLPGADLQADL
FT                   RAACGEGGVDMVDAAGLAVGLLGDAIYANPLMMGYAYQKGWLPLGQQALLRAIELNGQQ
FT                   VPANLAAFAWGRRAAHDLAAVQRLAGCATAPRAGEIIEVRRGQSTAVVDIKRPTGEVDA
FT                   LVAVRSEFLQAYQNAGYADRYRDLVQRVAQAEQSATGTTRLAAAVARYYFKLMAYKDEY
FT                   EVARLYTDGEFLKQIEAQFEGDWKLRLHLAPPLLARRDAQGHLVKRAYGPGVLKAFRVL
FT                   ARLRGLRGTPLDIFGYTAERRAERALIETYRNDLLAILPKLNRANLDRAVELASLPESI
FT                   RGYGHIKEAAMQRAAARRAELMQGFSATVVPIGGARAA"
FT   CDS_pept        complement(546621..547292)
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="Bpet0499"
FT                   /product="chemotaxis protein"
FT                   /function="Chemotaxis protein; stimulates methylation of
FT                   MCP proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40831"
FT                   /db_xref="GOA:A9I174"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I174"
FT                   /protein_id="CAP40831.1"
FT                   /translation="MPSRLDARATRHYFDSAFHCPAVKVLPNEYYVAAGEDIMISTVLG
FT                   SCVAACIRDPRAGVGGMNHFMLPEGDGDSPSSATMRYGAFAMEVLINELLKAGAARERL
FT                   EAKVFGGGAVLSAMQQMNIGERNARFVLNYLNTEGIPVLAQDLGDVHARRIGYFPRDGR
FT                   VMVRRLAPHHHKAEVLIAQREQVAAQTASAKAHTPPQIERFSAPAKPRFERFTRPSTAT
FT                   S"
FT   CDS_pept        complement(547554..548462)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0500"
FT                   /product="hypothetical protein"
FT                   /function="Transmembrane domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40832"
FT                   /db_xref="GOA:A9I177"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A9I177"
FT                   /protein_id="CAP40832.1"
FT                   /translation="MKSWLRQHRYALTVTLRRLAAQPFSSLANLLVMALALALPLLGGA
FT                   ILVSAQPVARQVSITPEVTLFLQTDAPAGAAQAIAQRIRAENAAQVQAVRVVPRDDALA
FT                   SLRNDPTWDQALAVLPGNPLPDAVVATLTEGEQLAQRADQLAQAWKQWEHVDLVQLDSA
FT                   WVQRLEAILRFARVGLVFLAACVAAVVLAAVFNTVRMQAMLQREEIAVARLVGATESFV
FT                   RRPFLYLGALSGALAALVAIGAAAIALAPLNSALLGLARSYGAEFTLHLPGLPALAAAV
FT                   LGTSILGALAARWSVTRSTRF"
FT   CDS_pept        complement(548459..549211)
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="Bpet0501"
FT                   /product="cell division ATP-binding protein"
FT                   /function="Predicted ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40833"
FT                   /db_xref="GOA:A9I181"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9I181"
FT                   /protein_id="CAP40833.1"
FT                   /translation="MKKRDGKICNRRPGSLRGTIAASSLPAAMIEFQHVFKSYGRGRNI
FT                   LADINFRVSAGEFIFVSGASGAGKSTLLKLIGGLEPASRGSIQVNGQRLDKLPARARPY
FT                   LRRAVGVILQDTHLLFDRSALQNVMLPLAVIGQAPEAASARARAALDKVGLAGKEGMNP
FT                   IELSGGEQQRLAIARAIVNRPAILIADEPTANLDHDTAQRILNVFRDFNRVGVTTLIAS
FT                   HDEALMSQYATRMLRLEPGKFHDSGASA"
FT   CDS_pept        549329..550345
FT                   /transl_table=11
FT                   /locus_tag="Bpet0502"
FT                   /product="putative extracellular solute-binding protein"
FT                   /function="ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40834"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A9I184"
FT                   /protein_id="CAP40834.1"
FT                   /translation="MKALKLAAVAAALFAASSAANAGATFDSVKKKGFVQCGVSTGIPG
FT                   FSMADSKGEWKGIDVAMCRAIAATMFNDSTKFKVTPLNTQQRFTALQSGEVDVLTRNTT
FT                   QTLTRDTTLGLIGAGVNYYDSQGVMVSKDLGVKSAKELNGATICVQPGTTTELNLADWF
FT                   RGQKIEFKPVVIDKYDEIIRAFSAGRCDAFTTDKSQLASTRTTLENPDNFVILPEDFSK
FT                   EPLGPMVRQGDEQWFNIVRWSLNAMLEAEEYGITSKNVDEMAKSSNPNIQRILGVTPGM
FT                   GKNLGVDDKWAYTIIKQVGNYGEVFERTLGADSAMKLERGLNASYKDGGLMYGWPVR"
FT   CDS_pept        550472..551662
FT                   /transl_table=11
FT                   /locus_tag="Bpet0503"
FT                   /product="putative amino acid ABC transporter permease
FT                   protein"
FT                   /function="ABC-type amino acid transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40835"
FT                   /db_xref="GOA:A9I187"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9I187"
FT                   /protein_id="CAP40835.1"
FT                   /translation="MTTNNPQVPAAAPKRRLSWNDPGVRAVVYQVVALALVALAVWFLV
FT                   SNTLHNLQVRNISTGFGFIDREAGFAIGETPIDYTPANTYGRAIVVGLLNTLRAAVLGI
FT                   ILATLLGTLIGVGRLSKNWLMAKVCSVYVETMRNVPLLLQLFFWYALITENMPGPRQAA
FT                   NPLPGVFISNRGLKVPALEGASLDFILGGLALAIIGTIVAAHWGKKRQEATGQVFPLGR
FT                   VALGLFIGLPILGWLVSGASLKLDMPELKGFNFSGGLTLSPEFAALLAGLVIYTSAFIA
FT                   EVVRSGIQAVNQGQWEAAGSLGLRRSRVLRLVILPQALRVIIPPMTSQYLNLTKNSSLA
FT                   VAIGYPDIVSVVNTTMNQTGQAIEGILIIMAAYLTVSLSISVFMNWYNKRIALVER"
FT   CDS_pept        551664..552764
FT                   /transl_table=11
FT                   /locus_tag="Bpet0504"
FT                   /product="putative amino acid ABC transporter permease
FT                   protein"
FT                   /function="ABC-type amino acid transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40836"
FT                   /db_xref="GOA:A9I190"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9I190"
FT                   /protein_id="CAP40836.1"
FT                   /translation="MSTTTPIPSEGLPPPRSQVGVWPWLKERLFSSPVSILATVLVAWI
FT                   LLMAVPALVEWAFLQADFTSTTSQECRKAAGACWAFIAEKHRLILFGTYPYDEQWRPLL
FT                   ATIILIGVIVCSGLRRFWNARLALIWVVGLTAVAVLMWGGVLGLTYVENSLWGGLPLTL
FT                   ILSTFGIAFAFPFGVLLALGRKSKMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFL
FT                   PVGFSIDKLLRAQIAIIMFAAAYIAETVRGGLQAIPKGQYEGADSLGLNYWQQMRKIIL
FT                   PQALRIVIPPLVSIFIALFKDTSLVVIIGIFDLTLAAKAALSDAAWRGFGVEAYVFISL
FT                   IYFVFCFSMSKYSQRLEKRLATGHKR"
FT   CDS_pept        552825..553565
FT                   /transl_table=11
FT                   /locus_tag="Bpet0505"
FT                   /product="putative amino acid ABC transporter ATP-binding
FT                   protein"
FT                   /function="ABC-type polar amino acid transport system
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40837"
FT                   /db_xref="GOA:A9I192"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A9I192"
FT                   /protein_id="CAP40837.1"
FT                   /translation="MSDAIIRMQNVNKWYGQFHVLRNINLDVAPGERIVVCGPSGSGKS
FT                   TMIRCINRLEEHQQGHIIVDGTELTNDLKHIETIRRDVGMVFQHFNLFPHLTVLENLTL
FT                   GPTWVLKKPRAEAEATAMKYLERVRIPEQANKFPGQLSGGQQQRVAIARSLCMSPKIML
FT                   FDEPTSALDPEMVKEVLDVMVTLAQESGMTMLCVTHEMGFARKVANRVIFMDRGEIIEQ
FT                   NSPDQFFDNPQNERTKLFLSQILH"
FT   CDS_pept        553678..554703
FT                   /transl_table=11
FT                   /gene="bug14"
FT                   /locus_tag="Bpet0506"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40838"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9I196"
FT                   /protein_id="CAP40838.1"
FT                   /translation="MRNPQQPPVSSARRALVRGAVALAAALACTGPALAQDTDFPTKPL
FT                   RFVVPYPPGGPLDSTARMLAEKVRVSLGQPVIVENRSGAGGNIGADLVAKAAPDGYTLV
FT                   MGAVATHAINPWLFANLPYDPIKDFAPVTIVAAVPNVLVMNVDFAKQNHIDSLADLIAY
FT                   AKKNPGRLNYGSGGNGSAGHLAGELLKARAGIDAVHVPYQGASPAQLALLGGQSDFMFD
FT                   NLAASAPLIKDGKVKALAVTTLKRSSLLADVPTMDEAGVKGFDLGTWFGVFTTGGTPAA
FT                   VVAKLNKAYADALRQPDVRQRLLAMGSEAEPMTPEAFAAFVKNEKNKYQEVVKLSGASL
FT                   N"
FT   CDS_pept        554827..555333
FT                   /transl_table=11
FT                   /locus_tag="Bpet0507"
FT                   /product="ISPsy8, transposase OrfA"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40839"
FT                   /db_xref="GOA:A9I1A0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1A0"
FT                   /protein_id="CAP40839.1"
FT                   /translation="MVKYSEQTKFAAVEEYCRGDLGLEAVAQRHGVNPHALRRWAAAYR
FT                   EHGASGVRAKRGRYSASFKQTVLQQMKQQGLSYRQAAARFDIRNFNIIARWARQYDVQG
FT                   LAALSTGQPPAMTSPVKPASPDATRTREDLLKELQFLRMENAYLKKLDALVQAKQKSAQ
FT                   QKKRK"
FT   CDS_pept        555333..556169
FT                   /transl_table=11
FT                   /locus_tag="Bpet0508"
FT                   /product="probable transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40840"
FT                   /db_xref="GOA:A9I1A3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1A3"
FT                   /protein_id="CAP40840.1"
FT                   /translation="MLELRQQFPLAGLLSVVGLSRSTFYYQWRAGQAEDKFASLKSRIC
FT                   AIFAQHHGRYGYRRITEAIRQQGWPVNHKTVQRLMGLLGLKSCVRVKKYRSYRGTLSQL
FT                   APNVLRRQFRAARPNQKWATDVTEFRVGTQKLYLSPVMDLCNGEIIAYEMACRPSFAMV
FT                   AAMLRQACARLSPYERPILHSDQGWQYQMPAYRELLAQHAVTQSMSRQGNCLDNAAIES
FT                   FFGTLKAEFFHLNTFQTIEQLKDGIDRYIHYYNHHRIKLKLNGLSPVQYRTQLLAT"
FT   CDS_pept        complement(556385..557581)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0509"
FT                   /product="Putative salicylate hydroxylase"
FT                   /function="2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /EC_number="1.14.13.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40841"
FT                   /db_xref="GOA:A9I1A6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1A6"
FT                   /protein_id="CAP40841.1"
FT                   /translation="MSNSTRTQTAIVVGGGIGGLAAALALTRQGIAVQLLEQASHIGEI
FT                   GAGIQLGPNAFAALDALGVGQTARGRAVFTDHIIMMDAVDAQEVVRIDTGEAFRQRFGG
FT                   PYAVIHRADIHLSILEAVQRDPLIQFHTSTQITGLRQDGAQVEVQDAQGRRYRADAVLG
FT                   CDGVKSVIRDHLVGDAARVTGHVVYRAVVERDNMPEELRINAPVLWAGPRCHLVHYPLR
FT                   GGQQYNLVVTFHSREQEEWGVRDGSKEEVLSYFQGVHPRPHQMLDRPTSWRRWATADRE
FT                   PVERWGEGRATLLGDAAHPMTQYMAQGACMALEDAATLGQAVKACDGDLPAAFRLYESV
FT                   RIPRSARVVWSTREMGRIYHAQGVERQVRNSLWKDKTQEQFYDRLQWLYGWKVENCLA"
FT   CDS_pept        complement(557642..558994)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0510"
FT                   /product="putative membrane protein"
FT                   /EC_number="1.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40842"
FT                   /db_xref="GOA:A9I1A9"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1A9"
FT                   /protein_id="CAP40842.1"
FT                   /translation="MFVTEPPRQIPVHGEYDVVVLGGGPAGLLAAASAARNGASVLLAE
FT                   RYGFLGGMGTAAGVSNFCGLHANVYGDIRQVVHGMADELLDRMRALDGLNDPHLILGKI
FT                   HAQAFDVSAFKCAADGLLRDSGAQVLFHALATGIVRGADGAVDALLLETKSGPRAVRGR
FT                   VFIDCSGDADIAQWAGLPFEKGDGQGHMMYPTLMFKVGNVDGERAREAWKIIPQLMDEA
FT                   EASGEFRFPRRGAIVRPQKHDYEWRVNVTQLSNPDGSAADGTDALSLSAGELEGRRQIV
FT                   DYLAFLRARVPGFERAYVLDIAPQLGIRETRRIVAEYMLSRDDVLGCADFPDSIGVNGW
FT                   PLEIHVAGDVQWVWPPIPQSRGYNQLPLRMIVPRQAAAAASNVLVAGRCAGMTHEGQSA
FT                   ARVSGSCFVMGEAAGTAAALALRAGVAPGQLPAATLRDQLRRQGAFLGEPA"
FT   CDS_pept        complement(559018..560004)
FT                   /transl_table=11
FT                   /gene="bug15"
FT                   /locus_tag="Bpet0511"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40843"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1B3"
FT                   /protein_id="CAP40843.1"
FT                   /translation="MHDFIASGWRRRLLSAVLIVMPLAAAQAADWPAQPLKLVVPFGPG
FT                   SSPDQVARIVGDKAGNILGQTVVVENKPGASGNIGTYAIANAKPDGYTFGVSITGPLVN
FT                   NTVLFDKLPYNPFKDLSALTLAVHQPNVLVVPAKSGITSIAQLLDALKQHPDQYNFPSP
FT                   GAGTVSHLSVELMLQRIGAKAVHVPYPSSPAALSSVIAGDTQFAALPPIAVMPMVKDGR
FT                   LKALAVTSSKRSALLPDIPTLAEVGVKGIEGSAWIGFVVSSKVPADVQKKLSDALIRAI
FT                   HDPAVQQRLQAQYMDPVGNTPAEFRAYMDDELRRWKPLIGQLGIKAQ"
FT   CDS_pept        complement(559997..560377)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0512"
FT                   /function="Chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40844"
FT                   /db_xref="GOA:A9I1B6"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1B6"
FT                   /protein_id="CAP40844.1"
FT                   /translation="MSTEPDTTAGPLRQYDDPAYRPLCANLGEVRAHIDRLDNDIVRLI
FT                   AERAMYVKDAARFKRDAFQVSAPARQAQVFERARALARRHDQGFENLEAVVEATYRAMV
FT                   AAFIANEQHYFTKMTPTGDPDA"
FT   CDS_pept        complement(560404..561042)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0513"
FT                   /product="putative glutathione-S-transferase"
FT                   /function="Glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40845"
FT                   /db_xref="GOA:A9I1B9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1B9"
FT                   /protein_id="CAP40845.1"
FT                   /translation="MQLHSFFNSSTSYRVRIALALKGLPYDYAPVNIRKLEHRAADYVA
FT                   RNPSANVPLLDDGRLALGQSLAIIDYLDARHPEPRLIPADPDQRARVLELSYAIACDMH
FT                   PVNNLRILRYLQDVLGATDEQKNAWYRHWISEGMATVESLLQRHGSGPYCFGAAPTLAD
FT                   CCLVPQIANAQRMGCDLSAYPHAMRVYTHCGEQPAFQAAAPQRQPDYAG"
FT   CDS_pept        complement(561078..562043)
FT                   /transl_table=11
FT                   /gene="bug16"
FT                   /locus_tag="Bpet0514"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40846"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1C3"
FT                   /protein_id="CAP40846.1"
FT                   /translation="MNTLIRAMAALALALAATASHAAWPERPITLVVPFTPGTGIDLIA
FT                   RQLAARLPQALGQPVVVENLAGASGNIGTEKAARAEPDGYTFLVTVNTLVMNSSLYKGK
FT                   LHFDPLKDLAPIGQTSWGSLLLVTHPSNPAATVADVVKAAQAAPGKLTYGTPGVGTPHH
FT                   LSMALFLDRTHASMLHVPYKGTAGAVTDMLGGRLDYMFLPVHVALPQVRAGKLKVIATG
FT                   SPRRLPQLPDVPTLTEAGLQGADVDMWYGLFAPAGTPEAIVQRMNQSINVILQDPATAR
FT                   AFDAQGMVPATSTPAEFGALVARDAKRWDDIITRTGISAD"
FT   CDS_pept        complement(562134..563393)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0515"
FT                   /product="putative FAD dependent monooxygenase"
FT                   /function="2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /EC_number="1.14.13.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40847"
FT                   /db_xref="GOA:A9I1C6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1C6"
FT                   /protein_id="CAP40847.1"
FT                   /translation="MKTDTDVVIIGAGVGGLVLALSLHQAGIGCRVFEAVPEIRPLGVG
FT                   INLLPHAARELDELGLLPALDAVGVHTKESIFFTRHGQFIYSEPAGKAAGYDWPQYSIH
FT                   RGDLQMALLAAVRERLGADSVVTDSRCVRVDQDADSVTVHLVNGAGEALPPVRGAIAVG
FT                   CDGIHSAVRKQLYPHEGPPRYSGVNMWRGVTRHPAFLSGASMVRAGWLASGKMVIYPIR
FT                   DAIDADGNQLVNWVAEIESPVPAQRDWTRAGRLEDFYPAFADWQFDWLDVAALIRNADS
FT                   ILEYPMVDQDPLPTWTRGRMTLLGDAAHPMVPRGSNGAGQAVIDARYLAGRLKHLGLGE
FT                   AALQEYDRARVEATTRVVLTNRSNPPDAILREVYERSGDRPYQRIEDVISREELEGISH
FT                   RYKQVAGFDPAGLKARASFL"
FT   CDS_pept        complement(563397..564095)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0516"
FT                   /product="putative fumarylacetoacetate (FAA) hydrolase"
FT                   /function="2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-
FT                   17-dioic acid hydratase (catechol pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40848"
FT                   /db_xref="GOA:A9I1C9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1C9"
FT                   /protein_id="CAP40848.1"
FT                   /translation="MSYVFTPAAPVSVPVAGSQDRYPVRRVYCVGRNYAAHAREMGFDP
FT                   DREPPFFFCKPADAVVPAEAGATLEIPYPPETANYHYEIELVAAIGKGGARIPVEQALE
FT                   HVWGYAVGLDMTRRDLQMKMREAGRPWELGKAFDHSAPIAPLRRAADAGDLSRAAIWLQ
FT                   VNGQDRQRSDTSKLIWSVAETIAYLSNYFRLEPGDLIYTGTPEGVGPVKVGDLMEGGVE
FT                   GLDALRVRVA"
FT   CDS_pept        complement(564132..565184)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0517"
FT                   /product="putative gentisate 1,2-dioxygenase"
FT                   /function="Gentisate 12-dioxygenase"
FT                   /EC_number="1.13.11.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40849"
FT                   /db_xref="GOA:A9I1D3"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR011960"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1D3"
FT                   /protein_id="CAP40849.1"
FT                   /translation="MPDGHPSADARAAYYARIARKNMAPLWESLHNLVPRQPAPRCLPA
FT                   LWKYNDVRADVLESGTLISAEEAVRRVLILENPGLAGQASITQTLYAGLQLILPGEIAP
FT                   SHRHTQSALRFIVEGKGAYTAVDGERTTMHPGDFIITPSWTWHDHGNLEAADGGEPVIW
FT                   LDGLDIPLLRFLDAGFAENYPAATQPVSRPEGDSTARFGHNMAPVRYQPASGSSPIFNY
FT                   PYERSREALDQLYRHGELDAWDGVKLRYVNPATGGYPMPTMATFMQFLPAGFQGKTYRS
FT                   TDSTVYSVVEGRGTARIGDQQFEFGPRDIFVAPSWQPVQLGALEDATLFSYSDRPVQAA
FT                   LGLLRESREG"
FT   CDS_pept        565319..566248
FT                   /transl_table=11
FT                   /locus_tag="Bpet0518"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40850"
FT                   /db_xref="GOA:A9I1D6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1D6"
FT                   /protein_id="CAP40850.1"
FT                   /translation="MDWTHRLRLRNLKMLLSLAQTRNISHSAAMLNTTQPGLSKWLKDL
FT                   EEDIGLPLFERHARGLRPTPYGEALIAHAQRIDAQLDRASGDMAALREGGGGRVVIGAS
FT                   GASASDTVPLAVLRLFERMPQARVKLVEGTTDRLLAQLAQGDLDIVVGRYAPEHHDPAV
FT                   QSEALYLEPVHLVARPRHPLFTKTQVQWPDVQAYRWILWPKGTPIRNALDTALEAVGLS
FT                   APADAVESNSVTVNLTLINNSDLIGVASHRAALRFSHMNAMRIVPLRLSGFGSVAMYWR
FT                   RETFLPAAVEAAMACLRQAVADHAPAPR"
FT   CDS_pept        566659..569043
FT                   /transl_table=11
FT                   /locus_tag="Bpet0519"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40851"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1D9"
FT                   /protein_id="CAP40851.1"
FT                   /translation="MDNVISLQRRTVVARTPLPGDMLAFRGMVGHEALSQLFEFDIDLA
FT                   SPSHSLDMKQLLGKPLTLDIQAAGGLRHLNGHITRCKLAGREGPTSRLYRYRATVRPWL
FT                   WYLTQTSDSKIFQNKSVPDVIREVLAEYPFPVEFKLAGSYRNWEYCVQYQETDFAFISR
FT                   LMEHEGIYYWFRHDADRHTLVLADDITQHETCPGYDTIPYYGPDRITVPRQEYISSWEI
FT                   AEQITPGAFATSDYHFETPGADLQARRNNPGAYDHGDLEMYEWQGGYTNPADAERYTRI
FT                   RLEELQCRQEQINGACNVRGMAPGYLYTLRNHPRQAENREYLILSAHYRIQEAGEASGL
FT                   DAAAFDVGFTVLPSATPFRAPRITPVPHTHGPQTARVVGKAGEQIWTDSYGRIKVQFHW
FT                   DRYGQKNENSSCWVRVSSPWAGGGFGGIQLPRVGDEVIIDFIGGHPDRPIVIGRVYNAS
FT                   NMPPWELPGNATQSGFLSRSRDGTPGNANALMFEDKPGSELVWLHAERDLTSEVEGNEL
FT                   HNTDGTRCTTIGSNDTTVIGALGGGNRDITVHGTDRLQVDSTRNVNVDGAETYTVKQQR
FT                   TVHVTDGLMKEEFDQGLHTTVAANGEIRNITGLFDETLNDGEKRLVTGAFEETIDGDVT
FT                   QTIKGGGTFTETIMANHIHDLTGTQDSTITGAVTHTVNGTFTQTVTEPLTVNADTSMTV
FT                   NTPSWTVSGAKQAFWTGSFLRGTPARATVVLAAADLWGVRQQVYAGINSQWSTVKLDLA
FT                   AFKNGDQGFEFGGAATQIKGIGVQIKSGVAGIISRVANIFP"
FT   CDS_pept        569057..569464
FT                   /transl_table=11
FT                   /locus_tag="Bpet0520"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40852"
FT                   /db_xref="GOA:A9I1E2"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1E2"
FT                   /protein_id="CAP40852.1"
FT                   /translation="MSNMAWWAAGTIATAVFIGFVAMVVRENARLFDQERELAAQLAAA
FT                   GQPAVATVLALSRQPGGRPFALPVKLSLRFADFEGREQQADLRLHIDRELLAGFMPGQT
FT                   VHVRYDRSQPARVAVDRLLTPTEIPAAWRGK"
FT   CDS_pept        569483..572110
FT                   /transl_table=11
FT                   /locus_tag="Bpet0521"
FT                   /product="putative secreted protein"
FT                   /function="exported protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40853"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1E6"
FT                   /protein_id="CAP40853.1"
FT                   /translation="MKIVKPLRLGVMSRPYVMRGRARLGVSVLALASLGDTALLQPEAD
FT                   LWALVGEMLGEDGVLDLGVPKPCAEFLVSGSAYTAHQPQRNACVARVRVGSLRKSLMVM
FT                   GDRYWLDRRATEPLPFDAMPLDWRHAYGGPSYPDNPRGRGADEEIVNGVRTRRLPNIEP
FT                   LDGRMTRPDQQPEPAGFGPVSPMWPRRFRRAGAYHDSWLDNGARGFLDTLDPHFFNAAP
FT                   PDQWWPGQPEFAPGVDYEIWNMHPTHARLAGVVPDWRARCFLRHAESQALRALDLGLTT
FT                   AWLFPDRDRVVLIYQGATDIAEDDGADIDLLMPALDPPDAMRPPSHYEAVLARRLDPDY
FT                   GPLHVLLDDELLPEASLGPWESLDSWNPMSSPLNRNQRARAASMRQRMRDEARAAGLDA
FT                   SAFDVPEPPAFATPSLRELPGLARQARHAAEEARIDMLHARRELARQLQAEAGNMPPGM
FT                   TPALLLDGAQAGAGPGGPPTLYGHSGLATLQELAAGQPLGQGDAALDGASMRAMMARAD
FT                   GQLREMYLRGAHLQPAAEAARPARAARLRRRVQALLAGSRDLSGLDLTGADLSGLDLSG
FT                   ARCVGTWLECADLSGARLDGADLTRAVLARARAEAGSWRDVTLRHANLGSATLTDTNLS
FT                   GAHIAHCELAGIRLQRCDLSGLTMQDCHLPGVELAGCHFDGAVFDTVTFWQQARLTDLA
FT                   FTQVRMARVSWVDCVLDGVAYEGAELLRCSWVQVECDTPVDWTRARLTTCCVVLTDLDE
FT                   AVFTEATLHESSLRNIGLAGADFTGAQLQRCDLSGADLRDAVLAGARADESLFIRASLA
FT                   GADLADADLKNALLHKADLTQADLRGANLFRADLAQALLDRSTDTRGAYVHLANTRPAT
FT                   RPSA"
FT   CDS_pept        572107..573204
FT                   /transl_table=11
FT                   /locus_tag="Bpet0522"
FT                   /product="conserved hypothetical protein"
FT                   /function="protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40854"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1E9"
FT                   /protein_id="CAP40854.1"
FT                   /translation="MMTPAMLRERIKGGEALSDLNLRGIALDGLDLAGAVMHRCDLTGA
FT                   SLAGADLRDSCFSECRMERTDWRGADVSECAFFRCDLAQADFREAACADTAFVECRAPR
FT                   IDFRGNTLKSCHFTQTALSGARLVDVTLHEGSYAECALDEASFAKARMAKVTFVRADLR
FT                   HTDLAGAALDKTVFIESDLSGLALAGQALDGCQFIDARMDGCDLRRAKLVQANFKGASL
FT                   RRARLNGAHADRALFVQADLTQADAAGASFEQSAWPDACLDGAVLSGANLTQAVLHRAR
FT                   CVATRFDGARLVYTDFSYADLRDADLRHAQLLRTQLHRALADGARWSSRDGVLDNDPAL
FT                   YEAELWSARRGADVAARKGRPAPTR"
FT   CDS_pept        573002..574114
FT                   /transl_table=11
FT                   /locus_tag="Bpet0523"
FT                   /product="hypothetical protein yqcG"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40855"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="InterPro:IPR026835"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1F1"
FT                   /protein_id="CAP40855.1"
FT                   /translation="MPICATPTCGMRNCCAPSCIAPWPMARAGARATASWTTIPRCTKP
FT                   SCGRRGAAPMLPRARADRPRRDKGDRVFADCQLMGMDLAFPDICKTPPALLPIPYPNFA
FT                   IGPMAIPNVWNTLLMMMPAHNLLTTIPMTNGDNAGVALGLISQTVMSQARRVTCVPNVL
FT                   FGCIPATRLTCLTVQNTINTMGMRALPSQLKVVLLGGGGGAGRGAKAAGGGAPGRGLRT
FT                   GRLATRSAKSGKPGKAGPASGSGTPGSPRPAAQAGKPAKTGAQKGDPRYKRGKFRKGVR
FT                   DKAWDTAKGKDGQVRDPVTKKTMRKDEPWDMGHKPGYEHHKHVKSAAERDIDRKQFLDE
FT                   YNDPSHYRPELPRSNRSHQGELKTDDYFGF"
FT   CDS_pept        574149..574706
FT                   /transl_table=11
FT                   /locus_tag="Bpet0524"
FT                   /product="hypothetical protein yqcF"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40856"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1F5"
FT                   /protein_id="CAP40856.1"
FT                   /translation="MARHALAVFEGTPVVHAYRHDEIDLSIDILVVDDSPDDGLVSYST
FT                   VGLFETELRHGDGKPLPMRIELCAEAPQEQEFWGNILSTAAFGLMRDGHAALPGSALPD
FT                   CVGEYYPDATVPHLYLCVPFSWQDGEFRRLELGGQIINWLQAFPISDAELAYLKTHGAD
FT                   AFEDLLLEHDPDLYDLERDSIV"
FT   CDS_pept        complement(576044..577564)
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="Bpet0525"
FT                   /function="Glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40857"
FT                   /db_xref="GOA:A9I1F8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1F8"
FT                   /protein_id="CAP40857.1"
FT                   /translation="MTKSFILALDQGTTSSRAIVFDRQGQARGVGQREFRQYYPQPGWV
FT                   EHDAGEIWQSQLDVAREALRNAGASAADVAAIGITNQRETTLIWDRASGRPLARALVWQ
FT                   DRRTAPLCDKLREQGHDRLLQARTGLVLDAYFSGTKLAWLLDNVPGARQAAQRGELAFG
FT                   TVDTWLVWQLTGGQVHSTDPSNASRTLLYDIHTQDWNDEILALLDIPRSVLPSVAPSSA
FT                   EVGRALPEWFGGPIPIAGIAGDQQAATFGQACFKPGMAKNTYGTGCFMLMNVGDAPVAS
FT                   RNNLLSTIGWGLPGQGAGPAGRPTYMLEGGVFMAGAAVQWLRDGLGIIQRSDQVEALAA
FT                   SVPDTDDVFLVPAFAGLGAPDWDPYARGTLVGLTRGTTRAHVARATLEAIALQSAELLT
FT                   CMNADSGIGLSELRVDGGAARNDLLMQMQTDLLGVPVVRPRVSESTARGAAGLAGLAVG
FT                   FWSGMEEFAGQWEAERRFEPRWNADQRAARLARWRQAVEHAKGWARPA"
FT   CDS_pept        complement(577617..579209)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0526"
FT                   /product="putative transport protein"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40858"
FT                   /db_xref="GOA:A9I1G1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1G1"
FT                   /protein_id="CAP40858.1"
FT                   /translation="MRRLVGLQEAGDFGFVIACHGTNVICTSCGSPEFTSAPGSRRRYN
FT                   RGAPLSPADMPADTASSPSPSSPPQDAARAARMIPFIVGCALFMQMLDSTVVATALPVM
FT                   AQALGSTAVRLNVAITSYLLAVAVFVPVSGWAADRYGARRVFMAAIALFTLSSVACALS
FT                   QNLTQLVLARIVQGIAGAMMVPVGRIILLRVVPKQDLLKAMSFLSIPALLGPVIGPPLG
FT                   GFMVTYMSWHWIFLINIPIGILGIALVRRYVPEIREASTPRLDWLGFLLSAICLATLVS
FT                   AFEALGHSLIPPLAVASLAATGLLCGALYVLHARRAAHPIIDLTLLREPTFAISVLGGN
FT                   LCRFAVGAMPFLLAVQLQVGFGLTPFSAGLITFASAAGALLMKFVATPIVQRFGFRRVL
FT                   TVNAVLTGLFIVACAAFTATTPVWLLIGILLAGGFFRSLQFTGVNTLTYADIPPERMSS
FT                   ASSFAAMAQQLGISLGVGVAAVTLNLSMAVRGADHVAIGDTVVAFLVIGGLCAASLLSF
FT                   RRLSPSAGAQLQG"
FT   CDS_pept        579401..580288
FT                   /transl_table=11
FT                   /locus_tag="Bpet0527"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40859"
FT                   /db_xref="GOA:A9I1G5"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1G5"
FT                   /protein_id="CAP40859.1"
FT                   /translation="MTSNSPVSGEALAALVEPPVDSTPDVVDSVAFARLYGEPLFQLPT
FT                   DLYIPPDALEVFLETFEGPLDLLLYLIRKQNFNVLDIPMADVTRQYLSYVEQIRLHNLE
FT                   LAAEYLLMAAMLIEIKSRMLLPVKKTDTGEEPEDPRAELVRRLLEYEQMKLAAQKLDAL
FT                   PQLGRDFKSAQAVADITTERMLPDVSVDDLRAAWADIIKRAKLNQHHHITREQLSVRDH
FT                   MTHILRRLNDVRFMEFGELFMERIREGAPVAVVVVHFIAMLELARESLLDITQAEPYAP
FT                   IYVRLAYTSVAAAA"
FT   CDS_pept        580327..581169
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="Bpet0528"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /function="Panthothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40860"
FT                   /db_xref="GOA:A9I1G8"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I1G8"
FT                   /protein_id="CAP40860.1"
FT                   /translation="MKVVHTIQELRDHLRGQNRVSFVPTMGNLHEGHLALMKLARQHGD
FT                   PVVASIFVNRLQFGPNEDFDRYPRTLRDDIEKLEKARDVYVLFAPDEREMYPEPQNYRV
FT                   QPPDDLGDILEGEFRPGFFGGVSTVVLKLLSCVQPRVAVFGKKDYQQLMIVRNMCRQFQ
FT                   LPVDIVAHETVRADDGLALSSRNRYLSPAERAEAPALYQALQSLRQQVAAGARDLPAIE
FT                   REAAQALAARGWQVDYLAVRRQRDLQTPQPQDLSAGEPLVALAAAKLGATRLIDNLEL"
FT   CDS_pept        581287..581520
FT                   /transl_table=11
FT                   /locus_tag="Bpet0529"
FT                   /product="putative regulatory protein"
FT                   /function="Response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40861"
FT                   /db_xref="GOA:A9I1H1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1H1"
FT                   /protein_id="CAP40861.1"
FT                   /translation="MQDSLSSGSVVGRLTPRERQVVSYLAAGKPNKVVAIELGISLRTA
FT                   EAHRARIFRKLGVRNTLELACTLCRHGGRSRS"
FT   CDS_pept        complement(581538..583625)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0530"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40862"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1H4"
FT                   /protein_id="CAP40862.1"
FT                   /translation="MRFVPARCLRAIRFLLPGLAWFACAGAAAAAPALPVAAAAPPTLA
FT                   ECRGIKDLAFVAHLDDDLLFMNPDIASNIEAGGCVQVVYLTASDAGEGEPYMLGRERGV
FT                   RAAYAYMAKQPDLWKADTVQVGAYHVARFTLQGNPHVQLWHMRLKDPWLGKGWGSLTPL
FT                   SQAESVPGMTADTLGPYHETYRRADLVHTLAAIIGGYGPTTVRHLDDTISVPYTKLCWR
FT                   CAGHGHPDHIASARLVREAIAQTPGNYAETGYIDYPSQEREANLADAEIASKSEIFRQY
FT                   AWNDYHYCSGPAGCKEPAGPAAAWVRRSYYVSRHDVAPELFADPQGGLMVFAAGEANDA
FT                   VNMWDTRSGRWNTLGGRTAGPLVSFAYPDSSVGILARDTLGGLWINKQNLDGTWKGWQA
FT                   LAGVRAARPPAVAPRGDAAAVVMGNDGLYHWTALRGLDSGWTPWQALPQLPRAVGNAAI
FT                   AKDADSRYWAFAIDRDGWLYVTRQRGSQDEAAWAPWQRVPAPRCGGGLAAIRNAQGLIE
FT                   LYLRDHATRHLLRIVQDAAPAPADTATQVLRWSPAVDLGVEYVGRPAVGADQDGEVAVA
FT                   VLERQGGPLWLVEDGRPTRLEAHAASLPAMRFLQGTLYVVARSAGQLQTYQVLARRDGV
FT                   WAAEAALGGLPMAGGGPFGPRIPTAGALTATATGPVTAATATLTPAAAGTGITAADGPA
FT                   R"
FT   CDS_pept        complement(584172..584909)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0531"
FT                   /product="putative lipoprotein"
FT                   /function="Uncharacterized lipoprotein NlpE involved in
FT                   copper resistance"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40863"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1H8"
FT                   /protein_id="CAP40863.1"
FT                   /translation="MPDPVLSPAPRRSFPTLTVAALAGTVLLAAGCAQQRSQGYYNPPA
FT                   ASTTTDAQYQGEGAGYRPVVRAPSQLQIELKAPPPGQTRGRTDAEDAAAAKATESSADA
FT                   AAEAAGSVSPAAHALVPQPQTYMGTLPCLTPSPQCAAQRVTLTLAPNGRWRSRIAYLDS
FT                   AGNLGKPSAEQGCWDATAERPPRVLLAGADGTQRIELIVAANNVLRVKSVLGKSPNLNY
FT                   SLTRQPDLDAIDELSGQPAPKCL"
FT   CDS_pept        585083..585931
FT                   /transl_table=11
FT                   /gene="pilD"
FT                   /locus_tag="Bpet0532"
FT                   /product="prepilin signal peptidase"
FT                   /function="Type II secretory pathway prepilin signal
FT                   peptidase PulO and related peptidases"
FT                   /EC_number="3.4.23.43"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40864"
FT                   /db_xref="GOA:A9I1I1"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1I1"
FT                   /protein_id="CAP40864.1"
FT                   /translation="MWHPFAVDPGWAIAMAALLGLVVGSWLSVPAHRLPRMMEREWLQQ
FT                   YQEFRPAASGPEPAASAYTLWRPGWHCPACAAPVRGWRRLPVLGWLLLRGRCGACGEAI
FT                   GWRYPAVEVTAALLFALCAWRFGPTPIALCAMGLCAALLALAWIDLQTSLLPDAITLPL
FT                   AWAGLLVNLGGALAPLPLAVLGAVVGYVFLWLLFHMFRLLTGREGMGYGDFKLLAALGA
FT                   WFGLAALPGLLLVASLAGVAGAGILRLTGHARRGQPLPFGPYLALAGMVMLLAAGGAAW
FT                   F"
FT   CDS_pept        585995..586639
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="Bpet0533"
FT                   /function="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40865"
FT                   /db_xref="GOA:A9I1I5"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1I5"
FT                   /protein_id="CAP40865.1"
FT                   /translation="MYKIGLTGGIGSGKTRVADMLAEWGAAVVDTDAISHDLTAPGGAA
FT                   MPAIGQAFGDAAVAADGSLDRAWMRDLVFREPDARARLEAILHPLIGLHTRRAAEAAQG
FT                   DYLVFVVPLLVESGRWREQVDRICVVDCDPATQVARVQARSGLTEQAIRRIMAAQAARA
FT                   TRLAAADDVIINDGATSAQQLRARAKALHDSWCRLAAAPRRLPPGAAGIPE"
FT   CDS_pept        586680..587432
FT                   /transl_table=11
FT                   /locus_tag="Bpet0534"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40866"
FT                   /db_xref="GOA:A9I1I9"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I1I9"
FT                   /protein_id="CAP40866.1"
FT                   /translation="MILYEYPFNERVRAYLRLEYLFDRLFYFAREGDARHHQIAVATLF
FT                   DILDATERTDIKTSVLQDLERQRAALQALRDHPGVAQDALESMLAEMERTVSGLAGQGR
FT                   AGQPLRENEWLVSLRGRLAVPGGATQVDMPSYHAWQHRTEAVRCADLQTWTAPLRPLHD
FT                   AVAMALRLLRESGRRSEIVAEQGGYQQMLAGKLFQLLRVWIDPAQGVFPEISANKYMIW
FT                   IRFSAQDGDAKPQQVARNIDFQMSLCSS"
FT   CDS_pept        587565..588815
FT                   /transl_table=11
FT                   /locus_tag="Bpet0535"
FT                   /product="HlyD family secretion protein"
FT                   /function="adaptor protein, connecting a primary porter in
FT                   the cytoplasmic membrane with an outer membrane factor
FT                   protein that serves a porin or channel function in the
FT                   outer membrane."
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40867"
FT                   /db_xref="GOA:A9I1J2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1J2"
FT                   /protein_id="CAP40867.1"
FT                   /translation="MPERQSATPTPRRKRRLAAIVLLLLAAAVAAWLLFKPGGSQQAAT
FT                   RGGRGFGGAATMNMPVPVRVAEAGTQDINIVLRALGTVTAYNTVTVRSRVDGELVRVAF
FT                   AEGQRVKAGDLLAQIDPRPFEVALAQAQGQQQQNQALLANARRDLQRYQTLFKQDSIAR
FT                   QQLDTQAALVRQYEGTQKIDQAAVDNAKLQLSYTRITAPINGRLGLRRVDPGNLVSAGD
FT                   TDGLVVITQTQPIAVVFSLPETQLPEVLEQVRAGRTLTVQAYDRADTQAIASGQLETID
FT                   NQIDVATGTVKLKARFDNADEMLFPNQFVNVHLLVQTRPDTTVIPTAAVQQGSAGAFVF
FT                   LLRQDSTVEVRQVKLGAINGDRVAVNEGLAPGDRVVVEGTDRLRTGAKVNVVTGDAAIP
FT                   ATPGQALGAGQSAPKAP"
FT   CDS_pept        588812..591901
FT                   /transl_table=11
FT                   /locus_tag="Bpet0536"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /function="Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40868"
FT                   /db_xref="GOA:A9I1J4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1J4"
FT                   /protein_id="CAP40868.1"
FT                   /translation="MSPSRLFILRPVATTLSMVAILIAGFIAYRLLPVSALPEVDYPTI
FT                   QVVTLYPGASPDVMTSLVTSPLERQFGQMPGLNQMSSTSSGGASVITLQFSLDLSLDVA
FT                   EQEVQAAINAASNLLPSDLPVPPIYNKVNPADAPVLTLAISSPTMPLPQVRDLVDTRMA
FT                   QKLSQVPGVGLVGVAGGQRPAVRIQVNPRALAAAGMSLADLRTAVVGANVNQPKGNLDG
FT                   PERSTTIDANDQLKSPTDYNDLIIAYRNNAPLRLSDVATAVQGAEDVRQAAWAGGQPAI
FT                   LLNVQRQPGANVIDVVDRIRAMLPQAQAALPATLDVSIVSDRTQTIRASVSDVQFEMML
FT                   AVALVVMVTFLFLRSLTATFIPSVVVPLSLVGTFGIMYLAGFSINNLTLMALTIATGFV
FT                   VDDAIVMIENIARHLEQGETPMQAALKGAAQIGFTLISLTFSLIAVLIPLLFMTEVVGR
FT                   LFREFAITLAVAILISLVVSLTLTPMMCARLLRPESEQRHGRFHQATGAFIDRTIAHYD
FT                   RMLQWVLAHQRLTLLVALGTFVLTALLYIAIPKGFFPQQDTGMIQAITQAPASVSFPAM
FT                   AQRQQEAARIVLQDPDVESVSSFIGVDGTNATLNTGRMQIALKPHGERDGDLAEVTRRL
FT                   QQALDAQQGLKVYMQPVQDLTIEDRVSRTQYQMTLSNPDIAVLAEWAPKLVERLSQLPE
FT                   LTDVAHDLQDDGLQTWVDIDRDAAARLGISTSAIDEALYNAFGQRLISTIFTQSNQYRV
FT                   VLEVLPQFRQSPEALGQIHLATESGTLVPLSAVAHISQGRTMLAINRLDQFPMTTVSFN
FT                   LAPGASLSAAVDAIAEAEAGIGMPASIETRYQGAALAFQNSLSSTLWLILAAVITMYIV
FT                   LGVLYESYIHPVTILSTLPSAAVGALLALMISGTELDMIGIIGIILLIGIVKKNAIMMI
FT                   DFALEAERKRGLAPRAAIHEAALLRFRPILMTTLAALFGALPLMLSTGTGAELRQPLGL
FT                   VMVGGLLLSQVLTLFTTPVIYLMFDRLARRGRARPVAEQP"
FT   CDS_pept        591898..595014
FT                   /transl_table=11
FT                   /locus_tag="Bpet0537"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /function="Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40869"
FT                   /db_xref="GOA:A9I1J7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1J7"
FT                   /protein_id="CAP40869.1"
FT                   /translation="MILSAPFIVRPVATVLLCLGLVLAGVLSFRLLPVAPLPEVDLPII
FT                   SVTANLPGASPETMASSVATPLERSLGSIAGVTEMTSRNSQGSTRITLQFDLSRDIDGA
FT                   ARDVQAAINAARSLLPTGLRSNPTYHKVNPSSAPIMVLALTSDTLSQGRLYDLASTIVA
FT                   QKLAQVNGVGEVTVGGSSLPAVRVNLIPGALSSRGVSLDEVRATLTEANANRPKGVVEN
FT                   DRYHWQIMASDQLERAEQYRPLVVAWRDGAAVRLSDVATVEDSVEDLFQTGFYNNRQAI
FT                   LLILRRQADANIIETVEAIRAQLPQLAALLPGDVDMTVAQDRTPSIRASLHEAELTLVV
FT                   AVALVMLVVLLFLRHWRAALIPSVAVPVSLVGTFCIMYLCGYTLNTISLMALIVATGFV
FT                   VDDAIVVLENIMRHIEQGASPMRAALRGSREVGFTVLSMSLSLVAVFIPILLMGGVVGR
FT                   LFREFAVTLSAAIMVSLVVSLTLTPMMCARLLRTQDHGRAPGRLSRAIGRGFDAVLARY
FT                   RRSLSWALAHGRIMLLLLAAAIGLNVYLYAVVPKGFFPQQDTGQLLGFFRVDQGTSFQA
FT                   TVPKLEYFRKVILSDPAVASITVHAGGRGGSNSSFMSIQLKPQAERKASANDVVNRLRG
FT                   RLQNTPGARVFLVPQQDIFLGGGQGSGSYDYTLLAGELSLLRTWMPKVQQAMAALPELT
FT                   DVDTSVEDKGRQVELVIDREAATRLGISMSDISAVLNNSFSQRQVSVMYGPLNQYHVVM
FT                   GVVQRFAQDAESLKQVHVITQDGRRVPLAAFAHFESGNAPLSVRHNGLLAADEISFNLA
FT                   PGVSLDQAIRAIDAAVARIGLPSDQIQAGFLGTAAAQQEVQSQQPWLILGALVTMYIVL
FT                   GILYENLVHPLTILSTLPSAGIGALLALMLVGSEFTIIALIGVFLLIGIVKKNAIMMVD
FT                   FALDAERRRGLSPRDAIFEACLTRFRPIMMTTLAAIFGALPLVLATGAGVEMRQPLGVT
FT                   IVGGLILSQILTLYTTPVVYLYLDRFRLWARRRRGAHGAADPQPDVERP"
FT   CDS_pept        595011..596507
FT                   /transl_table=11
FT                   /locus_tag="Bpet0538"
FT                   /product="putative outer membrane efflux protein"
FT                   /function="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40870"
FT                   /db_xref="GOA:A9I1K0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1K0"
FT                   /protein_id="CAP40870.1"
FT                   /translation="MSRASSSLFFFPAARASRGAAAVLCCALLSACAVGPDYQRPAIDL
FT                   GDAYKEAQAEGWKPAQPRDAAERGAWWRVYGDATLDGLMAQLNAANLSIAQAEANYRQA
FT                   QALVQGARAGFFPTVGADAGVTRAGGGSSASGAGVSNQYSLGGTASWELDLWGRVRRDV
FT                   EASRAEAQASLGDLANARLSAQSALAQDYFQLRILDEQKRLLESTVQAYERSLQLTQNR
FT                   YQAGVAGRGDVSVALAQLESARAQLVDLEWQRGQFEHAIAVLVGLAPSRFALPPQPFAQ
FT                   AVPQIPAGVPSELLERRPDVASAERRAAAANAQIGVAQAAWFPDLVLSANGGFRSGEFA
FT                   QWLTAPARFWSLGPALALTLFDGGARQAQLDQARAAYDAQAALYRQTVLGALREVEDYL
FT                   IQLRVLEQEQVVQRRALDATRESLRLARNQYQAGLIGYLDVAVLETSALTSERNAITLV
FT                   GNRLAASVQLIAALGGGWEGLDAEQAGAGDDAGADDSSGS"
FT   CDS_pept        complement(596593..597555)
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="Bpet0539"
FT                   /product="bifunctional DGTP-pyrophosphohydrolase/thiamine
FT                   phosphate synthase"
FT                   /function="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40871"
FT                   /db_xref="GOA:A9I1K3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1K3"
FT                   /protein_id="CAP40871.1"
FT                   /translation="MSERIVDVAAGLILRPDGQLLLGQRPEGKPWAGWWELPGGKLEPG
FT                   ETVLQALARELGEELGIEVTQAVPWVTYVHVYPHTTVRLAFCQVTGWQGEPRGLENQQL
FT                   QWVDPARAGEVGDLLPATLPPLRWLQLPDTYGISAIGGRAGLPDFLERLERALARGLKL
FT                   VQLREPGWPDGPGATSLRDALQAVLKLCHAAGARVLVNSAHPASWWRQADGVHLRWADA
FT                   ALLQARPELPADALVGVSTHDHAQVVHARELGADFAVLGPVAETPSHPDTAGIGWQGFV
FT                   AGTRDAGLPVLALGGQSADTLAEARQHGAHGIAGIRALI"
FT   CDS_pept        complement(597548..598414)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0540"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40872"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1K7"
FT                   /protein_id="CAP40872.1"
FT                   /translation="MTSSDFSVLIERAERVLAQLEAWLPAAPPEIDWSAHAYRWRKRGA
FT                   RGWLDAVRHVARIDLADLQHIERQKGIIDRNTLQFLQKKPANNVLMTGARGTGKSSLVK
FT                   AMLAAYGDRGLRLIEVDKSDLGDLPDIVELVAARPERYIVFCDDLSFEEGEAGYKALKS
FT                   VLDGSVSASGDNVLIYATSNRRHLMPEYMSENLQARHQPDGEIHPGETVEEKISLSERF
FT                   GLWLSFHPFKQDDYLDIVHHWLRELDCPAEQIEACRAEALQWALERGSRSGRVAYQFAR
FT                   DWAARHV"
FT   CDS_pept        complement(598439..599665)
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="Bpet0541"
FT                   /product="arginine biosynthesis bifunctional protein"
FT                   /function="N-acetylglutamate synthase (N-acetylornithine
FT                   aminotransferase)"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40873"
FT                   /db_xref="GOA:A9I1L0"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1L0"
FT                   /protein_id="CAP40873.1"
FT                   /translation="MAVNLQIPSESEIFPVAGVEIGVTEAGIRKANRRDLTVFQLAPGT
FT                   NVAGVFTRNRFRAAPVQVCEAHLAAGGPIRALVINTGNANAGTGAEGLQKAQDTCVALG
FT                   KLMGVPAQQVLPFSTGVILEPLPLDRLTAALPAALAGLGADQWFNAAHGIMTTDTLPKI
FT                   HSRRVQIGGKTVTFTGISKGAGMIRPNMATMLSFLATDAGIAQPLLRKLALEIANRSFN
FT                   RITVDGDTSTNDSFIIAATGQSGIDIATESDPHYAAVRDALAAAALDLATKIVRDAEGA
FT                   TKFITIRVEDALTTEEALKVAYSVAHSPLVKTAFFASDPNLGRILAAIGYAGIDDLDVS
FT                   KLRLWLDDVLVACDGGRNPDYQEADGQRVMKQPEIGVRIALARGQANETVYTCDFSHDY
FT                   VSINADYRS"
FT   CDS_pept        complement(600273..600761)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0542"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40874"
FT                   /db_xref="GOA:A9I1L4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1L4"
FT                   /protein_id="CAP40874.1"
FT                   /translation="MIDAPDLETRAAPDDHHALRLWLRMLTCCNLIESEIRGRLRTEFD
FT                   TTLPRFDLMAQLQRAPKGMKMGELSRRMMVTNGNITGITDQLEKEGLVMRTKMETDRRS
FT                   SVLKLTPQGRRVFNRMARAHESWVKAMFNDLPEAGRDALYQALGELKLQVVAARRHGR"
FT   CDS_pept        complement(600769..601671)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0543"
FT                   /product="conserved hypothetical protein, putative
FT                   esterase/lipase"
FT                   /function="Esterase/lipase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40875"
FT                   /db_xref="GOA:A9I1L8"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1L8"
FT                   /protein_id="CAP40875.1"
FT                   /translation="MPALYRQYDRAALDVQYNARATVPDVQPILAQYTAQSQAARAALP
FT                   HTANVPYGDHPDELLDIFAPASQAATPAAGAPVFVFIHGGYWRLLSKDDSCCMAPAFTQ
FT                   AGAVVVAVNYSLAPAVTLDRIVDQNRRALAWVYRHIARHGGDPARIHVCGSSAGGHLVG
FT                   MLLADGWHAQYGVPADVIAGAAPLSGLYDLRPLVHTHINEWMRLSPADAERNSPALLPT
FT                   GAACPLLASYGGTETDEFKRQTDDYLQSWRARGRQARYVPMPHANHFDIVLTLNDPASP
FT                   LTRAIFDQMGLPASGRPIR"
FT   CDS_pept        601870..603033
FT                   /transl_table=11
FT                   /locus_tag="Bpet0544"
FT                   /product="putative ABC transporter substrate binding
FT                   protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40876"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1M1"
FT                   /protein_id="CAP40876.1"
FT                   /translation="MRLLTSLVVAAALAPALSSADPIKVGIANDISGPFAALGAEARDG
FT                   FNLAIKQLGGKLGGQEAEFMQADMGGNPDQARQLVTRYIQRDKIDFFTGPIGSNVALAV
FT                   GPALFAAKVPYLSNNPGPSQYAGERCNQYWFGTSYQNDAFHEAAGKVAADRGFKKVLIM
FT                   APDYPAGKDALTGFKRGYKADVAEEVYTKLGQIDYAAELAQIRAAKPDAVFIFLPGGMG
FT                   INFVKQFVSTGLAQSVKLIGPGFSADEDVIQAVGEPMLGMYNTAQWAHDLDVPQNKQFV
FT                   EAFRKEYGGRYPSVYAAQAYDVIMAMDAAVKQAGGKASDREAIVQALAKADFPSVRGKF
FT                   TYGKNHYPIQAYYLRVIEKDGEGRITNKLVGKVFDSYQDVYVGQCKL"
FT   CDS_pept        603124..604038
FT                   /transl_table=11
FT                   /locus_tag="Bpet0545"
FT                   /product="probable branched-chain amino acid transport
FT                   system, permease component"
FT                   /function="Branched-chain amino acid ABC-type transport
FT                   system permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40877"
FT                   /db_xref="GOA:A9I1M4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1M4"
FT                   /protein_id="CAP40877.1"
FT                   /translation="MTLVVEQLLNGLQFGLMLFLIAAGLTLVFGIMDIMNLAHGSLYMA
FT                   GAYVAAETMQRTGSFVAAVLVAALATGLVGVVLELVLVRRLAVRDHLAQVLGTYAIILI
FT                   ANDLVKMIWGPAPVMLNLPAALSGPVRLLPDLMYPAYRLVIIACGLAAAVGLYWFVTRT
FT                   RAGVLVRAGASNRQMATLMGVRVPLLFLGVFALGAMLAAVAGALLGPITAVQIGMGEEI
FT                   LILVLVCIVIGGIGSIRGAFVGALLVGMVDTAGRAFLPMLLREVLPPAMASSLAATLAA
FT                   ISIYLLMAGVLVFRPAGLFPARG"
FT   CDS_pept        604042..604995
FT                   /transl_table=11
FT                   /locus_tag="Bpet0546"
FT                   /product="probable branched-chain amino acid transport
FT                   system, permease component"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   system permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40878"
FT                   /db_xref="GOA:A9I1M7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1M7"
FT                   /protein_id="CAP40878.1"
FT                   /translation="MRKSTFWTLGLVLALALFPYAAAALGLDFYVSVARRMLIYALAAT
FT                   SLNLILGYGGMVALGHAAFFGAGAYVVGILDAAGIHAALLAWPAAAVVAALLALLVGAV
FT                   SLRTRGVYFIMITLAFAQMVYYLFVSLRQYGGEDGLNLSGYSLLPGIDLADGTSFYYLV
FT                   LALFVLLMWLFGRLVDSRFGAALQGIRENESRMEALGYPVYRLKLTAFVLSGAAAGLAG
FT                   ALLANHNLFISPSLMHWTQSANLLVMVLVGGIGLRYGGVAGAMLMLALEEVLRMWTEYW
FT                   HLPLGILLLCVVFGAPRGVAGLAGPWFAGAARGGRP"
FT   CDS_pept        605051..605845
FT                   /transl_table=11
FT                   /locus_tag="Bpet0547"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40879"
FT                   /db_xref="GOA:A9I1M9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1M9"
FT                   /protein_id="CAP40879.1"
FT                   /translation="MTAHSTAAAPALQADGLVRRFGALLATDHVSLTLAPGEIHALIGP
FT                   NGAGKSTLIHLLSGTLAADAGRLALGGADITRLNAHQRVAAGLSRSYQVTNIFKSFSVR
FT                   DNLLLAAQAHAGSSFRYWKPRAADVALHDTAHALARQCAIDADLLDRPAGTLPHGEQRK
FT                   LEFALALAARPSVLLLDEPMAGMGPDETLRLTDLIESLRGQAAMLLVEHDMQAVFRLAD
FT                   RISVLVYGRIIATGTPAEIRANPEVRRAYLGEDEAATESAIC"
FT   CDS_pept        605839..606543
FT                   /transl_table=11
FT                   /locus_tag="Bpet0548"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /function="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40880"
FT                   /db_xref="GOA:A9I1N3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1N3"
FT                   /protein_id="CAP40880.1"
FT                   /translation="MLSMQGVHSGYGASQVLFGVDLEVGAGQVVSLLGRNGMGKTTLLR
FT                   TLFGQLPLREGGIRFAGQDIGGWTPDRIARAGLAIVPEGRQCFPNLTVREHLTAFTAAR
FT                   NPDIARPWTVERVLELFPRLGERARNLGNQLSGGEQQMLAIGRALVTNPRLLVLDEATE
FT                   GLAPLVREEIWSCLATLRAAGQTILVIDKYVERLLALADRHVILERGRAVWSGDSAALD
FT                   ADRGLWERYLGV"
FT   CDS_pept        607094..609454
FT                   /transl_table=11
FT                   /locus_tag="Bpet0549"
FT                   /product="probable bifunctional hydroxylase/oxidoreductase"
FT                   /function="2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /EC_number="1.14.13.40"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40881"
FT                   /db_xref="GOA:A9I1N7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1N7"
FT                   /protein_id="CAP40881.1"
FT                   /translation="MKIVCLGGGPAGLYFGLLMKLQDPANEVTVIERNRPYDTFGWGVV
FT                   FSDATMDNLRQTDPVSAQTIGDAFNHWDDIDIHFKGRSVRTHGHGFIGIGRKKLLNILQ
FT                   ARCEEVGVKLVFETFVQDDQAAALQYDADLVIASDGINSQVRTRYADTFRPDIDTRRCR
FT                   FVWLGTTKVFDAFTFAFVQTEHGWFQAHAYRFQDGLSTFIVETPEETWQAAGIGAMSQE
FT                   EGIAYCEQLFAPWLDGHKLISNATHLRGAAIWIRFPRVICDTWVHWNTLQTPRGPRRVP
FT                   VVLMGDAAHTAHFSVGSGTKLALEDAIELARCLGGAEGGLEQGLRHYQDVRSVEVLKIQ
FT                   NAARNSTEWFENVQRYAGLEPEQFAYSLLTRSQRISHENLRVRDAGWLEGYERWLAGRA
FT                   GGAVADAAAGARPPLPMLTPYRARGVELKNRIVVSPMAMYSCVDGVPGDFHLVHLGARA
FT                   LGGAGLVMVEMTCPSPEARITPGCPGLWNDRQADAFARIVDFVHANSEARIGIQLGHAG
FT                   RKGSTQLGWQKMDYPLAEGNWPLLSASALPYLPGVSQVPRAMDRADMDRVRDDFAAAAR
FT                   RAAQAGFDWLELHCAHGYLLSSFISPLTNQRDDEYGGSLDNRLRYPLEVFRAVREAWPQ
FT                   DRPMSVRISAHDWVEGGITADDAVEIARRFKDAGADMIDCSSGQVSPDQRPVYGRMYQT
FT                   PFADRVRNEAGIPTIAVGAIFEADHANGIIASGRADLCALARPHLADASWTLREAARIG
FT                   YCDTTWPRQYAAGKRQLETNFERAAMLAQQDAK"
FT   CDS_pept        609451..610242
FT                   /transl_table=11
FT                   /locus_tag="Bpet0550"
FT                   /product="putative oxidoreductase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40882"
FT                   /db_xref="GOA:A9I1P0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1P0"
FT                   /protein_id="CAP40882.1"
FT                   /translation="MNASERPLEGRHALVTGGARGIGLSCAQALLQRGAAVTLLGRDRA
FT                   ALDAAAAALGRLGAVRAVAADVADQASVQAAFEQAAQDGGAVDILVNNAGQAASQRFER
FT                   TDAALWQAMLAVNLTGTYYCIQAALPGMLAAGWGRIVNVASTAGLIGYAYVSAYCAAKH
FT                   GVVGLTRALALEVARKGVTVNAVCPGFTETDIVRGAVDNIMQKTGRTASEARAELAARN
FT                   PQGRLVQPEEVAEAVAWLALPASASINGQAIAVDGGEVMPG"
FT   CDS_pept        610262..611119
FT                   /transl_table=11
FT                   /locus_tag="Bpet0551"
FT                   /product="putative enoyl-CoA hydratase"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40883"
FT                   /db_xref="GOA:A9I1P3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1P3"
FT                   /protein_id="CAP40883.1"
FT                   /translation="MNSASPEHTMKHHRRPYAGYAARTFLWQVSADGKVATITLNRPER
FT                   KNPLTFDSYAELRDLFRGLVYATDIKVVVVTGAGGNFCSGGDVHEIIGPLTRMSMPELL
FT                   DFTRMTGDLVKAMRACPQPIVAAVDGVCAGAGAMMALASDLRLGTPAARTAFLFTRVGL
FT                   AGADMGACTLLPRVVGQGRASELLYTGRAMSADEGAQWGFFNSLHDSAGLLDAAQALAA
FT                   QLAAGPTFAHGITKKLLHQEWNMGVDEAIEAEAEAQAICMQTRDFRRAYEAFVAKRKPV
FT                   FEGD"
FT   CDS_pept        611121..612290
FT                   /transl_table=11
FT                   /gene="acd4"
FT                   /locus_tag="Bpet0552"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /function="Acyl-CoA dehydrogenases"
FT                   /EC_number="1.3.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40884"
FT                   /db_xref="GOA:A9I1P6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1P6"
FT                   /protein_id="CAP40884.1"
FT                   /translation="MADTTWLDWPFFDDRHRALAGELEAWCVDALAGIDHHDTDAACRK
FT                   LVASLGDAGWLRYCVPAGPDGAWGGALPQVDSRMVCILRETLARHDGLADFALAMQGLG
FT                   SGAIALMGSDALRRKYLPRVAAGQAIAAFALSEPDAGSDVAALSCSARADGDHYVLDGA
FT                   KTWISNGGIADFYCVFARTGEAPGARGISAFVVEAGTPGLDIAERIEVMAPHPLATLAF
FT                   DNCRIPASQRLGEPGQGFKLAMMTLDIFRASVAAAALGFARRALDEAVSRARGRRMFGQ
FT                   ALADLQLTQAALGDMATAIDAAALLTYRAAWLRDVQGVRTTREAAMAKMAATESAQAVI
FT                   DRALQMFGGAGVVSGMPVEKLYREIRALRIYEGATEVQKLIIARELLKD"
FT   CDS_pept        612327..613967
FT                   /transl_table=11
FT                   /locus_tag="Bpet0553"
FT                   /product="probable acid-coenzyme A ligase"
FT                   /function="Acyl-coenzyme A synthetases/AMP-(fatty) acid
FT                   ligases"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40885"
FT                   /db_xref="GOA:A9I1Q0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1Q0"
FT                   /protein_id="CAP40885.1"
FT                   /translation="MERSAHLDNYARDHLPPADEWPEFLLDSPDVAYPARMNCAVELVD
FT                   AMVARGHGERVALRWRRDGAAATLTYAGLQALTNRIARVLVEDMGLVPGNRVLLRGPNN
FT                   PMMAAAWLAAVKAGLVTVPTMPLLRAKELKQIIAKAQVSAMLCDAQLRTEAQYCMQAGH
FT                   EHFCPELRQIMLFNDPAPDALDSLAAAKPDDFAACDTAADDVCLIAFTSGTTGLPKGCM
FT                   HFHRDVLAMCDLFPRHVIKPGPDDIFCGTPPLAFTFGLGGLLCFPLRVGASAVLAEKLT
FT                   PDSLLELIQDFRATIVFTAPTFYRQMAALAGKYDIGSLQKSVSAGEALPDATRQLWKQS
FT                   TGIEMIDGIGGTEMIHVFVSSPPEEVRPGAIGKVVPGYVACVVDENMQPVPNGTPGRLA
FT                   IKGPTGCRYLADERQRRFVQQGWNLPGDTFVQDDDGYFFYQARNDDMIVSAGYNIAGPE
FT                   VEDALLRHEAVAECGVVGAPDDERGQLVKAFVVLKPGFDAGPELAAALQAFVKASIAPY
FT                   KYPRAVVFVDALPRTETGKLQRFALRKMA"
FT   CDS_pept        613980..614411
FT                   /transl_table=11
FT                   /locus_tag="Bpet0554"
FT                   /product="probable 4-hydroxybenzoyl CoA thioesterase"
FT                   /function="Predicted thioesterase"
FT                   /EC_number="3.1.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40886"
FT                   /db_xref="GOA:A9I1Q3"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1Q3"
FT                   /protein_id="CAP40886.1"
FT                   /translation="MTAMTAPFVSEVEVRFRHCDPAGIVFYPRYFEMINDFVEEWFDKG
FT                   MGLPFHALHVDRQIGTPLASVQCDFTAPSRWHEKLRQELAVRRIGGASFGADVRFVGPD
FT                   GATRLKAALTIVTVNLRTMRSTAIPDDLRQRMQAFLITG"
FT   CDS_pept        614416..614820
FT                   /transl_table=11
FT                   /locus_tag="Bpet0555"
FT                   /product="conserved hypothetical protein"
FT                   /function="Putative translation initiation inhibitor yjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40887"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1Q7"
FT                   /protein_id="CAP40887.1"
FT                   /translation="MKILQPPGWMPPRGYSNGVMAQVAVGDRLVFVGGQVGWNGQQQFE
FT                   TDDFAGQVRQTLENIVAILAEGGGRPEHIVRMTWYVTDKEEYVASYPEIGRHYREVIGR
FT                   HFPPMTAFQVAGLIESRAKVEIEVTALIPA"
FT   CDS_pept        complement(614856..616484)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40888"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1R0"
FT                   /protein_id="CAP40888.1"
FT                   /translation="MGNEAMLQLTLDADSGALVATCTPSDDTETNPGWDELAAAAQAQG
FT                   WGPEVLDHSGVAAFVTQCREAEPGTLVTGPVGAVLDGALRIDVEPDRMAALLTLTAARG
FT                   GRAMARADIDAALAAQGVVAGIDDEAVSQALQRGHCEALPIARGVPAQPGTPTRFESLV
FT                   PSPLARAHDDNAPVDYRELGTLVLVQPGTALVRRLPAVPGTAGLDVLGQPVPPEPVPDL
FT                   PFATGLAGVAPDEQDPCLLRATAAGAPMLVPQGAQVNSVVEVAAVDLNSGNIEFDGTLR
FT                   VKGDITTGMTVRVGGDVVVGGTVEAAHITAGGSLTVNGGIIGMAEAAPGDHTAGPRTAQ
FT                   VQCEGSVKARFIEHAAISAGQQVVAEREIRHSQVLAGHSVMVGPPGSQQGVVTGGEVCA
FT                   LHSVRAGTLGSMAAVPTVVRVGLDPHAEARRADLQATRTRLGEEKAKLEKVLMFLQMHP
FT                   EKAAADMGERARNTYAKACADLQDLDQHEAELERRLEPLQTATIIAAKRYFGGVTLQVG
FT                   MKVTTLLEDQPGGKARLEAGQLVIS"
FT   CDS_pept        complement(616770..618053)
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="Bpet0557"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /function="Glutamate-1-semialdehyde aminotransferase"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40889"
FT                   /db_xref="GOA:A9I1R3"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I1R3"
FT                   /protein_id="CAP40889.1"
FT                   /translation="MSSNAQLFDRACRSIPGGVNSPVRAFRSVGGTPRFIKRAQGPYVW
FT                   DEEDTRYIDYVGSWGPAILGHAHPDVVQAVREAALDGLSFGAPTRAEVELAEVLIERLP
FT                   SLEQVRLVSSGTEATMTAIRLARGATGRAKIIKFEGCYHGHSDSLLVKAGSGLLTFGNP
FT                   SSAGVPPEFVSHTLTLEYNNLAAVQAAFAQHGADIACVIVEPVAGNMNLIKPAAGFLQG
FT                   LRDVCTQHGAVLIFDEVMTGFRVGPQGVQGLAGIKPDLTTLAKVIGGGMPVGALGGRAD
FT                   LMAHLAPLGGVYQAGTLSGNPVAVAAGLATLRLIAQPGFYEQLAAQTQRLTDGLRQRAR
FT                   AAGIPFAADAIGGMFGLYFQDSVPTSFAEVSAGDADAFKRFFHAMLDRGVHFAPSAFEA
FT                   GFVSATHDNAVIDATLDAAEAVFAAMKG"
FT   CDS_pept        complement(618058..618741)
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="Bpet0558"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /function="Thiamine monophosphate synthase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40890"
FT                   /db_xref="GOA:A9I1R7"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1R7"
FT                   /protein_id="CAP40890.1"
FT                   /translation="MNASPSAAPLRFPAGLYGVTPEWDDTGRLLDAVRQAAAGGMTALQ
FT                   LRRKNASPAQRAAQARALAPLCRELGVVFLINDHWQLALDVGADGAHLGRDDGDLAQAR
FT                   AQAGPGLILGASCYNDLTRARGLLEAGADYIAFGAVFPSSTKPQAVRAPLALLGQARAL
FT                   TADRGAPRPAVVAIGGITPANAPQVAQAGADSIAVITGLFEAPDIRQAAQACAAPFTAS
FT                   THFQP"
FT   CDS_pept        complement(618738..619538)
FT                   /transl_table=11
FT                   /gene="thiD2"
FT                   /locus_tag="Bpet0559"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /function="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40891"
FT                   /db_xref="GOA:A9I1S0"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1S0"
FT                   /protein_id="CAP40891.1"
FT                   /translation="MTPPLILIFGPVDPSGADGLPADAVTCARLGCHGLAAATALTVQD
FT                   TAGIEEIHPVSPELLDDQARCLLEDMPVQAIKVGGLYSAEAASVAAQVAADYSQVPLVL
FT                   HLGQRGLPAHDAASQDDADDLLAATLELVLPQTDLVVVEHLRLAQWHADGDIDIGDAPS
FT                   PMHALAAGGAQWVLVLGAPVRPGHHANVLLGPGGQTATWPWQAPPERNSDTGGVAATAV
FT                   AAMLAQGLDMPKAVEQALRHADDTVGGAFLAGMGRRIPNRIGAP"
FT   CDS_pept        619707..619871
FT                   /transl_table=11
FT                   /gene="rubA"
FT                   /locus_tag="Bpet0560"
FT                   /product="high molecular weight rubredoxin"
FT                   /function="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40892"
FT                   /db_xref="GOA:A9I1S4"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1S4"
FT                   /protein_id="CAP40892.1"
FT                   /translation="MRTWMCLICGWVYDEEAGLPDEGIAPGTRWEDVPPNWVCPECGAR
FT                   KEDFELMEI"
FT   CDS_pept        619931..620536
FT                   /transl_table=11
FT                   /locus_tag="Bpet0561"
FT                   /function="Putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40893"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I1S7"
FT                   /protein_id="CAP40893.1"
FT                   /translation="MTDQNHDTQADDDANDAPATDFSNQFLIAMPQMVEGSLAGSVIYV
FT                   CEHTTRGALGLVINRPTDLTLESLFERIDLTLEIRPVKDSPVFFGGPVQTDRGFVLHAP
FT                   AGDYSSSIKLGDLALTTSRDVLQAVADGNGPARMLVTLGYAGWGAGQLESEMAQNAWLT
FT                   VGADADIIFDVPPEDRYPAALKLLGIDPVMLSGGAGHA"
FT   CDS_pept        620529..620924
FT                   /transl_table=11
FT                   /locus_tag="Bpet0562"
FT                   /product="putative Hollyday junction resolvase"
FT                   /function="Predicted endonuclease involved in recombination
FT                   (possible Holliday junction resolvase in Mycoplasmas and B.
FT                   subtilis)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40894"
FT                   /db_xref="GOA:A9I1T0"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I1T0"
FT                   /protein_id="CAP40894.1"
FT                   /translation="MPEETLLAFDFGEKKIGIAIGNTLTRQARPLEIIFSEIREARFAR
FT                   IGQLLQQWQPQRVVVGLALASDGGEQPATARCRRFANQLRGRYGLAVELVDERGSSMEA
FT                   QRLLGTHAPDDAVAAAVILQRYLDALP"
FT   CDS_pept        621079..621768
FT                   /transl_table=11
FT                   /locus_tag="Bpet0563"
FT                   /product="putative secreted acyltransferase"
FT                   /function="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40895"
FT                   /db_xref="GOA:A9I1T3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1T3"
FT                   /protein_id="CAP40895.1"
FT                   /translation="MFGLLCVGLAYPLMRRGARASLNRYWSRTLMAICGIRVVPGGVPI
FT                   LAGPVLWVANHVSWIDIFVINSVRATAFVAKSEIRGWPLIGWLVAGAGTLFIERGQRHA
FT                   VHAVGESMQARFSQGAAVGLFPEGTTSEGDIVRPFHASLFEPARTAGVPIQPVALRFLQ
FT                   HGRRSPLAAFVGEETLAANLWRVLGATGLSVEIEFLSPLSAHEPDGRPLSRLELSRRAR
FT                   EAVAAAL"
FT   CDS_pept        complement(622058..622891)
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="Bpet0564"
FT                   /product="diadenosine-tetraphosphatase"
FT                   /function="Diadenosine tetraphosphatase and related
FT                   serine/threonine protein phosphatases"
FT                   /EC_number="3.6.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40896"
FT                   /db_xref="GOA:A9I1T6"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I1T6"
FT                   /protein_id="CAP40896.1"
FT                   /translation="MKGSIWMIGDVQGCCAPLEQLLAHPDLAGDPDARFWFAGDLVNRG
FT                   PQSLASLRRIIGLGERAVAVLGNHDLHLLAAAAGVRKPSKSDTIGEILQAPDADDLVDW
FT                   LRHRPLAHFEQGHLLVHAGVLAKWDVAKTLALAGEVQEALRGPNWQKALQKMYGNEPVH
FT                   WKEHHKGGKRMRVIINALTRIRLCTPAGHMEFATKVPPGAWPAGLMPWFDVPGRATRDI
FT                   TVVFGHWSTLGLLLRPDVICLDTGCVWGGSLSALRLQDRKLVQIKCSQFQDPLAD"
FT   CDS_pept        complement(622888..624066)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0565"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40897"
FT                   /db_xref="GOA:A9I1U0"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1U0"
FT                   /protein_id="CAP40897.1"
FT                   /translation="MRTARRYLAREIYRSCAVVLLALLGLFTFFALVDDLDNVGDKFSM
FT                   LALLYMQALALPTRLYDLLPIGLLIGAILALAGLAQRNELVILRVSGVSGMRLLRMLWL
FT                   ITLPLMIGASLLSEFVTPAAEIKSGEASLMFRGKASGTRMDSGYWFKEPTRDGGTRIIN
FT                   IAKLLADGNVEGVTLYEFKPGLQLTTMSTAATGAFTRDKLVLKNVVETHIDDRAAQALA
FT                   DAKPPRTPPASVTKLPQRELDTTLSPERLLARVLTPERMSLNTLLDYIDYLHHNQLDAG
FT                   RQVVALWRKVSYPFTLLVMITIAAPIGFMQTRRGGVGAKVFIGILLGVGFFMLNQLALN
FT                   VGMLSRWPPWLTALGPNVGATLLALGALSLMEYRHATARFAQARWPWRRSPA"
FT   CDS_pept        complement(624146..624880)
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="Bpet0566"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /function="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40898"
FT                   /db_xref="GOA:A9I1U3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1U3"
FT                   /protein_id="CAP40898.1"
FT                   /translation="MPTRRSTMGRIRWGRVIGAAVMALLCLLIMYQLWMFCLVVWYAYR
FT                   DPGSSAIMRQELSRLRETDPDAELKYQWVPYDRISNSLKRAVVASEDANFTEHDGVEWD
FT                   AIRKAWEYNQRQEARGRHKMRGGSTITQQLAKNLFLSSSRSYLRKGQELVLTYMIEHVM
FT                   PKQRILELYLNVAEWGVGVFGAEAAARHYYKTSAANLGSAQAARLAAMLPNPRYYDKHR
FT                   HTSYLNSRTGTLTRRMRMVDIP"
FT   CDS_pept        complement(624887..625750)
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="Bpet0567"
FT                   /function="Shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40899"
FT                   /db_xref="GOA:A9I1U7"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I1U7"
FT                   /protein_id="CAP40899.1"
FT                   /translation="MSQASPLPRYAVIGNPVAHSRSPQIHAMFSSQTGKPLQYERLLAP
FT                   VDGFAATVQAFREQGGLGLNVTVPFKEEACQLAGAHLSERARLAGAVNTLWLRDGAWHG
FT                   CNTDGVGLVSDLLRLGVVLEGARVLLVGAGGAARGVLQPLAAAGCARIHIVNRSAQRAH
FT                   DLAAGWAAAGAVPGTRVTAGALAEAGVAGGWNVVVNATASSLQGAAPELPRGLYAPDAL
FT                   AYDMMYAAHPTAFMRQATDDGAARTADGLGMLVGQAAESFLIWHGVRPDPSPVLTALRA
FT                   TLLAKD"
FT   CDS_pept        complement(625747..626646)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0568"
FT                   /product="conserved hypothetical protein with tonB-like
FT                   C-terminal domain"
FT                   /function="Periplasmic protein TonB links inner and outer
FT                   membranes"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40900"
FT                   /db_xref="GOA:A9I1V1"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1V1"
FT                   /protein_id="CAP40900.1"
FT                   /translation="MQRSADSSSTPGRFLYWLSAPAQHYLRIGLAISLLLHAGALAWRF
FT                   AAPAPARPTQAPLEIVLVNAHTQSAPVQAQVVAQSQVDGGGNAERGVAATPLPRTGESA
FT                   ETIVLQAMRKRQAQLEAEQMRLLTQLQAQAKAGTERQPVYPWPDATAPGEDVHDQPGVV
FT                   QNAQVATLASRIQSYNAQPRKEFVAPSAQASRYAAYLDAWRSRIEAIGTQHYPEEARGR
FT                   IYGSLQITVSVRADGSVADVEIDRPSEHAVLNQAARRIVQMAAPFPPFPPQIAREADML
FT                   VITRTWHFVNDTLETQAP"
FT   CDS_pept        complement(626874..628763)
FT                   /transl_table=11
FT                   /gene="rnb"
FT                   /locus_tag="Bpet0569"
FT                   /function="Exoribonuclease R"
FT                   /EC_number="3.1.13.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40901"
FT                   /db_xref="GOA:A9I1V4"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1V4"
FT                   /protein_id="CAP40901.1"
FT                   /translation="MYVFYEEDGGFKAANILSETDASLQVESESGKRSKIKRANTLFTF
FT                   AEPAPAALLAEAAQAADALDLQFLWECAPQEEFDAAALAADYFGHAPSAVEQAALLMRL
FT                   HGAPAYFHRRGKGRYRPAPPDILAAALAALEKKQKQAEQQQQWVDEMAAGRLPGEIAQA
FT                   AESLLIRPDKNSMQWKALDAACARQQKSPDRLLLELGAWPHPLALHKRRFLATYFPRGT
FT                   GFPDAAIPPLARDLPLADAELYSVDDITTTEIDDALSVTPLPDGKVRVGIHVAAPGLAV
FT                   TRGSELDKLARARLSTVYMPGEKIPMQPDHVIQAFSLDAGREVPALSLYVTADPATGEI
FT                   SATETRVERVVVRENLRHNELDGQVTEAALNDPDAPLPYGHWLRPLWRLASALSAQRDI
FT                   VRGKPENNSRVEYSFYLDGDPDNPDTPVRLVPRQRNAPLDRMVAEYMILANNVWGGLLH
FT                   QHGVPGIYRSQQAGRVRMSTQALPHEAIGVPQYAWSTSPLRRYVDLVNQWQLIAAVEHG
FT                   VSARLVAPFKPRDADLFAIIGAFDAQYAAWNEFQGNMERYWCLRWLQQQGITRTVAHVL
FT                   REDLVRLANAPLVMRVGGLPELERGMAVELDILGMDELTLEVDCRYVGVVGGA"
FT   CDS_pept        complement(628849..629448)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0570"
FT                   /product="Putative esterase"
FT                   /function="Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40902"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1V7"
FT                   /protein_id="CAP40902.1"
FT                   /translation="MILYLHGFRSSPASFKARLMAQALRERGLAGERDWQCPQLPASPR
FT                   QALDLALGLARGQLAQADSPRRLTIIGSSLGGYYATWLAEQLDCKAVLLNPAVEAARDL
FT                   ATQVGQHRMYHSDAPFEFRAEYVDELAAVRVAAVTKPERYFLVAATGDEVLDWREMQAR
FT                   YAGCRQRIVPGSDHGLSDFERWLPEVLDFAFEAPGA"
FT   CDS_pept        complement(629445..630821)
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="Bpet0571"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase"
FT                   /function="peptidoglycan biosynthesis"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40903"
FT                   /db_xref="GOA:A9I1W0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1W0"
FT                   /protein_id="CAP40903.1"
FT                   /translation="MHLHILGICGTFMGGLALIARAAGHRVTGCDTAVYPPMSTQLAEQ
FT                   GIDLIEGYGSEQLALAPDLYVIGNVVTRGNPLMEAILDAGARYVSGPQWLGDNVLPGAH
FT                   VLAVAGTHGKTTTSSMLAWILEAAGLRPNFLIGGVAHDLKVSARYDPAVRPFVIEADEY
FT                   DTAFFDKRSKFVHYRPRTAILNNLEYDHADIFPDLAAIETQFHHLVRTIPERGRIVLPT
FT                   GSAALDRVMARGCWSETVRFGAGGAWQAGPADADGAFEVLRHGQAIGTVRWTLGGEHNR
FT                   LNALAALAAAEHAGVDPAEGVAALSRFGGVKRRMELRGTAGGVKVYDDFAHHPTAIETT
FT                   LEGLRRQVGQARILAVLEPRSNTMKLGAMAARLPAALQGADRVFCFGARSGKHALGWNP
FT                   DEVLAPLGERASSYDDLDALVAAVAQAAQPGDHVLVMSNGGFGGVHGKLLDALARRGAP
FT                   "
FT   CDS_pept        630889..631428
FT                   /transl_table=11
FT                   /locus_tag="Bpet0572"
FT                   /product="thioredoxin"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40904"
FT                   /db_xref="GOA:A9I1W5"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1W5"
FT                   /protein_id="CAP40904.1"
FT                   /translation="MNRRIFLYAGAAVAVAAAGGYAYRQRGGQAAHTPAPAPAGDPVAA
FT                   LQALSLPDLDGQPHSLSQWRGRPMVVNFWATWCAPCVKEMPELQALHQKYPAIQFVGIG
FT                   VDKAENMRQFLQKVPVSYPLLVMGAGAVDTLRTLGNPAGGLPFTLVFDANGRINRKILG
FT                   QIQSDDLDRTLQDLAA"
FT   CDS_pept        631564..631998
FT                   /transl_table=11
FT                   /gene="aroQ, aroD"
FT                   /locus_tag="Bpet0573"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /function="3-dehydroquinate dehydratase II"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40905"
FT                   /db_xref="GOA:A9I1W8"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I1W8"
FT                   /protein_id="CAP40905.1"
FT                   /translation="MAQQILVLHGPNLNLLGSREPHLYGSLTLAQINQGLETLAAQLGV
FT                   GLTAWQSNHEGALVERIQAARQDGTDFIIINAAAYTHTSVAVRDALAAVAIPFIEVHLS
FT                   NLYKREPFRQHSYLSDLAVGLVCGLGADGYEAAVRYAARH"
FT   CDS_pept        632099..632548
FT                   /transl_table=11
FT                   /gene="accB2"
FT                   /locus_tag="Bpet0574"
FT                   /product="acetyl-CoA carboxylase biotin carboxyl carrier
FT                   protein"
FT                   /function="Biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40906"
FT                   /db_xref="GOA:A9I1X2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1X2"
FT                   /protein_id="CAP40906.1"
FT                   /translation="MDLRKLKTLIDLVAESGIAELEITEGEGKVRIVKFSQTLQPVAYH
FT                   VPEAPAAAAAPAPAAAAPAPEAAPVPQGHVVKAPMVGTFYRAPNPGAAPFVDVGQSVKE
FT                   GDALCIIEAMKLLNEIEADKSGVIKEILVENGEPVEYGQPLFVIG"
FT   CDS_pept        632557..633903
FT                   /transl_table=11
FT                   /locus_tag="Bpet0575"
FT                   /function="Biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40907"
FT                   /db_xref="GOA:A9I1X5"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1X5"
FT                   /protein_id="CAP40907.1"
FT                   /translation="MFEKILIANRGEIALRIQRACRELGIKTVVVHSEADRDAKYVRLA
FT                   DESVCIGPAPSRESYLNMPAIISAAEVTDSEAIHPGYGFLSENADFAERVEKSGFVFIG
FT                   PRPETIRLMGDKVSAKRAMIEAGVPVVPGSEGALPDDPQEILRVAREVGYPVIIKAAGG
FT                   GGGRGMRVVYTEAALLNAVTMTRSEAGAAFNNPEVYMEKFLENPRHVEIQILADGGRNA
FT                   VWLGERDCSMQRRHQKVIEEAPAPGIARRLIERIGDRCADACRKMGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHPVTELITGVDLVQQQIRIASGEKFLLRQRDIQFKGHAIECRIN
FT                   AEDPFRFVPSPGRITNWHTPGGPGVRIDSHAFNGYFVPPNYDSMIAKVITYGDTRDQAL
FT                   ARMRIALSEMVVEGISTNIPLHRELLQDARFIEGGTSIHYLEHKLAQRP"
FT   CDS_pept        633949..634869
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="Bpet0576"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /function="Ribosomal protein L11 methylase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40908"
FT                   /db_xref="GOA:A9I1X8"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1X8"
FT                   /protein_id="CAP40908.1"
FT                   /translation="MRELVLHCLEAQAEALSDALLEAGVLSVSVEDADLGTDAERPLFG
FT                   EPGTEPDVQAWERNRVVALLPDGADPAQVYEQAMAGAGLDPIQAGGWTLRDVPDADWVR
FT                   LTQSQFGPIHIARRLWIVPSWHRDDPAVPGPSAPAEDAIHIELDPGLAFGTGSHPTTHL
FT                   CLAWLEAELPAGATVLDYGCGSGILAIAARKLGAGATDAVDIDPQAVQATADNARVNQV
FT                   DLQAMLPDALGDGTYQVVVANILSNPLKVLAPMLAGRVAAGGQLVLSGVLERQADEVAA
FT                   AYAPWLAMSVWQARDGWVCLHGRKT"
FT   CDS_pept        634893..636026
FT                   /transl_table=11
FT                   /locus_tag="Bpet0577"
FT                   /product="probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40909"
FT                   /db_xref="GOA:A9I1Y2"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="InterPro:IPR021834"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1Y2"
FT                   /protein_id="CAP40909.1"
FT                   /translation="MAMTTRCPQCGTAFKVVPDQLRVRNGLVRCGACSTVFDGRACLVA
FT                   QIPQAAPAGLAVPPDRSRPPAPPAPAAVPPAISEARPEPALGTLPPAVLRGRPDIRKHD
FT                   PYVGGHASQDDDDAYDDDRLADDEPGLPQPLAEAPAGTDADQDAETGTDAEIDAEGDAE
FT                   AENDAAANAGDHVEVEPVVLGEARTRYYGATDVGRTPPEFLDTDRQARRHLVRSLWGYA
FT                   CVLGLLLLALQVVYVYRSAIATAAPPLRPLLTSLCQPLGCQIGYARRIERIFITSSSLQ
FT                   PPRGQAGAPADGHSHLVLSVSLRNRYDQPQHWPALRLDLTDLSDTVVVRKVLQPRDYLP
FT                   PGQAEGPFEPGAEINVTVPIEVAGVQVNGFQLDKFFP"
FT   CDS_pept        636039..636980
FT                   /transl_table=11
FT                   /locus_tag="Bpet0578"
FT                   /product="put. Carbohydrate kinase"
FT                   /function="Sugar kinases ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40910"
FT                   /db_xref="GOA:A9I1Y5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1Y5"
FT                   /protein_id="CAP40910.1"
FT                   /translation="MTAPVLVCGSMAFDTIAVFDGRFKEHILPDRIQSLSVSFLVPAMR
FT                   KEYGGCAGNIAYNLKLLGGHPVPVATVGDDAADYLERFTGLGIDTSRLRVMPGTFTAQC
FT                   FITTDLEDNQIAAFHPGAMELSAQNDLSGARADWAIVAPDAKAGMFAHAERLHAAGIPF
FT                   IFDLGQAMPLFDGADLDRMLGLAQALTVNDYEAGVVEQRTGRSMADIASQLQAVVVTRG
FT                   GDGATLLTDGATVHVPPVRPAAVVDPTGCGDSHRAGLLYGLTNGWSWLDSCRLANLMGA
FT                   IKIASRGPQNHAPSRGEIDAQLRAAYGIGLPA"
FT   CDS_pept        637128..637667
FT                   /transl_table=11
FT                   /locus_tag="Bpet0579"
FT                   /product="lipoprotein-like protein"
FT                   /function="Outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40911"
FT                   /db_xref="GOA:A9I1Y9"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1Y9"
FT                   /protein_id="CAP40911.1"
FT                   /translation="MHKIVVTYEGVHMSQTLSSPVMAPRAGRWLAVAAVVASMAVLGGC
FT                   ANRSASSGVYSYDQAQREQIVRIGTVTGVRPITIQDDKSSGVGMIAGGALGGVAGNAVG
FT                   GGTGRALATVGGAILGALAGNAVENRAGRASGLEITVRLDNGETRVVAQEADVPISVGQ
FT                   RVQVISGAGPTRVAPY"
FT   CDS_pept        complement(638154..638717)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0580"
FT                   /product="putative membrane protein"
FT                   /function="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40912"
FT                   /db_xref="GOA:A9I1Z2"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1Z2"
FT                   /protein_id="CAP40912.1"
FT                   /translation="MFGDILRFLLEITFTLFGAALIARAWIHAVRLHPFNPLARGIFQV
FT                   TNWLVLPIRKLIPAGHSIDWSSLFAAWLTALVYLVLVWMLAVGALIPASLIPAALGSSL
FT                   LMVAKWALNLIVWLTLLQAVLSWINPMSPLMALLQTLTAPLLEPIRRILPRSSAIDFSP
FT                   LVLLILAQIALMMLARLTYGLVGV"
FT   CDS_pept        complement(638895..639524)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0581"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40913"
FT                   /db_xref="GOA:A9I1Z5"
FT                   /db_xref="InterPro:IPR009970"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1Z5"
FT                   /protein_id="CAP40913.1"
FT                   /translation="MATAKKAAKKAVKKPAAKKAAAKKAPAKKAVKKVAVKKVAAKKVA
FT                   AKKPAVKKTAAKKPAVKKTAAKKTVKKAAAKKAVKKAVAKKAVKKVAAKKTVKKAVKKA
FT                   PAKKAVKKAVAKKAVKKAVKKAPAKKAAKKAPAKKAAKKAVAKKAPAKKAAAKKPAAKK
FT                   AAAKKPAAKKAAPKKPATPPSTAAAPGAKTALNPAASWPFPTGGRP"
FT   CDS_pept        complement(639840..641030)
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="Bpet0582"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /function="Ribonucleotide reductase beta subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40914"
FT                   /db_xref="GOA:A9I1Z8"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1Z8"
FT                   /protein_id="CAP40914.1"
FT                   /translation="MLNWEDDKLAVQPAQSPAPAAGGQPARAATGVFGDAALPTPAAPQ
FT                   HAASLQSSDDAAAHRVKVADKRIINGKTDVNQLVPFKYKWAWEKYLATCANHWMPQEIN
FT                   MSRDIALWKNPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLR
FT                   QAFEEAIHTHAYQYIVESLDLDEAEIFNAYNEVPSIRAKDEFLIPFIEAIADPTFHTGT
FT                   PESDQKLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNF
FT                   GIDLINTIKLENPHLWTPEFREEIRGLFQKAVELEYAYAEDTMPRGVLGLNAPMFKSYL
FT                   RFIANRRCQQIGIEPLYPQEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE"
FT   CDS_pept        complement(641054..643978)
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="Bpet0583"
FT                   /product="ribonucleoside-diphosphate reductase alpha chain"
FT                   /function="Ribonucleotide reductase alpha subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40915"
FT                   /db_xref="GOA:A9I203"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A9I203"
FT                   /protein_id="CAP40915.1"
FT                   /translation="MQTTIASVTRPSAVPPSQTDVPADANGGQWASYNVIRRNGSVVGF
FT                   EPSKIAIAMTKAFLAVNGGQGAASARVRELVETLASQAVNALVRNRPAGGTFHIEDIQD
FT                   QVELALMRSGEHDVARAYVLYREKRAQERAAAAEVLEKTAPAVAQESHLNVVDNGVRRP
FT                   LDLAALRATIEAAGEGLSEFIDTEAILKETVKNLYDGIPVDEVFKSAILSARALVEKDP
FT                   AYSQVTARLLLHTIRKEVLGEEVSQAGMATRYAEYFPTFIQRGIEGGLLDAKLAEYDLA
FT                   RVGAALDARRDLQFGYLGLQTLYDRYFLHIRGTRIELPQVFFMRVAMGLALRESDREAR
FT                   AIEFYEILSSFDFMSSTPTLFNSGTLHSQLSSCYLTTVSDDLEGIYDAIKENALLAKYA
FT                   GGLGNDWTPVRALRSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLETWH
FT                   LDIEEFLELRKNTGDERRRTHDMNTANWIPDLFMKRVMENGEWTLFSPSDCPDLHDKYG
FT                   KAFEQAYLGYEAKVASGELKLFKKMPAISLWRKMLSMLFETGHPWITFKDPCNIRSPQQ
FT                   HVGVVHSSNLCTEITLNTNDSEIAVCNLGSVNLVAHMKPAAAGGFELDHDKLKRTVGIA
FT                   MRMLDNVIDINYYAVKKAKDSNERHRPVGMGIMGFQDCLQMMRVPYASQAAVEFADRSM
FT                   EAVCYHAYWASSELAQERGRYPSYEGSLWSRGILPQDTLAMLRDERGGHVEVDESSTLD
FT                   WNALRARIKEHGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVVND
FT                   YLVRDLKKLGLWDEVMVADLKYFDGSLSRIDRVPSELRELYATAFEVEPRWLVECASRR
FT                   QKWIDQAQSLNIYMAGASGKKLDDTYKLAWQRGLKTTYYLRTLGATSAEKSTGRGGELN
FT                   AVSAGQAATAVTAAAPNLPEPEVLGAVCTMRPGDPGFEECEACQ"
FT   CDS_pept        complement(644283..647789)
FT                   /transl_table=11
FT                   /gene="iorA2"
FT                   /locus_tag="Bpet0584"
FT                   /product="Indolepyruvate oxidoreductase subunit"
FT                   /function="Indolepyruvate ferredoxin oxidoreductase alpha
FT                   and beta subunits"
FT                   /EC_number="1.2.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40916"
FT                   /db_xref="GOA:A9I206"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A9I206"
FT                   /protein_id="CAP40916.1"
FT                   /translation="MDGTPAAEPALDLDYQLQDNLTRTRGRVFLTGTQALVRVLLAQRR
FT                   LDRERGLNTAGFVSGYRGSPLGGVDMAMWKARPILDAHQITFVPGINEDMAATAVMGTQ
FT                   QAGVRADRKVDGVFALWYGKGPGVDRAGDALHHGNAAGASRHGGVLVVVGDDHTAVSSS
FT                   IPHASEASLIGWQMPIVHPASIEEYETFALWGWALSRYSGAWVAFKAISETVESGQAYT
FT                   PAPPARYDMPADPDLPPEALEYTARDFLSPAVELRMQKRLRAVRAFARRHSIDRLVCAA
FT                   PHARVGLVTVGKAHLDTLEALARLGIDPWAADTPVRIYKPGLTWPLDAGRLHDFARGLS
FT                   HILVIEEKGAVVEGQIKDLLYNLPARPGVAGKTGLDGEPLVPSAGQLRPSLLAAPLAAW
FT                   LARTAGLRSAADPAALACPAPLSNDADGMRRRPYFCSGCPHNSSTKVPEGSQALAGVGC
FT                   HYMAAWMDRDTGGLTQMGGEGADWIGLSRYIEMPHVFQNMGEGTYYHSGYLAIRQAVAA
FT                   RANITYKILFNDAVAMTGGQPVDGPISVPQICQQLRGENVARIVVTTDEPAKYQGVELP
FT                   AGVTVHHRRELDALQRELRATPGVTVLIHDQTCAAEKRRRRKKQQFPDPPRRLLINSAV
FT                   CEGCGDCGVQSNCLSIVPLETPYGRKRAIDQSSCNKDYSCAEGFCPSFVSVLDGTLRKR
FT                   AAPTPGAPAWRRHLDALPLPPAHAPEQPYRMLVAGMGGTGVITIGAIVSVAAHLQGLSA
FT                   SVLDLTGLAQKGGTVVSHIRLAPPHAPEGPVRLDWQQADAAILCDPVAAVAPDSLGALR
FT                   RGHTQVVVNTYVAPVSEFTRNPDAALRPEALLAKIRHAAGEARTAALDAHQAALALFGD
FT                   SILSNMFMLGYAWQRGAVPLSHAALARAIELNGVAVQANRDAFEAGRLAAHQPQALEDA
FT                   LRPAAQVVQLHVPESFERAVARRERDLTAYQNAAYARQYRELVDRVAQRERELAPTART
FT                   PRLAMAVARSLFKLMAYKDEYEVARLYTDGSFRQQLREQFEDGYTLRFHMAPPLLARKD
FT                   PHTGIPRKLALGPAAWPAMRLLARLKGLRGTWLDPFGHSAERRMERQLIQEYRQTVETL
FT                   LKHLSPANLVQAAGIAALPEQVRGFGHVKVASVTHYRQRLEQMLQHYGPSGSPAVSARK
FT                   SA"
FT   CDS_pept        647922..648383
FT                   /transl_table=11
FT                   /locus_tag="Bpet0585"
FT                   /product="transcriptional regulator, AsnC-family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40917"
FT                   /db_xref="GOA:A9I210"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9I210"
FT                   /protein_id="CAP40917.1"
FT                   /translation="MDKTDIGILRALQEDGRASAQQLSEQVGLSAAPVWRRVKALESAG
FT                   VILGYSAQVDRAKVGLQGCMFAQISLERHSASTVETFERSVRDAPEILECYAVTGDSDF
FT                   LLKILVESPEAYDRFLHRFLFNLPGIRQTRTIVALREIKHEVRLPLSAA"
FT   CDS_pept        648352..649068
FT                   /transl_table=11
FT                   /locus_tag="Bpet0586"
FT                   /product="putative lipoprotein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40918"
FT                   /db_xref="UniProtKB/TrEMBL:A9I214"
FT                   /protein_id="CAP40918.1"
FT                   /translation="MRCACRSARLDARDVLPLPFGKELLLLHTICKLVSLHPKGAVIRV
FT                   PPARTHVRAGFLLPGGARCFEDVMNKVLWFRRIGAVGAALILAGCAARKTGQAPSPAAP
FT                   AAAPPQVACTPAEPGSRMVGTWQSNTRPRGVSGEFSALYTLAADGTMTYTTQLKIGKRI
FT                   RPGLREAGCWQLAEGVLTLQTTRSNGEAVDTADPIYQNRYRVEKADDKRLTLRELRAGG
FT                   QVVTARRMPPGYHLPY"
FT   CDS_pept        649070..650266
FT                   /transl_table=11
FT                   /locus_tag="Bpet0587"
FT                   /product="putative membrane transport protein"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40919"
FT                   /db_xref="GOA:A9I216"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9I216"
FT                   /protein_id="CAP40919.1"
FT                   /translation="MPTPTGSSQNRAIALLALAAFVSASAFRICDPMLPRLAADFGTST
FT                   GQAAATVTAFAVAYGLLQMFFGPVGDRYGKYRVVAVATFACAIGSMGAVLAPSLDVLVV
FT                   CRALSGAAGAGIVPLSMAWIGDNVPYEQRQATLARFLTGTILGMAAGQLAGGWFADTVG
FT                   WRWAFGALVAGYLIVGLLLWREVAQQAAASAARPAPGPRQGFAAQVRVVLGVPWARVVL
FT                   ATVFVEGLLVFGALAFAPAYLHARFGLSLTAAGAVVAVYALGGLLYTLVAGPVLRRLGE
FT                   RGLAAAGGLVLCSAFLIYLLGPAWGWGLAASMLAGFGYYLLHATLQTHATQMVPNARGT
FT                   AVAWFASCLFLGQAVGVALAGLVVDAAGAAALFGVAAVLLPLLGGSFAWALRRRLAAH"
FT   CDS_pept        complement(650325..651728)
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="Bpet0588"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /function="Glutamyl- and glutaminyl-tRNA synthetases"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40920"
FT                   /db_xref="GOA:A9I219"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I219"
FT                   /protein_id="CAP40920.1"
FT                   /translation="MTSTPATIRTRFAPSPTGFLHLGGARTALFSWAFARHHQGVFVLR
FT                   IEDTDLERSTPEAVQAILDSMDWLGMQPDEGPFYQMQRMDRYREVIAQMLQAGTAYHCY
FT                   SSPEEVEAMREAARARGLKPRYDGTWRPEPGKTLPPVPAGRKPVVRFKNPQDGATGWND
FT                   MVKGPISFDNTELDDLIIARPDGTPTYNFCVVVDDWDMGITHVLRGDDHVNNTPRQINI
FT                   LRALGATLPEYGHVPMILGPDGEKLSKRHGAVNVMEYDAQGYLPEAMVNYLARLGWSHG
FT                   DDELFTREQLVQWFDTRHLSKSASQWDPKKLNWVNAHYIKQMDNAELAARVAPRIERRG
FT                   GNPAAVDLAAAMGLLKDRAETLEQLAESALLFCKPYQPAPAELAEQHLTPAAREALADF
FT                   AQRAQGADWTREAIAALIKAVLADRGLKMPQLAIPLRVAVVGQTQTPAVDAVLALVGKD
FT                   AVLQRLAAL"
FT   CDS_pept        651854..654328
FT                   /transl_table=11
FT                   /locus_tag="Bpet0589"
FT                   /product="conserved Hypothetical protein"
FT                   /function="Acyl-CoA synthetase (NDP forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40921"
FT                   /db_xref="GOA:A9I224"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="UniProtKB/TrEMBL:A9I224"
FT                   /protein_id="CAP40921.1"
FT                   /translation="MLRHALAPLFEPRSLLIVADRPLPAAESLPAGLRQRITRVDAEPG
FT                   VAPELPAACAGLADGQRPDLALVCVSPAVLPETLRRLEPLRPRAAIVLPHELPDPYPGG
FT                   TLALCRAWAEKNGCELLGPRAFGAQRPHAGLNLSQHPTLARAGRVALVAQSRSITAAVM
FT                   DWAEDVHIGFSTAVSLGDEAAVGMAQVLDFLASDPRTDSIVLYLEDVGTAREFMSTLRA
FT                   AASVKPVIVLKAGRDGPAGSDAVLDAALRRAGAVRVRYFVQLFSAVKVLGYTRRPRGRR
FT                   VALLSNGSGPPQLALDLIGPDAAVLKAELAPSTRRALAGLLEPDAAIDNPVITYVPLTP
FT                   ERIQAVLDCLIDDNGVDGVLVLLAPDALADMHGVARQLAQIAPKAPKPVVSCFMGDAGM
FT                   RPLRRMLDDAGTSAFRTPESAADAFGVLATHYYNQQLLLQTLPPEPPSRLPDIARARAV
FT                   LDGARQQGRLTLSAAECRSVLDAFYVPLRDVPSGVLPGEPESRPMAIRVRRDPRFGPVI
FT                   QFGAGGPDAVLASGTDRGMDLPPLNGFLAGQLIERSRAWRRVLAPQISGAATEAVQQAL
FT                   VHVSELISELPDIESLDIDPLYAGEAQLRAADLRITLCAEPACATPQASGYPHMAIHPY
FT                   PARLVRAREFDDGTAWTIRPIRPEDGQTLQEFIRGLSEQSRYMRFVSMMRELTPRMVAR
FT                   YTQIDYHRELALVATTQVPNPENRGHPREVIIGFAHYLRNPDGRGAEYALVIGDDWQRR
FT                   KLGGQLMEVLIDAAREQGLEYIDGLVLANNRPMLTLMTRLGFTNDPDPEDPTMRRVWLD
FT                   LLPGQGSGSAGA"
FT   CDS_pept        complement(654476..655150)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0590"
FT                   /product="probable carboxylesterase"
FT                   /function="Predicted esterase"
FT                   /EC_number="3.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40922"
FT                   /db_xref="GOA:A9I227"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9I227"
FT                   /protein_id="CAP40922.1"
FT                   /translation="MSANPALLDCIELETAPNPTHAVIWLHGLGADGNDFAPIVPELRL
FT                   GAHPPVRFVFPHAPVQPVTINGGMAMRSWYDILVTDLVRQEDAAGIRRSEAAVRALIAR
FT                   ENARGIPTSRIVLAGFSQGCAMTLHTGLRLEEKLAGMIGLSGYLPLLDTAAAERHAANA
FT                   NTPIFLAHGTFDPVVALPRAQASLAQLQALDYDVRWHTYPMPHSVCAPEIADIAEFLRE
FT                   VL"
FT   CDS_pept        655646..657166
FT                   /transl_table=11
FT                   /locus_tag="Bpet0591"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted Zn-dependent proteases and their
FT                   inactivated homologs"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40923"
FT                   /db_xref="GOA:A9I231"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A9I231"
FT                   /protein_id="CAP40923.1"
FT                   /translation="MHFSLDLRLAGPVVAVVVNIGVGRRIGNRGSHGNSANTDLAMITV
FT                   SVHWTAMVNTPASSLPLAANHARFSELVEQALAHARRIGASDAAAEVSESLGLSVSVRK
FT                   DDIETVEQTRDRSLDLTVYAGQSRGSASTSDFSEAALRQTVEAAWHIARHTAADPAAGL
FT                   PDADQLAADIPDLALHYGWPVTTEQAAELALRAERAARAVDPRITNTDGATVGTYEGQF
FT                   VMGNTRGFLGGYPYSRHSLSVAPIAGRGNHMQRDYWYTSERDPARLASPEAIGRYAGER
FT                   TLSRLSARRIRTGKFPVLFEAPLALGLLGAFTQATSGGALYRKASFLVDALGKPVFPDH
FT                   IDISEDPHVRGGMGSSPFDDEGVRTRARSVVTGGVLEGYFLSSYTARKLGLVTTGNAGG
FT                   SHNLTLSSRHTRPGDDFEAMLRKLGTGFLVTELIGQGVNYVTGDYSRGAFGYWVENGQI
FT                   QHAVQEITIAGNLAEMFRQIVAVGADTIARGTKRTGSILIEQMAIAGT"
FT   CDS_pept        657280..658377
FT                   /transl_table=11
FT                   /locus_tag="Bpet0592"
FT                   /product="putative exported solute-binding protein"
FT                   /function="TRAP-type mannitol/chloroaromatic compound
FT                   transport system periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40924"
FT                   /db_xref="GOA:A9I234"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="InterPro:IPR041722"
FT                   /db_xref="UniProtKB/TrEMBL:A9I234"
FT                   /protein_id="CAP40924.1"
FT                   /translation="MQRRSFLKHAGLGAVAGSAAVAAPVFAQDAPTLNWRMASSFPRSL
FT                   DTLFGTGEIFCKFVNEASGGKFTIRHFPGGEIVPALQVMDSVSNNTIECGHTVSYYYYG
FT                   KSPAFCFDAAVPFGLNARQMNAWMFDGDGMKLTREMFAPHKIINFPMGNTGVQMGGWYR
FT                   REIKSVDDLKGLKMRTAGFAGEVLSRLGVVPQQIAGGDIYPSLEKGTLDAVEFVGPYDD
FT                   EKLGFNKVAKYYYYPGWWEGGPQVSLYLNEGAWNGLPKSYQAIVEAASRVAHVAMTSRY
FT                   DALNPGALRKLIAAGAELRPFPRSVMDASYAAAQTVYKEFSDKDPKFKALYENYMGFRD
FT                   SVVPWFRLAEGSYDQYLGVAMSAKK"
FT   CDS_pept        658676..659104
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="Bpet0593"
FT                   /product="50S ribosomal protein L13"
FT                   /function="Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40925"
FT                   /db_xref="GOA:A9I237"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I237"
FT                   /protein_id="CAP40925.1"
FT                   /translation="MKTFVAKPHEVQRDWFVIDAKGKVLGRVASEVARRLRGKHKPEFT
FT                   PHVDTGDYIVIINAAEIVVTGNKAQDKKYFRHTTYPGGIRETNFEKLQQRFPGRAIQKA
FT                   VKGMLPKGPLGYAMIKKLKVYAGAEHPHTAQQPKPLDI"
FT   CDS_pept        659114..659506
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="Bpet0594"
FT                   /product="30S ribosomal protein S9"
FT                   /function="Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40926"
FT                   /db_xref="GOA:A9I240"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I240"
FT                   /protein_id="CAP40926.1"
FT                   /translation="MIGNWNYGTGRRKTSVARVFIKKGSGKIIVNGKPVDEFFARETGR
FT                   MIVRQPLELTGHLESFDIKVNVHGGGETGQAGAVRHGITRALIDYDADLKPALSQAGFV
FT                   TRDAREVERKKVGFRKARRRKQFSKR"
FT   CDS_pept        659609..660673
FT                   /transl_table=11
FT                   /gene="argC1"
FT                   /locus_tag="Bpet0595"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /function="Acetylglutamate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40927"
FT                   /db_xref="GOA:A9I242"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I242"
FT                   /protein_id="CAP40927.1"
FT                   /translation="MAHASNSRIKVGIVGGTGYTGVELLRLLSQHPHVELTAITSRKED
FT                   GLPVADMYPNLRGRVSLAFSTPEKANLADCDVVFFATPHGVAMAQAQELLAAGTRIIDL
FT                   AADFRLQDTATFERWYKMPHACPDILAESVYGLVELNREAVSKARVIGNPGCYPTTVLL
FT                   GLAPLLENGAALVDTQTLIADCKSGVSGAGRKAEVSTLFSEASDNFKAYGVAGHRHHPE
FT                   ISEQLEKLAGGKVGLTFVPHLVPMIRGMFSTLYARIRPEALGTDFQALYEKRYADEHFI
FT                   DVMPAGSLPETRSVRASNNLRIAVQRPNGGDLLIVLVIQDNLVKGASGQAVQNMNLMFG
FT                   LPESAGLDQVAILP"
FT   CDS_pept        660725..661486
FT                   /transl_table=11
FT                   /locus_tag="Bpet0596"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40928"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="UniProtKB/TrEMBL:A9I244"
FT                   /protein_id="CAP40928.1"
FT                   /translation="MQQIPEPTAAPRSRPLMRWLTLLCVLAVGLAIGAAAGYRQGRQSA
FT                   AANNTVVVTAEQVAAQDAAIRQSQAESRFLRAQLDTADGEIAVERAARQELETQLRSAQ
FT                   DELGRVRDRLAFFEQLLPPGPEGAVDIRGAEVQRVGQGLKYRVLLMRSGRSDTPFTGTL
FT                   RFQAAGVLKGETVSVDLAPMQLKADASAPAAGAGAGAEAAAGGPLALQFDQYQRSEGVL
FT                   ELPEGFVPETVTVSVLEGATVRASRSVKLEF"
FT   CDS_pept        661574..661942
FT                   /transl_table=11
FT                   /locus_tag="Bpet0597"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40929"
FT                   /db_xref="GOA:A9I246"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I246"
FT                   /protein_id="CAP40929.1"
FT                   /translation="MNAVTETVDLQAPPSPLIFTDSAAAKVKDLLAEEGNPELKLRVFV
FT                   QGGGCSGFQYGFTFDEAVNEDDTVLDKNGVQLLVDPMSFQYLVGAEIDYKEDLEGAQFV
FT                   IRNPNASTTCGCGSSFSV"
FT   CDS_pept        complement(662001..663209)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0598"
FT                   /product="permeases of the major facilitator family"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40930"
FT                   /db_xref="GOA:A9I248"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9I248"
FT                   /protein_id="CAP40930.1"
FT                   /translation="MKSSRKADMPRSLVLLFAAASGLSVANVYYAQPLLDALARDFSIS
FT                   RAAVGSVITATQIGCAVALLLLVPLGDRVDRRRLMAAQLLALVAALATVGAARSAPVLL
FT                   AGMTAVGMLGTAMTQGLIAYAASAAAPHEQGRVVGTAQSGVFIGLLLARAFAGGVSDLA
FT                   GWRGVYFCAAALMLAIALPLWRRLPALPAALNTMPYPRLIASMLTLLREERMLQVRGML
FT                   ALLMFAALNIFWSALVLPLSAPPYRFSHTVIGAFGLVGVVGALAAARAGQWADRGRAQR
FT                   TSAAALAALVLAWWPLSLMASSLWALIIGIVLLDLGGQALHVTNQSLILRTRPEAHSRL
FT                   VGLYMLFYAVGSGMGAIGATATYAHAGWQGVCLLGAAVSLLALAFWGLTRRVAAAKCDA
FT                   GLA"
FT   CDS_pept        663323..663766
FT                   /transl_table=11
FT                   /locus_tag="Bpet0599"
FT                   /product="putative transcriptional regulator"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40931"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9I250"
FT                   /protein_id="CAP40931.1"
FT                   /translation="MPRRPINDEPCPVARAVEIVGDRWSLLIVRDAFDGTRRFGDFQRG
FT                   LGMARNILSDRLRKLVEAGILETQDASDGTAYQEYVLTPQGESLFPVVVALRQWGEQHL
FT                   FKRGERHSVLIDTRTGKPIPRMAPQARDGSVLTPAATAVRKVA"
FT   CDS_pept        663946..665667
FT                   /transl_table=11
FT                   /gene="fhaC"
FT                   /locus_tag="Bpet0600"
FT                   /function="Hemolysin activation/secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40932"
FT                   /db_xref="GOA:A9I252"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:A9I252"
FT                   /protein_id="CAP40932.1"
FT                   /translation="MRTEMARGSPWLGAAAMGVLAVAMAASSVAQSLPDAAARAIDIER
FT                   RQAQELDAQRARANQRPDVLPAELPGASGPVQFPAEQPCFNIVQVTWDGDLPPGRVRAA
FT                   SQAAVGHCVGASGLRNLQTHLLGLLIDDGLVTSRVLVPEQSLAAGELTLHYVPGRISAV
FT                   QSTGGIGWWRTVVPGGPGDALNQRDLDQALENIRRLGGQADATIDVAPGPGMGESDLLI
FT                   RPGTGKRWHAYVGGDNAGLDAIGKYQINAGLTLDSPLFLYDQLSVSWNSNAHWRDSQAN
FT                   TRAASVNYNLPFGYWALFASASKSTYRQTVAGFEEPIVYGGTTRQAQVGVSVVPYRGAT
FT                   YKGSASFSLSRKRVSSTLNDVDIEVQRRDVTGYSFNLGHRQYLGPVVLDVGGGVQGTLP
FT                   SLSDRPGYVYGDPDWDGRSTIVTANASLYAPFQIAGQHFAYQGTWQIQHAKTAIVPADY
FT                   FAIGNRYTVRGFDGQMTLAAEDGWSLRNELSLNLEPLGIPGQQLYAGVDVGRVGGPSAE
FT                   YLSGRTLVGAVLGLRGRLPMPYLNASYDFSAGWPLHKPDSLKTASTVFAAALMFEF"
FT   CDS_pept        665695..674814
FT                   /transl_table=11
FT                   /gene="fhaB"
FT                   /locus_tag="Bpet0601"
FT                   /product="filamentous hemagglutinin/adhesin"
FT                   /function="Large exoproteins involved in heme utilization
FT                   or adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40933"
FT                   /db_xref="GOA:A9I254"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024440"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="InterPro:IPR037178"
FT                   /db_xref="InterPro:IPR038233"
FT                   /db_xref="UniProtKB/TrEMBL:A9I254"
FT                   /protein_id="CAP40933.1"
FT                   /translation="MALFSISVRLMSKFRSLTIWLVLITQVWTPVLAQTLPISVDKRVS
FT                   GAKPVVGVSNGVPVVNIAPPSAGGVSNNRYIQFNVGPSGVVLNNSGGASQTQLAGQIGG
FT                   NPMLGNQRATTILNQVTAPNPSRLLGTLEVAGHRANVIVANPAGITCDGCGFLNANRAT
FT                   LTTGRPQIGSGGIDFDVSAGQLRIEGDGLYGGEAAQVDLLARSLQINASVWAKKLNVVA
FT                   GASRVDFGSGQVTAGAAQEPAPEFALDTAALGGMYANSIRLVGTEAGVGVNIGNNLVAL
FT                   TGDLQVSAAGDVRIRPTATLQAGAGLSLHSGSNVDVAAGGRLQGVGVAIVAGQDARLDG
FT                   TLSSAGDVSVQAGRDIATAGKLGVDGGAVLQAGRHLDLAAAAQIETARAIDARAGNRLI
FT                   LAGDARSGGDMALAAGGALEARGNASAAGNMFLHAGGDVSVAGQLLAGRDLSLSADGAV
FT                   DLAGTAVADRMLRVNAGADIVLREDALAQGSQTLAMTAARDLHVAGTTGTAETAASQGG
FT                   LLQLAAGRDLAVAPGGIVTASSPAIITAARDLRLDGIAVALAGDLDLQAGGQLAVGEHG
FT                   RAQASNRLVADAGAGLAVDGIVAAGDTVALRAGQSAEINGLIAALGGAGTGGLTVASGQ
FT                   DISVGRLARVQAAGAAAMQAGQDLRLDGAVTAIDGLTLATARDTWINGSAATDGDLAWT
FT                   GRRLGMGEHGLAQAGQRLAAQAQDSMTLAGTLVAGQALALGAVNDVQLDGTAAALQGDV
FT                   AVRSTVGDVRLGAQAHVQAGGELVAEAGRDLIAAGTLASGQDMRLRAGRHVQLDGIAAA
FT                   QGALDAAAAGDLSVAAAGRVQADGALALAAGGALSNAGVAAGATTATLSAGTAFDNTGT
FT                   VLSGGDLAASAGILRNSGQLAAGVDADGRLTQTGSLALRAGRIVNSGAVLASTEMLLAA
FT                   DAVDNTGGSLAATGAATIEARTLNNQAGILAAGDISIQALDQVHNSGDGTIAAARSLNL
FT                   DTAELLNTSGLVSSQGSADIDAASLRNADGRLLAEDRLALQAQEIDGVGTVHAGGDLAV
FT                   SVAGSLTQDGTLVAGRDLSLAVGDRLDNQGQVSAGRDLTVAAANLDNAAGAQLLAGRVN
FT                   TLHVAQALNNAGLIDGATTRITAADVTNLGRIYGDDIAIQANTLLNDAGASGAAVIAAR
FT                   RDLDLGVKSLMNREHALIYAGGDLRVGGALDAGGRAAGQADSLVNASATIETAGDASIS
FT                   AASIQNLNNHFASELVQVSTTPKVFYRPEGSTDMYDAATTWLCDLVTPQCSKDPNWLGD
FT                   DQERRMLKPSSKYPEAQYGPPFDYALNKRGKRGETSPVYPAYAPEKYTCTGPGGDAGYD
FT                   WCGMQPAEYFYSPSARIWSVFGVTPPAASKPPVAPTPPGESAGYKAQAAYQQALAVYEK
FT                   ELAAYQAPYAKLNQRISAFNADFDARMVKNITIYRVNEIITESRTVSTDPGKILVGGDA
FT                   SLAGAVINDKSQIAAGGTLAVDGPAIQNIGATGERRVVLKGTATRSYEEDDEREYEPAQ
FT                   PYTGAVSVTPVELAVAGAGGNQTVAPQGSAPAGSDIGTALPPVEIGSLPLPGDGEVRTV
FT                   TSPAQLPDSQLFVVDREADAPYLVATDPQFTGQRPFVSSDYLLDLLRQAGALTGIPDGA
FT                   PFLTPSGQPRRLGDGFYEQKLVSDQILATTGQRFLENYADAGAQYQALLQAGADFAAQH
FT                   GVQLGVALTDAQQRQLTSDLVWLVAQTVTLPDGTTEQVLVPQVYLLVRDGDLRGDGTLM
FT                   AGRDVSLNADGDVANSGTIGARGATVITAENIVNQAGGRIQAASVDLNARQDLANIAAL
FT                   IKGDTVVLAAGNDIALTSTTTSFKHGATSGVNLGGLSQIDAGSLDMAAGRDLRLAAADL
FT                   SIEGDARLQAGRDIDLGTVKQSHSEAYVYGKRNDSKVRTASEIGTTIAAGGDVALVAGQ
FT                   DIKARAADVTAGGQLAAAAGRDVAISAGQASGYARDEHYYKTSGFMSSSSTHTVKSTDW
FT                   TQAQGSTLTGDTAVVMAGRDVNVAGSNLAAQNDLVVSADRDVNIVAGKNTTDDYQYEKI
FT                   KKSGFGALGGISYGKYEQTDSLDGKRVFHTASTVGSVEGDALLNAGNTLTVAGSNVLAR
FT                   QGDVTLIGRNIDITSVTDTTWQREFHEIKQTGLTVTASTPLVSAMQTAQRMGEAAGKTD
FT                   NAVMQGLAGATTALAAANAYDAVMKDPASAGGVSIKISLGTSKTSSTTERKSSTAMGST
FT                   VAAGRDLAIVAQGGGQASGITVTGSGLSAGNNAVLQAEGDILLQAAKNSASQKTDSKSS
FT                   GASIGVGISLGANGAGITAEAGVSASRGKASGKDTTWTPTTIAAGNTLALQSGGDTSLV
FT                   GAAGKAAQIVADVGGDLLVQSLQDSSRYDSKQTSVGFGASACVTGCVGGSVSANAGAGK
FT                   MHSEYDSVTQQAGLWAGDGGFQVKVGENTTLVGGVIASSQQAVAEALNSLSTGTLVVRD
FT                   IENRADYSASQIALGGGMGFGGGGGDDLGTTKDNEVAGGATKEHGTSVPSTGGGLGLGT
FT                   PVVAAASGDARSTTQSAISGGAIEIRDEAGQQALTGQTAAEAVASVNRDTSNTLNVLDP
FT                   IFDKEKIEAGFEIVSEASRQLGQFLTNRAKEIDALEDRANDADLSKAERDQAGAEAERL
FT                   RLQWGPGGSYRRWMTAVMGAASGNVTGATGEIVQAAVVNYLQGLAATEVKRIADGMGSG
FT                   ANAEAARAALHAIVGCAGAAGGGASCGAGALGAGASSVLATLLASVAGDDLSAQEKEAR
FT                   SNLIQSIVAGTATGLAMDAATSASSAATELANNALSLGELKSFAAEASTCRALGTCDEI
FT                   QQKYRDLSVENQEKMIALCAQDPVACRTQYGDFVEGVTDYRKELDAAFGLDIPPGLKAD
FT                   LAIYLYQHQEAIGVALNTEIAEQLQEKYGLTSEAAAQWAAIAAAAVGVTRGQKGNNLGG
FT                   TLIKISQKQLDKKFKHASDFGISTTKKNSETLALFESKIKTHISSASTVQQGTYGFVKD
FT                   SKVFFNSETNNAVVIDGAGNFVTGFKLSPGTKQFENFIKNGVLR"
FT   CDS_pept        674811..675086
FT                   /transl_table=11
FT                   /locus_tag="Bpet0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40934"
FT                   /db_xref="GOA:A9I257"
FT                   /db_xref="InterPro:IPR015287"
FT                   /db_xref="InterPro:IPR036471"
FT                   /db_xref="UniProtKB/TrEMBL:A9I257"
FT                   /protein_id="CAP40934.1"
FT                   /translation="MSFVLLEFAKSFVEGRISAPVFSEAYMELWKIERDSGSLIRDESA
FT                   LSERLSSIFCAADMYNSDSESREEYEFDDEQLRFEVCKLVEGIISK"
FT   CDS_pept        675462..675779
FT                   /transl_table=11
FT                   /locus_tag="Bpet0603"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /function="Large exoproteins involved in heme utilization
FT                   or adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40935"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:A9I259"
FT                   /protein_id="CAP40935.1"
FT                   /translation="MGAAGKAAQIVADVGGDLLVQSLQDSSRYDSKQTSVGFGASACVT
FT                   GCVGGSVSANAGAGKMHSEYDSVTQQAGLWAGDGGFQVKVGENTTLRRLSRQLEPDSCG
FT                   L"
FT   CDS_pept        complement(675765..676829)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0604"
FT                   /product="putative transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40936"
FT                   /db_xref="GOA:A9HXQ1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXQ1"
FT                   /protein_id="CAP40936.1"
FT                   /translation="MTNAQDRRQAVALVDEARQAGARLQSACIELGIGLNTYRRWATGD
FT                   EDRRPHAIHATPSHALTDAERQAVLQACHRPEFASLPPAQIVVRLLDEEGRYLASESTF
FT                   YRVLRQADEQHRRGRARAPRHAGAPRRHCADAPNQLWSWDVTYLHTRIRGRFYYLYLIL
FT                   DIYSRKIVGAEVFESENMANSATIIQRAVLREQCQHRPLVLHADNGSAMKGSTLQVTLE
FT                   KLGITASHSRPQVSNDNAYSEALFRTCKYRPGYPIDGFASVQAARLWVHQFIHWYNHEH
FT                   RHSAIRYLAPAQRHAGLDAPILQARQRLYQQARQRHPARWSGKLRNWQPIGSVWLNPEP
FT                   DQHEQDTDPVLEAA"
FT   CDS_pept        complement(676826..677317)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0605"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40937"
FT                   /db_xref="GOA:A9HXQ2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9HXQ2"
FT                   /protein_id="CAP40937.1"
FT                   /translation="MKYSAERREAILKKLLAPHNRTVSDLAREEGISEATIYNWRKQAR
FT                   GQGRLLPDQASDSEGWSSQDKFNAVLESAALSEVELAEYCRRRGLYAEQLRRWRTSCEQ
FT                   ANAQSQSAARQEADALKAERRRTRDLERELRRKNAALAETAALLTLRKKARAIWGDEEE
FT                   "
FT   CDS_pept        677401..677595
FT                   /transl_table=11
FT                   /locus_tag="Bpet0606"
FT                   /product="transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40938"
FT                   /db_xref="GOA:A9I268"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9I268"
FT                   /protein_id="CAP40938.1"
FT                   /translation="MAELCRKHGISEATYYNWKAKFGGMTVSDVQRLKELEQENNKLKK
FT                   LLAESMLDKAALQDLLSRK"
FT   CDS_pept        677634..678455
FT                   /transl_table=11
FT                   /locus_tag="Bpet0607"
FT                   /product="probable transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40939"
FT                   /db_xref="GOA:A9I270"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9I270"
FT                   /protein_id="CAP40939.1"
FT                   /translation="MTERGMGVTRACGLVGISRSLFAYESKRTGDVALTERMKEMAALK
FT                   RRYGYRRIHILLRREGWQTNHKRVWRLYSQAGLSVRKRRGKRIAPAERVVRPVATAPNQ
FT                   SWSMDFVSDGLAYGRRFRCLNIVDDYTRECLAIEVDTSLPGLRVAQVLQRLAELHGLPK
FT                   SITVDNGPEFAGRALDAWAYQVGVKLSFIRPGKPVENAYIESFNGKFRDECLNEHWFMS
FT                   LRQAKSLIEDWRVEYNTERPHSALRYLTPEQFAQAHRQQRFLTLDSMSVPY"
FT   CDS_pept        678506..678679
FT                   /transl_table=11
FT                   /locus_tag="Bpet0608"
FT                   /product="integrase, catalytic domain"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40940"
FT                   /db_xref="GOA:A9I273"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A9I273"
FT                   /protein_id="CAP40940.1"
FT                   /translation="MERFNRTVRYEWLSQYHWDDLDHVQRAATQWMWSYNHERPNMALG
FT                   GFTPKQRLAMTV"
FT   CDS_pept        678707..678880
FT                   /transl_table=11
FT                   /locus_tag="Bpet0609"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40941"
FT                   /db_xref="UniProtKB/TrEMBL:A9I277"
FT                   /protein_id="CAP40941.1"
FT                   /translation="MGGLPFFVVRPAGCGLFEPFVPAIAGIKSPAYEITDGFRHRYVFL
FT                   RKGTSLQQTLNS"
FT   CDS_pept        complement(678881..680017)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0610"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted molecular chaperone distantly related
FT                   to HSP70-fold metalloproteases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40942"
FT                   /db_xref="GOA:A9I280"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I280"
FT                   /protein_id="CAP40942.1"
FT                   /translation="MTRSGGPRVSTPGRLFIGLMSGTSLDGADGVLVRLAAGQAPQVLA
FT                   TAGLPMPDALRAELLALNRSGADELHRAALAAQALARVYADAVQALLQQARQPATAVTA
FT                   IGVHGQTVRHRPELGYTLQLNAPALLAELTGIDVVADFRSRDVAAGGQGAPLVPPFHAA
FT                   MFAAPHERAVLNLGGIANLTLLVPGQPPRGFDTGPANVLLDTWCRRHTGQPYDDNGRWA
FT                   ATGQVQAALLEHLLADEPWLALPPPKSTGRDLFDAAWLDQRLQSYDGPAPAPQDVQATL
FT                   QRFTARTVADALEAAAPATRDVLVCGGGARNQGLKAELAMCLQRPVQATDAAGVPAQWV
FT                   EAMAFAWLAQAFLDRTPAGVPQVTGARGPRVLGALYPA"
FT   CDS_pept        complement(680035..681519)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0611"
FT                   /product="conserved hypothetical protein"
FT                   /function="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40943"
FT                   /db_xref="GOA:A9I283"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A9I283"
FT                   /protein_id="CAP40943.1"
FT                   /translation="MRAVETCTPRKHPGDSRHPERSCTMNRGSNSPAGFRSKVAALFAP
FT                   RSEPTSHRGGLVRRTLMVTAIGLFAGAAALGMVQQPDHSELPPSRQIQSILPLQPDQVS
FT                   LSTDDSSAPYISETRIRPGDTLAAVLQRLEIDAPGLQRFLTQAPSARSIYKLYPGRAVQ
FT                   AATDAEGKLVWLRYIHTPGDEENGQVTTRMLLVTPSQEGYTAREIADNTDRQTRVAVGT
FT                   IRSSLFGATDAAGVPDSVTLQMADILNSKVDFLRDIRRGDQFRVVYEVRSHQGRYAGAG
FT                   RVLALEFVNNGKTYNAVWFSPDGKSGSYYDFDGVSLRGAFLRTALKFSRISSTFGMRMH
FT                   PIHKTWTGHKGVDYAAPSGTPIHSTAEGTVEFAGQQRGYGNVVIIKHFGKYSTVYAHQS
FT                   RIAAGIKPGVKVSQGQLIGYVGSTGWATGPHLHYEFRIDNQPVNPLAADLPVSRPLDAA
FT                   EARKFKAAVLPYKQQIALLTQFQQTLPESTTNVASR"
FT   CDS_pept        681721..682950
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="Bpet0612"
FT                   /function="Tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40944"
FT                   /db_xref="GOA:A9I287"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A9I287"
FT                   /protein_id="CAP40944.1"
FT                   /translation="MSQSEAPITPEVEADLRVAKRGCDELLVESEFARKLANSRATGVP
FT                   LRIKLGLDPTAPDIHLGHTVVLNKMRQLQDLGHNVIFLIGDFTSMIGDPSGRNSTRPPL
FT                   TREQIEANAKTYYAQASLVLDPARTEIRYNSEWSDPLGARGLIQLASRYTVARMMERED
FT                   FTKRFKGGVPIAVHEFLYPLMQGYDSVALKSDLELGGTDQKFNLLVGRELQKEYGQAPQ
FT                   CVLTMPLLEGTDGVEKMSKSKGNYIGISESPDSMFGKLMSISDTLMWRYFELLSFRSLE
FT                   DIAALKAGIEAGANPRDAKVALAQEIVARFHSAQAAEAALAAFQARFRDGAMPDDMPEI
FT                   NIAGAPLGILKVLREAGLVASGAEAQRNVEQGGVRVDGDRIEDKSLQLQAGTYVVQVGK
FT                   RKFARVNLAG"
FT   CDS_pept        682981..683634
FT                   /transl_table=11
FT                   /locus_tag="Bpet0613"
FT                   /product="conserved hypothetical protein"
FT                   /function="Phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40945"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:A9I289"
FT                   /protein_id="CAP40945.1"
FT                   /translation="MKLSSLSFSDNESIPDRYAFGKIDPQSHVALAENFNPQFSWDDVP
FT                   EGTRSFVLICHDPDVPSKPDDVNQEGRVVPADLPRVDFFHWVLIDLPADKRDIQEGDFS
FT                   SGITPRGKGGPLAPGDARQGINDYTSWFAADRDMSGDYFGYDGPCPPWNDALPHRYVFT
FT                   LYALDVPRLDVQGNFGGNDVLKALQGHVLAQASITGIYTLNPELAPKQIGDTSA"
FT   CDS_pept        684201..685448
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="Bpet0614"
FT                   /product="serine hydroxymethyltransferase"
FT                   /function="Glycine/serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40946"
FT                   /db_xref="GOA:A9I292"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I292"
FT                   /protein_id="CAP40946.1"
FT                   /translation="MFDRKLTLSQVDPEVWAAIQKEDVRQEQHIELIASENYASPAVMQ
FT                   AQGTQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRLKQLFGAEAANVQPNSGSQANQG
FT                   VYMAVLKPGDTVLGMSLAEGGHLTHGASVNASGKLYNFISYGLDANEVLDYAQVEQLAK
FT                   EHKPKLIVAGASAYALHIDFERLARIAHDNGALLMVDIAHYAGLVAGGAYPNPVPHADF
FT                   VTSTTHKSLRGPRGGVIMMKAEYEKIINSAIFPGIQGGPLMHVIAAKAVAFQEALSPEF
FT                   KQYAQQVAKNAKVLAETLVKRGLRIVSGRTESHVMLVDLRPKGITGKEAEAVLGQAHIT
FT                   VNKNAIPNDPEKPFVTSGIRLGTPAMTTRGFKEAEAELTANLIADVLDNPRDEANIAAV
FT                   RARVNELTARLPVYGG"
FT   CDS_pept        685562..686038
FT                   /transl_table=11
FT                   /locus_tag="Bpet0615"
FT                   /product="predicted transcriptional regulator"
FT                   /function="Predicted transcriptional regulator consists of
FT                   a Zn-ribbon and ATP-cone domains"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40947"
FT                   /db_xref="GOA:A9I295"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I295"
FT                   /protein_id="CAP40947.1"
FT                   /translation="MKCPFCGNADTQVVDSRVSEEGDTIRRRRRCLSCDKRFTTYERIE
FT                   LAMPSVVKRNGSRSDYDTAKLRASLSLALRKRPVSTDQVDSVVARIEETLLASGQREVS
FT                   TERIGELVMAELKKLDKVGYVRFASVYKNFEDIGEFVDAIREMQGPMLPGKLRK"
FT   CDS_pept        686068..687210
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="Bpet0616"
FT                   /product="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase / 5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /function="Pyrimidine reductase riboflavin biosynthesis"
FT                   /EC_number="1.1.1.193"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40948"
FT                   /db_xref="GOA:A9I298"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A9I298"
FT                   /protein_id="CAP40948.1"
FT                   /translation="MTTLTDPDDLIWMRRALALARTVMYTTTPNPRVGCVIVRDGRVLG
FT                   EGATQPPGGPHAEICALRDAAARGESVQGATLYVTLEPCSHYGRTPPCADAVAAAGPAR
FT                   VVVAMGDPNPQVRGQGLARLRAAGIAVTSNVCLDEALEINAGFVARMSRGIPWAWVKMA
FT                   ASLDGRSALHNGVSQWITGEAARADGHAWRARSCVVLTGMGTVLKDNPRLNVRAVETPR
FT                   APRKAVVDGDFAIPEDARLFDGAEVIIFTARTDAGKAARLAARNARVVALPGQQAGRVD
FT                   LPAMMRWLGEHEFNEVHVEAGAGLGGALMSAGCIDELLVYLAPVLLGDAAAMLRLPLIE
FT                   HLDHARRLEFTDTARIGPDLRLRARDSTRWQALREAAMCR"
FT   CDS_pept        687248..687877
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="Bpet0617"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /function="Riboflavin synthase alpha chain"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40949"
FT                   /db_xref="GOA:A9I2A2"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A9I2A2"
FT                   /protein_id="CAP40949.1"
FT                   /translation="MFTGLVAAVGRIVRVKPLADAAQGGVRLHIDAGELGLGDVGIGDS
FT                   IAVQGACMTVVALDDRHFQVDVSRESLNLTVGLDRAGEVNLEKSLRVGDQIGGHLVSGH
FT                   VDGLGTVLRFDNVGESRELAIRVPPHLARFLAYKGSVTVNGISLTVNRVTDVADGCDIS
FT                   INIIPHTQAVTTLRNVKPGDRVNLEIDTIARYVERMLAAPRPDGLK"
FT   CDS_pept        688215..690161
FT                   /transl_table=11
FT                   /locus_tag="Bpet0618"
FT                   /product="conserved hypothetical protein, putative protein
FT                   kinase"
FT                   /function="Putative Ser protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40950"
FT                   /db_xref="GOA:A9I2A6"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9I2A6"
FT                   /protein_id="CAP40950.1"
FT                   /translation="MRCRRLSVQNIVEGFKSLYAKDQETELSLEEYLALAKQDPMAYAS
FT                   PAERMLAAIGEPELIDSRNDPRLSRLFSNRIVRRYPAFKEFFGLEDVIDQIVAFFKHAA
FT                   QGLEERKQILYLLGPVGGGKSSIAERLKALMEAYPIYALKGSPVNESPLGLFHPDRFGA
FT                   TLEKEYGIPQRYLSGIMSPWAVKRLKEFDGDISQFRVVRLNPSVLRQVAIAKTEPGDEN
FT                   NQDISSLVGKVDIRKLDRHSQDDPDAYSYSGGLCLANQGLLEFVEMFKAPIKMLHPLLT
FT                   ATQEGNFKGTEGFSAIPFNGLILAHSNESEWQTFRNNKHNEAFLDRIYIVKVPYCLQVT
FT                   EEVEIYRKLLRNSSLATAPCAPGTLEMMAQFSVLTRLKEPENSSIYSKLRVYDGETLKD
FT                   VDPKAKALQEYKDYAGTDEGMTGVSTRFAYKILSSVFNHDQTEVAANPVHLMYVLEQRI
FT                   GREDYPEEIRRRYLDFIKGYLAPRYAEFIGKEIQTAYLESYSEYGQNIFDRYVTFADCW
FT                   IQDEEFRDPETGESFDRSALNDELEKIEKPAGIANPKDFRNEIVNFVLRARANNAGRNP
FT                   TWTSYEKLREVIEKKMFSNTEDLLPVISFNAKASAEDKSKHQSFVDRMVDKGYTEKQVR
FT                   LLCEWYLRVRKSS"
FT   CDS_pept        690174..691433
FT                   /transl_table=11
FT                   /locus_tag="Bpet0619"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40951"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A9I2A9"
FT                   /protein_id="CAP40951.1"
FT                   /translation="MNSLIDRRLNGRNKSAVNRERFLRRYKDQIRRAVQDLVRERSIED
FT                   MDQGGEINLPARDISEPHFRHGQGGDRELVHPGNREFAKGDTFPRPSGSDGEGGSEPGE
FT                   GESVDQFTFSLSRAEFLNLFFEDLELPHLIRTQLGDVTQKKWQRAGYTTTGSPSLLSVS
FT                   RTLKASLSRRVALGVAARAELEAAQAKLDAAIAAGAPQAEIDALRQEVEDCANRLARLP
FT                   FLDDLDLRYRNRVSVAMPMARAVMFCLMDVSGSMDEGKKDLAKRFFTLLYLFLSRKYEH
FT                   VDVVFIRHTDNAEEVDEQTFFYDPKSGGTIVLSALELMHEIVQQRYPPSAWNVYAAQAS
FT                   DGDSFGADAGKSARFLAENLLPATRYFAYIEVPDSQEARKSSLWAEYEQETAPHFVMRR
FT                   ICERGEIYPVFHDLFKKETA"
FT   CDS_pept        691430..692995
FT                   /transl_table=11
FT                   /locus_tag="Bpet0620"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40952"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:A9I2B1"
FT                   /protein_id="CAP40952.1"
FT                   /translation="MNAIVGSRAELEALGRARPISEGSEWTFELIQRYDEAIAEVAEEY
FT                   GLDTYPNQIEVITSEQMLDAYASAGLPIGYPHWSYGKEFIRNEQFYRRGMQGLAYEIVI
FT                   NSNPCIAYLMEENSMAMQALVIAHACYGHNSFFKGNYLFRQWTDADSILDYLVFARKYV
FT                   MDCESRYGIDAVEALLDSCHALTPHGVDRYKRPSPVSYREEAQRQAEREEHARLQYNDL
FT                   WRTLPRTEPDTAEEKRRIAFPPEPEENLLYFIEKHSPKLEPWQKELVRIVRKIAQYFYP
FT                   QGQTKVMNEGWATFWHYTLLNRLHQKGLVTDGFMMEFLQSHTNVVSQHGFDERGYGGIN
FT                   PYALGFAMMQDIRRICEAPTPEDRKWFPDIAGSDWVKTLDFAMRNFKDESFISQYLSPR
FT                   LIREFRFFAIADHQASPVLEVAAIHDEEGYRHIRKLLAEQHNRDNQVPDIQIVRYRRES
FT                   DRSLVLRHLQTRGRPLVADDADQVMKHLGRLWGFKVRLEETEPDGTVSSYREVNPANSL
FT                   REGS"
FT   tRNA            693100..693190
FT                   /gene="b_petrii_trna_03"
FT                   /locus_tag="Bpettrna_03"
FT                   /anticodon="(pos:693134..693136,aa:Ser)"
FT   CDS_pept        693494..694294
FT                   /transl_table=11
FT                   /locus_tag="Bpet0621"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40953"
FT                   /db_xref="GOA:A9I2B4"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9I2B4"
FT                   /protein_id="CAP40953.1"
FT                   /translation="MLGLYKTIKGEGMDCRLATHPLELLIGAHKEQPAAYLLAVTDVFN
FT                   SELPVVVHALRSYGSAYIAMRVSDPEDWQYDRMASAVDLQIPAYFEPAAAAALFTSRLR
FT                   QWLHAVPGSNQQRYVKRICPTHEIYDRLQGYPRAEFPYSRRHARCFEEIRPPAPTPALS
FT                   SMGWVLSCSGWVLKSPKGHAISLSASERQILVWFSQSEDGFIPVHERSPLLSEGPPMKK
FT                   RSLAVVISRLRAKCSALGLAVPIFTQRGKGYQFAQPLTVDAPSS"
FT   CDS_pept        694531..695247
FT                   /transl_table=11
FT                   /gene="lytR"
FT                   /locus_tag="Bpet0622"
FT                   /product="response regulator LytR"
FT                   /function="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40954"
FT                   /db_xref="GOA:A9I2B7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9I2B7"
FT                   /protein_id="CAP40954.1"
FT                   /translation="MLRVVVVDDEAPARRYLRRLIESLDGPQVVAEAACLHSAIDTINQ
FT                   HRPDAVFLDIELTHSTAFDVLSALSCQPQLVFVTAHAPYATRAFEVDAVDYLLKPVGIE
FT                   RLRQAVQRLYTRLNRSADDAAFLTVRSLRHNRLVRAQALAALVAQRDYVRLHVEQAETL
FT                   LMYATLKSVLPQLGALPFAQVSRSVVVNLDQVGHVVAQSSLAAQVEFINQAPPLQLGRT
FT                   AYLRLRQALDERRARQ"
FT   CDS_pept        complement(695312..695545)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40955"
FT                   /db_xref="UniProtKB/TrEMBL:A9I2C0"
FT                   /protein_id="CAP40955.1"
FT                   /translation="MNKTARQNVPSEHADDRWPKAPTHADKGTGVMPMPDEAPDVAGRA
FT                   RRGRAIAEPGDPGVITPEDDVLDTSHLHRHDR"
FT   CDS_pept        complement(695680..696936)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0624"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40956"
FT                   /db_xref="GOA:A9I2C3"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:A9I2C3"
FT                   /protein_id="CAP40956.1"
FT                   /translation="MLQDGSRIAYLSDQLTIWGPRILVAILILIVTHFVARLVRWGLIK
FT                   LVDKIPLLTKASSESDSDLAGSMGTLGYWVIWLVGLLVALQPLGLTQAMAPINALTQEV
FT                   FTYLPRIIGAGIIFFVGVLIARIARTIVETALGAVKWDRLCARLGKTAAAPDTAATETI
FT                   EPPPSAGGRCGALVRTAGMLTFTIIVIPVAISALQTLGISSIVEPTVFVLQTILDAIPR
FT                   IFAAALVLAIAYFIARWVRSLLEQLLVSTGFDRALTGFGGLSTQTTPSRVAGWIALVAI
FT                   MLFAAIESASLLKFDIVAAMLSQVTELGGQVVFGSAIVLVGVVMARLVARLVGDAVGES
FT                   GLPSILKYAIIALAVAMGLRFMGLANEIVNLAFGLILGSAAVACALAFGLGGRETAHQL
FT                   LQRWINERKNKNPPTNRPE"
FT   CDS_pept        697087..698100
FT                   /transl_table=11
FT                   /locus_tag="Bpet0625"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40957"
FT                   /db_xref="GOA:A9I463"
FT                   /db_xref="InterPro:IPR011213"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9I463"
FT                   /protein_id="CAP40957.1"
FT                   /translation="MPCAGLMSAGAGSYNPAFCTVAAPALTDPTERSVSAELVAVLVAV
FT                   TQGQPRVLTTEDASALPAGPFELEHRSLQAGLRAWVEAQTHHPLGYIEQLYTFADRDRS
FT                   DDGGWRAISVSYLGLTREAGATGVAQVGWQDWYRYFPWEDHRDGPPALIGELIAPRLKA
FT                   WVRAADGRAAQAHRRQRAALTFGLDGAAWNEDMVLQRYELLFEAGLVPEAARQAPAVDG
FT                   PMVPGQAMRHDHRRILATGIARLRAKIKYRPVVFELMPPAFTLLQLQTAVEALAGRGLH
FT                   KQNFRRLIEQQALVEETGDMATGTAGRPAKLFRFRRDVLLERAIAGSKLPLARQPK"
FT   CDS_pept        698222..699091
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="Bpet0626"
FT                   /product="nicotinate-mononucleotide pyrophosphorylase"
FT                   /function="Nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40958"
FT                   /db_xref="GOA:A9I465"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A9I465"
FT                   /protein_id="CAP40958.1"
FT                   /translation="MKSAPDLALPVAPLPAVMLEPLVRAALLEDLGRAGDLTTDAIVPN
FT                   DAQARTRLVARQEGVLAGLDLARLAFQLMDAGIEFRPVLADGARLRPGSEIAVISGPAR
FT                   GMLTAERTALNFLGHLSGVATATASIADAIRPHGARVTCTRKTLPGLRAVQKYAVRVGG
FT                   GSNHRHGLDDAVLIKDNHVAVAGGVRQAVQRARAGIGHMVKIELEVDTLEQLDQALEIG
FT                   VDVVLLDNMDLPTLREAVRRVGGRAVTEASGRITPESAPEVAATGVDLIAVGWLTHSAR
FT                   VLDIGLDS"
FT   CDS_pept        699202..699600
FT                   /transl_table=11
FT                   /locus_tag="Bpet0627"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted redox protein regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40959"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A9I470"
FT                   /protein_id="CAP40959.1"
FT                   /translation="MTIRVRQNAPGTLQFTATAEGHELPLDMPRPQGQGPDPHDYFDTS
FT                   LGGCKAMTVMLYAQRKEIPLESVDVDVVRDAGEERKGIYRLTAKLTLHGPLSDAQIDEL
FT                   FSVAEKCPVHKLMTAVDVQVSTLVVRPA"
FT   CDS_pept        complement(699635..700420)
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="Bpet0628"
FT                   /product="enoyl-[acyl-carrier-protein] reductase [NADH]"
FT                   /function="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40960"
FT                   /db_xref="GOA:A9I473"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9I473"
FT                   /protein_id="CAP40960.1"
FT                   /translation="MGFLAGKRILVTGVLSNRSIAYGIAQACHQQGAELAFTYVGDRFK
FT                   DRVGEFAAEFGSDIVLPCDVAEDSQIDAAFASLRERWDGLDGLVHSIGFAPREAIAGNF
FT                   LDGLSRENFRIAHDISAYSFPAMAKAALPLMQGRKASVLTLTYLGAERVVPNYNTMGLA
FT                   KASLEASVRYLASALGPRGIRANGISAGPIKTLAASGIKDFSAILKFVESHAPLRRNVT
FT                   IEEVGNVAAFLLSDLAAGITGEITHVDAGFSTVTAGMED"
FT   CDS_pept        complement(700511..701896)
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="Bpet0629"
FT                   /product="membrane-bound lytic murein transglycosylase D"
FT                   /function="Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40961"
FT                   /db_xref="GOA:A9I476"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A9I476"
FT                   /protein_id="CAP40961.1"
FT                   /translation="MILSRLLLPLVLAMLAGCAGTARQPVQAIDSAKQQYTAKDTSRTV
FT                   DLTNPPVDAWDRIRRGFAIPNLNTPLAQEWTDYYAAHPESVQRMAARAGKYLYFIVDEI
FT                   NRRGLPTELALLPFVESAYNPTALSRSQASGLWQFIPTTGQYFNLKQDWWRDERRDPIA
FT                   STYAALDYLEKLFEMQGDWYLALASYNWGEGSVQRAIAKNEAANLPSDYLSLDLPEETR
FT                   NYVPKLQAIKNIIANPRKYAVVLPPVENSPYFAMVRKNRDIDLEVAARLAEMPLEEFKA
FT                   LNPSFNRPLIRGEHQPTLLLPTDRVDIFNANLQAYQGDLSSWKVYQPRRGESYASIAKR
FT                   FGISEAELRRANDISSRRRTASGGSLLVPSGGRAGVQLASLETPAGALDSLDAAPSRAK
FT                   PATRGSRRPNVRTHKVRAGDTLFGLAKRYGTSVDTLRALNNLKGNNLKIGSQLRLPGTG
FT                   ARG"
FT   CDS_pept        complement(701907..703196)
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="Bpet0630"
FT                   /product="probable hydroxyacylglutathione hydrolase"
FT                   /function="Zn-dependent hydrolases including glyoxylases"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40962"
FT                   /db_xref="GOA:A9I480"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9I480"
FT                   /protein_id="CAP40962.1"
FT                   /translation="MRQPRLHARHARAGSPEAPGIEAGDDQPAFGHQHALGFAQHFMRR
FT                   VGAFEGMRQHQQVDALRLEWQGVGTGHHAALPLRRLLGGGHLRAHPALERHAVGPQQID
FT                   FGQSRLPGVISENIRHHGVELRALPGQDVFAWRRLEPFGQFYNRRSFFAQVDVPEMMQA
FT                   MPAPGGDGTVAPLPAFSDNYIWAIVRDGQVAVVDPGEAGPVLELLARRGLQLRAILLTH
FT                   HHGDHVGGVLELLRHAPATVYGPAQERLPHCDVRLSEGDRVTLPELDLDLSVLDVPGHT
FT                   AGHIAYYGRAAGRQPLLFCGDTLFAGGCGRLFEGTPAQMHASLEKFAALPADTQVCCAH
FT                   EYTLANLRWAMAVEPANRTLQQWYQRAQQLREQGRPTLPSTLRLEQDTNPFLRTQQANV
FT                   AQAAAVQSGRVLDTPVAVFAALREWKNDFK"
FT   CDS_pept        703544..704023
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="Bpet0631"
FT                   /function="Ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40963"
FT                   /db_xref="GOA:A9I483"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9I483"
FT                   /protein_id="CAP40963.1"
FT                   /translation="MMQTDSNEDGPQVEMWTDGACKGNPGPGGWGVLMRAGAHEKTLHG
FT                   GEAGTTNNRMELLAVIEGLRTLKRPCQVVIHTDSQYVMKGMTEWLANWKRRGWLTADKK
FT                   PVKNAELWQALDEQVARHKVSWRWVRGHAGDPGNERADALANLGVESLRKRRAGA"
FT   CDS_pept        704173..705318
FT                   /transl_table=11
FT                   /locus_tag="Bpet0632"
FT                   /product="RND efflux membrane fusion protein"
FT                   /function="Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40964"
FT                   /db_xref="GOA:A9I488"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A9I488"
FT                   /protein_id="CAP40964.1"
FT                   /translation="MAGRPYAPPPIRMKKAVLLAAAAAGVAAGAALGFWAPRWLTAPPA
FT                   DTPARASATAAPVSAIRVETAKVQQLTFTRGISAVGSLRSDESVVLRPEVAGRIQHIDF
FT                   QEGQPVTKGQVLIRLDDSVPRAELDQARANLALAQSHYRRAVDLQGRGFVSQQARDEAA
FT                   SNLKVQQAAAALAQARLDKMTIRAPFAGIVGLRSMSVGDYVDQGQDLAPLEAIDPLKVD
FT                   FRVPEMYFGKVKVGQALTVRLDALPGEVRQGQVYAVSPLVDAGGRSILLRATVPNADSR
FT                   LRPGMFARVQLLFGADQVLAVPEAALAPSGQSQYVFNVRDGRAHRAEVTLGERRDGKVE
FT                   ILTGVAAGDQVVVAGFQRLTDGAPVEIVPAPAAGASGAERS"
FT   CDS_pept        705315..708395
FT                   /transl_table=11
FT                   /locus_tag="Bpet0633"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /function="Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40965"
FT                   /db_xref="GOA:A9I491"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A9I491"
FT                   /protein_id="CAP40965.1"
FT                   /translation="MILSEICIKRPVFASVLSLIIVLVGLISYSRLTVREYPNIDEPIV
FT                   SVNTIYKGASPEVIESQVTKPLEDQLAGIEGVNVMTSRSRTERSQINIKFDLSRDPDAA
FT                   AAEVRDKVSRARRYLPDEIDEPIIGKVEADAYPIIYIAVESGSLSAIQTSDYINRYIKT
FT                   RLSVLPGAAEVRVYGERLPSMRIYVDRDKLAAYNLTVQDVETALASQNVEIPAGRIESR
FT                   DREFSVVSSTDLQTPAQFAAIVVANVKGYPVRLGDVAKVEIGAADDRILSRFNGRPAIN
FT                   IGLTRQSTANPLDLSKAVRAEVAQLNETLPAGMKLNIAYDSSVFIERSIQSVFRTIGEA
FT                   IVLVVLVIFFFLRNLRASIIPIVTIPVSLIGACGLMYLFGFSVNTLTLLAMVLAIGLVV
FT                   DDAIVVLENIFRHIEEGMPRRQAAFQGAKEIGFAVVAMTLTLVTVYAPLAFATGRTGRL
FT                   FIEFALTLAGAVLVSGFVALTLTPMMCSVLLRHEPRHNRWYNLVEGWLEALARGYRRAL
FT                   GLALRHRGVVVVVGLLVAGASGVLFSVVKSELAPIEDRGVIFGTVSAPEGATLNYTLES
FT                   MLEIEHFYSQIPEAEANQVSVGYPTVSDATAILRLKPWEQRERKQQEIARELQPKFAGL
FT                   PGVKAFPTNPPSLGQSARSKPVEFVIMSQASYPELARMVNVFVDALRSYPGLQNLDTDL
FT                   RLNTPELRVQVDRDKMADVGAGVDVVGRTLESMLGGRQVTRFKDEGEQYDVIVQVLPRD
FT                   RANPADISGIYVRTRDGSMVQLDNLLSVHESVSPQSLNHFNRLRAVKVEAAVAPGYALG
FT                   EVLEHMHEVARQVLPHTVVTDLDGQAREFRDSSGSIYLVFAMALAFIYLVMAAQFESWR
FT                   NPFIIMLSVPLSMTGALLALWASGGTLSIYSQIGLITLVGLITKHGILIVEFANQLRDQ
FT                   GRELVDAVVEASVLRLRPILMTTGAMVLGTLPLAVSHGAGAESRQQIGWVLVGGLMLGT
FT                   LLTLFVVPVAYTLIATVRRKPGHAAESAGHAAPPATE"
FT   CDS_pept        708402..709127
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="Bpet0634"
FT                   /product="DNA polymerase III, epsilon chain"
FT                   /function="DNA polymerase III epsilon subunit and related
FT                   3-5 exonucleases"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40966"
FT                   /db_xref="GOA:A9I494"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9I494"
FT                   /protein_id="CAP40966.1"
FT                   /translation="MRQIIFDTETTGLDPSQGHRIVEIGCVEIVNRVVTGNHLHIYLNP
FT                   DRDSDPEALAVHGLTTEFLADKPRFADVAQQFLEFIQGAELIAHNAAFDVKFFNAELSM
FT                   IGRGDLSQYCALVTDSLQHARTLYPGKRNSLDALCDRHGISNAHRTLHGALLDSQLLAE
FT                   VWLAMTRGQDALLIDVDDASQGGGAGIALGAFDSSVLPVLAATADELAEHEEYLASLDK
FT                   SVGGACVWRKLDAPVAVDA"
FT   tRNA            709197..709271
FT                   /gene="b_petrii_trna_04"
FT                   /locus_tag="Bpettrna_04"
FT                   /anticodon="(pos:709229..709231,aa:Val)"
FT   CDS_pept        709513..710103
FT                   /transl_table=11
FT                   /locus_tag="Bpet0635"
FT                   /product="putative lipoprotein"
FT                   /function="SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40967"
FT                   /db_xref="InterPro:IPR021658"
FT                   /db_xref="InterPro:IPR037125"
FT                   /db_xref="UniProtKB/TrEMBL:A9I497"
FT                   /protein_id="CAP40967.1"
FT                   /translation="MRISYLFVLAILFLSGCRLDTKTAEEVAQLKQHITQQDSAIQELK
FT                   RSSEALKAELASVKLDTSFNSLRLNLESASYTAPLNLTDQSFSTVRTGLGIFLVSVQDV
FT                   TPFANGVKLKLDVGNPQAMTYAGLKFKLSWKTASNANGPDQTKDIDLPQRFLPGSWNRA
FT                   ELVISPAKADDIANVRVSIDPNQVRLQVPASKG"
FT   CDS_pept        complement(710134..710940)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0636"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40968"
FT                   /db_xref="GOA:A9I4A1"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4A1"
FT                   /protein_id="CAP40968.1"
FT                   /translation="MNLAVPAIVVFFVLLPGFIFRSRLKLVEKESQDFSPFGQVVAGGV
FT                   VCAALLHGVVLAGAYFLDRTARLDLFVHVLVSPSTLAAEDFRAIAGSAWQIAQYFGALY
FT                   VLAILVPTAIRACIVYFELDRFDSCLSKLFRFHRAPWYYLLSKADFKASERPMLLISVS
FT                   AIVEVAGQAYLYHGFLDEYFTDKDGQLDRIVLTATERRRIEQDRAIEKPIQSAGENEPD
FT                   VGPQDVAVRFYPITGDYFVLRYSEIITLNIHYYRAEVPTQKETQQS"
FT   CDS_pept        710991..711254
FT                   /transl_table=11
FT                   /locus_tag="Bpet0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0637"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40969"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4A4"
FT                   /protein_id="CAP40969.1"
FT                   /translation="MTTVRSAPEALLNVKELFPASFACVLRIASRSLLVASRLDKTSLI
FT                   RGLLDTFIITSEGMVLPHRLLRTQVLPGAAYCPQGQQRTIEV"
FT   CDS_pept        complement(711860..712432)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0638"
FT                   /product="Major capsid protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40970"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4A7"
FT                   /protein_id="CAP40970.1"
FT                   /translation="MPGKLRRVLDDAPALTQQVSPLLRYGVLAKASAEIIAGATVGKIQ
FT                   GLATQATQHQVPGTMALADAIGNAATALDVEGWNADTVIIHPNDLFAIRSERTTDEGYV
FT                   ASGWVGGNKQTIWGLRAMSDPSVTEGEPLVLDSSQVAILDRMDARVEFGRSGDDMINNL
FT                   VTALAEGRLGLAVFSPSAVKIISFGSE"
FT   CDS_pept        712679..714352
FT                   /transl_table=11
FT                   /locus_tag="Bpet0639"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40971"
FT                   /db_xref="GOA:A9I4B0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4B0"
FT                   /protein_id="CAP40971.1"
FT                   /translation="MRINLPITQNCYDFPADQTLISITDLKGRITYCNPNFIEVSGFTR
FT                   AELIGQPHNLVRHPDMPDEAFRDMWETIQAGMPWTALIKNRRKNGDYYWVRANATPMRN
FT                   GARIVGYLSVRTHAPQDEIQEAEALYAAMRRDAERGQRVHVLHRGAVLNNSLLGRVGRL
FT                   FSFGLRGQIILSTLFMAAVAPLAYVIGKPYGAPEWVPALASLAAAALVARRLVRIGVAP
FT                   LREVISTANLLAAGDLTQYVRVDGKGEIGQLQLGLAQLAVSMRTVVRDVREEVVKLRSG
FT                   AGEIASGNRDMSARTESQAGSLEQTAAAIEQISHTVHQTTGMAESGAGMARETVGAAQR
FT                   SHEAVQNVVTTMHEISQASQRIGDIIQVIEGVAFQTNILALNAAVESARAGEQGKGFAV
FT                   VASEVRALAQRTTQAAKEIRALIEESGQRVRLGEQRAGEARTRMDEVVDAIQRVTDSLE
FT                   HINDTSQQQSSGIGQVNTAVTQLDQITQQNAAMVEELAAAASSLDEQVSVVHDTIRVFR
FT                   LTDQDSSLAEVDAVALRKEGRAMLGKPSGGQQPGLALIAA"
FT   CDS_pept        complement(714375..714896)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0640"
FT                   /product="putative acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40972"
FT                   /db_xref="GOA:A9I4B3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4B3"
FT                   /protein_id="CAP40972.1"
FT                   /translation="MTDRPHVRPMQADDIEPVLRIQASVYPATLLEDAALFQNRLEISP
FT                   GTCQVAEGPAGLLGYLVAYPWLADHPPALNTPLDAVPRDADSWFVHDCAVLPAAQGLGV
FT                   AQALLQGGLEHARRRGLCHTSLVALRPAVSYWERLGYRAAAAHAGLRTKLAQYGAGARY
FT                   MVRSLEKPRG"
FT   CDS_pept        715066..716124
FT                   /transl_table=11
FT                   /locus_tag="Bpet0641"
FT                   /product="putative bactoprenol glycosyltransferase"
FT                   /function="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40973"
FT                   /db_xref="GOA:A9I4B6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4B6"
FT                   /protein_id="CAP40973.1"
FT                   /translation="MPIEFRSEAPAAAVPPSQAAAPLRALPARADALGDCHVSCVIPCL
FT                   NECDNLRLLLPALRAQLQGLCAQWEIIVVDDGSTDATPELMAEWTVLDGMRYVQLSRNF
FT                   GKEAALSAGFEAADGDAVICLDADLQHPPALIGAMLQRWREGADMVYAVRTHRGDESWL
FT                   KRTGARVFYRLLSGAHGVEVPAHAGDFRLMDRRVVEALVALPERTRFMKGLYAWVGFRA
FT                   EPLPYTPDARAHGASRYGAWRLVRLALDGLTAFTTWPLRLVSLLGCAFSLASFAYGSYL
FT                   VLAYWFNGNQVSGWTTIITALLFFAGVNLISLGVVGEYVARIFDEVKGRPLYVVRQRRG
FT                   RAQRTGARRGQA"
FT   CDS_pept        716121..717740
FT                   /transl_table=11
FT                   /locus_tag="Bpet0642"
FT                   /product="undecaprenolphosphate-sugar glycosyltransferase"
FT                   /function="trans-membrane transfer of a sugar residue"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40974"
FT                   /db_xref="GOA:A9I4C0"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4C0"
FT                   /protein_id="CAP40974.1"
FT                   /translation="MNAYRLKQLRAGVPPAGLLLLAAGIWLGWLAWMRPLTLPDEGRYA
FT                   GVAWEMLRSGSHAVPLLDGMPYFHKPPLYYWMAELCFRLFGLNEWAARMPSWLAAWAAL
FT                   AGLYAFVRRYRDAACATAAVVILATMPFYYGAAQFANTDMLVAGLVTLAVLAGADAVLR
FT                   AEAGERYRVPSLAAAVAAALAVLAKGLIGLVLPGAALCLWLLYTRRWRGFVVLLWPPAL
FT                   AAFALVAVPWFWLMQQRFPGFFHYFFVYQHFERFAQSGFNNVQPFWFYVPVVVGLALPW
FT                   SLWGGGALRKVFWTDADAFGLRSLMAIWAGVVLVFFSIPSSKLIGYVLPALPPLAVLLA
FT                   EVLQQALQRGDPRRTRRMAWGCAAASAAICVVLVGVFAANPRRSAEALGRRIAAEMGPA
FT                   DTLVTLHSYPFDLGFYTGARRPGWVVDDWSDPEIALRDNWRKELYDAGQFGPQVARRVL
FT                   VPHGGLAARLCAAAPGSRFWVWGGVDDGRRFRILHGMQAPLADAHYRVWRVDVDAAFRQ
FT                   RVCGETPTAGLPGTSARPGPAG"
FT   CDS_pept        717892..718908
FT                   /transl_table=11
FT                   /locus_tag="Bpet0643"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /EC_number="2.4.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0643"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40975"
FT                   /db_xref="GOA:A9I4C3"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4C3"
FT                   /protein_id="CAP40975.1"
FT                   /translation="MTRERYDERNQPACRIGGQRGHAQQFDAGHGGQPVCGRGRAAHGD
FT                   EPANLFEQGAHGESGMGQWWKRIVVCGDDFGMNAGIDAGMLRLAKLGRLSAISCLTQGP
FT                   TFTAHAAGLQDADLDLGVHLNLTEALGHPGQADVAPLRALIARAYTGRLDEAWIDDQLT
FT                   RQFDAFEDVLGRAPDYVDGHQHVHQLPGVLPRLLRLLEQRYGRQTPWLRYTAPGMQEGI
FT                   PLRESAKARLIGALGAETVARVARRDGWRTNRRLLGVYSLQGGARRYADLLQRWLLNAR
FT                   DGDLLMCHPAVSGAGDTLAGQRAAEFEVLARADLGDWMRLNGVCVARPVAAQLSEML"
FT   CDS_pept        complement(718903..719814)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0644"
FT                   /product="putative lipoprotein"
FT                   /function="Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0644"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40976"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4C6"
FT                   /protein_id="CAP40976.1"
FT                   /translation="MPLLPRFPLRRLLGVGLVAAASAVGCTQLDAWQRQAIFSPEPDQQ
FT                   RWWREPPADTEIFDLALPSGDKVHAWYWQHPRPGAPAVLYLHGARWNLNGSAFRMEGWT
FT                   RMGYSVLAIDYRGFGESTPLLPSEDTAFEDAAAALRELARRQPDPARRFVYGHSLGGAI
FT                   AIDLAARDDMPPFAGLIVESSFTSIAAMLGTLKWGKLPGASLLVTQPFASVEKLATLTT
FT                   PMLFLHGTADRVVPHTMSDELFAAALKVPPHLKRLVKIDGASHSGSIRSGQAYETAVRD
FT                   FVRDARQAYRPVAAGNVAAPPL"
FT   CDS_pept        complement(720261..720893)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0645"
FT                   /product="putative membrane protein"
FT                   /function="Putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0645"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40977"
FT                   /db_xref="GOA:A9I4D0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4D0"
FT                   /protein_id="CAP40977.1"
FT                   /translation="MTALPFNESTLLLLGPLALFALVSSITPGPNNIMLASSGLTFGFR
FT                   RTIPHMLGVNLGFTLMLVLVGLGLGTMFQQLPWLYTVLKYAGAMYLLYLAWKIAMSGPL
FT                   ESGAQRGRPFTFMQAALFQWVNPKAWVMAVGVIATYTPQAGFYWNLALAAAVCCVVNLP
FT                   SIGIWAAFGTALQRWLHRPLAIRAFNVGMAALLVASLYPVAVDVVRG"
FT   CDS_pept        complement(720890..721801)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0646"
FT                   /product="putative Permeases of the DMT superfamily"
FT                   /function="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0646"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40979"
FT                   /db_xref="GOA:A9I4D6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4D6"
FT                   /protein_id="CAP40979.1"
FT                   /translation="MSRPTAYASPAPAAAPLWEGYGYGLLGVLVFSLTLPMTRVAVAEL
FT                   SPVLIGLGRALLAAVPAALLLWLTRSRLPSRHEWPGVLLAATGIVVGWPMASTLAMATV
FT                   PAAHGAVFNGLLPLSTAAFAAWRSGERPSLAFWAWAVAGAVLVMGYALRQGHGALQTGD
FT                   LWLLLAVLLGGMGYAEGARASRTLGGARTICWALAVSAPVIAGPVLWLAAHTPPPSATV
FT                   AAAFAYLAFGSMFLGFFAWYRGLAVGGIARVGQVQLLQPFLTVVAAALLFHETVEPLTF
FT                   VFALAVVAIIAGGRRAIVRKAP"
FT   CDS_pept        721800..723380
FT                   /transl_table=11
FT                   /locus_tag="Bpet0647"
FT                   /product="transcriptional regulator, GntR-family"
FT                   /function="Transcriptional regulators containing a DNA-
FT                   binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0647"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40978"
FT                   /db_xref="GOA:A9I4D3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4D3"
FT                   /protein_id="CAP40978.1"
FT                   /translation="MIPVQGGACGQAGFLPLYANRSVQYRYTFPYHLDYWPGRTAMTVT
FT                   LASESAAGWRPVRQADATLVAQLADDVARRIDDQGLRPGTRLPSIRKMAEQAGVSRFTV
FT                   VEAYDRLVARGLVQSRRGAGFFVRARRGPLAAAARAASAGDIAAPPARIDVAWLLRNMF
FT                   REPEASAMPGGAGLLPADWLDPGMVSAAVRAVGRAVRGHLVAYGSPLGYAPLRQQLASR
FT                   LQADGVPAHPDHNLLTTNGVTHGLDLVARHLVRPGDAVLVEDPAWFVIFGRLAAFGARL
FT                   IGVPRGPDGPDLEQLDRLAALHKPRLFIINGAVHNPTGHTLSAGAAYDILRLAERHDFL
FT                   VVEDDTYGELHPGGAMKLASLDRLNRVILAGGFSKMLAASLRVGYLAANAELLQKLADL
FT                   KMLAGLTTPELGERVVHRVLVEGQYRRHIERVRARVNVARQQCLSALVGLGLAVPHEPH
FT                   AGMFVWADCGRDSESLARTAVDHGLLLAPGSLFSPSQAPSTMMRFSVSMVDTPGIWQAV
FT                   ARVLAAPGN"
FT   CDS_pept        723450..723797
FT                   /transl_table=11
FT                   /locus_tag="Bpet0648"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0648"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40980"
FT                   /db_xref="GOA:A9I4D9"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4D9"
FT                   /protein_id="CAP40980.1"
FT                   /translation="MADVPIKPLTEHFAVAPQLAPDDMAGVAAAGYKSVIINRPDFEGG
FT                   PDQPTAADVSRAAREAGLQVEYQPVIGSAMTPADVARFAELLRTLPGPVLAYCRTGTRC
FT                   TNLFVASQQMP"
FT   CDS_pept        723891..724361
FT                   /transl_table=11
FT                   /locus_tag="Bpet0649"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0649"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40981"
FT                   /db_xref="GOA:A9I4E2"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4E2"
FT                   /protein_id="CAP40981.1"
FT                   /translation="MFKKILIPTDGSPLSAQAANAGICFARSVGAEVVALHVTQPFAAT
FT                   IGFDGMAAAYAITDEDYEKASAEQAEKYLKQILDRADTAGVKAQSRAVSNFNVADGIVQ
FT                   AASENGCDLIFIGSHGRSGLSRLLLGSVTAKVLSLATIAVLVYRVKEDKEKK"
FT   CDS_pept        724535..726649
FT                   /transl_table=11
FT                   /gene="fusA1"
FT                   /locus_tag="Bpet0650"
FT                   /product="elongation factor G"
FT                   /function="Translation elongation factors (GTPases)"
FT                   /EC_number="3.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0650"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40982"
FT                   /db_xref="GOA:A9I4E5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4E5"
FT                   /protein_id="CAP40982.1"
FT                   /translation="MTRKTRIDQYRNIGISAHIDAGKTTTTERILFYTGITHKLGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYDAVGGVQPQSETVWRQANKYGVPRLAFVNKMDRVGADFFRVQRQIAERLK
FT                   GDAVPIQIPVGAEDHFLGVVDLVKMKAIIWDDASQGVRFEYQDIPAELADEARLWHDRM
FT                   VEKAAEADETLLEKYLSGETLSEDDIKRGLRLRTIANEIVPMLCGSAFKNKGVQAMLDA
FT                   VIDYLPSPADVPAIKGHDEQDREIERHPADDEPFSALAFKIMTDPFVGQLVFFRAYSGV
FT                   VKSGDSVFNPLKGKKERLGRLLQMHANERREISEVYAGDIAAAVGIKDVTTGDTLCDPN
FT                   HVVILERMSFPEPVISQAVEPKTKADQEKMSLALNRLAQEDPSFRVRTDEESGQTIISG
FT                   MGELHLEILVDRMKREFNVEATVGKPQVAYRETIRKTCDEVEGKFVKQSGGRGQYGHVV
FT                   LKLEPQPAGGGFEFVDAIKGGVVPREFIPAVERGVRESLNAGVLAGYPVVDVKVTLVFG
FT                   SYHDVDSNENAFRTAASMAFKEGMRRARPVLLEPMMHVEVETPEDFTGHVMGDLSSRRG
FT                   MVQGMEDIAGGGGKLVRAEVPLAEMFGYSTSLRSLTQGRATYTMEFKHYAEAPNQVAEQ
FT                   VIAAHGGGGR"
FT   CDS_pept        complement(726728..727564)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0651"
FT                   /product="probable transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40983"
FT                   /db_xref="GOA:A9I1A3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1A3"
FT                   /protein_id="CAP40983.1"
FT                   /translation="MLELRQQFPLAGLLSVVGLSRSTFYYQWRAGQAEDKFASLKSRIC
FT                   AIFAQHHGRYGYRRITEAIRQQGWPVNHKTVQRLMGLLGLKSCVRVKKYRSYRGTLSQL
FT                   APNVLRRQFRAARPNQKWATDVTEFRVGTQKLYLSPVMDLCNGEIIAYEMACRPSFAMV
FT                   AAMLRQACARLSPYERPILHSDQGWQYQMPAYRELLAQHAVTQSMSRQGNCLDNAAIES
FT                   FFGTLKAEFFHLNTFQTIEQLKDGIDRYIHYYNHHRIKLKLNGLSPVQYRTQLLAT"
FT   CDS_pept        complement(727564..728070)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0652"
FT                   /product="ISPsy8, transposase OrfA"
FT                   /function="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0652"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40984"
FT                   /db_xref="GOA:A9I1A0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A9I1A0"
FT                   /protein_id="CAP40984.1"
FT                   /translation="MVKYSEQTKFAAVEEYCRGDLGLEAVAQRHGVNPHALRRWAAAYR
FT                   EHGASGVRAKRGRYSASFKQTVLQQMKQQGLSYRQAAARFDIRNFNIIARWARQYDVQG
FT                   LAALSTGQPPAMTSPVKPASPDATRTREDLLKELQFLRMENAYLKKLDALVQAKQKSAQ
FT                   QKKRK"
FT   CDS_pept        complement(728207..729010)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0653"
FT                   /product="putative hydrolase"
FT                   /function="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0653"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40985"
FT                   /db_xref="GOA:A9I4F4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4F4"
FT                   /protein_id="CAP40985.1"
FT                   /translation="MRSEPQLPLQTASINGYAMTYTEHGDGTPLVLVHGSLCDCRYWKS
FT                   QMGPLGRSFRVLAPSLRHYWPQQWDGVDFSMDQHVDDLLAFIDTVGEGAAHVVGHSRGA
FT                   RVALEAALRAPARVRSLTLADPGLPMPGREGDTRGGFRQRALALIEAGEVDAGLALFVD
FT                   TVSGADTWRRMVPWFKDMVRDNASTLGGQATEHLPPVPREQVERLALPTLLIGGALSPA
FT                   PYPAVLDMLAEWLPAARKEVIAGSSHGMNLGNPRAFNAAIEGFLA"
FT   CDS_pept        729140..729637
FT                   /transl_table=11
FT                   /locus_tag="Bpet0654"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40986"
FT                   /db_xref="GOA:A9I4F7"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4F7"
FT                   /protein_id="CAP40986.1"
FT                   /translation="MSAESATPLPESAQRVARLLQELGHEHSIVILPQTGKTSAEAAQG
FT                   LGCQVAQIAKSIIFRRRADDVPVLVIASGVNRVDEAKVAGLVGELAKADARYVRDMTGY
FT                   AIGGVCPIGHAVKPAMLIDQDLFQYDTLWAAAGHPHAVFQLSPQQLVAMTGAPVADVAL
FT                   RA"
FT   CDS_pept        729662..730564
FT                   /transl_table=11
FT                   /locus_tag="Bpet0655"
FT                   /product="putative Permeases of the DMT superfamily"
FT                   /function="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0655"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40987"
FT                   /db_xref="GOA:A9I4G0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4G0"
FT                   /protein_id="CAP40987.1"
FT                   /translation="MDWTWVWIPATLAAATAQAGRNAVQRSLTATLGTLGATQVRFLFG
FT                   FPFALLFLALVLIVGGEPAPVGGTDFMGFVLGGAVAQIVGTAMMLAAMRERSFVVVTAW
FT                   TKTEPIQVALFGFAVLGDPLSVMGVAAVLLATLGVVLMSVDPASATGRGSLRPALLGLV
FT                   SGAFFALSAIGFRGAILALDSGGFVLTATWTLAWSLGVQTLLLVLWMALFNRALLSACL
FT                   RAWRASIWGGLLGATASQCWFLGFALTAAANVRTLGLVEVLVAQLLSRRLFSHAGSRRE
FT                   LSGVALIVLGVGLLLASSG"
FT   CDS_pept        complement(730575..731252)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0656"
FT                   /product="putative periplasmic protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0656"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40988"
FT                   /db_xref="GOA:A9I4G3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4G3"
FT                   /protein_id="CAP40988.1"
FT                   /translation="MRAQVLPLRTLAVTVFLAVAAPAHAFSDDEARRAILDLRQQVQQQ
FT                   NEQNQRARLQLADQMQAMQQEIMQLREQLELVSRQQPNTQPGQGGANNPPGATAADPRE
FT                   QAAYDGAIDQFRKGQYKEAAESLAAFVALYPNSQLAPTAKFYLGSSRYAAKDYKGAIEQ
FT                   LNQLVQESPDNARAPDALLVIAGSQIELNNRAGAKASLQRIVKDYPSTPAAETAKSRLQ
FT                   LLQ"
FT   CDS_pept        complement(731338..731841)
FT                   /transl_table=11
FT                   /gene="pal"
FT                   /locus_tag="Bpet0657"
FT                   /product="peptidoglycan-associated lipoprotein"
FT                   /function="Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0657"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40989"
FT                   /db_xref="GOA:A9I4G6"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4G6"
FT                   /protein_id="CAP40989.1"
FT                   /translation="MKIRIAKSLTIAALAAALAACSSVPLDDQAGQTGSGTAGQGTGTG
FT                   QIMDPFNPQSVLAQQRSVYFDFDSYTVPDQYRGLVETHARYLASHQQQRVQIQGNTDER
FT                   GGAEYNLALGQRRADAVRRMMTLLGVSDAQIETISFGKEKPRATGTTEADFAENRRADI
FT                   EYQR"
FT   CDS_pept        complement(731873..733192)
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="Bpet0658"
FT                   /product="TolB protein precursor"
FT                   /function="Periplasmic component of the Tol biopolymer
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40990"
FT                   /db_xref="GOA:A9I4H0"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4H0"
FT                   /protein_id="CAP40990.1"
FT                   /translation="MTPAPSRPFPAGLARAYGALFALLTAAALLVWQPAHAQLRVDISG
FT                   TGATQYPVAIADFAVDDVHGRAIAEVIRADLTRTGQFRLISAAGSGLNVDSPVAYDDWR
FT                   TKGADFLAYGSITRGADGRYDVRYRLADTVKKGQLDGVAFSGSEQELRRVAHQIADRIY
FT                   EKITGVRGVFSTRIAYVLKRGNTYELQVADADGQNPQVALRSREPVISPAWSPDGSKLA
FT                   YVSFESGKPVVYVHTLATSARIPVANFKGNNSAPAWSPDGSKLAVALTRDGLSQIYIVG
FT                   ADGSSNMRRLTRSPGIDTEPIFTPDGRSIIFTSDRSGGPQIYQTSLDGGDARRLTFNGS
FT                   YNISPRISPDGSTLLYVARRDGAFRIASLQLATGNETLLTDGRDDQAPSFAPNGMQILY
FT                   AAVQNGRSVLAGVSSDGRVRQTLSVLNGEIREPTWGPFTR"
FT   CDS_pept        complement(733209..734396)
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="Bpet0659"
FT                   /product="colicin exporter"
FT                   /function="Type V secretory pathway:nvolved in the
FT                   translocation of group A colicins, bacterial protein
FT                   toxins."
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0659"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40991"
FT                   /db_xref="GOA:A9I4H3"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4H3"
FT                   /protein_id="CAP40991.1"
FT                   /translation="MTPPIFRHDDTKPVTPAAQDNRKALGLAILVHILLFIALVFGVNW
FT                   RSENPGPVQVELWAEGDTPDSPPPDVQPDEPKPEPEPPKPQPQPEPAPQPEPQPQPEPP
FT                   PPPPPPVEKPQPPQPDPEIALEEARKKREEEEKARQEAEAAKEKARLEEERKQAELKEK
FT                   QRLEQERKAAEKAAAEKAAAEKAAAEKAAAEKAAAEKAAAEKAAAEKAAAEKKAKEEAA
FT                   KKAAAEKAAAEKAAAEKAAAEKAAAEKAAAEKKAKEEAAKKAAAAKKAAADKALREAFR
FT                   NDALGAAGIPGGTADRNQQGGGRDDGYGAKVRACVRPGVAYPTPPRSGSENPTAQYRVQ
FT                   LSSDGKVTGVSLTRSSGNTGFDRAVETGIRRCNPFPKPSTGRYESVIDVVYRMYD"
FT   CDS_pept        complement(734430..734885)
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="Bpet0660"
FT                   /product="Biopolymer transport protein TolR"
FT                   /function="Biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40992"
FT                   /db_xref="GOA:A9I4H6"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4H6"
FT                   /protein_id="CAP40992.1"
FT                   /translation="MPSVRSHGRAGRRMKADINVVPYIDVMLVLLVIFMVTAPLITPGL
FT                   INLPSVGQASEVPATPLEVQISEDGQVALRMREAGATPQDIARDQLVDQVRQRITAETP
FT                   VVIAADGKVPYETVVKVMDELRSNGVTRLGLLVDQGQGAAAQEPKKR"
FT   CDS_pept        complement(734885..735565)
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="Bpet0661"
FT                   /product="TolQ colicin import protein"
FT                   /function="Biopolymer transport proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0661"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40993"
FT                   /db_xref="GOA:A9I4H9"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4H9"
FT                   /protein_id="CAP40993.1"
FT                   /translation="MQVTNDMSLLSLIAHASVPVQLIMLLLLGISILSWTYIFAKRLAI
FT                   KRAHAQTRRFEDDFWSGGDLSMLQQAVASRRDEQGALARIFDAGMTEFLKARRTNVNGD
FT                   INTLLDGPRRAMRAAYQREMDSLESHLNFLASAGSVSPYIGLLGTVWGIMHAFIGLSNM
FT                   QQATLASVAPGIAEALIATAIGLFAAIPAVVAYNRYTHDIDRLSIRFDSFVDEFLNILQ
FT                   RQVR"
FT   CDS_pept        complement(735569..736135)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0662"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0662"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40994"
FT                   /db_xref="GOA:A9I4I3"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4I3"
FT                   /protein_id="CAP40994.1"
FT                   /translation="MWWNCRPVAKARLRKSPPDQPWNRCLPSWKHCRLPGPVPGNREAA
FT                   IPIVIEPKSAESVLNVRVYYEDTDAGGVVFYANYLKFLERARTEWLRALGVEQSALAES
FT                   EGRLFVVHSLDMSYRKPARLDDYLTIRSRVTRVGRASIHFAQRAERDGELLAQGNIQVC
FT                   CVDAVHLRPAALPAVVRTKLESLQE"
FT   CDS_pept        complement(736038..737768)
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="Bpet0663"
FT                   /function="Prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40995"
FT                   /db_xref="GOA:A9I4I5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I4I5"
FT                   /protein_id="CAP40995.1"
FT                   /translation="MRASTYHLNTLKEAPAEAEVASHRLMTRAGMIRKLAGGIYTYMPL
FT                   GLKVIRKIEAIVRAEMDAAGAIELLMPVVQPAELWQESGRWEQYGAELLRIKDRHQRDF
FT                   VLQPTSEEVITDIARNEIHSYRQLPLNFYHIQTKFRDERRPRFGLMRGREFTMKDAYSF
FT                   DRDEAGAQQSYDKMYDAYMRIFERLGLQFRAVAADTGSIGGSRSHEFQVIADTGEDLLV
FT                   YNPDSQYAANIELAEAPALLAERAAATQPLEAVPTPGAAKCADVAKLLGLPLERTLKSI
FT                   VLATEPEPGKVQVWLLLLRGDHELNEIKAGKLPGLAGFRFATEDEIVAHFGCKPGYLGP
FT                   IGTALPVRVVADRTVANMADFVCGANREDFHYQGANWGRDLPEPELVADLRNVVEGDPA
FT                   PDGAGRLAIQRGIEVGHVFFLGTKYSEALKATFLDETGKPALLQMGCYGIGITRIAGAA
FT                   IEQNHDERGIIWPRAIAPFEVVICPVGWGKNETVRNESVKLYDALRARGVDVILDDRDA
FT                   RPGVMFAEWELIGVPLRVTVGERGLNDGVVELQARRESTAAKIPAGSALEQVLAKLETL
FT                   "
FT   CDS_pept        737834..738409
FT                   /transl_table=11
FT                   /locus_tag="Bpet0664"
FT                   /product="probable (di)nucleoside polyphosphate hydrolase"
FT                   /function="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40996"
FT                   /db_xref="GOA:A9I4I9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4I9"
FT                   /protein_id="CAP40996.1"
FT                   /translation="MLDREGYRPNVGIILVNSKNEVFWGKRIREHAWQFPQGGIKYGES
FT                   PVQAMYRELHEEVGLKPEHVRILGRTRDWLRYNVPDHFVRREWRGHYKGQKQIWFLLRL
FT                   VGRDCDVCLRATQHPEFDAWRWSQYWVPLDAVIEFKREVYTLALNELSGILFRRQHETR
FT                   YLRQRVHGQGRPAEGLPAEPDGHAHIAG"
FT   CDS_pept        738390..739076
FT                   /transl_table=11
FT                   /locus_tag="Bpet0665"
FT                   /product="two component response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0665"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40997"
FT                   /db_xref="GOA:A9I4J2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4J2"
FT                   /protein_id="CAP40997.1"
FT                   /translation="MRILLVEDELEMASWLVRALAQSGFTPDHAPDARSAEALMAANEY
FT                   DAIVMDLRLPDKHGLVVLRDMRGRDDRTPVLLLTAQGALQDRVRGLNLGADDFLTKPFA
FT                   LEELEARVAALVRRSRGRQFPRLQCGSLAYDGESRAFTLDGNLLFLTPREHAALVALLT
FT                   RSGYPVDKAQLFGKVFTQDSEANLDAIEVVLHRLRKKLAGSDVRIVTVRGLGYMLESSA
FT                   SEPAGT"
FT   CDS_pept        739057..740592
FT                   /transl_table=11
FT                   /locus_tag="Bpet0666"
FT                   /product="two-component system histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40998"
FT                   /db_xref="GOA:A9I4J5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4J5"
FT                   /protein_id="CAP40998.1"
FT                   /translation="MNPPEPERFRFPLVGIRTLLITLLLPGVIVLLVIDSWNDYRTLAD
FT                   ITNEAYDSALLEPARVLESSIEFAPDGRLVVATPVYAQVILESKAGLRKYFRIEEIDPP
FT                   LPEGAAAVPPPGRTVAGMPELPRPPAWPAVRGDPVFFNSVYRHDPVRVVAVLRDLHYHG
FT                   QHRQVLVLVAESIGRRLQAETTARRQELLRDARMLALVAILVWWGVAWSLRPLARLRND
FT                   IRARRPDDLTPLDASRVPGEVIPLVEAINYHVARYRRVLDEQSQFLADASHQLRTPLAI
FT                   MLTQAQYALREPDPKRAQEGLRAIVDQLGRTRRLTEQLLSLAHASQADATPRELLDLND
FT                   VARNVVLQYLPLSHEKRQDLGWSAAYQGGTSADRPAVPVMGSDVELHEALSNLVHNAIH
FT                   YAPAGARITVSVARRGSRAEVAVSDNGPGIDALARDRAFARFDRLEQGRASVSPGSGLG
FT                   LSIARAYARRNDGDIELRDGDPNEQGGVGLAAVLWLPLADPGTAASGGAAGPA"
FT   CDS_pept        complement(740604..741527)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0667"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAP40999"
FT                   /db_xref="GOA:A9I4J8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4J8"
FT                   /protein_id="CAP40999.1"
FT                   /translation="MQDLNDLFYFSQIVEHGGFSAASRALDIPKSRLSRRISQLEATLG
FT                   VRLLQRTTRRLRLTLAGERYLHYCREMTASARAAEDAMRQLQAQPCGPVVVSCPIAIAQ
FT                   QMLAPLLPEFLDAWPSVSVQVLATNRRVDLIREGVDLALRVRTRLDTDAELVVKHLGMA
FT                   SSSIVASPAYLQRHGTPQTPQDLAAHTTLSFSEPQSEVRWPLRNRQDEELVVTLRPQLC
FT                   CNDFIVLTEAAVRGRGISLLPTVATYEEVRRGQLVRILPDWLSPSGIVHCIYPSRRGMA
FT                   PAVRALLDFISDRLPSMYARMEHGAE"
FT   CDS_pept        741659..742285
FT                   /transl_table=11
FT                   /gene="acpD"
FT                   /locus_tag="Bpet0668"
FT                   /function="Acyl carrier protein phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAP41000"
FT                   /db_xref="GOA:A9I4K2"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9I4K2"
FT                   /protein_id="CAP41000.1"
FT                   /translation="MKTLVILSSILGDRSHSKQLADHLIQRLRQHEPDGSIRVRDLAAD
FT                   PVPYFDGATAGALFTPADQRTAEQAAIVARSDALVAELFDADRIVFAVPVYNFGLPAQL
FT                   KSYIDQIARAGVTFRYTAQGVPEGLLKNKQVVVLSARGGKAEGTPADTLTPYLAQVLGF
FT                   VGLVDPVFISAEGMAMGELAAQDGLALARQRIDALVAGAPQQVAA"
FT   CDS_pept        complement(742320..743225)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0669"
FT                   /product="putative oxidoreductase"
FT                   /function="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases"
FT                   /EC_number="1.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAP41001"
FT                   /db_xref="GOA:A9I4K5"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4K5"
FT                   /protein_id="CAP41001.1"
FT                   /translation="MASIGSRDYDKVVSQKVAFLGLGVMGLPMAGHLARAGHEVTVYNR
FT                   TAAKAQAWAEEFGGKSAPTPREAAAGAQIVFACVGNDDDLRSVVLGDDGAFAGMAPGAI
FT                   FVDHTTASADVARELYALAREQGLQFVDAPVSGGQAGAVNGVLTVMCGGEQQAFDTIKP
FT                   VAQAYGRAVTRVGAPGAGQLAKMVNQICIAGIVQGLSEAIAFGQAADLDMKLVLDVISK
FT                   GAAQSWQMENRGSTMVDNKFDFGFAVDWMRKDLGLVLAEARHNGARLPLTALVDQFYGD
FT                   VQKMGGGRWDTSSLIARLRD"
FT   CDS_pept        complement(743417..744922)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0670"
FT                   /product="putative membrane protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP41002"
FT                   /db_xref="GOA:A9I4K8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4K8"
FT                   /protein_id="CAP41002.1"
FT                   /translation="MELFDHLMLGFSVAFTPENLLYALLGCVLGTLIGVLPGIGPVPTI
FT                   AMLLPITYVLPPVAGLIMLAGIYYGAQYGGSTTAILVALPGETSAVVTVLDGHQMARNG
FT                   RAGAALAIAALGSFFAGCVATLLLAGFAPPLAEVAFKFGPAEYFSLMTLGLVGAVVLAS
FT                   GSLPKAIAMIILGLLLGMVGTDVNSGVARYDFGIPELQDGIDFAIVAMGVFGFAEIMTN
FT                   LEQKENRVDITDKIGSLYPNKQEFREAAPAAVRGTILGSMLGILPGGGAVLSSFASYTL
FT                   EKKISKNPERFGKGHPAGLGGPESANNAAAQTSFIPLLTLGIPGNAVMALMVGAMTIHN
FT                   IQPGPQVMTSHPDLFWGLIASMWIGNLMLVVLNLPLIGLWVKLLKVPYRILFPAILVFC
FT                   TIGVYSLNYNTFDIFTTAIFGVVGYVWSKLKCEGAPLLLGLVLGPMMEENFRRALLLSR
FT                   GDFLTFVDRPLSASLLAVAILLVVLVALPSIRKKREETFVEED"
FT   CDS_pept        complement(744936..745400)
FT                   /transl_table=11
FT                   /locus_tag="Bpet0671"
FT                   /product="Hypothetical 16.3 kDa protein in TAR-I ttuC'
FT                   3'region"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0671"
FT                   /db_xref="EnsemblGenomes-Tr:CAP41003"
FT                   /db_xref="GOA:A9I4L1"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4L1"
FT                   /protein_id="CAP41003.1"
FT                   /translation="MQLRNRQDFWSGVMFIALGLGFAWKATGYQMGTAARMGPGYFPFA
FT                   LGLVLAILGAIVLLGSMTKSATETHVDKFDWRIAFLVIGSVILYGLILKLLGIYISVFV
FT                   LVVVSSLASHEFNLKVAAANGVFLVVFSYLAFVKGLGLIFPLWPSFLGLN"
FT   CDS_pept        745813..746259
FT                   /transl_table=11
FT                   /locus_tag="Bpet0672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0672"
FT                   /db_xref="EnsemblGenomes-Tr:CAP41004"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4L6"
FT                   /protein_id="CAP41004.1"
FT                   /translation="MLQDLDQLAARIGQLVQRTRQLHAERDALRVRLSQSESSQRALEQ
FT                   RCADHQAEIQALQAKLQEHDSAVAGMLNEARQTESDLREQLARATADRQSLESRASARE
FT                   AELQGSLHARDTDLQRLRVAASAARERIDTVLARLPGAPTGEQP"
FT   CDS_pept        746259..746570
FT                   /transl_table=11
FT                   /locus_tag="Bpet0673"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0673"
FT                   /db_xref="EnsemblGenomes-Tr:CAP41005"
FT                   /db_xref="GOA:A9I4L8"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4L8"
FT                   /protein_id="CAP41005.1"
FT                   /translation="MERVDVTILGRDYSLACSTEEKPALMAAVRHVDQLMLRIQGSGKV
FT                   SSNERIAVMAALQIASELLAMKAPDGPLGGLAVGDFKRRIEDMNSLLDDALSGQEKLL"
FT   CDS_pept        746875..747639
FT                   /transl_table=11
FT                   /locus_tag="Bpet0674"
FT                   /product="putative exported protein"
FT                   /function="Predicted periplasmic/secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0674"
FT                   /db_xref="EnsemblGenomes-Tr:CAP41006"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4M1"
FT                   /protein_id="CAP41006.1"
FT                   /translation="MMHSHPVLSLNRIAAACCAALALAAAQPALAQQPSQQQEQQSQDT
FT                   GAHAPELTLQASASSDVQQDTVRITLAAELEAASQAAAGKALTAALDDAVKRAQGVKGV
FT                   EVRTGGYNVWPNTNEKGKIQNWRGRGEITLESKDFAAASALASKLSDKTAISQINFLLS
FT                   REAREAEERKLLSQAAQAFRDRALAAATAFGFSGYRVRSLELSGGGSPTPVPRPMGMQM
FT                   MAKSSQAEAADVPLEAGKVTVSISVNGTVALH"
FT   CDS_pept        complement(747614..748579)
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="Bpet0675"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /function="Catalyzes the first step in lipoprotein
FT                   biogenesis by transferring the N-acyl diglyceride group on
FT                   what will become the N-terminal cysteine of membrane
FT                   lipoproteins."
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0675"
FT                   /db_xref="EnsemblGenomes-Tr:CAP41008"
FT                   /db_xref="GOA:A9I4M7"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A9I4M7"
FT                   /protein_id="CAP41008.1"
FT                   /translation="MARLGARATPCVMWRERSLLGMVCLSGVWRGPRGGWPPVAAWRHV
FT                   RRLLSIQSFFAWRNMLHYPEFDPIALRIGPLAIHWYGLMYLVGFALVYVLGRMRLARGH
FT                   TPALGPRDLEDLIFYSVLGVVLGGRLGYVLFYKPGYYLAHPLEILYLWQGGMSFHGGLI
FT                   GVILVMLLFARKKGLSFFTVSDFIAPLIPLGLGAGRLGNFINGELWGRPTDVPWAMVFP
FT                   QSGDGLPRHPSQLYELGLEGIALFALLWWFSARPRPTGQVSALFLIGYGTFRFLVEFTR
FT                   EPDNFLGLLAGGMSMGQWLSLPMVALGIALYVFSARQPSR"
FT   CDS_pept        748515..750200
FT                   /transl_table=11
FT                   /gene="ilvD2"
FT                   /locus_tag="Bpet0676"
FT                   /product="Dihydroxyacid dehydratase"
FT                   /function="Dihydroxyacid dehydratase/phosphogluconate
FT                   dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bpet0676"
FT                   /db_xref="EnsemblGenomes-Tr:CAP41007"
FT                   /db_xref="GOA:A9I4M4"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL: