(data stored in ACNUC16935 zone)

EMBL: AM910996

ID   AM910996; SV 2; linear; genomic DNA; STD; INV; 3159095 BP.
XX
AC   AM910996;
XX
PR   Project:PRJEA28803;
XX
DT   04-JUL-2008 (Rel. 96, Created)
DT   22-JAN-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Plasmodium knowlesi strain H chromosome 14, complete genome
XX
KW   complete genome.
XX
OS   Plasmodium knowlesi strain H
OC   Eukaryota; Alveolata; Apicomplexa; Aconoidasida; Haemosporida;
OC   Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
XX
RN   [1]
RP   1-3159095
RA   Boehme U.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Boehme U., Pathogen Sequencing Unit, Wellcome Trust Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, CB1 3AD, UNITED KINGDOM.
XX
RN   [2]
RA   Pain A., Boehme U., Berry A.E., Mungall K., Finn R., Jackson A.P.,
RA   Mourier T., Mistry J., Pasini E.M., Aslett M., Balasubrammaniam S.,
RA   Borgwardt K., Brooks K., Carret C., Carver T.J., Cherevach I.,
RA   Chillingworth T., Clarke T.G., Galinski M.R., Hall N., Harper D.,
RA   Harris D., Hauser H., Ivens A., Janssen C.S., Keane T., Larke N., Lapp S.,
RA   Marti M., Moule S., Meyer I.M., Ormond D., Peters N., Sanders M.,
RA   Sanders S., Sergeant T.J., Simmonds M., Smith F., Squares R., Thurston S.,
RA   Tivey A.R., Walker D., White B., Zuiderwijk E., Churcher C., Quail M.A.,
RA   Cowman A.F., Turner C.M.R., Rajandream M.A., Kocken C.H.M., Thomas A.W.,
RA   Newbold C.I., Barrell B.G., Berriman M.;
RT   "The genome of Plasmodium knowlesi strain H, a zoonotic malaria parasite
RT   with host range from monkey to man";
RL   Nature 455:799-803(2008).
XX
DR   MD5; 378a5eddac45dcbb28dc072ad7bd53aa.
DR   BioSample; SAMEA2272753.
DR   EnsemblGenomes-Gn; EBG00000978149.
DR   EnsemblGenomes-Gn; EBG00000978150.
DR   EnsemblGenomes-Gn; EBG00000978151.
DR   EnsemblGenomes-Gn; EBG00000978153.
DR   EnsemblGenomes-Gn; EBG00000978155.
DR   EnsemblGenomes-Gn; EBG00000978156.
DR   EnsemblGenomes-Gn; EBG00000978157.
DR   EnsemblGenomes-Gn; EBG00000978158.
DR   EnsemblGenomes-Gn; PKH_146952.
DR   EnsemblGenomes-Gn; PKH_146954.
DR   EnsemblGenomes-Tr; EPrPKNT00000002609.
DR   EnsemblGenomes-Tr; EPrPKNT00000002610.
DR   EnsemblGenomes-Tr; EPrPKNT00000002611.
DR   EnsemblGenomes-Tr; EPrPKNT00000002612.
DR   EnsemblGenomes-Tr; EPrPKNT00000002613.
DR   EnsemblGenomes-Tr; EPrPKNT00000002614.
DR   EnsemblGenomes-Tr; EPrPKNT00000002615.
DR   EnsemblGenomes-Tr; EPrPKNT00000005170.
DR   EnsemblGenomes-Tr; EPrPKNT00000005180.
DR   EnsemblGenomes-Tr; EPrPKNT00000005190.
DR   EnsemblGenomes-Tr; EPrPKNT00000005191.
DR   EnsemblGenomes-Tr; EPrPKNT00000005199.
DR   EnsemblGenomes-Tr; EPrPKNT00000005203.
DR   EnsemblGenomes-Tr; EPrPKNT00000005217.
DR   EnsemblGenomes-Tr; EPrPKNT00000005223.
DR   EnsemblGenomes-Tr; EPrPKNT00000005231.
DR   EnsemblGenomes-Tr; EPrPKNT00000005236.
DR   EnsemblGenomes-Tr; EPrPKNT00000005238.
DR   EnsemblGenomes-Tr; EPrPKNT00000005254.
DR   EnsemblGenomes-Tr; EPrPKNT00000005265.
DR   EnsemblGenomes-Tr; EPrPKNT00000005267.
DR   EuropePMC; PMC2656934; 18843368.
DR   RFAM; RF00003; U1.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF01591; snoR15.
DR   RFAM; RF01593; plasmodium_snoR16.
DR   RFAM; RF01848; ACEA_U3.
DR   RFAM; RF01991; SECIS_5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3159095
FT                   /organism="Plasmodium knowlesi strain H"
FT                   /chromosome="14"
FT                   /strain="H"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:5851"
FT   CDS_pept        join(2446..2559,2967..3851)
FT                   /locus_tag="PKH_140010"
FT                   /product="hypothetical protein, conserved in P. knowlesi"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140010"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LGD9"
FT                   /protein_id="CAQ41786.1"
FT                   /translation="MPVATRQNKKGRKAGAFLFCTKVSLYTLLIWIVNCSNSCQYDGNS
FT                   YSVMNNSLGKAFDSRALRSLAEALEEEAVQHDAPVAYEDEIEQDAPAVYEEATEQDAPV
FT                   EHEEVIEQVAQDVAQEVAQEVAQDVAQEVAQDVIQEIAQEIAQEVAQEDPEELEEVKIE
FT                   YNDDGTLRIRSTDTYKQPAVANLYKERINNFYRKFDPTITRDFEYLKKNVNLFNERERA
FT                   LEGDPSAIAKYPKGYWDPHLALQKALKEIMDKHNEYREMLANNFYDVKLMDDFENLRTN
FT                   PPYIQREYGRLDLRPYTPKPINAKEDKGYYKCGKGKKSKRKSWRRKLLCCF"
FT   CDS_pept        join(7922..8086,8243..9031)
FT                   /locus_tag="PKH_140020"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140020"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140020"
FT                   /db_xref="GOA:A0A384KIH4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KIH4"
FT                   /protein_id="CAQ41787.1"
FT                   /translation="MEDNHVPRQKCLSTEHKHTKTGRKNPLNIKKCTFILFIKISIYAL
FT                   FICSLYYSNHDIFSTPPNTQYKQWNKASVKSGALMEQGPAYINKYSKFNEYSKLFHVHD
FT                   DYPRFNERTYFGRNLAELKSEGDERALTQLHSAISEIKNGDKYFLDQNYRSLEEEIEDY
FT                   DTGIYFHNIVTKIPGGVIEEHTDEIEYYEAMTENDDPAMDYPDEELIYFDPEIDEHEEL
FT                   DEEEQRLKKYLDSFLDDEVHLKNIHDFIQETEDCVRKYKKKKYDFFNYIVELRKKFNRI
FT                   IKSIKHRLLKFMTYNKHYLIKVLVSTITRLLSILFL"
FT   CDS_pept        join(10333..10404,10560..11009)
FT                   /locus_tag="PKH_140030"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140030"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140030"
FT                   /db_xref="GOA:A0A384LKF8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LKF8"
FT                   /protein_id="CAQ41788.1"
FT                   /translation="MARLLRIILAMAFIVWISPCSTIDPKIEKACARRPPKYWNEEIED
FT                   YPDFYFSTNHARKKSFFKKLAYPIKAIDAHLDKVVLRNMMPELEDPDEIPHTRWGHFCR
FT                   FVGDNLIFAIAILFIVAGLLVIYLTDLERFIKSLVFSCAISVPIFLALIVFKKVLKVNY
FT                   MYKLGLEEYY"
FT   CDS_pept        complement(join(12553..13045,13273..13346))
FT                   /locus_tag="PKH_140040"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140040"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140040"
FT                   /db_xref="InterPro:IPR006496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KVG4"
FT                   /protein_id="CAQ41789.1"
FT                   /translation="MKTLVLNVIFVLFLVWKYNYSFAANSSMKSQMSAQNMPQVLAQQR
FT                   FGRIMAETHVNQPYKEDFSIGTKAEQNSLYNTKSDDTNVYSDELKALFTKVSSIWKESI
FT                   EDMEEEYYEKTQQVEKSWRENIWNNKWAKYLEHVHNTIQKKLNDLSNTPHDTEVDIAFM
FT                   LSYVYKVFEMFIEEVIEDAKKQAKM"
FT   CDS_pept        complement(join(15907..16602,16857..17063))
FT                   /locus_tag="PKH_140050"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140050"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140050"
FT                   /db_xref="GOA:A0A384L346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L346"
FT                   /protein_id="CAQ41790.1"
FT                   /translation="MFLRSKDTSARGTMSYKCNMMVAEGLNKADENALRKDQPKKEGLN
FT                   SIFFYSKIFACSLLIWASQCSYSHTDFSSSPNEAYTTGSLENAVFNRILASNDPRGNYP
FT                   PKAHASYMGMGSHDEQHPSTSHNAPHHGAQNGGAPLELNIDIEKKLKDLKDVIWDKVEN
FT                   AVDWGTLSDNVKGYLEKIDSNIENKIVSEVNKANKDSNLMENPDAKTQIISTFSQNYTI
FT                   ITPPLLLLFLSILTSDKIKKHLANILLTSLFVAITYIFFKLKKMDDVKKKSANDHGNSK
FT                   NDEGHNAKKSKDKFKGAHA"
FT   CDS_pept        complement(join(19902..20537,20800..20877))
FT                   /locus_tag="PKH_140060"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140060"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140060"
FT                   /db_xref="GOA:A0A384KLV9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KLV9"
FT                   /protein_id="CAQ41791.1"
FT                   /translation="MYRILFTKIFFLTLSAWILRASDNRKGVGFNVNNRRRSAHNDLQL
FT                   RVPRLLSVNDLDSEIDYGSLESLGDGREKEEIYERRGKVDLRSFTFDDSEELDPNLESF
FT                   KEYMKYVAKSDKSFREKYDDTRDYIKNMDPMTRKKIKNEMKDRLSERRRTKRRRKCSQL
FT                   HGLCNDMYGDLQYNDYRMKAQIRKMKRKISARSFIAGALSAILAILLFPIELICSSGVL
FT                   LIMGLSLVFLLLEEI"
FT   CDS_pept        complement(24296..25030)
FT                   /locus_tag="PKH_140070"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140070"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LM10"
FT                   /protein_id="CAQ41792.1"
FT                   /translation="MNNSRKSNYRRLSLFASLSVMFLCGSTFVSKYDTNTVRSCCQEES
FT                   CQGEKVFGRNLGEAGVQGVLSARNELMRFRRRSIYSHMDKLVDCLFRGFLDTLMWFTDE
FT                   VYKSDESGDYKNTSMIEKILRKQMYAEGVTLSNRTVTNEVQRTKERHEEIATQGTNSEV
FT                   VRRMMKMYELENNLSKETLKKISAPNRTQSIHDILNTEKIKLKIKNKLEIIPYTYDDSI
FT                   IDSVSSRIIGRVTDISKDENIM"
FT   CDS_pept        complement(28399..29040)
FT                   /locus_tag="PKH_140080"
FT                   /product="early transcribed membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140080"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140080"
FT                   /db_xref="GOA:A0A384KLI1"
FT                   /db_xref="InterPro:IPR006389"
FT                   /db_xref="InterPro:IPR021626"
FT                   /db_xref="InterPro:IPR038403"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KLI1"
FT                   /protein_id="CAQ41793.1"
FT                   /translation="MNISKMLTFFFLLCASEKLFIVCASRILSSIEKDLAPLQNIDDIL
FT                   AAKDRKKKIYYSLISSGIFVAVAIALGIGYYINEKGKQDNFEKYTLFKDKRFQFEEPRD
FT                   GQVPSTSREYVEPAGINKVNIKGALIENTNENDVPIKKFNIFLDNARIAMQHHFSNLSG
FT                   PQQAYYVNDRDYIRMVVQSLEERRNVQLSRVQEDLAVLNMEHFLQNISKE"
FT   gap             31413..32412
FT                   /estimated_length=1000
FT   CDS_pept        complement(join(34633..34668,34921..34966,35109..35185,
FT                   35303..35365,35630..35689,35797..35825,36025..36118,
FT                   36315..36319,36451..36526))
FT                   /locus_tag="PKH_140090"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140090"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140090"
FT                   /db_xref="GOA:B3LBI5"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBI5"
FT                   /protein_id="CAQ41794.1"
FT                   /translation="MEHVHRTALTETEDDLRIENQNFLGEAETVVRLVIVFVDILLIAS
FT                   LALDLNVNCDGYLRTWIIGAILLSFFLFSFVRRVQVLLKEDKGLFSEVLLMLVCFLWTY
FT                   FGTIQINKASLCQKSAPYLFWTVFTLVTTIWCSIIGLILSLMIITIGSFFVVRSKVG"
FT   CDS_pept        complement(join(38305..41650,41927..42484,42628..44774,
FT                   44914..46737))
FT                   /locus_tag="PKH_140100"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140100"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140100"
FT                   /db_xref="GOA:B3LBI6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBI6"
FT                   /protein_id="CAQ41795.1"
FT                   /translation="MENQFNAKLECVTDFSLFEKLKKSILKDNVGDLYISSLRSILEKI
FT                   KDPVVDTSHIICNHHYAEAVLFFYATLIIEKYEFVSVFCEDILSKNRFEHVVENLKRIK
FT                   VKHVESLNKIEKIIIENIDTCEKCLMIYYLLQKEFLEMISTFKKNEEALINFVKREIFK
FT                   FNFNRLFNKIICPIEYDKVDSVVLELMLNGGKIFQVNDNYHLETNQINEENLKLFTEKF
FT                   LNLKDDTIYNIIKKYAHHESLIFLCNLVHMEFKKCKKLLTIGNSQMCKKIDSPKDDLNC
FT                   KEKESEENWDSYNMTENLQSYVYVHIFLLFQHRDVENSIIKVLKDKIILYSLMLNALRY
FT                   GDNFIQLIIFKIINFTFIKDDNFLNDSNKKLIISILSYWVKLADACIIKMMKTSLPEEG
FT                   NVGSNVQKTDNFFLKKNFSDYDILKYIQCLISAIYLLSLIRRRSKTETCNLLSEQSCVQ
FT                   KNKRSMTFYMNEYNLESLSLKAFFTKNDMYEYFLGILFSENKEVINRLFNLIFKLLYFV
FT                   KNSKLYISKNTNVKNKYFEEATTFSCINIVYNILDATKRMFVNSYEVDEYTKNLYRKCL
FT                   RERKNAFDCIVLHSFPQFISYREYYVRLYVIKVLSTLLSDSSIRDSLEKNTIFEIFDSL
FT                   MSMKFDRDQQKRNDERKNVNILLLHLLKANIRDSKYSSRTTNILFSDKQKDVKKYIASI
FT                   CDDGFPLLDLKNMFEYIFVLFVKLTNIIVKRVLSLLEIEKYKVLFMNVFEIVELFMKEL
FT                   KKEKSRKCRCLFFSTAMYFSHLISNSIYKSKVHSSVPFLNKVFSLIKNIENYVDFMYDD
FT                   LLTLKDSQEELFDAKTYEEKLSLDGTYDEGITGEGVFDEPLSDDEVYYSSDSNSKSIKD
FT                   MHMLYFYSNTFCEDEKGGGKKGVIGATPDRNSRSNRIDSANGGMVHHVNKEGVKKSNSN
FT                   GLSRFEVFMNRSIRKSKVNEKGIYNYMHSFFFLCVSNASMKTRRHVVKSYDLIAKYMMK
FT                   DEYKLNRVKKKSGIFSPPVVIIRDVENEDKRYNITVDKYDYMLKSYIVNFFQSKRYMYI
FT                   FLLSVFQFSNIMILYLKKTNFISNDFDEKIDVLECFTLINSKTWFYLNVAIECVEKYIN
FT                   KRKANQFLLGILNLIIDNLWKIIIFIIFNIKIKTFSIKSKTHSIRIFSRDSLLLFLNFF
FT                   STWISFIRKFYTRGDPFSSDVILPELFFRKFTTLSMQILSIFNFVESNLSSLSHHETNA
FT                   SLLIKQKEIMNSILDALIGLVKDKEPGGHESHLHNLIQFKLKLKNLATPIYVQELTEAC
FT                   DYEALFTKAKEMLMGKERRNDLSITGLETAEGRRATYLGTDPSCKVVNRSGQEYNSDGF
FT                   TFDKGKEFEGGRSRSAMGATSEVASRGMSRSASRSHSPSNSLSSKDGKCKQVEGKEKEP
FT                   KVEYMSEEMRKEAALERAKKILEKTAALKTQKRAIVLNETNTKNNKHEYFKEMKEKRLE
FT                   AENSMNKYYGMLQEFLNWDFSSLESMLKYKMCINEEIPLHFQDEEDYYRVFKPMVLEEC
FT                   RCCMINKMSGRTNRYVLNLVAKKKTSYWIEWQMSLGNENKAIDDSLKPMDLIALIPFES
FT                   ERNVLLDNDKGTVKYHNLKKILKSNKHLIGLVDFSMNKTENMCDVKLMNEDILIQKSEN
FT                   EKNRLKLNCLTCNKFNAYFLCNLMTNIREFQSVYLSRNSSLFNIILNPTLCNKNLKGRR
FT                   NMSISNAFLSEENTRGSDMWTSKLSSMEKYILNIMKNYNLLNESQIEAIKMVLLNKNSI
FT                   SLIQGPPGTGKTKTVIGIISALYAIINSRNNDEKRQVGKKKKDCAYNDQNENCNKKILV
FT                   CSPSNSAIDEIAKRILNDGLINFANMRRSTSSSKKSSGSSSSNNSISMSNTMGLLGGHG
FT                   HVNGVSDPKMKKMVEAQNAQKRVKSGNAEERRTRHGDLEKQTITPKCIRIGISKKTHEE
FT                   IQPISLDYIFSRRKNMEKNVYETRFNEKKNKMILSLKAIDHTCSRVEELRGKLNHNDSK
FT                   KYCFDFNETKSKSSSLEKIENVNDFFSEEIINNVDIKYLEKLLYLFNESFSHYEWSLEK
FT                   LKGEKKCFEEKKRKLIDTDKEIGSFYANSNKDNMVFESEVIFSTLSGSASPVIENLDFE
FT                   YLIIDEACQCVELSCLIPFRLKIKNVIMVGDPKQLPATTFSSDCTKYGYSRSLFERLLL
FT                   CNAPSVLLNVQYRMREQICCFPNMYFYKGLIKNDENLMNKPSFYLHYLNLYGCYKFINI
FT                   EGIESTTCHKSYINYVEAYFIFKLVLYIHHFFSSKNDENPIPSFYKMSANFSLSDIGII
FT                   CPYLSQVHLIKRMFEGYFPSSNSPEISTVDAFQGREKSIIIFSCVRSNRQALEMFRNKD
FT                   ELESGSVNSYPRVKRGGHGSNSDRSLDDPPFEDPASDDSYVDELHTKKWFNVGGKSVTT
FT                   ENDFKSVHNIRGNNIGFLKDERRLNVALTRAKDCLWIIGNRKNLEKNGMWDSLIKNAIA
FT                   RNYYSDLDLNFGRSTTEENIKDIIDTYFSQIGKNRMEGKNWKEDQNDINHEIFSSSNSS
FT                   EGSINGLRKNKESLFKERKDFAQVNYMLGTENKLKSNMGASTVPQGEFLFSMSYTSSRF
FT                   GGNGENGTIKNGNIGSNVRKRPNDGSREDEQEELLLKRQRHN"
FT   CDS_pept        complement(49705..50745)
FT                   /locus_tag="PKH_140110"
FT                   /product="pbs lyase heat-like repeat domain
FT                   protein,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140110"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140110"
FT                   /db_xref="GOA:A0A384LEP7"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027517"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LEP7"
FT                   /protein_id="CAQ41796.1"
FT                   /translation="MTASIQNRGSRLIQYEDSSNKEFIRKYLVETRNEFIEKQMRALYE
FT                   CREIYKHDIDEVINILTYALENNDSVLLRHEVAYVIGQISNEKCNDILIKLLSDTEENL
FT                   MVRHEAAEGLAAIGSDSNIDVIKKFLNDEKVEVRETCELALSSLLEKNKYATCSCSNKD
FT                   NIKEEIKKKRNEEFISKKFNTIDPVVFTPNDNTKSVDALIEDLNNERIPLKLRYEALFK
FT                   LRDMETDMSINALGEVLIKDRKSAIFRHEVAFVLGQALHLNSLKYLISSLQNVDEHEMV
FT                   RHEVALALGSLGSLNINSQEYKNVQSEIISTLKTFSKDACRVVSESCLVGLDYIAENLN
FT                   MAIEIN"
FT   CDS_pept        join(52076..56304,56487..56912,57091..57220)
FT                   /locus_tag="PKH_140120"
FT                   /product="atp-dependent dead box helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140120"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140120"
FT                   /db_xref="GOA:A0A384KPM2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KPM2"
FT                   /protein_id="CAQ41797.1"
FT                   /translation="MNRNSASDNNLTREENLKYDDETTSTVLLEKKKLTNKERKKLEYE
FT                   ERIRRKREKHLKKVKKIITKTNLPSLNGLKNELLKDCSPTILNGTDEPKDAFQNGKNEE
FT                   NMKSHNVNSEVETLQSDNRDGIQNPNDHSNETNERGSEENKSRRKDIERINKKYKQLCS
FT                   MENVSKKKLIKKLKYKQKQDKEAEKEKLFKNIEQYRLNTNQKNFIIQFDSKKKNPNQEN
FT                   LEKLFQTYEEMNIDLPNNLKVIKKKLEKKKKKFLESKKRNQEFATSQHGAEGKKFKVSK
FT                   QEHHHVDVHQNGDLIHSEEDDTNDELVESACLAQNEINLDEDVKETKWKDALSTESNLA
FT                   QNDHLDEDNIYGDTADRANQRDEGNAQPEEEKRKILYQRVSINRTDNIEKMRQALPVLG
FT                   YEQEIIEAILNYDVVFISGDTGCGKSTQIPQFVYEHGFCTDNYLIGVTEPRKIAVRSIS
FT                   NRLNEELNIEDVAGYQIRFEKSHFLKNSKIKVMTEGILLREILNDFILSKYSVIILDEA
FT                   HERSINMDLILGLLSIICKIRKNNYFAYKSNIIPIKVIIMSATINGTHFFENKIFTNYT
FT                   SINIPTEKVPVVDHFLSYTPQNYVEEAKKKVIQIHKRLPPGSILVFLTSQEEIYRLYNL
FT                   LNNLKMSEKNTQVEDEKNMHTLEHTNEKTEKAQNENINSFDLSEDEKNANDNKCSFFLR
FT                   STDENKEKRIIFEASDSDDEDAPLHSALSVSTTNLPEQREYDSDGHEENYTSLDNSNSA
FT                   EENQTNKNVESNGLGKTDNGNDTLPCSANSQTEEGEDGEEGPPPSDCHTKGDNHDGEDA
FT                   ENGGELSEDSESCEENTQDNQSDNQPDNQPDNQPDNQPTNQPDKQPDKQPTNQPTNQPT
FT                   NQPGDEQTEGEPNEHAVSGEAKKHRNKQESTIWKGSDGSGRLKVFKLFANMHMQEQISL
FT                   FKDPRDDERVCIISTNIAETSITLPNIRYVVDCGKEKRKIYSALNDYSYYVIDNISKSS
FT                   AIQRKGRAGRILHLLKKNKKNKKKIETEKGHVYKLYSSNYYNYFFKNDNDFPILNYPLD
FT                   SLILYLLSFKIKNVEHFPFINKPEKCKFEEAKKRLIYHNCVYFGYQDVQFLFKTLSDKM
FT                   ASKKSIENHINMFNPEHKSGITPTGSFVLSLPISTRYAKILTDVCLKSLAINHTSSIPL
FT                   ACLLVSCLYLESIFSYDYKLRAKYGKGRKKRKTLMNGNGERSSNQTNGNDSLNRRNYNL
FT                   ASLIFKKNNESEDQSDVNSCSSGDVSPYESNASDEKSPNTDEKDNILDDFKLKFDNDID
FT                   FYLSVCTSFYFSKDKNNFCCSMHLDRKKMEELLKLSNHLIKIINHKFNRNINFDHLENN
FT                   PSDVSKKIIHYAVIQGFIDHLAIRSDLIHNQYTRNSNLNFNNKKAYFSQNMNTPIYINS
FT                   SSVMYKNRPYPKYILYNYIMKNAKSYVMFDCLTVNESDIGKITNVCIYINEYEKIPPAK
FT                   YDMKKDKIVVCVKPLYLPYSHYLPMTTKELNENGLLFYNYLALFILDGSIFPKMSSFHL
FT                   FYTHSANDIISCTSQPVKQFVDALREARISSRATLINKWKSQKDFLKQEFVSLIGKKLN
FT                   KYNEQVIDKTWPPLN"
FT   CDS_pept        complement(join(58058..58223,58423..58841))
FT                   /locus_tag="PKH_140130"
FT                   /product="40S ribosomal protein S7 homologue, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140130"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140130"
FT                   /db_xref="GOA:A0A384LGK8"
FT                   /db_xref="InterPro:IPR000554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LGK8"
FT                   /protein_id="CAQ41798.1"
FT                   /translation="MVSVKAKVLKNNPSDLEREIAQCLIDIELSSSSDIKNDAKEIKIL
FT                   SCDLIEVEKIKKKTILIYIPYKIYTTYVRKIQRKLINELEKKTKKYVVLVAKRTILKAK
FT                   QKTKSFKIIPRSRTLTSVYDSILEDIVAPSEIVGKRISMKADGKRLFKIMLDSKERQRD
FT                   NIEEKLISFAAVYKKITKRDTVFTLPPTNEK"
FT   CDS_pept        62194..64878
FT                   /locus_tag="PKH_140140"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140140"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140140"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KBK4"
FT                   /protein_id="CAQ41799.1"
FT                   /translation="MNAYLLEKRLAAKWFHARGNPFVYRKSRHVKHFSQAQIPKRVGFM
FT                   KPAFKLNRKAQKYIVNVQWLKSGNTKELQKLCNDIKKDANSFNSYEIIDLVYYLSKHSN
FT                   RNVYLTIEPLLFHFFRKYNASVNLNGVSIHRLLRVLTEYQDLVYREWIYSIAKIISKKH
FT                   AHISMRDIQLILDDLALFYDFQIHCQITPFYNTVINRIHELEIKRLPFLIHVIGRIGCN
FT                   NPNLLNILVATLKKNISKNDLYRSDFSGLLLRGLANLKVLPDRNILHQLYKPVKENLYY
FT                   TNIKYLSWCADGFSRLNYFSPLPMLLNQILQLKDKITHLELNDFSSILNCIQAYILIKQ
FT                   YNGLGEKGNVPHWRRNPTSDNIPKVQSDHPNDGRNLIQHPRWNIPSDGSYKKLMLHEGN
FT                   SDHREIPIQDSHSEQSRSQIIARENGEYEEQASHTREDHTEGRETIHPNKTLQNDVKNG
FT                   GKKYHSIQRNQTDRINRPCGDYVAQEKCTKNRVKLNVELEKDATEYAPHASSNVMNKTD
FT                   DTPGRGNYILPTSNDKAFREINSILQVNANTIPLEELYDIYLKLEKIILEKITESIYST
FT                   TPPYRVIMFELLTRLFRFYKKPIDLIIHMNTHRYDTSLLLKHTNSLPFIISNERGRKIS
FT                   NSQLSFLVEEYDFSNDFFFKDCPNDQSGAKKSTPDGEHTQIEGEKHRLRAPPSAEMKND
FT                   GKERQKNEQPHGNETNTYHHDVERNLHLSEDNQINVNTPLPKIFKTFLHSIYFRTPALG
FT                   GRTIMLLLIALVRLNFGEREKFEYRTKTDSNILPFSKTSEIYRPFTKCIIREIIRKLES
FT                   FNSEELIICAMCLNELDALNLDDELFSLLIERLFNLNKSNYMSHDQLLQLNNLFHFWYT
FT                   RRRNLIAQNLRFSSAKQFKSFLA"
FT   CDS_pept        join(66027..66088,66403..66511,66671..66853)
FT                   /locus_tag="PKH_140150"
FT                   /product="hypothetical membrane protein, conserved in
FT                   Apicomplexan species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140150"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140150"
FT                   /db_xref="GOA:A0A384LIR4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LIR4"
FT                   /protein_id="CAQ41800.1"
FT                   /translation="MLSFVKSVGRGFARSYTWCKSASCRRFFSEDYFWTKANVGPFFIV
FT                   LLTAPYWLGGIKNIYWTLRYEQLNKQEILSDRFTWLYERMLEDEVHKTLLQKLPSYNFK
FT                   NNGPENMLGPSQI"
FT   CDS_pept        join(67168..67334,67562..68066)
FT                   /locus_tag="PKH_140160"
FT                   /product="methyl transferase-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140160"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140160"
FT                   /db_xref="GOA:A0A384LL16"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LL16"
FT                   /protein_id="CAQ41801.1"
FT                   /translation="MESCPEVKINFHHIYSNQELRKNVYLPSSDTFTFLEALEEDVETI
FT                   SPTVHAALEMGTGSGYLILSLYELLLKRKKKINLLYCLDINEKACKCVRKLTLENKISN
FT                   VEIINTDLFSNLKHCKQFDLVLFNPPYVVTEEEEMNKTDIVASYAGGKYGREIILKFLL
FT                   SVYDYVSDKGVIYLLMEKNNRPNEILNDGNISSRFNYTELKKKKTLNETIFIYKLSKKG
FT                   S"
FT   CDS_pept        complement(join(69099..69386,69619..69703,69838..69945,
FT                   70153..70267,70439..70469))
FT                   /locus_tag="PKH_140170"
FT                   /product="synaptobrevin-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140170"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140170"
FT                   /db_xref="GOA:A0A384KEW0"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KEW0"
FT                   /protein_id="CAQ41802.1"
FT                   /translation="MSIIYGLVARDKTVLAEYTEFGGNFSNISRLLLEIIPPHSARKSY
FT                   IYDDYVFHQLMKNGITFMAMTDKELGFLTPYAFLEEISKVFFKHFNYTSDFIALSLDEE
FT                   FKPVLRENMRIFNNYESNDVHNIKNKISNIQNIIIENIEKILERREKIDILVNKSEKLY
FT                   QENISFRRQAMRLNFFMWMEDNRFLIYFISSIAIFVFLIWSFYNV"
FT   CDS_pept        71775..72710
FT                   /locus_tag="PKH_140180"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140180"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140180"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR039169"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KY54"
FT                   /protein_id="CAQ41803.1"
FT                   /translation="MSEEIYKTVVEKVLQHTCQEKPSKYYFLIKQSQQNTKDFSLAKIT
FT                   FREEPLLNLEDNLKEDETFALVFNNSEISHKKLKKKTKEEYLLGKLKSSNDSVSDEQIV
FT                   EKLEKLLKCEKKNKENIFKKNSLHELHNSYAFYDDAFCENFYLMGDEYDLQISKQLNGL
FT                   SVLSLNKCSTIFFNILSDLKADTSKSFIQLIKENVKVEYDPRLLNARVSGKRKKNALFV
FT                   NENMTILKIFYKDKLYMVKNKICGYQLDINENLVENPYLLFLGQQEAWILILKCKEDVI
FT                   SQKCITAIQYEEKRKSVIEQYNCVLDSLRK"
FT   CDS_pept        complement(74144..77074)
FT                   /locus_tag="PKH_140190"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140190"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140190"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHD1"
FT                   /protein_id="CAQ41804.1"
FT                   /translation="MKILLSSDEVNLLVYRYLVENGFIHAAYAFFNEANISKNSYYISH
FT                   DEKLPCHALVTFMQKALVFIFIEYHTEHNNGRISCKEPFSLFKRHECFAEENDLSEEQE
FT                   NKIGIRENEKNNSNNLNTCSASSKAFGNNNVNRTNLSNSVSFSDLKNDSSLNNVDGHGP
FT                   SGANAKKNPVSKKNGGKIDNEEADGKTNQDNKKNMNQVSNGNGKDTNNNCSSNNTNDSN
FT                   APKAKTNSKPSIYSSSFSNFASLNYNDSNISFKDIKRNYANIFAQGKKSKKSSSNKKNN
FT                   STNTGGSNNVSNRSNNKNSETDSGHNNSGGGNSKKNDSSVSSNRSEGKAPNVKNESDDV
FT                   GPSGNQRKKSKVMKIVSKSNKENEDENGKCNNMSDSILSDDKGKEHNHVSDTKEDNVEG
FT                   TKHNGAKKYNNLNNNIKKNNVNTSSSGKGASLSNNNNANGKKKELSGGNAGQNNNSSNK
FT                   KKKKVKKKKKESTSSNSTNNSKKTIKSSLQKEKNEKGNKSVTSKQKKNDRQDSDDEEED
FT                   EDCDDEVSDENSEEDSEFSNDNEGYNNENDCNAPMEDSANNSAQGRDNPSSSSINNNAT
FT                   VDDKSNDDTYANFKKNSGTNIISNNHSHNSTIDGVKNENSNPHIIMTHYDGFPNNAYDG
FT                   NLQEDALAKEKSLNGNNSKYATMLKGEFGEQPPAEVEGIEENNNSSKSEFNFSFTNFLN
FT                   KKISSIFNNTSGNDDLIEKKHNNDCNDSTVKDASNNEQVLPQDAQDPPTSEAYESVSSS
FT                   KHSYNKFSQKGKLIKDEYMEAKYEKEHLAKEQRNEAKDVAGEVGAPAKKQKRPYDYNSD
FT                   MKVQEGGDTQQMEEDENDKICVEEKKRKKSSIYEENYKNEMNKEFFKKLTQTSANKGDS
FT                   KCEEGSGSLDMKEESEDDELGRGVEKQGMDNELERPQNGDLHHCGNDGNEELAKAKICE
FT                   QNKISINNSDKNYYNRSPSTAHGDDHESYDKMDENYHGEGNFLKTN"
FT   CDS_pept        complement(join(81695..81850,82105..87159))
FT                   /locus_tag="PKH_140200"
FT                   /product="sodium/hydrogen exchanger, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140200"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140200"
FT                   /db_xref="GOA:A0A384KRC3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KRC3"
FT                   /protein_id="CAQ41805.1"
FT                   /translation="MLYLKLINCEKSGKKRNRISLNVFIKIKIFLLCILFVLLKNEDNV
FT                   CQISERLPGEDVCPMRFSPVGGNEKDDDMKISTLKRKQGENINFSDEACANISVTHDDI
FT                   SRLNVFEDAYNLFCGANFVNEKYLVLFGCSDKRLTYRKRGHTSRILRERVRRNAYYENG
FT                   RENTEFSVDSRGENEGENEGDDEENRNQLPSASNEVSEGMIFFCFIFISATMLQFILSK
FT                   INRLNIPVSVIWFLYGMCTYVIAKNFNMFEENALHKSIINARNIDSSVLYFVLLPILLY
FT                   EATQDINYYAFKNFLYGGIGLAVIGVALQVGILGIMFYYSFMYRQEQSPLSSSFLLASI
FT                   LSSTDPVAVLSILSVVDAPSKISSMFHVESLINDGSSVLLFQFFFYLTIGYKANASQYV
FT                   ILFVKLLFLSPVFGIGMAMLTFAWINLYRKYYYNQCLATITMCYLSYFVSEYYFNLSGP
FT                   LAIVCYGLFINAYGHIALDEVAQRKHKEIVELLALMGNSSIFIISGIVSFGMMENVFKD
FT                   NLYFFMYIVLTYIYLVLARSIMIVIFTPFLSRIGYPINWKEILLLIWGGLRGGIVLVLG
FT                   LRIEAENKINDKLTKELAYYISGSVLLILTIQGLTFECLYKMLNIYPPNPFRIVYLEKV
FT                   LKMIDYNFYIRKKNLKNYWLFKGTNILHFSNKIVPELYWRKMNKYGEFDLRLPDIYACL
FT                   QDISSCDISFWERAYDSQTVIESFDDISSYGQSSFPNKKENRINPGGEKKSDNKNSGHS
FT                   SITRRILQKNEFSSVLKNDTLNDGGTPNGRSVEIYAGRENPSSGKMRKSIYEEVKWKNS
FT                   NFTDIEYEDNSDEYSYINNEDSNSRKKRIREKIRMKNNGSRRQRVGEFMSRGKRSLDNF
FT                   SQKGEMKINIIRNNDNYFSSNDEDEHNYTNINYSLSSKNLDKLSNHLNELSDNESCYTD
FT                   KVCENSKIKNLNAFNYAKISIKTYDRLINKMNYREFKRTKTEKENFTVIDSIVDNKNEE
FT                   AFNPKYNLRLIEHATDLPKTLSDNLLVRSSVENEKGSNGDLKNGAQDYSEKEKKKKKNF
FT                   NILHEQGSLKEGNWGKEIDSMKESVMGRNPEGEKQYVQNDIRPGEEHLIKNINYENITK
FT                   MDENLLNNYKDLKRIVEGTNEDTPGVTKADQGENELLMSDNFIIKIQKEKSHECEEDEE
FT                   KDFVKDERGEGHENDLEEKDDEAEEEEGDIKNCITCVTNEEGNVVDDIINYDGSESKNN
FT                   EHNFEEYLTYKNLFAMDSDGKRISSFFNKNYDKKSSLKMEMKNSSELNISTKGTNSKTL
FT                   MLMNNEIEKRKRMKNMNKSKCASCTGMFDFTISPRTRRDSNPSALKVNGNKGGKRKKGD
FT                   IQNCADGESEDFLNGGSQNGRISRINSSRKGGNDNSVSNNNNSNGDFLDGGKGIPKVQR
FT                   NNTADFTAKRYDTDRTINFECIEDVCQKKHVATFYSFLKRPKMKIKNKLFSEIRRARSH
FT                   ESYGKSQDKSRKSKDDVFYSSLKKKIVRKEREGELYIMIFNTCRELYKKLYVNGFISGE
FT                   CLLTLTSILDLSADFALKKVRMNPIKAWADAFDKGKNKNSNKRRRSIDHRNGFEYEFNV
FT                   LLSKLKINTKHSFFFSPKVVNIFLVYEHCMKDLQIILSYVDVHQCTLDKGGITMKLLLG
FT                   KNLLRSYYRNIELAKSLIPHLVNKYKDVVKYCLIKIGADMLMHLKKTIVNEQAANGLLL
FT                   TQDNEKLNGIFDEQQIKINRYRPYLHYFLKKNMFKMIIK"
FT   CDS_pept        join(90204..90455,90740..90856)
FT                   /locus_tag="PKH_140210"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140210"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140210"
FT                   /db_xref="GOA:A0A384KXB4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KXB4"
FT                   /protein_id="CAQ41806.1"
FT                   /translation="MTSDKHSNNFFSEFNIYHKKNTKKVVYRYFQNRTQKQTKYITLSL
FT                   LGLSGLFLYITNKAYDRNIFYLNNEVYKKFSKNYDASSPLEAQNRSFARTFVKAKRKNL
FT                   ELDSKPLVSQIIRIDEKE"
FT   CDS_pept        join(92416..92440,92591..92697,92873..92909,93040..93105,
FT                   93252..93338,93511..95987)
FT                   /locus_tag="PKH_140220"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140220"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140220"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZC7"
FT                   /protein_id="CAQ41807.1"
FT                   /translation="MITDSEAPTYNFNSDDEAPCEYLNDVYAISEDTFSFKIIKQLGEG
FT                   YYSPGNGHKVKIIYYQLGSEDKIASSNVYLGKNDKLPYICEIAAKCMKPNEVSIIQAPK
FT                   QFTKIFSNSERKNKYDRKENFRTEFKKALRFKQKCVEKYMSYSIVPTLKRIKLSSNDVK
FT                   FLVRKRKLKKDNRKGNNDVVERNAPNEELKGEDTQKYFESLTLEDINNVRYKILKEEEL
FT                   STYVVYLKEYNRVEILNDDKTIIKEVLREGKGIFTPKKNDYIDFFIQDGKKGEFIHTTL
FT                   EEHNLKYRGLFKILQNMKKKEMSKIILKGLECLHIYHSSKNTHTEKDQPNGQERNPNGL
FT                   ERNPNGMENDQNGVCNDEKQKDILNETELFNIEENQVKQNHGEIKVAKNIDIHIRDELT
FT                   KQKKEIIIELLDFKKSKLVNFSSIINLNNKEKLLFYVSENGKNNPPNKPIIDTDCELII
FT                   HLSINNDKDRTKGKKINLPVHFWKNNGNIEKRKAFFLFSYGSCFTAPLWFYECFKGLKE
FT                   GDEVIIPLSKNRNIFSENQFAYHLIFEECDQGGEAQHKRRGEDQDEDDIERIKGAMNGR
FT                   KKCTQNDNHQITKKNHSRRKWSKKKDLKFVQCLISNRNKGKGFFLIDGLKENQVNRFCE
FT                   GFFSSQMSLIEGTHNKEESLELPFHFNSFQKVRRKKFYKSVAKIQKKEKLNRMKNQLSR
FT                   QFYEGSLSNECMCIPKKGEEKGEKTDNFSFFKRALKNVYFDKSFYEKNAILKIKIVKLI
FT                   CKRKDPWNMNMQEQIEYLKIYNKMGNTFMKKNLPYAASLQYIKGFDIFRFSKIYNIIFE
FT                   EKKINMSNLASDDMTKELVLHMEKILTNLAISHYKLGHYNECVKYAENAATINPKNVKC
FT                   IYWKHMAYLQQNKYDQIIKNLNNSFCLNNLTLLKLYNTARAIKKIQDAQFNSLFYAMYD
FT                   HN"
FT   CDS_pept        complement(96789..122747)
FT                   /locus_tag="PKH_140230"
FT                   /product="peptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140230"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140230"
FT                   /db_xref="GOA:A0A384KMG7"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR033317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KMG7"
FT                   /protein_id="CAQ41808.1"
FT                   /translation="MEETLEKKLVVKRLLRKNEKFQDGKGAKKRIHRIRMALLNMSEKE
FT                   ENCFLLDVYPLIKSYISHCVPCYCLNRTYIFRKSILNIFHSMIYKFKKIKYIIEIFDIC
FT                   LNLIVKQNEEYTIICIRIITEICKLHKNDLILFDIYKYVNVVSLQILKAFYNRLIGKVK
FT                   RGKFLKSAINVYRKRHKKIRCVRSSGDSLKVVREIILSNYVLMNLYPNLLKINENYVKI
FT                   LCKILSLLNIWDFKYSRAFCIEYIHCSRDVVCKTSYSYHFLDTHLSVGKNELGLSDPCG
FT                   NVLYPCKFERLYNYLVDDSIPLDSKVVRGNSKISQRKDTDMNKFDESIPQEYNVPFHCE
FT                   DELVKNFGVKKGKKQFYKNVNYKNYEIDLSKVSDVWSLKNMVVYMLIFFLRMDKMNKYF
FT                   HLKEFLIEKILEFLKYEEKHSMEEGKIFMENIRLLLHENFKKNMKYYLGLFLNPSTYRS
FT                   FLRYKNNGHLDEQVFVLIHDIFHYFKDQPVWNYEVIKSCISAYSLVIMSKKSFIFIQKV
FT                   CVKLLMYIIEILFAMKKKSAEYFSLYFDIINIMLQKSYSLKCELYDLYRRGLRYSREDM
FT                   MSADGRTKKGRYFHLRRKNKLCKDREVMKYDSDHLSKFVLSRKYFLQNRIKKEEHLEKI
FT                   KAPAKYYSHKNGTKKGKVALKDVRLKNHWKLEETHDISELLEQYKFLLYAIHDCVRSNI
FT                   FYIYLYFNKEAIICKLDGEKRRSNISQDENCNISKEGLNCSGEYVNNDLNRRGDIFDSC
FT                   TSKENAVNVNSANVGGVNECDDTAKGKNDKKPASKRKRIRKIGSISKRKRPSRPKNPNK
FT                   SVKNVERSNDVKNGYPNGGSTFQRSNGNIVSNLENGVKNELGQSLNAGEYNCQTENGKL
FT                   ASCKDWGAPISKVPLNVSNIEHEQNNYIALNYLQNNDDLLISNYNCILSGGDMISEING
FT                   RTELACAVKDNYSGTYTADKNFHSYMNKYHKENENKLNGLMYGCTVEKVNNSHSFMNGY
FT                   RNINDNGIIKGQHCEFAKEALWSTGEDIFEEKGNIIKSQCASQNVFIKNGNNDMCNVSK
FT                   NDSQESGFRMGKLQGEDSEQGIPNGDLVYDTFEEMYDISHVDLTHAQSILFKSYQLSEN
FT                   WVKIIHKIFYRMVVCCILLTSCFSHITVEKLGIKSGALRRVLKKNIKNGGSSDEGDVLE
FT                   EDYPKDDRSMSSTCRPYVHINVQSLSKEDRRKVFNCISYIKNEEKNLLYMCAKSIISLS
FT                   GNDFHIFMNYSIKPLFKLLFQYPQIFYIFQVLGAVSSTSLLFCKVCFGYIIKKMKTFPR
FT                   LKNDFKPLHYFNKNVRSKFATDLYKCKLFYKVQSPSDCLLDQSYCDTFQIGKDCRHNYL
FT                   LNKGKKVPLGGSAKSSGLVSNVSFPTLSRKNGSGAFEKGKRSETGSSLLRTLGIQIDYF
FT                   DFSILEEYENGSYIEGDSEMKDIKSVLPNDVNFFRELTYHNDVQMLSVLNNGTAGATGM
FT                   EKNSDKKWKKKKHYFLHEMEERDIINPANFVSPHLLKFAKVKRRRKYSAESYAISADDV
FT                   NGVILNRPIFKNSISHEYQQGIYSPIRSKSLPGNYIVKRDVVNDWQFSHGIFSKKGEIK
FT                   TVKRRRNRMCDAFIRTNDYVMGYNSFSMNNTFNSYMSYKDLIIKVIHFLLKVIKYYSHY
FT                   YDQFLSELKTISQICLDLILKDSKCIQVVHLLKFLLETICFVNCANELNMNRENITGLN
FT                   YALNKIPFRDNLRFMKCMKYISASTEGNADRSRSGGGSTMDIVLRNGCIMEDILKKESS
FT                   MQYVSNEGNSLLNRKENNTEFMKSLQKEDMEISEAFGKKEASRSYGRGSRDAYHDAPGH
FT                   GPEGRTKGVEANKVKEIIVSVLNWLENVYLDFPKLYKMVLCEMCLELPINYFTKEKFHL
FT                   YMKSLLICLGSKNMNRIKVALKSMEENIFMANNNHIKGSISSSFYFKNKDGTTSCIFTH
FT                   LMKFLRKKICFEFNFNKIYEQKYYLNDLFRNPADIALLQMGVIYTEKVLSEKEVNKYMN
FT                   KVYMENLFMILKLYCKFCEDNEVRNNYYVRLNSKRSVISHFRIGFFLKRQIKEYKRKRC
FT                   IQEVQDETIEGKPLMIKNERTLNYESISTVKNHLVEVNEYPQVKGNKSSSFDNSNPSGS
FT                   CKISDRSKKRRKSIPVKNEGECEGGNTQINTSKEYQYIVENNNVEANVERRRSRRTASR
FT                   KKIRSIESEVEEKKKCNDKQNGTLSICNDNIIKEVKCNNEEQNKKNSCVQDDRIINVSV
FT                   KLVNEKKDEADGDNSNLVKLLMSGSTLDDSFDSIIQHMDLEETLNYCYKVLKNNVKSNN
FT                   AKCLYYYKQPMMNACMRRKLCVRKKKRICVRKKKKREKFSFFNFYQLENLRKRKMNEQD
FT                   EVATDKRSNKKLKVYSSSSEGNDKLVHSKCMNRKDRLSVIEEVKQPILKIMKDMGVAEE
FT                   GAVRTSLTRKMEGTFHGGVNCTNKISNHFADKKKLFFIGNRNFKSYERFIENGRTKYFD
FT                   RSDLCYYCILKDQRISCYRIILTIFIFIFNHSKCISDFYQHMIKIASQNVEFKKGMKNG
FT                   PVGVKTPNGLSTNTADKVNKNGVTVDKKRKGTSKRFSSSIGEEQSPNKNVKMVDNAPNE
FT                   HKEVLGRKANNANGTKRKNKICFETCKCRKYLHKYSFIYDDNNIFIKKLMYCFLILLVE
FT                   INEKGKNDNIGMDAEGGNGKKPQKAERNCGMICSDEMWKSKLKEIVKNVIRRIGLILSS
FT                   RFVLTRKEKLIYVGSHNNEIDVSSFIFTLCNLVDYHPRFLQMSIEGLNFIEKILRTILN
FT                   VQPVKIKAGMKSTFFFNLCACICNLCNAIKVKKKIFGLLLLLRVIRILPPDWIRFNVYN
FT                   VVRTLLACRERNKLKYMRIVQLLVEECFELVISSLFTGYVGEINTFILNNFRGVDNTFV
FT                   NDIRNLRSLNDNVDEEALKNFEFINKSAIGKIRSSVEKIRSFWNLNNKEVKGIDDSYEK
FT                   YAKDVRSKRLFKGKLFWYKNDEVYTWDILSSRGKNRRSEKEVKRMNKILVNILKILIYN
FT                   LRKKEQDRHFIKKAFIIISKVLRTDTRELLTYKYSPRGKLCLQDIYMKHFCISNFVKSS
FT                   LQRKITCLDFYCFFLSQKPYIKFDMHVMINLIETVVKIIQYLEKRDEENRIFNYILNGN
FT                   VYRSCSKDGRNGDLYERTNLGFHYEKKLNDGVDHTHHEWKNQNKIHLGENDGELYNWST
FT                   KNGYVNHSNVCYNWQISSNHNGAEDENVVDNRNLKNELTRLQSTVPNGYGSELNSQKNK
FT                   DLQNLYEKIKKKNRDYSILYNKDYGSKSDNRNEEENKDLTIDDIANEWGNKTDNISRRF
FT                   KHYSDDKNNENLSGMDKQLDCEGATRRKSSNSYHSIYFNNKMAMHDSDKGVLAKHDSLH
FT                   GNDELNIQNNDVFDEHSGGYNCHIGAKDNVEINADVGESPYINQNCKGRNGSALVRGTI
FT                   KYGFSHGSTGCPTASLCDGKIEVDAGVLDKNAKDICSTANNGDRNNLLEEEEQKRKNCV
FT                   MRNSISSYISTNFARFKVENSPNASASFKGMKNNLVQKNKCLLRSQIRSLKVSNRNSAT
FT                   SGGSTCNGNANANNANCYQNFYFNGKEREDEGKDESASVPENFIMEPKVNADSIPVEYN
FT                   KENLVTEFIKEYFSQDRNPKEQFARGIVRNGKIVNESYPKEHLAKQQLLKEEYKTVIDF
FT                   FSHFITLVRIFFSHELYKYLLPTMNAQMNKRSVYLYNRCIHILVNFLFSKEKELCMKAE
FT                   STLRFLIVINEHDRDSGLNENLVNNYSKNCGNGVDKTSGKNGGPYNCSKTMNTNKNITN
FT                   VWKLNKIDLKIYLKSILCNLSYALRNNGFVLKKNFIIGLSKIYSFFPQLFSPHLTDGFI
FT                   QYVKFWNDKCGEDKFVLKDVEKVLEVFSSFFTKSRLTYDQFKEITDLLFCIFTRSEKSS
FT                   SISLLNLGELNRWADRGIRSSVASASSGRNHVVDNTEGVASTRHTTEEVNPACQSVDIS
FT                   VNKNALVRENGIEEELLEYFITNYSNNENREMSTSLMRALSLLCSNNHEYALKYFIEQR
FT                   HNQKIFSRFVCTLRVKDQVGFRKYICKKISILLNILLRFICDFKSNEYLMHVFSVYLFS
FT                   VNDGDLRQVLSYDCSRMKEYANRSVSTNLKEDTSLYLEGGERNEERTSGDDHSGKDSEA
FT                   CELKFIPIMNVSNFVVNLFSVINVVHAVLLYEPSWIFLNFYEDRVKKNRMSLIEVLYLC
FT                   LIHLISQYLSFQDTNFLSFLRSRECKKCVKIFILFFHFSRDLLRCLVLDGFPMQNSAEN
FT                   SRVHKSLMRSKNGGKNDIICDSMKYNGYLFFLRTNLLIILAFIVCTNRDEDYNYLHKFF
FT                   KRCTKKGLRFREKRFLFFTLVRILHNFNAPILSHFFETILRFFIIPILKEYIKKAEKVK
FT                   HLTFPEEKCTSNGNTNEKEIICELQHDRMIMSVHAKLFTQEDMNQINQREKSNSLRNDQ
FT                   SGGSNLLNINSYYNGNGAVSTICNNVKVGNTYDYAGDLNYRRDQNGISGANNNAYVNLA
FT                   RNNICPWAFIRTSQNCTFVHNLNDNGSSGSANNGFCLLYTSIHGQRKNVHLYPFYNHNL
FT                   FFSINEIFYVLKAILRGRTDLKEVLIQKLSISRMVVDLIRRIKCKKSKMIMLSYVRRFN
FT                   NEYVNSPCDDVKQLSIRNIINTCKYSRNFNWDELTTIYLHLLYCYKNEENNLIKLNLKE
FT                   LTKAILQKREQHKKYSYKGNILLRQMERSHMHCYYCKVYSDKLVVKDNRKRRCFCYPEG
FT                   NSSFRKIDRRTQNSKHLLWKKGHIKNCDLLNHRRVVILSYFKKDETVFNKMHILEFALT
FT                   HKYYFFNVYPYVMGSILKNFEKMTNRLYIDRKKKSLLIRALSVALKFIKFNIFCNSVHE
FT                   LFRLVNDEVVLRKIHPLEGLPSEDGNKLEEGNEPEAPNGRNVQNGKSDARALRELRSGK
FT                   MVFIAEHAKHDVIEQNVNIGEKLRNRKGSSIIERENACISAQLEEENKQIANKNGDVPL
FT                   QGGSIQKNKSILKMSKLTKIMLNYYVKIGKDDEKRHLFLIGLVNVLKKYNRIYVQYSIL
FT                   NVLTNLIISSLMQHGNELHQAKMTNRILRILERILRIKNNVKVKYVDVYKTLMCFYSIH
FT                   CTTKEYIKRRKGKCGNNPQVGDESMLQNLLHNIITLEIQNKRSGNGELAVHSISGISNN
FT                   SNDGVITNEDGGGRENEISAFSFRNERTYSFTKNSEGKESFDGFVKNEKLSNGSFVDDT
FT                   LSRNEKSSIAQDWQTNYLRRDGANIAPNILKGIDKEGKDICDKSEMISALKSALLNQIG
FT                   MDDEKKVNMMNGHFPTVEKHVEQISNAYEMINKGYGMNMVKTIYRVLKVLMKYSNRKGV
FT                   CKSLHILSCIFFLLLNFGNRKMGRATLLLINHIVIKHSLFLDNFGNIIGRISPQGRENG
FT                   DSGVASQIGVNEEKYNTKKEPYFMFNNQFEREENVNRKIEFLHEMLISLCLRGMDGYRK
FT                   NNREYYMDNTLYVEAKLETSLNIFTLFCQIYDRNGGNQYAQLIRYLILEYLKRLRCIAC
FT                   YCLKKRERMGTLKQLLFLINTNLHLVDKNEAIHCLETMQALLLLECKNGSNFHLFILNM
FT                   NEYHLEDVQKRLEGPMEDFSTDVMSERSTCASSMEEEGKEHKIRRKAQVKKIINELSGK
FT                   EMSNFQIGHYIKYINSVEDEGGTCNYMHNYRISRRYFLSKDRIIYERRRKNYLRRKICR
FT                   DKMNHREMTNDLYASLFCKGGGNNCEGVTNLKSNVQVRDVQAMCKNGAKNVQTNGKENY
FT                   EKTTVGKEVVSPHVMGIRKLRKEKRIKQFYKRLKCYDEIFEAYTIEENICNDLFMCKKR
FT                   KKLKKFWSCRKNEKVSICLSSEEKAHLIRNLIIFDYSDDYHCYVKYYDILLYFIKNEKE
FT                   KYSERYHIIDLKNMFLRHLLPNILRGTFSFIPKIRYTCMNLFQKYFLSNDLFESICFLF
FT                   KNDYFKHIIDKYFVCLFLNVLFSFFKHNVDTYVYLRKRTQGLVPFLCRRRGARCHALTD
FT                   GPIAKGAVNGGKFSEHARGKTCSDNMKKKQKKCTAREACKVVDLENYNNDFVTWNRYLT
FT                   KYCSEQQGFVNKCQEKFIKAKYLFKPMLSLVNIFKEYCRLVWIDLFSQLFNFFNKEQIN
FT                   KLNFCIVHFLYNYISFTESSSNNYNMCMSRAGNEKGASTLNMSWRKNKNFQNNVYGNDY
FT                   NVNILETILTCIFKTRFMLYIPTEIILYCAKNFCTYEISKCMLQMLLFQNLRKMKKLDK
FT                   QKGEVEGFSPIEDMNRKKETGSNHIAIDKPSRSKNKKKSESTNMNKGGVGNNSSENRSI
FT                   IDGRSEDSIGEMKRSYNSYKQIINFLIEINSDLNERDNVYALRTYYVRNVELSKSLFFN
FT                   HYNMYYKNEYSYLKYFMSYENLNLTKEELGINRINWIDSLKHFGKVSCIESYMKLLQVK
FT                   EGMKRNDEFKSSHLSTCTFLSEERKDDSVALSFNYEALKSNYLTNLNNVYCIIKDNLKC
FT                   IQVQDNMGRNNTEISSEVNGSDLYPVCTLGETLHGESKKSQGGGNTQCIDIGGGAIVTA
FT                   KNDIDFSKKNGTNARRSGRSRTNKLINLKFNKSKDGKIQTTIHDYFKSNKKTLPEDQEG
FT                   KTHTEEYNKEGDNADKRMSEKCLNGEENINDSNSGHSSRRDIISDGKVNTICSGVNKCS
FT                   GSIDCKDFHRSSGNVRNDNYSAHYSGNFGSGKNGNIAYLLNGLSGYGERDGMKNIVYSY
FT                   LEKIIYKLQENSETIVESMQGNENIEIDEVVAGSDIQKNVENEVGKNAKGREEKNVGSS
FT                   ADGGANSFGRMVWERGNAFNEGEHFVSKVNGQSSEFLLKKFKFNLKSKHIKTVKENIDD
FT                   GMNLLINKVRQMCNYKNNNLSLLFAHAEMFKHAQTSIEIIRENSIKKKQEQKKETELQL
FT                   ICLLHNLFIMCNKDSSVYVYDDIHNMKYSYQWKLLFLKICKIFMDKCGLLSLSKGGGCT
FT                   DNWTDKYKNYHLLNLTKNMREMNNMSYNYFDKIYENFVQNGGNRNSAICSISGNSISNH
FT                   GSKSGGRVLDARCRYMYNMEIIKMNLKKLINSNISNNGYNIAQNMLEKYSSIACDGSEM
FT                   CRKKNSYKKEKKANISHEENYLYIRNMEYEHFNICINLLKLEKNTFLQKVVKKLKCYIN
FT                   SLNLINTFDFDSLPMVNYEKFRSEFFYMKGKILWNLNKIILFLYRNNFIEKNSKMNCDR
FT                   CRYMCQDIAREDEVGNSQISTDVVFHPLESPQRTEEEKSLNITNLVVSNNDSCNPIEKE
FT                   DNKRNKRRRKGTNVDKERSNLFQEGVFHSSVPEEKKEEGVHDKPLKRKKRSKVIGATSE
FT                   TAEDSVKKSVQKNEQSPLHGKEMDSQIEVSDYKESNKEDKKLGKKGDRKRQQKNDNGEY
FT                   TCKCDHNKCNLFDGNLIEECFLSSLKIYPLENNSWTLWADYCNKAFKETQNISFCLSSI
FT                   ISYLIYSSLNTHEGYYYLSKVLYLLSSNMRDNSIMQVFNKYNDNICPNLWLFYLPFLIN
FT                   NINVNGDNYLYFHKILYLLMRKYPQDVFYHFRALQIERKGKLYYLHDRRGKKKNGIGGN
FT                   SSLMKNNVNIVKDPYEGKNYKEKFQMEDIIFSRDGNNVDEYGSKGVGGLSARSNVIGEN
FT                   GTGNSSIFDGVDNPSVNRNAKQGNAHSVQRAIGKVRICSNRKTEREGEKEVTPTAANSP
FT                   IEVNEEGYEYGDLFKDGFDQLMNVFRNKHADVYMSLNYMCNGILNYTRLQPHEETYYIV
FT                   GKLLDRCMEFPYAQTHVSTFIQKMTENYILYKRYKSKMKKNYRGSRSTKIAINNMNMFW
FT                   KEFKKDVKLLKRNVRKRRGSFNNVNFKEKGEMKSHIMNNCTGGDEKEGDLITADGGEIW
FT                   KKGRKENYFSLGEFPQIAKKWKDILFIIIHSLNENQEFDYFSHSMFDMFSNFPVKIELP
FT                   GRRLKYIGEHINYLNDLNLYCSTNIVRMNKPIMPTVLSTRCMKSISFLTSDGNIQYYTV
FT                   ESCNSIRRKSEEKFTMLQILMNNTMFKFSHTKKRGLSFGINIHTPLHPSFKLKDETFED
FT                   ISLRELYNHYMLVTKNEKYSIDNILLHHRNLIKNSIRTFLLNKVECVVREEEVAMAERN
FT                   KKKKSSLDKGNEEKGTILVNKTKSEEIPEIRAAGSMVKNTILKKNSNDIFVNAKKSGSN
FT                   SSSCNTDKMVEGMLYKAQMEYYNSLSYEELIQNFRTEKWFRKSFRKCVRKIVKLHFKDI
FT                   CKMVPKNIMKNYFYSLHNDLESYYVMNSQFVKSYSLTCMLNYIFFQQNSSLHTIMLSKR
FT                   SGRTMFSEGKPSYMNLRKYNPKEEGIRKRGVPFRLTRNIQQFIGFQGLRGAFPSNFYVS
FT                   IMALKKNMNYVRDFLNLTTLDDFYSLYVYGENRKILLNKERSLNDEEVKHAYVKSFHVD
FT                   DSTRKMIIKDAEDHVRNVCYRISSLYKNILGRKKKVSLSKEDECKKESDVFKGLEYYSD
FT                   LQDISLSELSSDDDLEHAKNNSEDKNAQNAKKTNANAKRKRSETQSKLLKVEGSSKICK
FT                   SRKSPLKKEPNGGDNNVCNKGDSLINGSNVATDTSPNKEKSLIGDEATGETRHSEEIEK
FT                   SGNGDSNMEIANNASNVDNATDRNNGLITPNDKSNKKRRRSRKKPNGDPKEEQSEPNQA
FT                   QAPMEEKTLENKSTNEQNKKNKTTASRCKNNRTQKGEEQNVTKNVLLDNGRDQNTESKC
FT                   TGSNLQKEQSAKLRENGHTHMDESHNSVIDLMEISMSKKYLKTANGPWFPWF"
FT   CDS_pept        join(126108..126200,126354..126449,126636..126823,
FT                   127072..127214,127400..127491)
FT                   /locus_tag="PKH_140240"
FT                   /product="GINS complex subunit Psf3, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140240"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140240"
FT                   /db_xref="GOA:A0A384KYU3"
FT                   /db_xref="InterPro:IPR010492"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR036224"
FT                   /db_xref="InterPro:IPR038437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KYU3"
FT                   /protein_id="CAQ41809.1"
FT                   /translation="MENEIVLSEEVEELKNLIYVDDTPFNHLDFMKVPCIPCCVLPGMS
FT                   FLNTRAEEEHKNGYRKDEINETDELLVEYFYAKRLHRSNLVKIKFPECYEMAGALLSDA
FT                   TAASVGNLTHLYFELGTELCHMLPENEWPVEKLEELLLIAEMRRRIYLMKHNDQVDQTY
FT                   LEGMTFMERKMFNSFSKGTDVDKQKATSNRNIFNFFEFDL"
FT   CDS_pept        complement(join(128077..128183,128448..128535,
FT                   128685..128738,128895..131417))
FT                   /locus_tag="PKH_140250"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140250"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140250"
FT                   /db_xref="GOA:A0A384KEX3"
FT                   /db_xref="InterPro:IPR022816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KEX3"
FT                   /protein_id="CAQ41810.1"
FT                   /translation="MKKLGVNTKSGANLSRINENENLFKKPIEFNKNIRRLSFLNNKNN
FT                   DANEKDHLDKCDKTKVKEINEVFKNCMVALSHNKICTRNAFDIRIIDHLEDLVNLNDEE
FT                   INEELNDEMLETGDFNLSFTRASKAIEGATKVYGYRVEAIYDQTYNFLSNMNIAKQSEV
FT                   NEELMDEKKNVNEISNRKMKKRKLEFLQESSTLAKSSDITMDSVTVSNISVDTFFLKLN
FT                   STYDHSSGNSYLLPNLILNNDLSIQFDGDIDACEYKRRKKMEVANEEGMDENADATERS
FT                   GKSPVIMQSSSSEDNECSEQMVKCYKRKLFLHSDVLRDVLLGAGNEDFSSLNICPELDY
FT                   FKAEINKHRMKRSDSKDLEDGDDDDNHHEDDNEEDDYNLNEGGNIRMHKGDYYPGESAK
FT                   NNLALNLSGNMTMDNLLDDSDFNNASGGDGRMLNSSVNNNSMHFNDYKIEDLNIENVMQ
FT                   ESLSFDNMNLNDCVGTNLNYSQSILSFQQGSNTMTGLPLPELMKSENKDFSLMNSLGGN
FT                   FSLSTQNTLFFKNQGGSPRGKGLISTIPDEDTLWNRNVMNLENRLNAIDVNNKFNYHYY
FT                   APSKLIAHGNFRNLMDIGKGTYKNKHMVLNSIAQKKVKASFDVSLIDFENLYKEINDVE
FT                   LSTYDLWKKEKKKYVSNALFSIDQTSYIFETKDYCINCVNTVTDRIMKFSRAAMATRGD
FT                   YTGDLKLNVVLNEVNSDFLTNDMGHINFPEGKNMESMFPEHLDDHQDSHIQAGLNDAID
FT                   KFYNMDFEDVWQNENENNLSKQESKNENASALQLRQSASRGSTLGNPNMENVAKFVDVS
FT                   KIKKILCDIVKPAGKEASDVDIPAEQNDQIVPYMEEKTTTFKDIINATKSKMNPAEVNG
FT                   TSIHMLFVCLLYTCNDQELLLEKIPNEDDFYVHYGLPVEYHVKPDDVLMLEN"
FT   CDS_pept        complement(join(133770..136329,136694..136908))
FT                   /locus_tag="PKH_140260"
FT                   /product="DNA ligase 1, putative"
FT                   /EC_number="6.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140260"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140260"
FT                   /db_xref="GOA:A0A384LNB2"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LNB2"
FT                   /protein_id="CAQ41811.1"
FT                   /translation="MCIGSYANMKLLVLFLIARMLLCKVYSCMRREYSYIIPFMQKNKF
FT                   YRRKTNFNVKVFTNFRDSASNRRSGFLKCLSFPKKTMEGKNEETDIKEESKVKEEGKES
FT                   TKRKIASDGNTKTKKAKAKSENDVKKGSLFNCTVKEDDKVSDLTSPKFNPVHFDVSNLY
FT                   LSQKDKEKHKFKDSLLFTFLTNTFNQIEELKGSGTGSKKNVAIILSNVFRVLIYYSPND
FT                   LIPAVYITLNKVAPDYLNVEAGVGEALILKTMSEAYSRTESSIKKDLQQIEDLGIIAES
FT                   CSCKMRTIFPLPRLTIQSVFNELKSIPNLSGSNSQQKKREVIKKLLVSAKTSEAKYIVR
FT                   FLQQRLRIGVNSATVLQALSYAFILTRPFIPEEIVQKGKLMNEQLLSVKGSGSGEEDDN
FT                   VSDSTMENEMNKVNKKKGGMLNVAKQTGESPSHVKKENEKENQSVKDEFDMNALIESIK
FT                   MRNEKISKPNLFYDIGKEGDTRLLPIFKELKKSYCEINNDSDIFECMEKSVKSALCELP
FT                   NIEIIIQNLLNGDDMNTLSKKCTVKAGLPVQPMLAKPTKGIQEVLDRFNNVTFTCEYKY
FT                   DGERAQIHYIDKDNIKIFSRNLETMTEKYPDVIQIVRDQIISGATECIIDSEVVAYDIE
FT                   NKKILPFQVLTTRKRKDVDIENIKVKICLFPFDLICCNGVPVIKEPLEIRRKLLYSLLK
FT                   CKEGVLCYATHSEMNNVEDMDIFLQDAIENNCEGLMVKTLLDNASYEPSRRSLNWLKVK
FT                   KDYIEGLSDSVDLVPIAGYYGKGKRSGVYGAFVLATYNSETENFQTVCKAGTGFSDEIL
FT                   GSLYDTLSDKIIPSKKSYYEVSDKLNPDVWFDAHYVWEVKAADLSLSPVHTAAIGVYSD
FT                   DKGIGLRFPRFLRLREDKNAEQATTSQQIVDLYEAQFTYNKNKNDFNEESESE"
FT   CDS_pept        complement(join(138527..138663,138872..140222))
FT                   /locus_tag="PKH_140270"
FT                   /product="Mg2+ transporter protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140270"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140270"
FT                   /db_xref="GOA:A0A384KUB9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR039204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KUB9"
FT                   /protein_id="CAQ41812.1"
FT                   /translation="MSYESFTLKDNGECLKRDYDCDELDFNDDDDIVNTTSFEKNTYEY
FT                   NLKNKLINRYKKDKDDLDTISRMENSVNSSTFINREKYYLNDDNADLKARIRNSLCNSN
FT                   NNSSGQSNHGNHNGNHSNYNLNYNFNMDAAKRESNLKLEGILHENDYLIQLSKLKRHVI
FT                   VEIFGGKCFIREYLCTELLKRVKQCCHINYIKQKSGLINYRDCKQLLAENNNIASIEAR
FT                   LNAILVSLPPLTCIILHSSVFLVIKEDLIRDDLIKKLCNVSKKYTNLYKVDTKIMEKRP
FT                   FEFSALECVFSSTIEHLNAEMKLLSKDFADIKFTLKVTNYQDVLTNLHNLKEPTNILIN
FT                   KVNSFIKAFHEISENNADLKKMELTKCYFNPINGEEDNKESTNQDLQMLLEYFDQELHQ
FT                   IHDQVKHLYELMQNLENKLVSDLSLSRNNLIRMDIVISLINSGFGIGTLITGVFGMNLK
FT                   IKLEEHEFAFIYVTGLVIFLCLITVVMSVYFFKCIRI"
FT   CDS_pept        142506..143087
FT                   /locus_tag="PKH_140280"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140280"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L2Y7"
FT                   /protein_id="CAQ41813.1"
FT                   /translation="MSKYKGSLLTVLIGSTIGWNLNRLYRQNELSMHGVRNNHDIIVVR
FT                   QVNISDKNNPDNYLHNQNNTNTSIRQNPQSVILNEKELLNLVQNFNHINRKHKGFCETS
FT                   IFKNSTFSNTNNEHNGEDSFNTYLIIDKWKTKREFEKSKKEFEKLFAHKNHLYDKKMED
FT                   IYLNYEMYNNNYETVSAQNIFQKLYYFIFD"
FT   CDS_pept        complement(join(143674..143880,144150..145643))
FT                   /locus_tag="PKH_140290"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140290"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140290"
FT                   /db_xref="InterPro:IPR018997"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KDR9"
FT                   /protein_id="CAQ41814.1"
FT                   /translation="MDAENEVVKLLLRVGQKINKGPEQLKPFIKIIVEDNWLDSLESLK
FT                   NLGEDEWNKLKIPIRLLEEIKKELGIRKEDDKSTEHCDRDLSNNVGKIGSSEKRVPREL
FT                   GHQNGDDISNFNILNNQQGLSNLHKKLKKSAMDECGSSHQTLREDYEVTNQISERIGRS
FT                   GWNNVDDKNVGKRKGGTGISVKVAENGEGIKSSFIKYDKDKLEKMIECNVTEIPKEDIF
FT                   YLSYEDEKYGCRSYSEEKISTIKCINETEKLKNINIDDLKSIIPILCKIVKNILNNPNA
FT                   LNTRILKSNNDIMKRKILIYPEARNFLLSIGFVEVHVFYVMERVDTLLLLCIYESLQHI
FT                   AKDSIKIDSPPKAAFDPFKSNIVCVDTLKKGKIKGDEQIDKLLREKKEQMEKLMNQTVD
FT                   LNPKIYRFQPNAPKGGSNISSDSEKEERSEDLAFLIPNIKNMYKEQTFKSKTKLELEKI
FT                   STRKVYSKAVLKILFPDSYVLEMSFSAGTLIREVNENIKKFLNPSVASKKWFIYETPGI
FT                   CKFDPKKRLSDCNLIPSALLRFKVDPVEDCEAQNSFLSDDSIAKYFVKS"
FT   CDS_pept        complement(147641..148270)
FT                   /locus_tag="PKH_140300"
FT                   /product="small heat shock protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140300"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140300"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KPF9"
FT                   /protein_id="CAQ41815.1"
FT                   /translation="MVMNDITKSDTHERKDEVTMDKGGMFNNFFECMNEQMKRIDRYHE
FT                   DMSRMMNSMRTHYFSDELSKYFPSRRSLLDYDLGDARRNDLFFGKPQFLMDRFKNVPPM
FT                   DVVDKDKEIEIKIDVPGLSKDNVQINLYNRNLEVSGDFKKTEETRDDEQRYYVKERSQT
FT                   SFYRSFQLPENVCEDNIKATFKDGVLKIDIPKKDVLPEKKKKIEIQ"
FT   CDS_pept        150657..153968
FT                   /locus_tag="PKH_140310"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140310"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140310"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHP4"
FT                   /protein_id="CAQ41816.1"
FT                   /translation="MNSTFWLWLKWALLLVCTLTSDGTKINFKRKKILFPSFTQNGWRR
FT                   TGRENHFASHTFVRRRKDAFRLLKKIDIPLKLSQGDNIGEENGSLNCLKELIESVLHKK
FT                   YEYKNSSKEPIFTISHLASHFMNNSVNLQNVQIDEQDRDKYTYEKNRIGDFLTEHNIQV
FT                   GKNLGELSQVDTNVPPSKEQSSGSINGDNIHQSQNDDNKNYLSDENKILCLTAKNKIKK
FT                   EGVICSIPSSNIIHFDYIMKQIRKYVDLFSSTYNVNYIKYIFKNNMEDEIKELHPLTIL
FT                   LYDIYKRHVHFLSFMKSPFIFLKFWDVKLTLVIMYVHFLSKYVTILLHAYNFNNTFFVF
FT                   LGNYLAKREKPNGIMRKNSTGSEEERYDKPSENQCGKPSDTPKDSLLCNANTEEKLSKP
FT                   PHTHIDQTNFALTQKTNDILKEKTNFFFYKNYEHYINYIVNKKRLSHLPLLFSDSSFLL
FT                   FNNMNMKNIIYFRRQMLHEILNLLKSEEHEDSNFLLIHKNAIRKILFTNNKYYQRIREF
FT                   LPYLDNFPWEEKRENRHDISPNHTADINRLYHFALLVGESNENGPDSCPKGPDSRPDGQ
FT                   CNHTSGGAMFGAPSESLRDTIQSITYTESLFESLDNFVNYNFLMRIYSYVSSHAIRVKG
FT                   KVPLNWQHSSEGEKNINQIKHINKIKEGENNPSHSENYELNDKILSSNVKMEKVEKAIH
FT                   ELTVEECAKHDFNQYEKAEKEEENKYMCLIPIIDICNHSNFSNNCIIKKEMKKRAEVES
FT                   HIKGNLKMDSHSRDDANETNEMKDILKEAHIKYNPKEAHDREEDLPISNLDHVQLVSSK
FT                   DIDRGEEITISYGNLSNDLLLLEYGFVDKQNTKVYFHFDVKIVREIIIQILGFDKLPLT
FT                   MLESLPQVKVDLFKKLHVIQNNANLYERFDVNNMESAKITRKKKEILKDYVRKNKYFNE
FT                   YNIFTMKDRINKFYIEEKLQHSQKKNYLYIGTEFIVDPILLATIRVIIYDDLNHLAKVK
FT                   VTDLVKWEYHLSPLSEIVVLQILIKLIDEIIYEQFYHINYEEILKKGKVPYSDLKFLQN
FT                   KFLQKDLFNSEKSIDVSHSSNFKIVIYNIMKLKELQNARSKLTEKLKQMKGLIKV"
FT   CDS_pept        join(154464..154685,154840..155019,155160..155362,
FT                   155630..155726,155857..155941,156056..156096)
FT                   /locus_tag="PKH_140320"
FT                   /product="cyclin 4, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140320"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140320"
FT                   /db_xref="GOA:A0A384LDU3"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LDU3"
FT                   /protein_id="CAQ41817.1"
FT                   /translation="MINDIILIDREHIKTPSEEKNVSKDDETKLRIYGCQLIQEAGIIL
FT                   KRKAVTLATAQVLFHRFYFKKSLTDFDVKLIAPASLYLACKLEEDFCRVYKIISAFYFL
FT                   YKYEDLKSKHYYFNVKNVKLQHFRIDAESMEYKNMKVEVFTYEVLILKEMGFLVHKINQ
FT                   HPHLFLLPYVHSLFNNLNKFDENLTKKLAQYSWGFLNDSMRTTLCCEYQPRCIAVASIF
FT                   LAAHKLNIPLIRSTNWFALFDVAYEDIRKICIKILQLYKIGRCHYIDVLKKEK"
FT   CDS_pept        complement(join(159193..159294,159428..159490,
FT                   159651..159683,159844..159925,160120..163286))
FT                   /locus_tag="PKH_140330"
FT                   /product="phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140330"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140330"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBK9"
FT                   /protein_id="CAQ41818.1"
FT                   /translation="MKNLTHKHKKEGENIILKIEKNAIIEKKEYQVIPKYFLLNDDKNK
FT                   NVYCLLKKKNSTKSEKELMNGEKEKKLLIKRQGESENYDGILSSVPNHNNSDVCKLGSP
FT                   SSFPSCYYVCEEKNVVHSTPNIKTVEKIENENTDFRKESFLRLLRNSSKKILCSAEKVK
FT                   IFKNLFLKIKRKDENFFCDSKGGVDSTLENGVTDECTPPGVCMICPRGEEEGEENEKEH
FT                   TRGGNKTFTISCTVKLKGKGISTDIRNGEGFSEKSPQNNRMRKEENDLKSNSEMLTNEK
FT                   EEHEYIFDNSLKDRMKERYPVKYEDGSKSKIFLEKFLKEKKNRMNNALPLNIARDRIFE
FT                   PKEITKLSRLKRASGMISYADNFPKQVLQPSGDSATLEYCASDMNIKKCAIMGYGRNIS
FT                   LEDKTEVAPIRRNEEQSGNVIRKKDSNFIMCKSSMKAVKMGKKNTKGLHISSNNKKIIA
FT                   PFVCGKTKEGKKEIAVMVESGENGWKDHTDWDEYSLSQIMQYNEKCEIGVEQRQGRNHV
FT                   KEDSAQETQMWKTWALCVQQNKNDDAQEVAAKPNVSNEENQSKVRRSIKDVGELQKSDK
FT                   VSIEQKNYGHQPDPVCKDVIDKMRKEGGSTFHVLCEENGKTNGEKEQPGGGKNLKVNPM
FT                   QTCSQNTSIITDTVSSPHNRKEEKCRRKKFFFFQKNKVRIKNFINKNEIFNLSRKEENR
FT                   NMKMEKVNKRVNHASEEISPHSFSTSNNSMSKLGGIQVVRSVSHAYNSSGLNRRIADRK
FT                   IKVEEEVFSSYPVEVGDTKREFEDHTLMDERRIATVEIVSTDTDVLKRVCIGNQLDGSL
FT                   KHGVNVMTENDNLNSCEDDLLENGRAHEDIQICENCSNTGCSNSYTNEDNEGEKCSYNI
FT                   SYHKQKLLMDDLITSVSKEKNYENPYRQKKKMLEEKKEKKNTDKTSEQKCEDTKMERKI
FT                   NGLKRKKKKFRSYFKKFRSFFFFQHRKRTSTLTSITAENESNKVIRKKKFHLKRKKKIK
FT                   KLKSLRLLNMYSSKKMMDKRKNERRADNHCENYQTRGFLLGEQREKERVSCVGVGKMSI
FT                   FYIIAPPLKTIVLDLDETLVHSTLRGEKYNSFRIHIELGDGRCVIYHFFKEISKHYEVV
FT                   IFTASLPKYANAVIDKLDKDNICAYRLFRESCTFWYAHLIS"
FT   CDS_pept        join(166919..166989,167464..167550,167749..167920,
FT                   168097..168147)
FT                   /locus_tag="PKH_140340"
FT                   /product="DNA-directed RNA polymerase 2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140340"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140340"
FT                   /db_xref="GOA:A0A384KHM4"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR037685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHM4"
FT                   /protein_id="CAQ41819.1"
FT                   /translation="MSVPTLSNKPENIDLLVLPPGEKKVSCEISEKGDCNIFTIKLEDH
FT                   TIGNLIKQALCQDPQVTFAAYRQPHPLQNTIEITIKPKGYAGVKLLSDNVNSLLSDVSQ
FT                   LRETFKKKVQRYKDKSVYYADE"
FT   CDS_pept        169476..173627
FT                   /locus_tag="PKH_140350"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140350"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140350"
FT                   /db_xref="InterPro:IPR022100"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KMV6"
FT                   /protein_id="CAQ41820.1"
FT                   /translation="MKDLFFADINSAHLLRHYDNKLLLVSGNKIKFYTYEEIKKVVRAQ
FT                   NIAIYGIDYINKNEKIVHISNNVKLKCPIRISEARFVATDIHSFNKDKSVATEEKRDHT
FT                   DQVGNAPAEITTSQNSHVGDPHNGDSCNGTSYSDNLPNGDATTTGESHSENNALGEKNT
FT                   LTLKHDNRGNTSPPDGINHVCIAFEHGNVCIFSEDEAKKEFIYEKLIYRKVCDIVKIEI
FT                   FSIDNNLKCLILYRDYTLILYQDRYLSSVKLPTHEYAYNFCLSTNYQNIAVFNHISMYI
FT                   YDISKKNLCTEGEGAANAEGGTHESIGNSGNIDDNGDKGDSGGNGGGVASNNCVEVKNI
FT                   FELSKNYKNILSCDWHPKNHCISLCGKKAVRYLTIYNYKVYEFSGAEIHESFINASKFI
FT                   TISDNVILLTTLSCADYLFCVWEFELEYCLYKFKSDYLISHFDLSYFNDHLHMSMLAQE
FT                   KHLANVKLLGKKILQKIEWNDSEKETSSAGDEYQNDGSNLEHSATGKPIHEKKNINNLS
FT                   DILKDNNNYNMEKKKKSSMKSTSTFLNERNKMSSDLPTESNDKRRNSDSYSGDMHNYLN
FT                   NVKKRKKKIFTDDDEEIKDTFINRSHKKIARNRHGDAQNKREDKQDEDYHDTKTDKDSD
FT                   DQYNSEENEKHISHKKKKYKNQDEEDNEYNPKQYNLQDFINKNRDVIRNSSKGGRNDDL
FT                   HFEDSNYLFDNEDDQKSVIGFNTYVKDKFDQLRELKKQVDLLEKQISGYTKINHDDFIV
FT                   LCPGLCEEPENINDQWCMFWNDIGHITKKKEGNKTYIYVYLFRGEDVGKKKITDIYNVT
FT                   AASLSAYGFALASNPYEKSLSKINSILCFHNLRDNVIWNKYLPKDEFIKGVANGNNFVA
FT                   IVTSSNFLRVYSTYGYIISTFLLKGLPVAICAYDYLLFVITCQYIFEGVSTYNINNTYN
FT                   CTLYKINENFTNLKSNKYNTYHITILYDDVLSLPSCHYLNWINMSNFGIPYVRDTSNFI
FT                   YGLYPLFKSNTNHIVYDWVPVFDFNNLNKVEPIEGRATGQNSKHNLGNRKGSNERPHTH
FT                   GQEDADDIVQNEQDVNDDNPDDDLTYSECTYYPLYFDNFEQISVIKLRKNEVEPRSNKI
FT                   ESCLGYNVEKKYILSNECNLIKYERFVKLIQTNPNLSLDNDSNNSEFTSLPWEQYDELR
FT                   SRVDLFCKQLFANIHYDYMNDGKNKSAADTLKSLNKLYDKWIMRMFAILKNDKKNQKLA
FT                   VKTSRLFKNIKNMMLSISLVDDEYSTLHSEITNEYLKRQIKDESYKNYEENLHYDEDYK
FT                   DDEQKRKEIYEKCYNNSQHMSEDEKKNLPDVKPTNQQYINVAKTQIEHKDKKESGFLDK
FT                   FFTGVTKNQCVDNLFSQEKKTTQIKKKNTLESFFSELKEN"
FT   CDS_pept        complement(174617..175873)
FT                   /locus_tag="PKH_140360"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140360"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140360"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LI33"
FT                   /protein_id="CAQ41821.1"
FT                   /translation="MRFLLITFKVVLIFLIELMKNHDKTFLSICGAKQIVEKDFHQKGG
FT                   KRIFHFLTPQSSFKQGSKLFMTKKFKYKYKNSLERRIRKGRIRNEINQKLKKKNSAYIM
FT                   ITEKLSKLDPEQKYFKYDKNILKEYENIKNIYKNKKLGRKFNQFDYWYSSRKKEAKYNY
FT                   SRHVNFTITENKFNFKNVFSYFHILEVVHEKFKNNAFYINGLQSFINKYYDPVTGKRIK
FT                   YYDKIREQLELKKKNGGPKDEVACDKEGASVDGVSEEKVKSNYVPTSSGSSEEEVKKNQ
FT                   CYQEGTVKNKDKMECIKKEREKDTCTSKKEFFQMIEKNLREFEYSNEVSEDGSFKLFGS
FT                   PTSCLLKKNGPVAYDIRNLFMKSKMSSKRRRFKERKLFDIINFKCKNRRERLMQTAVRK
FT                   LAKRKMKDEKYILDPMEPA"
FT   CDS_pept        177228..178232
FT                   /locus_tag="PKH_140370"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140370"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140370"
FT                   /db_xref="GOA:A0A384KD72"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KD72"
FT                   /protein_id="CAQ41822.1"
FT                   /translation="MTHRYYFYTKEITHIFWGNLPCKLNRRFMSIQGSLLHNPIGSISR
FT                   FRIKHTCANQNESEERQKCPSSEQFATRTFMYPKREKGSTNNTDEYRRKSCIVGSTSEL
FT                   SLRGNLFICQDKKFFSGRSGGLKRRKKRKDERVINTCAGKRLEFFYPKKKRRQRIGLIQ
FT                   NSRKNIVYDNVLKRFLVYYYKQGIQVFRSFSCKKKRNFESARNKAIILSKQYNKKYSKQ
FT                   IDRENGTNKTPLNINDSNLSTKYDQNVTRNVKIVPDKNKSGYRGVFYDSTEHAYICVYN
FT                   EAGIRKFQIFKIQNNDYLEAYNLAVMCRRYKLFKNFQFVSQRNRIRSGRIHLK"
FT   CDS_pept        complement(join(178790..178957,179123..189256))
FT                   /locus_tag="PKH_140380"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140380"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140380"
FT                   /db_xref="GOA:A0A384KI05"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033173"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KI05"
FT                   /protein_id="CAQ41823.1"
FT                   /translation="MDSESENEQGKERAKEEVNNMKEVQEFVFFKKGKVKREHIELVKS
FT                   NIEDILNGDNEGLFGLLNLLFFMKDANYVKNNLCICLHQLSRALNEINVEDVKKKVFKY
FT                   IVKKLECGKYSYFDRALFCKKFLSFCSAYEDISSELRNVECFHDLFVNCLSFLDSLFYS
FT                   NDKLSELSHKFRMVKKGAIKKLMVIFSNICNINKNEKGEKKEWKKATDMMGGEELDYIL
FT                   NMYAKEKYFFYLIVESFGLFLCKNSEKNILDRKKYVDRFTNNFINLLNSNKEILLKINR
FT                   SFKYIFQNGKDDKIFQSILNHIHRYDEVALINSSPFYYYCEIYTKEHFYTLLEIIINMK
FT                   KNKDVKNCNILYFILFYKFHINNENDSVLKMLIERNEKLNIVKFDEKITFLKTATYLLS
FT                   TNRSKEIKDIVLANRNMITNYLKKDLNEDVKLECLIFLRNFGSILKNDKDVYKTFSPLV
FT                   LEILEKYGKNNDKFLHYCLLFFIDLVDSIEVNEKLISTFKAHLNFCLTKQILKYIYGTN
FT                   LFLLLYIKNKHSSSGVTINNHINEILLKSLYNQSELFYLYDIIELKKIPPNKFFFYVYS
FT                   FVLLLHFLLQEDKKTLSDYVNEMMKDFPTFIYFDQLAKSHVLPVLLGEKNTKAEEEKKK
FT                   KAPAIALHESKKELMKKDNPKNKRDHMHMLMLMTVLCLLHYLEGKKFDKNEYRKKNEKK
FT                   FHTYLLSLKRGGIINEENCEYQSYVDDFDMLLDILLMQKEVYQVLLHSFYVYLYLYWNS
FT                   GPRFRYDNGYVLRRFVFILLSYMDKIELEPTEKNSCYFLLLLCLCHPCIFYKNLRSSVS
FT                   RRRMKKYICGRILSHVNLDTVIAFILKGSDYYNNELHKSVCLHLIEVFYIWEISPSWEK
FT                   RHVTEGGEVEEENVSILTNRTDSAIVGDTLDKEKGKKKYKRVKFAFGDESNCEKNYSEM
FT                   MNGDDGRNLVRLHDHEVKRKLTDFTSKLIDMLDDSSIQNVKEEEIEICKCPFNSLYVDK
FT                   NVYQPTVVVESKNVKRNKHLFSMYDEETAEMIMKEELNKSKKTTANSSTSPTKDKKGNK
FT                   SKELTKEDLEMEEIKKQNEIRIKVQGIVERNKYILQCIKKMSYIDDIYDTKYINLFIKK
FT                   IMAFLKNDLTSRYSQAYLNKIIQNMISTKLLTCKNKITRCLYKISKYNKADESAIIIFS
FT                   SFNMNQKISYVLTLFLFPIVLHSINIINDKDATLNIMKTLEILLHSKTKINDEDALKCL
FT                   QISFEKYPDLDIELESFLDNFNSYLLSEKNVKALLELCVTDNEKRRNVIIKSLYKFVKN
FT                   EDIKGDKDSLDTIFKSEFIHLHMNIFLNDYNEETQECCEEIIRTLGIAPVSDQYKLIDL
FT                   LQKECSDFQNMICKAIVGSTDRKKTKELLLQLTSKYITFKEYGKIGILKTMEELAKEYY
FT                   VILIDDVEFILNFLLGLCLEEKKDISKIKEFVITCGSSVINLYNEYLIKSKRKATKKKA
FT                   NRKGPKSGTSKNGKGKKKFSSGKHQLEESEEESYSEEDEDFKYYSSDGSASSTEVSKRG
FT                   NSKKENKELEEAFQRIYKVLNKYRDNKKSNNKSVVDLVVVMFYGCLGANLKKESLELLN
FT                   KLIEQILHKDTDNFTQIEISGIIPKFIENLKSDKEDFDDEYEEEELEEFDQMNPNMAKS
FT                   VTSRMSNSNKKKTVTFYIDGKLHSSPKGAKGGGGTVAMADDKKGGNVVAPGEGKENESE
FT                   TQPAGGKKGKKKNKGDKGNNKGSSSSSNTLTCSAQTDGLIYLENYDVGILVEKIFSIVQ
FT                   SHKDLKVRKGCCLLLGSVVKAHGMHILKRFNILGKVNCNIYSEDIIKRQSFYLMYGYLF
FT                   KVLKIKFEPYILKNFKLLLECYKDNVNNIKVLGVSVIEEILNVLGQYGLKKILPFIIFS
FT                   LKNSSIRNKDVVSYLDTLHLIICKFDIICYVDNPTLVNLVNLLCELVSETNSKVREICI
FT                   RIFNKLEKMIQNVEMKNISRQLLLCIYSPNDNHLCDFLDIFSAISFQYKIDNISLCLLF
FT                   PVIKKGINNIRLDLKKKALQILYFLIYLVNDQSLFIIYYDSIFKILIVLLNDAIPEIRF
FT                   LTAKSVGNICYFLDMNKKLYYIQYIFNILINTESSVEKSGVSLCLSSILAKCSETIAEN
FT                   FISTVVRLIDVKKYIEMKNRHGKRAKQIEDKVIKGGRKGGSGKGSKSVAKGKVAIEFSS
FT                   EGEEDDDDEDGVQFVDSDMEEGAYSTGEAEEDYDDDEDDEDDDDDEEEDDDEEGDHEDQ
FT                   SSGDEIYTLSDESEDEDFEADEEGTSSKGGRYYEEEEEDDDDDDDDETEEEDDSLTEEE
FT                   SDSDDDVLSKNSEKKSTYLNGLYLIEKNEDNDYRIQIDDDLANWNLVYDKKIIKNDNSK
FT                   EGLIGFFIYIPECAPRYTEKFLKKILQKLLLCLNDTSEKIRDIALRSCKVLISIFSRDN
FT                   TSLILKFIENKIYNSYWRIRKDTVLLLNVLIEKNIEINKEEKDIETLNLLHERFYFMLS
FT                   LICIMRNDKNINVRQTAYSIYKNYVNKRILQEMWPILLKKITQNLSSRSTSKQIISASA
FT                   LSDLVFKTDSNNLESILENMVNEFKTTKCTSIRKGISLGFCEIFSQNKYHNFVVTHVHN
FT                   IIYMIKELANQKNTGDLIKSLSLLLKNIDQVVLKGIINDFVTDVMIASENRNSLKKFTS
FT                   KQYISFKSIKIFLNVHTELVIDIIVDKALVPPYSAAKMKLLSYVSYAKLSNYTVLFRKL
FT                   MHIFINLILGGLREFRSHGFDMKNYSAVVSYSMDDNAQEGGVNEVVSKEELKMGKSDEE
FT                   EEVDDEEEEDDDEDDDEDEEDEEEDNGAFQTDMKIQDIIISLKSFLKNISDRNVDTLTE
FT                   ILFAELRKNDGEADLSYGGLEKLEDEEKRPNGNKAQGQSTDLSCMHNYAKICSAGKLAE
FT                   LKKFESTKRSGKVREIILSIFKYMLDIINEGDICVLNNECLAAHSSNATEPSSSRNKGK
FT                   IQRKKRVHILHSDRIITYLSKISKYALIDINKKVLEIGSIIYMYLIELIKMLDSNYCYV
FT                   ETVQDVINKYSSDSNLAQVPDGKYEIVGLNMNKKLFASLVGMCTHVILMSTNPNVKIKA
FT                   IDIVRMIFLYTNKEVSSPQILKVSGILIRVLTNKYIEQAKIYIFSTFEVLIRKGSNFIR
FT                   PLIPQLQTCIIKSLSNEKLKNQIIHILNIISEKKLSRVDLLINDLLNNINIQTNPQQSI
FT                   TIFMILSNILSSPDVNIKNILNKIINSVKSNLVHSNLNISFYACKIYVLLIFFHLPNKK
FT                   QYLESILVPEKERVDFSTYYFVLHISEISNFYDILKRENMMECFKQVYENILKDEINSL
FT                   QNVSYQIFYNMSKQDEECISFVYGLLPYLKLPPMTVISVEIHRYYFKGLRNIFKKYPGI
FT                   YKENEPIFLLILDNLQLALSNTVQVFKSLGERCAKHVLEINDEPQHKAKMNFLKDHMEG
FT                   TKYNLLLEQVNRLLAKKHNIKSDSE"
FT   CDS_pept        complement(join(191501..191766,191976..193650))
FT                   /locus_tag="PKH_140390"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140390"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140390"
FT                   /db_xref="InterPro:IPR007946"
FT                   /db_xref="InterPro:IPR033647"
FT                   /db_xref="InterPro:IPR033648"
FT                   /db_xref="InterPro:IPR038514"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBL5"
FT                   /protein_id="CAQ41824.1"
FT                   /translation="MNLLGGKDDEENAVFADNDGCSLVLIMGDNKDRKDTRKKEYPSEK
FT                   EYSSKNAYSGKKEYTSKNAYTGKKEYTEENVYPGENAYTGCKANQGEANKNDENVVECG
FT                   KSRKNEERVITGMIKILEEMKESDDTSDAVNPGINPDGHQQSAEYATQVQNGDEVKRNT
FT                   YPRKDDTKLHVGLDYSTFYLDTPYKIIKCMNKGSHFLFWGSDTLCGQSDQVTKEFKMNE
FT                   MKKNNSEELRNSRFIFFDRKKKLLVLKYNIRSNSFNYISESDPIYMYFHQLHEKKFLDD
FT                   NIIKEKKNSILIYPYTYVKIWESLTCYINEEVINKIEPVNKTFCSSFLEAKEEEEEKKK
FT                   KKKKVGADLLREEEMNLCNQPYMFYSVIPRYPSSKTYPNEGRVSGGSRRKKEDNLGVNS
FT                   TEIEGAGGINMEDHSVGGVNVEGGHLTCSDVSVGVHEVVSDEPLNFHLDSANESYFERI
FT                   DVDSKHKKYVPSDLTIIHLEKYWILKEIIQQEYTYVYYENEKKEGFHKFENKLFYILGE
FT                   FQFAYILFHLGFNYQSFVQWRKLFELLSNSQHLVTNFPGEGDFFEEALRVISIHLSYLS
FT                   DDFFDNTENSFILFGVYNIYEIVSGVGEVHEGITNVMNSIDSIIYAKLGLHLPDLSFVY
FT                   EEYQPTYVDDD"
FT   CDS_pept        join(194503..195881,196107..196324,196354..196466)
FT                   /locus_tag="PKH_140400"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140400"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140400"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBL6"
FT                   /protein_id="CAQ41825.1"
FT                   /translation="MYECIDFEALKEEVRRERLEGKKTNDVDADARREPKREEGGLLKW
FT                   LMRGFKGRLMNGLKSQQKNELKNQMKSESKRELTKAPPQNCSAKEPRSSPKEGIENMSP
FT                   KMAIKAINPTHLYNYFQLLLDEGNDKCLFLVDLQTEEEFQMYQIKNAVHIRNEYLMDRM
FT                   KKEIELKKDAKVVFYHANEEVQKNSRYGRLVYSHFANVKANFYLLRGGYENFEKEYFFL
FT                   CINKNRLNTNLSSIQNCEAYISYPIKFCSNLFIGTPIHMINPSLSNHLNIKYVYDFTDS
FT                   GYEMKIVEGIEYSRYNVTDRTVRNSNACKGQCVKYENILDIRMMYDIIQSILQNVDLNE
FT                   NICTVESNILSGNADKQKDIVKGTHHMEKSSATADRRHSQKKAMLNISNKQNMQNGNIL
FT                   IMCNHGMKNRRREKINSISLVIAMCYLMYTRRYDPNLIIASVLRINNNFNITAQTMNFL
FT                   YKGKILKTTTLRSTTLINTLCQQIDYVYFEICTSCTQLTKEETHISYENILQSFLFQMH
FT                   NNHINMFVMKIMKSISAKIMDERKVQVCSFGKLPLHFTNILRSFLIIYNHFW"
FT   CDS_pept        complement(join(197123..197330,197490..198274))
FT                   /locus_tag="PKH_140410"
FT                   /product="peptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140410"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140410"
FT                   /db_xref="GOA:A0A384LQ77"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LQ77"
FT                   /protein_id="CAQ41826.1"
FT                   /translation="MDPKNNMFFCSNTRMENRRLGSNYLYMWREKSYDYEKHPDVLSFI
FT                   LSMVPLLIVIVVHLLINTNGYYIGNLFLMITYLFSFFFFILYYYNSYAVFVLFVFFSFF
FT                   ISLCLHEFAHALVAYKYGDITMVYKGYLYLDIVNYLDIFHTLVIPLVTLLTTGFGLPGN
FT                   LYWLQLHFIRSRFQMSFIYLSGPISDILCILVIVFFYNFYSYFKNSKNLSAQPHSILLI
FT                   SLATAASVLVDSFLLNICPIFGFDGWGILEPYLPYCLNTLINEEIVNTYLSYICPLLVF
FT                   IYFNFIETKYLFFTRIVNFILGRILGIEISHVTIGVNAFPTLFAYLRNV"
FT   CDS_pept        200702..201292
FT                   /locus_tag="PKH_140420"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140420"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHG2"
FT                   /protein_id="CAQ41827.1"
FT                   /translation="MPHHLTSFVAALTGSISSGTCCGCIPFSLSPAVTPAVASSTAPLS
FT                   AAVPNTAIPAAVASQGAVSSSPVLTSAMAFFAPFLAFYKKYNIFEETKEHAKEKVDKMC
FT                   QCNLVTSEELYYHSQHIPNEEEYLDGKNNYKNVVDDPESNTSDDETTRKCNLNREEIIK
FT                   EEFESLSQDKSLPSSACSIHSFLEEPEEELFKN"
FT   CDS_pept        202047..202889
FT                   /locus_tag="PKH_140430"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140430"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KRK9"
FT                   /protein_id="CAQ41828.1"
FT                   /translation="MSKLENQIKQIESNIIIKEKKIQDLEREIQELKNYSKGLYEKLIN
FT                   QQEVLLKRKKQNVLTDIKINRLKKDMIELCKAIHNANRKITNAFAELKKKKFLIKENTQ
FT                   CMEEIYNDVIKKNVMHNEQNNTTLTILNHFFIKKGYHNDDLKLLLKDKKEKIRIVKNQI
FT                   KEMNNNITTKRLNIALLDSRLIANLHTIKSYIKELIQMGAFQKININKKNIRRNCLHII
FT                   NNVIDKQESTEKNILDPHTDDNQMETADNNVSTENREEEKLELQLNTQEFIQLENFLL"
FT   CDS_pept        complement(join(204642..205456,205796..206483))
FT                   /locus_tag="PKH_140440"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140440"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHT3"
FT                   /protein_id="CAQ41829.1"
FT                   /translation="MKYQEKDEHERRHQNDDRDYGSMRKIFRNSYKKILWPLNLGIHDV
FT                   EDKNLKKCLCLIVTNIPVDWTKLDITWFFREYFYKLAIDRNIEFPLIEQVYLIKNEPSA
FT                   ILACHDSVSRQTIENLSNCTLRSVKNKKKITLNIQPYYKEEVAEREKGKDKNREGKNES
FT                   DNEGNRESNPEEKEDKNEDEEGNGEYTQGESEGTEEGRRKSEKEMPSDDEGKKINRMRK
FT                   RSVTPPRKNGMEWPKDLELRNCSDIELRRKLCVFGRYKPLHWGVKELTTFLKYYFDTLK
FT                   RDHEKFEIPEISYIWADKGTHLVTFACKNEKSRFNMLLVRACYLNEDDAKNNIKNALRV
FT                   WIQFEKWTPYKNPPNGKYKNYKMPRSDFNKYSYQHDHNIDKGSYTRSYRNPPYDDYPKH
FT                   RNGSYRYNGNGHRKITPPSNYYHNNADDRGRRNYDHGKNSYGNRSPSPPPPSHYNKYKK
FT                   KYSRSPTPRNYYKKKLKRSRSHDTRKEEINSHGRKNKSKAYH"
FT   CDS_pept        209206..212979
FT                   /locus_tag="PKH_140450"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140450"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140450"
FT                   /db_xref="GOA:A0A384LHP9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHP9"
FT                   /protein_id="CAQ41830.1"
FT                   /translation="MDAPPEMDLFPLKGNIEQGNHPPCLKKKNSKIISYLKNESKINVL
FT                   LSKVKEKNGVNFLKNNQCGKFSLKEDKRKEVILCNHLSNLSYTQTSEKGINEKKGEIYM
FT                   YRKYASEHDNTPMSSPPGKKKRTKKSTLLHRLVTLPSGVQTQKADAQLNRYTGEVKKND
FT                   VTSEGGKIITHEYKFCKMKAKKYSTLKYNIFVKGLKNVDNGTEERNTSFPREEPAMISN
FT                   KVNCRKIQHAERSAKFNCDDLLQIYEHRYLRHIFRNSKNVPSHKEIKQIYNTDYVQSQN
FT                   RYNSKEQQLTNGKNYNNLDKSETGINDHHNSNHILYPSDGKYGKDTILKRNINDEITTP
FT                   GDCTHSRYSSCHSNGVNNAQVKSNTADDPINQIGSGPVKNDNAIMLSEKNTPISYVDME
FT                   DPHRSDNLEGEKIPNDGESDFKQMGNSCENNTEKENKNILNYSNVYKPSDEEASPIEPP
FT                   QNGKHKKNETLTSTNSVTGESLVAPPTVNKPEQTVNFREEEENPTCLLPNTLQPKKEER
FT                   EKVACAPKATEKLIKNILIEELKNEIYYSIIKMEDEKVSSEYEHRKSRKGRTYKLGGIN
FT                   RFETPRGGSHLSASCPPSFIPDTCSSDKNKTIDMKNIPEVETIVEKSPETDNKVQHKDI
FT                   QKKILKQEGNQNPPSGSKKKRENEEKMGKKNCTDLKKVNVNRSEKQVSLCKGDTNNGHV
FT                   KNEEKHKLRNVPKNTKNVSTPKLVIHKIDKKNSKEYFSIKIENKPNTVKKFTLEKTSKE
FT                   GKSNREKKKVHSGNIGLPQSLPPEGEQKSTVKQRTDERCSGAKGSSSTEGESKCPPNCE
FT                   STQPPNCPPNDPNSALTWTTWRVRLFPLFRIEENRIYADKKSRAYTTLTDHINDIICKT
FT                   FKTQKRFLIFHIILYSVNLLIFYALLQRDFLLNQDSSSNTKGTLCIFYILIAELYILLL
FT                   NNAFYFFFKNQIKNVIFSLDRVNLIHIMSKLFPQYSSFFKKQFSMHEKNGNSFYKELES
FT                   YQSGILKEKALSSGEHSTNQCNNWPIKKKHSVRFADYDILDQLKNGHYNVTSAENDYAR
FT                   YASHNGEDSTTKNALPMNGENLFLSQTMKGTLIHSLFNASNTTSYGTYSKQAQPHNSLT
FT                   GQGNYRNSLEQTGQNDKIKYFAPGETHTNKSTENEQITNLTLFILNEQKKNIPNQFFFF
FT                   KLREYFNLLIILFASLLIHTTIFLEIKDPFHFHVKTNLFFFIFVSFIIFLQVLISIMAE
FT                   IEEIFIQKIKMLLNKRVTFLDYQLVMYLGLKH"
FT   CDS_pept        214077..214490
FT                   /locus_tag="PKH_140460"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140460"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140460"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L7G1"
FT                   /protein_id="CAQ41831.1"
FT                   /translation="MYMPFFNILTKNALFFKTPFGGKNRKLCNFAKCTISTNSITEKVD
FT                   PRQNKQLKLEQIGRLNNVILSVQAEEALNKSASLSIYRLPNNSSFMLTGDVREEDNFRK
FT                   VLYFKWKARKSYKKRVMNLPSTKSRRRYAQKNR"
FT   CDS_pept        complement(215463..216893)
FT                   /locus_tag="PKH_140470"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140470"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140470"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LKK6"
FT                   /protein_id="CAQ41832.1"
FT                   /translation="MKLLVILFCLVIFFFEENIGVKIYTNDSAIFDINKVLKSRLSVLY
FT                   RKGNKLNNYFFSYIEKNGKKNKCYKYIQDALYDPNTQIMKREVFKCLNTSRDILSKTFH
FT                   DVINKLFLYIKNVFIKKYFIFFLLYLININCESLVSQINDPYVLNNYNLSENASPALYN
FT                   LKYEEVEIPIGAKIKGWLIKSNKKSNKLFLLLHGYNSNRQACLFFLNILKKLNVHHDTN
FT                   IFIPDMKNFNEKGVEDIYNILIYFKDKMALNDVNVYTQSSTNLLVLLLSKHYKNKIVSK
FT                   SKQKFINNIIPYSSDKKNSQEDVIYIDKYIFDSPILNLHRTINIHFKLHDIQKKINEEK
FT                   MKANVDMNNLYDKKTVLSYFISFFMWLLNNQLKGHLYDFDFNKLVNENNINPANIYILH
FT                   SLNDNISLLNILSQEVKENRLLPLKNIYIFKNGRHGNIYESSKKEYDLIVKRIIKGFNI
FT                   FDFLYYIPMRSKMSSLSF"
FT   CDS_pept        join(219441..219650,219929..221431,221603..221810,
FT                   221982..222043,222167..222270,222391..222481,
FT                   222669..222746)
FT                   /locus_tag="PKH_140480"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140480"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140480"
FT                   /db_xref="GOA:A0A384KR05"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KR05"
FT                   /protein_id="CAQ41833.1"
FT                   /translation="MHHLSCLKLPIRHHFKSVIFHNHISKRKISDTCESKIITLTKSKD
FT                   YDHLKIYRSNIYNGLYENQILQGVKVHRVDSEGYGEIAIYSARQHLLFFLKFFLLIPEE
FT                   QVNLKVLDINKKKKKTIFQVLCKTRKSKYEIVPRCEYFSKCGGCIYQHIDYKFERKLKK
FT                   NLLISLCEKYNINVLASGKDYLQNDHYFCEEGEQNEEDMLEISQIKREYMSTDLEEEDD
FT                   DVETNNRSGNCTSRDLTPDQESCIPSQDDRGKHANYARLYDFLFSNDYHYRNKSSINLS
FT                   VTDNLSIGFYKRHSYEICDVDKCHIHDEHIQNVYEQVKKEILDNFKKNYIYVFNKINNS
FT                   GYLKGVDIKVSKNNAELQILISFIGFSLNDKAKKALTKISLNLASKNTSIKGIIYNVET
FT                   NKLKQNRNEVILYGQNCIYHSCGGYTYKLGANTFFQPNQYLNECIVQIILKLVKNYKIN
FT                   AKQACVYDLFCGIGFYSLPLSDLFGQVISVDYSIDNIKNLEENVKMNNVKNVKCFNLNL
FT                   FNLQSLRQINLHIRRYIVNLVKQKNYDVYYLLKEKLHSTYVSANSEGALVENLQVHSPY
FT                   STLPSFIYTQLNEWPSKEINGNVCSSSAKNGHTYYDNNVLQNEQHGNFPTEDSNKVDED
FT                   SYLSREFVIPIPDLVIINPPRKGCEKVFRRWLRGLCCRYIIYISCNANSQFRDINHLTN
FT                   LGYVVKEIIPLDTFPRTPHFETVALLEFDFNQKVDNEQKQIMEFELNEIKSNKKKKK"
FT   CDS_pept        complement(223270..224451)
FT                   /locus_tag="PKH_140490"
FT                   /product="26S proteasome regulatory subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140490"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140490"
FT                   /db_xref="GOA:A0A384LEU2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR035263"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LEU2"
FT                   /protein_id="CAQ41834.1"
FT                   /translation="MDNKESIKLYVKKVIEHREIESQVKNLRLDIKEQNKIYEKTEDNL
FT                   KALQSVGQIIGQVLKQLDDEKFIVKASSGPRYVVGCKSKIDKAKLTIGTRVSLDMTTLT
FT                   VMKKLPCEVDPLVFNMISDIDKSENSKNKVNYNQIGGLSEQIRQMREVVELPILNPFLF
FT                   KRVGIKTPKGVLLYGPPGTGKTLLARAMASNINCNFMRIVVSAIVDKYIGESARIIREM
FT                   FTYAKEHQPCIIFMDEIDAIGGRRFSQGTSADREIQRTLMELLNHLDGFEELGNVKIIM
FT                   ATNRPDVLDPALIRPGRLDRKIEIPLPNETARIEILKIHANKMTKLGDIDYESVCRLCD
FT                   GFNGADLRNVCTEAGMFAIRSMRDYVIEEDFYKAARKISEAKKLESKMEYEKI"
FT   CDS_pept        227826..239960
FT                   /locus_tag="PKH_140500"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140500"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140500"
FT                   /db_xref="GOA:A0A384KU18"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KU18"
FT                   /protein_id="CAQ41835.1"
FT                   /translation="MIGRLLSTFVITSIVRWINLSSQNDPKELHNLLDRNSLRIDIENK
FT                   EECSLKYDKMMTHFRHVYLVQCGGHAKTVRLNLGGESKKEDAHQSGDTIKKGGTQQIEE
FT                   PNEKYSAGKKSNVAFFNERGKKITKDNIILKLENNRKIIYKVCQMENPPQCIFIYVIIS
FT                   FKFDVMRLRELLLSNYTMEEKEGAKLNMLHRENVKVGNINEYLLQHFLLDSRKVIQFYE
FT                   ISANVTNDDHPLYLYASSHTSNFVYVDRNLRNLLKEENYQYETYFYKFRCSDNFQIFAA
FT                   TSDTSKENFFVYRLVITCNGGSEGRDVNEISNGGRRDFSSLFDVSFTDPTFIIPPFRMD
FT                   EFKYDVFTPDNNFWLRISSPNVCHPPSNITLNDKRVITEYNLITLNEHMDELFYDDCIE
FT                   QWKLLQKKSSVQEDKNCWDVKKRQDYLIFGNVHDGDASNCSRKCKTDLFAERIELENSS
FT                   WQNIFSSKRKIKFRNHEEINKVIFPTKRVFILKYTKEAQKKQSSVGAYTMNDKTKVIYF
FT                   FFYIHKIPANIIVNSFAFIAFLKNANCAPNNICHLENDGQPSYIQVVFKKRKNKRLSYF
FT                   STNLLLTQNNENFRHYIDKRDNLKLFINNENICDNIKYSIKEIGSTEERINIKIVDQNN
FT                   NILYNTDLIIIRKNVFYKFALQLLSYFSYAYIISCFCLHTATVLKSIQFVQILTLFNIK
FT                   YDALPPLYNYFLKKLNPLSFISHVFDVKVYRKSLVNQFAYDAQLLTWNSATDPHTTNGD
FT                   DNLEDGHIIKEKQFVQSERRHYYGGKLSQERDTGRGYFHGKANKMMESNIKGDNLQKDN
FT                   HYDIEEETLMNETPLEDYPPHSASKADAVAIKKKYHKKKSMTNQRNQKWEDEIMFLHTL
FT                   VSTLLNIIIILLLLTSLYFVYSKYIQRKVIAEIIPMPFFSRANFVPLIYDLFVFPVIFI
FT                   TTNIVVHDSGYHAKVYFLHIDIYVLKFVSIVLLFCYVLSYVLLSLHVVLSVKRSTTYSC
FT                   YLQRFIPLSISRIRGIVTKPLPFQFLFNDTNGIYLPSRLTLLRSAAQGKSYPSYAFTNQ
FT                   HVKGTGQIHKEEIHPFFFSLCPRRVSEAKRHVTNNTPLKRIIRSYVDKQRGKDRRIDLS
FT                   HHQPLLQDIELSVPGGKDTTKKGSRKHISSKRLFPKNVKSPNGIITPNGDQKGDTHDGN
FT                   NDGDLGHSCPERDTRNNPVKGRNIAKVFKNAFCILDRHISEHQLDGTPFDSDSSYPASE
FT                   KYQAQLSSLRENEPLSMGINKYICKSLGVQNQEHKVDHQIGASTQIKIHHKREDKKCNL
FT                   STLAENLPTICLTKCIKILHHFSALFNQSKYKISYAEAVKKDAWRNKLLRVTITRASLN
FT                   HSIHSSNGTNEKDPNLHFLTHDEDTHIGYLYDKVSLFKKTLFVKKAVKLKHVYFLLFQK
FT                   KEIQLFVNKDQICDDTLGIYSLLTNNCSNENASHFFCVRLITVICITTVNLSIRNDVLF
FT                   TLFSLSLFFFALFVYNFSSILKPWGGAESWEQLGEYQKEETCKDKKKATQPFTHDGKLS
FT                   SGKFYLGFDNVYDKNDQDDRNDSDNAKRDLSHFKFTQQDRYNEWMKKDMLTDETSYSEL
FT                   VLSVILFFLLLSNMFTKKGENSQLFSLLLSLLTTSLCVNIWKVKNAFHKIIIHANYYVA
FT                   TKWHSAYFKTYAMYFLHVVEQLCDNFIQWIVTIHCNNKDCDIPTGGDTTRKTGYANLFS
FT                   YFRNKIFPNYNGVTFKNLKVDKLKIHHQEKDIDYKYEALTLDDNCKNVFKSELRKNFYV
FT                   IGKMNFTKLQEGLSNVPVYIHNDSKKNRKYYICSIDVVDDENHNSRKSLSLYIKGKDKK
FT                   GKKIFLHSSRRGDLLWTSTVTRQRKPSLDYIPTYGKLPSEGRPIKGGKTDTPTNKATDS
FT                   HVPNTASSAKAPFGQQTGERIKVDKYSYTLLGKDGLTIRSLFIKPNKTYRIQPVFKEKH
FT                   LKCEHSKHGNKSKSPNLSLDNSARIANSYLQDLSDMETFPKLHKNWNSHIGCGKWEELS
FT                   NEGFRYSSSNSQSSGEDTHRNGNRTAKLSIAPHICSRKKGRKFKGDKGFRQFHVVCEDI
FT                   GTLIITHDINYVDTLGDIKVENEYGETFCLNSIQNCITFIKKKKIVILSHPCFYKNETY
FT                   YVYLRGGGQKFLSDYLTEGIYVQSSPNGEIILTSFSQNKKMYSLQTRNDQRNTDITDSE
FT                   GQNFSYKSRTLLDDQIHMYKITDHKKKKKFFFVKVHKQSNIFYAQSYLRRKCKNSLVFA
FT                   FMKQFFCSKYDNLQEEQPIDDFLEEINQTDFVPIQVLYKLKESTDVAAAKKLQNYFIEC
FT                   LNESPILCKGDDKYGEVTDVAYELLTTSEVGATRGKKKTYGGSSIVRCFEKNKNWFFPW
FT                   RKFHLLSGREDSTTRGIVRSISSHLTNGIFKKEQPKKHGGTIHTQDGRAHQNRNHSRRE
FT                   GLLHLCKRHLIRRKKTKGEILYRYAANYKDLIKTYNTHIKIYESKYNYVKHNKGNIKVL
FT                   ADILLELLSFPYILDVFQRYNILDKREGENFHHYGNNISFNIYSVYEKCSLNKKQTFCK
FT                   IVNYLEELATHKIMYIITFYKEKLNYLHLLDKMNMDVSVCNVQRNIDRMFYHRFRFSKR
FT                   GMGRTRDGWDHPTSRSIAISTHDSSSDRNGSRCLATNGNPTQGNGNTLKGAPNERIHEK
FT                   TLHEVILERYIKRRKSFGRKFYEIKKSIREIAEKYRQEEQGTKKILFHFPFFIHKKKII
FT                   KMKKNVEQQIYEWNACLTNFFSNFLNHSLTKTHICHYNLRILNKHILNSIKHSMFAKRK
FT                   NAKLHFSNVNFVHVVIPLSFLNPQKALLLSPTFFYMKYSLSKPIFVLCNQDDIGSFLGE
FT                   EGGRVHKERGDSPKWEESSYGGTSLLGEDELSGMEREEGDRKKTRREKSKRCNAPRRKK
FT                   NALPKETKIDLEKKKQKEHILLPCYLEIVNDHLLIYLFDNYDNKLCWKIERGNYSLETR
FT                   EMIDRNGEKEAKYATDERKKKGRCTTSNNGETVTQTLHPSEEGHSNYGTPDKVKSELVY
FT                   AVISTDENEDTAISSLIKKKEKTIPKYKRLEEKNESSQKGGNYLAEEKNCFVKCVRMFS
FT                   NFFRNLQDSWGRNLCLLCACYEGQENKLHNGNSDYIKLIVKINPAVIPKLSKAITINDH
FT                   AWEKLTEENKLLIQERIEEVCLDIKRVLPRGGGDPPEMDPNFVSSDEMLTRTKKDHRLY
FT                   SKYPNENVKMEEFALPDGVPPPDGKLSGEPPLSSTHVIEKEFANEEWHELQLYTFSFYK
FT                   NKLSELITNYTKSLGMETSNSSENRANAHHDVGLDIIEKRDSINEAWRYDHVGEETEKE
FT                   YDGRKEEERNISYLLKGIERMRSTTFIKKKFMEDSEKSTHKELIFYDKNQQLFCKYVGD
FT                   MKNKFYNGHGKLYDKFNSLIYDGQWLNGQKHGKGKLLFKYFNIWYLYEGQFSNDEIVDK
FT                   GIISLIDKEYVKRIQSDKINKLCPLLIKVNFGKYKWHKTVKGAMEESAQFEKELIKQIE
FT                   KTVMQNYTSNNNVDFWPKEITDIYFPYLRKWNIYSFYCSCNIENIKDKKEIFESNENNF
FT                   KNLIGYPSFELRNGKNDLYLDQRPGDDDGQADSEGTPGENYPKQTCREAEGKCDSPNQS
FT                   LPNNSSQEYIVHKRDKTNVLHQEFFEYMKKKNEPKLYYPLLSKTLGLAKIIYADKSEYI
FT                   GPVNSKGQPNTNEQFPQAIFNNEYFFYEGEMKNFLPHGYGIFKNKKDGKNTYLGFWKNG
FT                   HREGNGNLHLGNKKYIVQGNFIKDKLHSNVNIFIKDGKICKIYISSVSTNNQKIKVFFR
FT                   NGYIFYGHFSENYQRNGIGILIDNNNKILYHGYYKNDMIDKFCYILRHKDNTIYCGNLY
FT                   QGVKKGFGKLYYEEKLHFDDENEFNLSLSNAKILARKLESYDGIDINSEIPLNFSLDSN
FT                   HVIYVGYWDENHFSHFGSCNLRNGIYKGEIKDSKKDGFGIYIYKNKKSYKNKNRYVLSY
FT                   FKKDKISSMGKYYNEYDKLKVHSFHKEQIKRKKSAYDKCFTKGKIKYDILKTDKLYINQ
FT                   EIDYYITVPLSDTLSVIMDEVLDKSTSFVHYLYRPFRFDLNYFLKK"
FT   CDS_pept        complement(join(241008..241419,241690..242561))
FT                   /locus_tag="PKH_140510"
FT                   /product="vacuolar ATP synthase subunit h, putative"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140510"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140510"
FT                   /db_xref="GOA:B3LBM7"
FT                   /db_xref="InterPro:IPR004908"
FT                   /db_xref="InterPro:IPR011987"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR038497"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBM7"
FT                   /protein_id="CAQ41836.1"
FT                   /translation="MPCYDKYEEINILSSEDVELLKKFHAFNKKEKFDYFKENNTVVTV
FT                   LFNCLQTDFNVHLIQYVLTIFYEIIRNDGSSYSYILSILNDKGVYSYLMKLCTHNDTYI
FT                   ADKSSFLLSGSFCYNSNNNYFTETEIKDFILKIDFFNVSEEGKMDIYINILKIDNYRKD
FT                   IYELEQFLTIINKNLDLSNNNANKQYKSVFCVWLLTFKDNFIKKLYKNNIISVVINLFK
FT                   KCRVEKILRVSLNIIKNIMHMDDCFEIIVDNNIIQTLTVLQYDKWRDNDIYDTIVQLLH
FT                   KLDQRVKNYSNFERYCHELSKGKLKWSVLHTEKFWLENVMQFERDEFKAIQQLADIIKS
FT                   YAHNIAQKSDSMELKEEVDGVTVAVACFDIGEFARLYPNGKKICQKFRIKENVMILIAT
FT                   KDRDIVREALLCAQKIMLNNWQSISNAK"
FT   CDS_pept        complement(join(244903..244960,245169..245231,
FT                   245405..245460,245707..246594))
FT                   /locus_tag="PKH_140520"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140520"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140520"
FT                   /db_xref="GOA:A0A384KRC8"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KRC8"
FT                   /protein_id="CAQ41837.1"
FT                   /translation="MLGKRKLVEAQKEKKKKKWIEELDDDSEEIDLDCLNNLEEEEIAD
FT                   LEKEDEDVLEEEGKNGASNMTAGDDETIIDNGNNKKKKRYDWMSSDDEDISSEEDEEEE
FT                   VVELVEKGKEKKEQEQDEERINSSDETHMKPDNASEQGTRSRNSSELKGGEENGNVRYH
FT                   PNGTIYDMNNSYWKNENIGKINIDERSNHSDDGPMEIIENINKYSINPLDIKLKEIEHL
FT                   VTYVYFNNIHFSCVTEHLVQFLEKFTKNKIVQINSDKSTNHTIIYKYDGKNNETVLINK
FT                   FPHYGKLFVHVKNYQDVLRLLKLNETQFMGRIIKSTQAYKKKNSFYILQAPSHYKYFIQ
FT                   VLASEKNKNSTNYV"
FT   CDS_pept        complement(join(248186..248584,248809..249474,
FT                   249967..250695,251621..252253,252402..252989,
FT                   253295..253909,254121..254212,258997..259837,
FT                   259928..260032))
FT                   /locus_tag="PKH_140530"
FT                   /product="SICA antigen"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140530"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140530"
FT                   /db_xref="InterPro:IPR024285"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="InterPro:IPR024290"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KVC2"
FT                   /protein_id="CAQ41838.1"
FT                   /translation="MAAAQAVPNGGLLEEWMKTVVNKNGGTFSSRKEAMEQMKEDLRTT
FT                   WEELTQWLVGRWESYEISRLCESAGDILKGEESNWHRGEYLRNVCKGIVEIKYFMRGVK
FT                   TIRLKQGDTKDEDPVITPLTNEEAYRRCIVGTVALSEIYGDHCHLKDVIDHISRNVENN
FT                   LKKKHSQAAKNLDKCKNIDQIALIFGKALLQEEIKRRAQAERAGRKNENWRIWVPWNYW
FT                   KDVCKVPRRDPTKLQQQREENAQHMTEFLKVGDNSSSSSSAGTPSISDVLVNDDYSLDQ
FT                   NTLQKVFRGAMQLDGSFQVGGALQKIRKATEQVQADGCMKQEGKTLCQRLECAKKRWEL
FT                   NNKAQQQNFWDNYVKPQLEKLLPTSNDSAALTDYCKDASNLDSANKEACKHMTKFLHQM
FT                   YKNSNGSTKEYSDQIIKCVLLKEYANKLKEKAKEGGYCSIDDGLQKAFEKSKDFMKNGT
FT                   SQCGDPNDNKCFECKWTDTTNDGLDNCRIDSSQSEKVQDKVKTLFSSHNQTQDPKIQET
FT                   LAQFNTNNSLCEYVNCAAKRWKENNSTSGHGSGQEEFWEENGPMKKLWDELANKMKDSN
FT                   GKDASGSGQCGSFGTEAEKAACKYLHAGLTHLYTTTASSSVLDNPSFRQTMGCFLLHSY
FT                   AKYMKDKAICNIDKGIQEAFKNNNATCSSGKEPCVPCQWNDTSMENCTVQTSTNDTGTA
FT                   RDKVEGIFQEDKDKNISTMLTAINKMETLCNRLQCIASHLNSTNGQKPSITSADTFWTT
FT                   SGEVERLWNDLSNAMTNNGNDAGDCGTVDSDRPATNPERKACQYLTAGFEKLKEIAASN
FT                   GNGTKILDKDPSLKQAMGCLLLKEYAKRMKGKSKCVIESGIKEAFNSWNRSITNGTCNG
FT                   TEPCVPCQWNDTNIDQCKIGIIDAAGDITQTAVKDKLTHVQSKIDNTSTETLPNINSMS
FT                   TLCDYIRCAAPKWFKNKNGTNGNSKHSWCDFWEEVGVKPELVKMFTAIRTNGNNKSKQT
FT                   NVVCDQFGDDNPDSVERRACNHITAGLDYIKKIPNGAASKQSNGQDNQLLQRAVGCIAL
FT                   NMYADKIRDESDKVCPIGEEKINKMFEEWNNNNNSSSSTPCNGVSGTNSCFKCTREKDF
FT                   NSCDLLVNKDLIATASSGGSSPCNNNDNDKDKVPKQMNNLLNEDKSTINTKMKQTLDKI
FT                   TDMKSSFCTQVQCAIKKKLKSKNGQTPSSGTTQPWKNIEEDATKELKELLEYMSQSKNQ
FT                   EKVNQYCKDNEDKWNKIGHKEGRTNKAACLLFASGLKHIYTHDNGRVNGRVDGRVNGPS
FT                   FGQTMGCLFLKEYAKQLQTMANEKKKGYSWVHPLCDIDKGIEHAFNKSSDIMNGTPPCN
FT                   NGNNSCFVCTWHNNDYDKCKIGNDQIQDQVKPLLGTKSDSMEKTLENTVCPILLTDLLT
FT                   PFLPLAPVSIGLSAMAYYLWKYFGPLGKGGQRFRRSPAEIPGPSVQEQVLDHVEEAGSH
FT                   EYRLVKKRKPRSAATRTERSGHANRRAIIEIHFEVLDECQKGDTQLNQKDFLELLVQEF
FT                   MGSEFMKEEQVPKEEVLMEGVPIERVPILGSGFMV"
FT   gap             262826..263825
FT                   /estimated_length=1000
FT   CDS_pept        complement(264961..266247)
FT                   /locus_tag="PKH_140570"
FT                   /product="RED-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140570"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140570"
FT                   /db_xref="GOA:A0A384LG99"
FT                   /db_xref="InterPro:IPR012916"
FT                   /db_xref="InterPro:IPR039896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LG99"
FT                   /protein_id="CAQ41839.1"
FT                   /translation="MSGELTNSDFRLIFDNYEKEKKERENNLLLKERKKLKRKEKYLTR
FT                   KKKNEEKEEQKYRDRAEERRKGIVKDVKDASVLYDNANNTIDESKFMGGDTEHTHLVKG
FT                   LDYLLLNKVRNKLIDKISSERKKLKVNKTDNGPVANKIPTFSNDESRHIFKYFFLYEHP
FT                   HHVYFKRKIENIYGNIMNNMKFKNYNRNIYSVNYKYNINMEVDKNDVPIRYIYKVEDVK
FT                   VNYTYHLEASVLDEIDVCFKWHMENKKKKKNERLPKRPLTANFFRQEQNYELGQGEDDD
FT                   DVDIFKNDGDEMGGGGEPVNSAAIAPDVANVGGNRVGGSADGEDEADGDDSDDDDDDED
FT                   DEDEDDGSDDGGSGSSSAIGVHTEGRRKEQYGKDGNKRVQQDGGSNRSLFYSKKLPDTG
FT                   KVGTENRSNKDSLSENIFKDTYDECYPGY"
FT   CDS_pept        267657..269156
FT                   /locus_tag="PKH_140580"
FT                   /product="U1 small nuclear ribonucleoprotein a, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140580"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140580"
FT                   /db_xref="GOA:B3LBN1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBN1"
FT                   /protein_id="CAQ41840.1"
FT                   /translation="MKHSNATNQVGNKEPNNDNPYEPPYNHKDISSAAEELHERNSTTN
FT                   ENVLDGNFGEYPPHYDGGPNDDTSKLNSPHRHPQGSNDQNIGINANSENISNAAAEGRN
FT                   RSDSLNSTGTPTGAAINQMNNSMYTPNMPYMQNNKMMMNGGKNMHGKFPMNMNPPMSAF
FT                   QNSHDIMTNPLRMPMFPGQPNPMLFNNPMHYMNSKAYLKHLKYNKVITADPSIPPNETL
FT                   YVKNLNDRIKIDEMKKSLKDLFKQYGVIEDLVVMKSFWRKGQAWVVYDTVESSTKALNA
FT                   LQGFVLFGKIMQINYSHNKSDVHSKRDGTFVERSKEPKKPKQILERERKQKEIFEMMQR
FT                   NFIEMQMNNFRIMQNNELEKRKKIDLSQMDTQDLIAKAQAKAYEEKNKKKNEDFTKNNN
FT                   TMYQQPSPYYPMNAFAPMQNNIVVACKILFVENVVENVNTEEFNDLFKKFSGFIEARII
FT                   PQRNVAFVDYSDEAAATNAMKGKAQGRRVRWLPTGFPQPSY"
FT   CDS_pept        complement(join(269515..269565,269696..269780,
FT                   269961..270559))
FT                   /locus_tag="PKH_140590"
FT                   /product="exosomal 3'-5' exoribonuclease complex
FT                   subunit,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140590"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140590"
FT                   /db_xref="GOA:A0A384K861"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR026699"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K861"
FT                   /protein_id="CAQ41841.1"
FT                   /translation="MEDGVIISGDYIQMGKDKVKGINEHNFEQVHDVESENFYRSKCSG
FT                   ILLKAPYYPYKYDIMNTSYKYMPKVGDLVIGIVKSKKLDYYQMDINCNCECIIHKIESF
FT                   KYATKSSFPNLANGTLLYMIVEKINLDNNSVVASCINSSDVKSWINYENYLGELVDGYM
FT                   FPVSIAYAKSLIGDKCYILDLIGTDISYEVAVGHNGRVWIKTDDPRETNMIHTALRYSY
FT                   GKTKAQMDVLWKSIYNLGKKDT"
FT   CDS_pept        271706..274303
FT                   /locus_tag="PKH_140600"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140600"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140600"
FT                   /db_xref="GOA:A0A384KQR9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KQR9"
FT                   /protein_id="CAQ41842.1"
FT                   /translation="MTDKVCRMVENMVYEFNDLKRKELFTDKEIVTIANKRRNHEYTIN
FT                   SSSSILLNYILYIEFEINLEKIREKRKLKKKNDMLNEINEYNKLLKSQYEEYTNLKAKI
FT                   QSEKCPQKSKSLRKLLNKSEYNINCCKKNILKMENKLQVLIRHSLSDYSLVKRIINIFQ
FT                   TCLRKHHNNIEIWLHYFNFCYVKRRMENLESAILNSLKYHIQNELIWVFYLHYFYNIRK
FT                   NIQYTRKLYIRAILFIPKSLSLNVLYFNIEFDIFYKLLTNFKQKVDNSSNNHFNQFVDF
FT                   CKNSAKEEQDTNDATASQTKEDILKRDIDQGDYKTVKDEDKYGLDVIIFLTKKYLETFQ
FT                   NDKSHLYIFIFLLLNIYFKMEKNKWVKNYVLRFDNFKEIIFNSIDMYKRDQPCFFYYQF
FT                   VSKCVASTHCELSEDKDFQLLKNSFYQNGGEESQLQRYFDVTQVNLMLRELLDTFHNDL
FT                   MVYFFCLLLENLFEVFVEYANVDDVFTVDNYAGAQFPLLTQPEGSLNGDAKTGGNKDNT
FT                   EPKLDEQLEEQSNKEDMEGKKNILFHMKKPTLTNHEELQIFQFLKEEIFLCGSYKFKKV
FT                   NEEYLKEKDNSTYHFLQKLNFVAYVCLFENRHSDISKNNFIYNYEEINKNSEILSSILY
FT                   FFLFDPKKVEAGDMPKRKHQLEHAQQVNEAQGDLSKRRKKGFALLGKDSQRLPQASSKR
FT                   GQRRDVNSVYESDSDNMSDEESGGVSSKSNSNSDSDSNSEGDGQRNPDLDEHLNPNEGK
FT                   GSTNGGEGPIKLHTQPTCENETAKQKISIIDELLSLLSKEVDIFVKVTILKCILKLIIF
FT                   LNNNQLKRHFSATISEEFEKVRKTPPQKNFLKVELTNLTDLYKKAYSDEYAGV"
FT   CDS_pept        complement(274948..275961)
FT                   /locus_tag="PKH_140610"
FT                   /product="DNAJ protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140610"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140610"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L251"
FT                   /protein_id="CAQ41843.1"
FT                   /translation="MNEPSSGETNLQGGEDDVSAKGRSYGGAGGEKDAESNMNPSDNNT
FT                   SSAVEDNHENSAQKEGADELGEDALNEMFDDFLKDIENISSNMENQQEGKKLNKGDAES
FT                   EIARLLANKNSSPFEIFGIHEDVDMEKIKSKYRRLSVLIHPDKCKIEKASEAFHILNKA
FT                   YEELKKDDIKEQYKSVYETAKKNIIKKLNLKKIRNELNEYLNKNEEEYEITKEVQLLIN
FT                   EECENLLKVQKEKMEYAQKCKLANLQYAKEKEEEKMKEELKKEEERKLWIEGREERVNN
FT                   WKNYKKDNLKTEKEFHIYKNVGKKKEERTEEEKEKLKRISTTNPMEKDGNKKRRKT"
FT   CDS_pept        276927..278795
FT                   /locus_tag="PKH_140620"
FT                   /product="DEAD box helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140620"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140620"
FT                   /db_xref="GOA:A0A384LPV5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPV5"
FT                   /protein_id="CAQ41844.1"
FT                   /translation="MLSLVFPPRKHCCSGFTKSFLLSQANLNRSTFTRTSGKRFFFLRR
FT                   GFKELCARKGGIHIGHTRNASYSSTAGGINEEATFSGRLQDDRRVGAGAPCGEAPPEQI
FT                   PPSPQINGNPSNVVPLKPKRGENAEPPLCKKENGDDINIEDAEEIDKDAKRSLLEVFKY
FT                   KKFTDVQKIIYENVIREKKTNDLLVQAKTGTGKTISYLLLAINDIERNKIMSVHTLIIV
FT                   PTRELANQIYNEAKMLLTFKNNINVLTLIGGIKRREDQINLRRIKPDIVICTVGRLLDH
FT                   FECTYLFNTLFDNLKMLIIDEADQLLSLGYENDINRILTYLPKKRRNLLFSATLNHNLD
FT                   DIRQKMCKPDYMFLNCVKDPSKHTNEQLKQYVIFHKAVDTTVILYNLLMEHMRLNQFTY
FT                   KILVFFPTARATCFYANFFKTQLKISVYEIHRKKEPAQRQITANRFAVESVGILFTSDI
FT                   SSRGINYPDVTLIIQVNCAISREQYIHRVGRTARSNKDGTAILLLNEADELFYQQIKDL
FT                   NIQILNPNDYLLKNVNVSNYLNSWMSNTQLLYLAYAYYSSLLRFYKTKYATLKLSDDEI
FT                   IDVVNNALLSTGLVEQPHISSKLAIMLNMQNNTRLKIRKDIDDLLL"
FT   CDS_pept        complement(join(279315..279901,280282..280741))
FT                   /locus_tag="PKH_140630"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140630"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140630"
FT                   /db_xref="GOA:A0A384KNL4"
FT                   /db_xref="InterPro:IPR004141"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KNL4"
FT                   /protein_id="CAQ41845.1"
FT                   /translation="MDTYDYKLNVNYPFKVDEVRNKKKTEKKNIEIFYENDSDLYSPCI
FT                   DVEGALCVIAEGGEIFRYKLKSQKWDEKGGDKSGSTSSSSEELDGEDTDECNNESGEND
FT                   QRDQSVEDVQNGRKKTNTQNAERERYHSIDVEAVCLCADNDYNFYVFDPMIRGLMVINR
FT                   NKEMELYTDEYEDQYFQGVNNLFYDQKRNILYIIDSGSINEENKCNLFYVNKDIEMMMS
FT                   IDIPNMPYAHNLCVYDNGSTNDIYVCLTKENKIVRLMRRGNSYIKCHFLQIDGCYSPLF
FT                   ICTDNTNFVVLLKDLSGCQKKGKLVEINSNGEVINSIYTKGCQFNGICYYDKVDKYFFI
FT                   EGNVIYTY"
FT   CDS_pept        complement(281880..282152)
FT                   /locus_tag="PKH_140640"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140640"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LH51"
FT                   /protein_id="CAQ41846.1"
FT                   /translation="MLTLISVCSYLYYAHRDSILNLVGLSNKEDPNESQQNRGSTRTNK
FT                   RRVKGKKSVKGNLTSLSDSDMRRTKFILRTYSDVDFHIKLQSKKR"
FT   CDS_pept        complement(join(283696..285602,285749..285866))
FT                   /locus_tag="PKH_140650"
FT                   /product="dna-directed rna polymerase alpha chain,putative"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140650"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140650"
FT                   /db_xref="GOA:A0A384LJF4"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJF4"
FT                   /protein_id="CAQ41847.1"
FT                   /translation="MMLFLLLVLVFATASQSHFGLILKRKNPAFLPVQTGHSKHRNARG
FT                   RSSHLRRYYTREEPENRKFRNRNIFKFGSFEDDQISDGDDSNEYEEFDDQDYDNVHEDR
FT                   LNDDHVINEEAKDDSGLVRFDVFREEGKEKTEDGAQLSGEDNPTANGKKEDELKNELKD
FT                   EGDKLEGEDSLWMKSRRQVAGQHRYNVYKDEVNKKGDNEIDLQQADKIDRKKGKLPPYI
FT                   YQGGKAYEGKAENYEPEVYDFHTYNKYFDELCKEKKSTIDSYQLNKSQLDESYFDAKKG
FT                   GPKTFGFKFKQIQPVKYHQGRAYTYFFMHSHEVELSPIFLNAFRRVAMKHLKGGRVTAL
FT                   RIPNMKHEFYCIVGVRENFFDLAQNLRQITFKNVPENIDMDNYITGKFRIKGPMIVVAG
FT                   HMQLPKGIEIVNKNQYICSVSAGSYLEMDVKIESIEEYVMPEYGSQSRNRDICKDNFIH
FT                   FSSSCTPVEYFGFMGQRRGINLDTLGEINIVEMHTDGSITPKSALLKTIDYISENFQYM
FT                   ENALYNNCHTCDDGSVEEEFRNPEFYMDKDRYTDVPWNKYKTTAEELEDTKKWLYRKDV
FT                   HRQYDIDPESAQSKQEREILWEKKKKFLKEIDKRREQIKKGPSVSEGEYIPSEERHDCL
FT                   LDWPVDKSERNMNPPRWVIERPLDRSPHIGHEEIYDEGI"
FT   CDS_pept        288461..292108
FT                   /locus_tag="PKH_140660"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140660"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140660"
FT                   /db_xref="GOA:A0A384KH92"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KH92"
FT                   /protein_id="CAQ41848.1"
FT                   /translation="MDNGGIRKRKDAKENKVNIQGGMNFPTNEGVANNGNWNSGNSISR
FT                   GKNEHWDLRRNALGLSSNIGSSARRDSSSDNSKSGKKKSLGIFNSSNISAISNNCMKSF
FT                   NNMLNNINYNINSSVGHGTGGGNHFSDKSGAQGETNFYENQFKNLNLAKGISYLSNIAN
FT                   PQQKFTSDNRNVGGNQSNFNFFRNYENNLAQKRENNTSGTNQYSNSSQGKYANASGANM
FT                   TKSTNKGTVNSENLESFLNDKEIQNPNYNITGFGNIYISEINNLRNINNDETYCTCLDN
FT                   LLRNHGNIDSNEMLKYNDKNINCLNDIIFLDVYRAYNVLTYMQEKVNIIIYTIKIIGKK
FT                   LKKKHVPEEVVISLEFLNFCVKNLGLFFVRFLDEGFMKKISALLKTTTLKKSITKDVKS
FT                   KLSKFLIVPIIHPGVATDPRLHFIKRKILFMLQLWHDSFILHQHIAVSVFDEYKSLKEK
FT                   GITFPIINKAEKFYVKNADTSPSFSDDNILHDLPLKLAQINNMMKSLKEIKHMHNDEEK
FT                   SKCIAIVAKYKDLVLQSINKLSDYKGNINISVTLNSLLYINDQICIFEKWEKERGNGDG
FT                   SESALKSTKKEERTEEEKEKLKQKGKKKKNKKKETLSQSNINEIIFNKYDPWNTEKKEG
FT                   KNEAEQEKDIFFNESVGSFASATSANFMSKQATIPFNSKNGAPCNSENVFSFFGDESIE
FT                   PEVITSPKKDNPVEDKYSVFNELNFSNDSAHHLSNNFQQGLGNLNVTSETTAQKPWNPL
FT                   PPSVHIAQQMLNSPNKQTTQNNNFDSDKSRNNLLPKGEGQNSNIHSETANSLSPHGYNS
FT                   PLRRNDTGEAVPIPGKRTPSTHIHILTSEPEEENFKVGVTDDIFNLTQIEISNQSYLSG
FT                   KSKNRDGACTGDSLPDDANATADNVQNGTVVTSTHISVLPSPNNSQKGENKVNVSKDNA
FT                   PHFNGINFDNIIDSAEISQNALKKNEQKTIGQSNITKEETVTNENGNEANYDYLFETFD
FT                   FDPSDNKVAGANVQMNASGVVEEQSNLKKTSECNPPDIGSNRENEKTNIKNVCDTQIGN
FT                   LYGGTSDMTFDQVKREATSMNTKHNPLSLNTVNKEDLYSHLNHLTPISSESDESLSRDE
FT                   ISSDKHKCNSDSPNNTSNMEEEISKKGFQNDGSVDQCEKEGFEGKHPVNTPISEENVNE
FT                   KDKKEDTPEEAVSNSDSNDINFDEIDEITKAIDDLNDNFENMNIYKFDN"
FT   CDS_pept        complement(join(293015..293099,293307..293526,
FT                   293814..294661,294868..297218))
FT                   /locus_tag="PKH_140670"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140670"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140670"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBP0"
FT                   /protein_id="CAQ41849.1"
FT                   /translation="MYTHMMSSIQNMCERKNITTHVQCIGQSEHVLRRGTCGACRNSVL
FT                   SKEKKSMRKEGIKINRKYKKLMIEKNRVHKRKHVECCAGINEGLVRNSLFRGVEYVAGR
FT                   TVPPTFGNCRRCCCNASRPNGIIHIGEYTCRREICTKHQMQNIYPLSMGSAVQVSMGFH
FT                   RNECVQGNVPLQERGNTYGLCAYPHMCGLSNRGVAGCPNCTNRMATHSGVGNHNGMASL
FT                   NRAVHPNRMGDYPRMVPPNGMGAYTPIISPNRAVVPSGGVSPNRAVVPSGVVPPNRAVV
FT                   PSGMVSPNRAVVPSGVVPPNRAVVPSGVVPPNRAVVPSGMVSPNRAVVPSGVVPPNRAV
FT                   VPSGMVSPNRAVVPSGVVPPNRAVVPSRVVPPNRAVVPSGMACPNRALHPNGMEPYTRT
FT                   ESPNRIIAYNRMVAYTRMLSPKRAVATNTTVVSNKIVSPNIAVVPNRMAVPNKITTHDE
FT                   IVICNHVEEVDGVVSQSECNKENLSRRESVADNDTAIIDISAMQENVEDSPVQANTQSE
FT                   STSPNALNEKVAERERNTESANNTDDVLNQIRARYKDFLRMCSLKSENIQATKDEDEPY
FT                   LKIYNGEYSCDTDYSCDGSVVEIGKNGREELTEEEKFILRQMEEVLKDIDDEEVANQPD
FT                   DQNNIEVVCQLDDQNNSEVVRQPNDQNNSEVVCKPNNNRTNAVKGRCKRNHKKAFESNN
FT                   KNALPNDAEIDPIITALENALKGDSQNCLEKELTGEENSSTHKKRHKKEHKKENKKENK
FT                   KEHKNRKNVAKAESYEKMEKRMAKRQKIFLPGSASPSRDTRGRSSQYRCSRSGRSRRSS
FT                   SQYRRSKGSQCRRSRSSQYRRSRSSQYRCSRSGRSRRPEHRRQKKEMTYHGKRKTRADE
FT                   RERMQKENGGNKREHSSKRLKGKNRSRSRSSTNEEEPAWERKKKLYYEKEKNKMSRESR
FT                   DPDRRGFSSYDKSKERVKGRHNEYDNRHRRHREDKQRRGNNMDKDQMHSYDHEGRDKSS
FT                   ENVHVKKDQQEDGAEEEEKNKNEPKEEKNFNPSGLLAQEKNYKNGVELKYIESIDAELP
FT                   DKKWRLYVFLNANTKDPAEILHLHRKSCYLIGKDDLVVDIKLANPTISKQHAVIQFKKH
FT                   GSEVLPFLLDLKSTNGSYLNNDLIEPNKFYELRQTDILRFGSSAREYVLLHDSSDNPSH
FT                   A"
FT   CDS_pept        complement(298972..301320)
FT                   /locus_tag="PKH_140680"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140680"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140680"
FT                   /db_xref="GOA:B3LBP1"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBP1"
FT                   /protein_id="CAQ41850.1"
FT                   /translation="MSGREKEAKYKHRRVFICVCSNVCVPMYVFQCVCSNVCKGVYLLQ
FT                   HKNKKSLLLCPICRTYRCASCGRAVEDVLIFSCKHLICLICASEQLQKKYEKCMKACSE
FT                   EGEKTKRWGNHKISECFLNSKGVASAIDNDKLSELFKKEKLGYITCYICNVKNKLSLDT
FT                   IELLTKVGLFSHDVLNVHKFFFNSNTSREYANGKISEDHIKKKSVQFNDTLNSDVVKNE
FT                   DLKKLLVSSSMYRYLEDHTDDMGKYSYICNVCSLNEAVMYCNDCVEYLCKECCNSIHQE
FT                   DIINKVNFTDKKCHDYYEINKKGIHLKKIVKSPKKFLNIRKEDIEILHDRDGDSSPDKF
FT                   VDENLRERKFGDNYTKEIYKVYDDDNSDFDNYDENHFYERKKKLIDREDTKKKRMHISK
FT                   KLNDLVEDMKNASSYDSENSSAKGTTGSVGRTGGEIKGETGSRKYHEKGKRRKNRDKHH
FT                   AKYRHTPHTTAKNACNAIPCRKKDQKGEDEGEEGICLLSNSTVSHVDLSSSESSMCSVN
FT                   NSEREISIRDIRKGGHKIDSNVILNDESVNSKNFTTIENIRCSQHYNYPIQYFCHTCCN
FT                   KCFCSECAINGVHTSECNIENINKAFITVLNNYLIKWNEIINELMNDLNRNFYESLEDI
FT                   KNDWSLTLSECYYDLNSKIGYITNNLSKKEKEIFEQLDLYMDTFKRENMDYIELLNSKY
FT                   DEIEKTINIIRDNKFQNNPIEMIKFYRNNINMIDRTILANNDFKPIEDLSKIRQSKIFY
FT                   MDLYASQIVSYMRYLQAFLKPSGPYLPSA"
FT   CDS_pept        304079..306157
FT                   /locus_tag="PKH_140690"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140690"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140690"
FT                   /db_xref="GOA:A0A384KGS2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KGS2"
FT                   /protein_id="CAQ41851.1"
FT                   /translation="MEAASSYDRNDTCRSAKNGSTKNNREQEDEKNNSNLLTIYSFISS
FT                   YVFKEDMNYDENDSRYELLESQDLENEGCEKKVSFSEYNEKVYRYYRGRSGSEHGEEAD
FT                   NDDEDDEEEEEDDEEDEEVDDDDHGDDDGEELDDEESDCNAHTLENANEEDVIVQGSVP
FT                   RKKKRSKRRRKKGIPHGENHMISMKEKKYKNKLCKKEKKNKIHNVNEDYREAHNNGPIK
FT                   KNINNISKYFMLSMDNINEQENIFKDEKQLSRQMSYYNDAYYYTSEMIYKNNKRHKEKF
FT                   ALYLRLMSLFVNIMIGIYLITHFPHTNNEFEMNSQNGHYRENENLKEIIRNTLFPAKSG
FT                   AATVYEDNVHAHMNALTSQSEVLQNNEKKRKYLDILFRGSTKAKEKGTNAASPWKDENS
FT                   VDDKKKDKEVVVLRDNSSNHTEKRNKTSEEEISEFNNPITDIDIVNIIHDEYIMQYIYL
FT                   EMNKIYKYAVYSFFGELLVISIIVFSLFILRIIIKDNNKFSVILTMYGILYKIFCYIFA
FT                   HYVLVMGLYILSIYYNIYRSKDISENNFNFFCYHYVCNNLHIHLLMLFYAFQNIIFTIN
FT                   DTFNCIRMMFIIVKHIIVRIYEKITCKNFITFYELKEDKSPLSLNCMNKFKKKCNMNNK
FT                   CCRDKTCVEIDIDEIHELEYDKSQMPFPSLHQKPYCKNLDIKTYEQSLLNMRNPIFK"
FT   CDS_pept        307588..308046
FT                   /locus_tag="PKH_140700"
FT                   /product="CCAAT-binding transcription factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140700"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140700"
FT                   /db_xref="GOA:A0A384L569"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L569"
FT                   /protein_id="CAQ41852.1"
FT                   /translation="MEEQENTENINMIKETIFGLPNSVILKIIHNNPNLKNYKVRKEAV
FT                   TTLGRCLSMFILYITDGALEHCEGDKRSTISVHDILKSLDDSLFLDIHDELKRQVAIQE
FT                   EIQKKEKAAKDANNTAKADTGSGDDKAQGEMNQANEQDDLDILLQALE"
FT   CDS_pept        complement(join(308958..315439,315703..315730))
FT                   /locus_tag="PKH_140710"
FT                   /product="carbamoyl phosphate synthetase, putative"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140710"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140710"
FT                   /db_xref="GOA:A0A384KV23"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KV23"
FT                   /protein_id="CAQ41853.1"
FT                   /translation="MSTEFWPDYDYRTVGKLILEDDTEFVGYSVGYEGCKEDEKASSNR
FT                   EATKEINSNQVLEKKKYLKEDILFKNSKIENEDYIVTGEVIFNTAMVGYPEALTDPSYF
FT                   GQILVLTFPSIGNYGVEKVHHDHFGLVTNFESNKIQIQGLVICEYTKHSYHYNSYITLS
FT                   EWLKLYKVPCIGGIDTRALTKILREKGSMLGKIVIYKNAKNANKLYKEISLFNPGEIDT
FT                   IKYVCNHFIRVIKLGKINYYNNGKSKEDSKGINDENNYSLNEVENGNSLTNVNDYNYHS
FT                   LSSFEKIDFNKNSNQHSLLRDKMNLLTSSEENIDYYTGYREYSTNGGKKDAFFTLRGTC
FT                   EYDKYLIDLEENSFFHDGNVDEYGHYDVEMSLQRSGLSGRNKHGFTQDEVTFNLNNDYS
FT                   TYVKKKLNKEEFLNLVNKRKSDKEKIIVIVDCGIKNSIIKNLMKNGKDLPLTYIIVPYY
FT                   YDYNSIDYDAVLLSNGPGDPKKCEFLIETLKKSLQKNKLIFGICLGNQLLGISLGCETY
FT                   KMKYGNRGVNQPVIQLVDNKCYITSQNHGYCLKKKSILRRKDLAISYVNANDKSIEGIS
FT                   HKNGRFYSVQFHPEGNNGPEDTSFLFKNFLIDMFNKKREFREHIGHNIIYIKKKVLLLG
FT                   SGGLCIGQAGEFDYSGTQAIKSLKECGIYVILVNPNIATVQTSKGLADKVYFLPVNCEF
FT                   VEKIIKKEKPDFILCTFGGQTALNCALMLEQKKVLKKNNCLALGTSLESIMITENRSMF
FT                   AEKLREINEIIAPYGSAKNVEQAIEVANKIGYPILVRTTFSLGGLNSSFINNEEELVKK
FT                   CKEIFLQTDNEIFIDKSLKGWKEIEYELLRDNKNNCIAICNMENIDPLGIHTGDSIVVA
FT                   PSQTLSNHEYYKFREIALKVITHLNIIGECNIQFGINPKTGEYCIIEVNARLSRSSALA
FT                   SKATGYPLAYISAKIALGYDLISLKNSITKKTTACFEPSLDYITTKIPRWDLNKFEFAS
FT                   NTMNSSMKSVGEVMSIGRTFEESIQKSLRCIDDNYLGFSNTYCIDWDEAKIVDELKNPS
FT                   PKRIDAIHQAFHLNIPMEKIHELTNIEYWFLHKFYNIFNLQNKLKTLSLEQLSFYDMKY
FT                   FKKHGFSDKQIAHYLSFNNPNVNEAVVMRYRESLGLHPHIKVIDTLSAEFPALTNYLYL
FT                   TYQGVEHDVLPLNMKRKKKLPAEGNGKKVDRVENHVYPHNISPEMEENKSVKQLKMGCD
FT                   QNVCNEMFGKDVDVTVVSTKVDGAVGKHKMVSSSPIGDSKMEGSSNDLLSKEVKQEKGI
FT                   GSDETNIFSGKNCTNNISSSSGLNIAENTIMNNDPHSAQQGIGDNQHNKSSNANNTSKD
FT                   GWNKKLQNREVLMNQRMDDISNRSSHSTNDQLYLENFNTSDEEMTNKNGDTSHYMSKKK
FT                   KNFSDSKGAGNMYYLVDSVYNNEYKMSKMKELINSENTDSNDSFQCEQRGSVVKSGHVG
FT                   TPFGATSGAEDSIAMHVPHYARSRTNAGKEEITKGENKLHHEGIEREKSKGKSSNKKRE
FT                   TKLNSNGINIDDKNSDCFSELSYLRNYTKSSNAENDNTDDDDAFYNGGDDVYTCSTDNG
FT                   LFDDCGESYNTFSSKDSEGSSSIYSENENIFSEKFNDIGFKITHDRNEKEKEKKKCFIV
FT                   LGCGCYRIGSSVEFDWSAIHCVKTIRKLNHKAILINCNPETVSTDYDESDRLYFDEITT
FT                   EVIKFIYNFEKSHGVIIAFGGQTSNNLVFSLYKNSVNILGTSAKSVDCCENRNKFSNLC
FT                   DSLKIDQPKWNKFTKLSKAIQFANEVKFPVLVRPSYVLSGAAMRVVNCFEELKNFLMKA
FT                   AIVSKDNPVVISKFIENAKEIEIDCVSKNGKIINYAISEHVENAGVHSGDATLILPAQN
FT                   IYVETHRKIKKISEKISKSLNISGPFNIQFICHQNEIKIIECNLRASRTFPFISKALNL
FT                   NFIDLATRILMGYDVKPINISLIDLEYTAVKSPIFSFNRLHGSDCILGVEMKSTGEVAC
FT                   FGLNKYEALLKSLIATGMKLPKKSILISIKNLNNKLAFEEPFQLLFLMGFTIYATEGTY
FT                   DFYSKFLESFNVTKGSKFHQRLIRVHNKSSENLMPNITDLIMNHKVEMVINITDTLKTK
FT                   VSSNGYKIRRLASDFQVPLITNMKLSSLFIDSLYRKFSRRKEKKPFYTIKSYDEYISLV
FT                   "
FT   CDS_pept        join(319052..319218,319497..319578)
FT                   /locus_tag="PKH_140720"
FT                   /product="40S ribosomal protein S27, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140720"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140720"
FT                   /db_xref="GOA:A0A384KHP3"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHP3"
FT                   /protein_id="CAQ41854.1"
FT                   /translation="MNVDLLNRDPAEEAKKHKLKRLIPSPNSYFMDVKCPGCLQITTLF
FT                   SHAQNVVLCGSCNIMLCQPTGGKCKLTEGCSFRKKIE"
FT   CDS_pept        complement(join(320817..327086,327229..336129))
FT                   /locus_tag="PKH_140730"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140730"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140730"
FT                   /db_xref="GOA:A0A384L447"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L447"
FT                   /protein_id="CAQ41855.1"
FT                   /translation="MMPKQMGTEKYEKSKLHNKQNGKQRKKFPKILEDKYVEMLISKDV
FT                   KGKNRGGKKCGAWEEKGKTNKYIVHLQKLYKEFKFEECLNYGLENIEKLEKKNYVGKIE
FT                   FLKIIGNVYFYLENYKYSSLTYILLSKYLNRVSDKYKVEICYNAGVVFIKYFLQSNDIT
FT                   YYLNAKTSFHCSMLYNENGSKHFNPIIYENTVSILKRHFPLGVKEQVKGMKNENNLFPN
FT                   SSDESIFLESGTDLTVWSDVNDKVAKQEGKNTQGEDPQTKVLSSLGDSKSCTLKGDMHK
FT                   GDKNSKERKGKNQDDEEDIYFDSNNTETFSIYDNSVDMRDSVLRKSEALAKEEKTHTEG
FT                   RSSNIQMKEDIQENTVQSDHKLVNVSNEGKNMTNNFCNNLKNILFRNPVKSLLNNTSRP
FT                   FVKSKSSSFLKSTPGSILKNSSYKILKKSSGSIVGNSPMNFISKPTGNVVRSSSSNFFN
FT                   SNVGENTFVGSPMCMVRSNEGNFVNNSSSQFLTKDSSYNISPSTPRFLPSHSTLNLASN
FT                   SPISFANNQTNILQNKASTIFGNNFPYKRMPQQKSIIKCIERSTDGRIHQEGPKALSNS
FT                   NECKALEYMSPIENGLLQHKRRKTNQEIPLSASCERNIGVSNDLFLRSKDNKMCTFDYW
FT                   RVKEKEGIIDKVKQDAMGHMLLQKTKSGSLREEAQEGKSQRSKAKKEVMEEGKVEREQI
FT                   QDETHREENPKEMMIKRGNVKKDKDKKGKTGKGKSRRPNTLFDKLFSNESFNGSLLRRV
FT                   RKACKLYQTRLMNEYYHIYYLKNKKKKVKKIIKRKRIADFFHYLYEICKKNKHDFLMKF
FT                   VDQEKRSKGVSHRNATRQGAMKKGMLPNDKRTLNRREIKFCTGKISPHECNEKLKTLDK
FT                   GEISREGTRKGSVLIPFAGGRDRCVKEEGMGKAPHSLRNYEGSSVNLLEMNCIDKGGRK
FT                   KKLQYEQRKKVDMQRTPPFDLSRFVNLYSQIRSGQNQERGEKYQKEKMEIEEIIILSIN
FT                   KINKKRIRDKVKKLSSYNNSILSNIGDKFIDDMNELFLIKNYAKILKGLKRNDNIKHIY
FT                   YLYENMYAIDKFDHINGSNFFNISHFIIDILLLKQIKEKDYLKKKIHKMKYSYQNYYAI
FT                   YDCTDSGALFKDILPQLLIPTIKDTNKDDPKTLSSHIMSTENSQKSLNFLPSIFKDKKK
FT                   EVDLNEQNDSYINVKFSSTTTINNSDTISYTNQKKEELLGERMNEVLSGEKHGSEQASR
FT                   GGTNSCLSLRNHDRTSVKEDGVKSGTGDTSDTTYGNKPILRDFLSISSSSQRGESNASS
FT                   ISCMARAYKCEMEKVYLEMSKEEEGIFDVEKFYEHMNVSNASNDEDRIRAEEVILMLFY
FT                   HYCNGGGDCNSSVSRDRNVSGNCGVEYTIRRALFKIFFFFISNGIINKKNLHEYVSFLR
FT                   LYQFYLDSIKCDPLIYFYHNIEKDSEKIMDSIKGKAVIHDDFTSSIMLDNYLNVIHCHL
FT                   YMLKLLYKSYLNKLKRKHTYDKVNLEFMINHTFSILNYLLIKYSYDERGRVVRRRVVFL
FT                   FLQFLYLNSKYYFKNVTFFLNKYDINYLIKSETGNFCKINADLRRAHSVNENTETEGPN
FT                   GEGESKIEIYDTQKEMGEENAKRGTIPGKGEKGRSSEEDGILDNQGDANEEGYYYCDEE
FT                   RVGGVEELLYEGISNIEEEQDRGRKCKEALMEKGENQCNRKDAFVDKEEWKDEFVSKNE
FT                   QLKKGKNKTHNSSISNMNKFKNVFTKLDENVNIAFSSFLKCYHKCFFILNLRLHENDMF
FT                   RKIVWKVAQRIVTYCNDLYTILKIKKIPINRSYNYVFEEINDNLYRKNIFLKPSFFKVL
FT                   REDNYVNRIYGVHKEYIEKEGRRRVASHGMEDLDQNDVLNILITFAKFNRAKCQREKMN
FT                   KKKKQFIFLLHSYKYIKKFICKELKENSILTLYRKAKRLDENFNQSIDYLHSLFDTRLC
FT                   LLSLDFELQNIIIEFLNRCMEFVQQYQQEQNPRFVIINKMMNVYSCVFSLFYLRLNTFS
FT                   EFHTNKLFKILGIEKNIFSYDDQATWHMLNLFNFVNFRYGSSYRFLNSIFTSFHVLLNV
FT                   LVKIDIHMEMDRKCIGSGRYKRDTQISSEGNTYGNAMRQRNYEQVQKIIEREKMKKERR
FT                   TGLSQSMHGVRFGKGIIYKIVKEVKKKVTVSGKLKIKNSIFENIIGKKMNRYFVNPFGE
FT                   EVRTKKLERRVGELCKEKRMEKVGVLFNSTFCGEEKSHLGEYCSDPLSTIHTETQVETI
FT                   AAVDRCEVRKRRIVVRAKGGMFHMSQFKHSNRNQRILQSYGKLKKIEKKLKRKINNVCF
FT                   FKYIAVINKSQNKIYTTLSRTCAHILFILISILHIENYNILHLRKNQDFFINNDIYNTY
FT                   YLFLHISSSIILLLSSVLKMYLHFNPSVRLDGGEYTERKLDQTKGLTAMAKIGKSAPNI
FT                   QDEDGIAIQMESEEGGQRCRKRHLPQDGWANQNCRIAKMNNHTRDNNDGKFCIRQKEEE
FT                   SNKGRYQIYLETLIKFSSMNILLMSKKKYNKKNKMKKNKYIFIFCNIIENLLQNSMFYV
FT                   DIFNSCKNKDILEMQDVFSKVSKLCKENNIMDDFMKIKNELIYHSLFKYILQEEYINHF
FT                   NVDKNELYNMNKCSLNLFYFSLNILLTTFNTDISIHLERSLHNIHHFNHDKLYYEFVLN
FT                   NVKRTVRYIRESSKSPFNCIFACVLYYLTRWKKESGKMLKGKNSEEKNILLRRNISNQR
FT                   FASSHNMEEVKENLFFNLFSKEQCTDDTAIMGSVNNNWKGKEDSNSKFYIHPGEDSYGI
FT                   FKRNEKIIPGGDKHVEKETSHLKVHQRNERKIMIKIVYDMISPYMDIKNIKVYNRIYRN
FT                   NHTINSLINICFSFLFNNFLFLKPVYPFDIVPKEKNENESCGKKIRRTNYTLDIFSMKI
FT                   SDIKAVELFLSLYIHKYMQSICLDVNKLVDYNTYMNQFFWVSNRRNISVSFPCNDYTYL
FT                   NYAARNVYYKFNDYNVLQFLINFKKSKSEGKEFMMSFVKAFERMISLDEEISTDYTDPL
FT                   MYNVYLDYLNDLFLNDDYYYVCFYEYIKNVYLEENDGEFHIEDMDCYIKELNEINPYKI
FT                   KEEMKRKFDEYVQKNYLLLTVRKNRRRGKSMSCEDDMRQVGKDIGEAEKKLISNGEERI
FT                   KIVLNNNPYHFKNMYRAYRNRLFKLVNKKNINYLELIKMLNIKPYNHFSNMFYCSFIHI
FT                   LSEVKYDYNKHYNFNIGKIMDKLNIGLKASFYNNKNVILYYYTFQQYFHLYKFLEDKYF
FT                   SEFVLPEYMLLNITSRFVNNSLYNTNLYRIYCFLKFLYIRNVLKHADILLNFLLYVYYK
FT                   YFHYHYRGKDEFSHHFIDLFLSIHEESYNNSLLITELKGKDNCVENNLLGTGNLLEKNP
FT                   LLGGIPVANSAKEGPHGEKIDREAAKRDDTNGEIITSNELHSDDNDQLNRGNETQSAYQ
FT                   EINNYHLVLSNSQNRFIHLLFFKILINCVKSKINILNAKNLFNNLNFFISSYVKYSLTY
FT                   TFEERNTAFLDALRHKYSFYNLQAVKKNLKLCIYLKNVYLKRDLFNSDILSFLNIECGM
FT                   KKASSPGGLSRKKKKKRNANFDAPQSMNDQFSTSQMLEHVRKGQYSAETLQSCSGLEYR
FT                   KDENVNRKRTIGDNVLHVHDFEGSKKNEMNKKMKLLSGEACQIEEDEEPNCKENCLDNN
FT                   VAEILTDEGNQIIGMQTVKVKREVEEQYSNVERTNPIDSFESGKKEEQEEEEKKNNPHE
FT                   GETNDQTFCLDIMEDVKKGSHIKEDLQANQIKVKKEEMSDGNDTKVSIDSLTNANILRK
FT                   QFFKKRSTKKVSKKYYINILKFYLANRAQGYALNYSECQKLEDKSIYLVFLFLGKIFQF
FT                   LFNSLLSESRLQTDENKNHKKRERDMKADVKDAPECVEGSYTYENLLLYFMLISMCHYA
FT                   DSLIFLSIHFLDLHEISSKQSISLQGNSQQSSSQKGTLQNPSSVNEGNAALSHKEEMNT
FT                   YNLADQEERNEQGNENQSETPDIHMKKLNYCEKLQVEKSPGKYEDSSNNSRNGCENNLK
FT                   KNNLFLKPSLTSTRSYYMCRNEAVYIINEDKESTQMIIPLYKLLVTRLKICLYYPKYFF
FT                   LASLFNYKYDTRLSDYLLNYLKDLNLSEGIKYYTYDLNNNGKGSTVLGLDGDCNGGVAK
FT                   RCTMVDALSKGQEADHLGDHHTSGINRNENNEGENGEREANISRNIYDPLDEAHMLDHN
FT                   MKNPSTYNEHAKNGTFPFMKEKQSLSMCVNYYTHYHENGNSNNCSFPSHYNSSNRMEYD
FT                   NANMDMELTKQKHRNHVENTLPYETYERELNEKDMSEFNYNVYKLKVVIKNIEIRYEDV
FT                   LNDIIEGLNFIAENKNCGNYNSQAAYHLCIYYFMRKNYTKCIHYMKFFINKGNFKIWQN
FT                   ESFNQDYYNLYCKRVQRSEFIFIKYFTIVLEVSKNVLKNVLRKIYEEMLCEHGNVVKGK
FT                   ELRRGGNIPCVDDPQQGDNASSRTDNFLCAHLRKFLVGEKVLELFKEEKEEEAASETPV
FT                   KNADERKTDDNNQADGQKTEEHKTEKHKMDEQKTEEQKTEEHKMDEQKTEEQKTEEQKT
FT                   EEDKTEEDKTEEHKMDEHKMDEQKTDEKETDENKTEEHKTDEKKKDEKETDEPKETNVN
FT                   EYKGSPNKENENGTKERPIEEDITSEKNDPPQVAEAGNSMSNQKENKIGEIESKWIYLG
FT                   YDHLDHLNEIYDILKILFEIYIYIGKTIKRFNDYKVLEEATVIYGSNISVINVLFKIIT
FT                   EHLCFIFEVLCYFTPHILVYPIILLFAGDRVLSCTVSEESSENVTETPPKSNTTPVSSK
FT                   YTYLKRATNNEELIYNSSCASLDLRIFKLFREFLANKSATIPANLSTRMHNIFLLTCKK
FT                   VLYYQKSEQDIIKNLSSYNKKGNRKKKEGIMKFVENALNRNKTKLFEFLNLFKNGKLLN
FT                   CTNYLNCEDINFLTSKLNYNSSCKDMNKSRHVIHLDNNNVDKTTSQVDKENTISTTNDV
FT                   GHELSPDANTPMLSKNDSVDEQKKKQWILYHIKLNNDKNILLYDDYDIFNNIKTKNEAL
FT                   NCVNSILSYKNSAAKKGETSNLKKRKATDSTITDVKNAIRERDLRRLNREKSKVV"
FT   CDS_pept        complement(338567..339961)
FT                   /locus_tag="PKH_140740"
FT                   /product="nucleoside triphosphate hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140740"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140740"
FT                   /db_xref="GOA:A0A384L6I2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L6I2"
FT                   /protein_id="CAQ41856.1"
FT                   /translation="MNEDGSNNLIIEDVIRKHIEENKELVGKIIKFRDRIPLVEYKKKD
FT                   DEMYICSKYYFIGDIYIKVKKRNDKFRLSFVGSKLGDEEEHLGLSNPEQLNREVESSSM
FT                   LIDKKDRLGGMPGEHEDVDKLHTEVSSDKPRTYADNDELSAQEDTHELYTELDNEIING
FT                   ELEKELLNRDLWSQMSNIHLDREILNAELYNQVSKTDRGNWVLSKFRKKKYIIILSGTS
FT                   GGGKSTLSCLLGFFLNIRRILSTDVVREILRKYKMKDDKYLKFSTYESWKVNESDDDGG
FT                   VSSSASRGGSSIGAENGGGSSIGAENGGGSGSNDHPEGSKAESVETRLRRKCIENYAKQ
FT                   CELLFTYIDDIINDHIRSNESIIIEGVHLNADMIKKFNKKYPNSIIYFLVYINDKETSI
FT                   QRFSSRSVDSKTEENKYIKNINYINDIQKYLLERTKCLNPPINYIENIDIYNSLEKVLR
FT                   IIYSFG"
FT   CDS_pept        complement(341821..345906)
FT                   /locus_tag="PKH_140750"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140750"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KV32"
FT                   /protein_id="CAQ41857.1"
FT                   /translation="MKVPCGVLRRTQRAEPSAGGTMDKGKNGKLLFAHLNKRTYISKVE
FT                   EISKTKGCTVKKNKFRNIYVDFSLNKYININSLDVGKFIKTPIHYQTFRELVDTIKNVS
FT                   DVRLQNIHLVRKIVNSIGVYITNYLNNVSQLNHLTNLNTSNGGVNLQDNFYDLDNCDED
FT                   ENAITPNSITTILISLYKLKYRNEKFLQLLERLIFVKKDNFKFSQLNLILYIYAYFNRV
FT                   NKKFINSLLMNILDNEQKLNADNILSIFTSLFYLNCKNEKTLDRLANYIISNHLQFDIH
FT                   VIIFLLNNLRKMNYSNSNSLMEYFHDQIILKLGFLPPGRTEKEKKIIDRFFLKRKIQLI
FT                   IDEENLQEGGYPVGWKDGDTEQGSHHDIAHLKDEKKGNITCSYYPPVGKIDPSYNLCEE
FT                   HIMNTYGSVHNKYIVENNYVDYIYEYYNEKDLEEGSKSKLDILMEVLIYNKHFKEDLLT
FT                   VLYEYLLNNLKSFMNQNDSDMCRMLSNMYYFQINNFPKVLLLNKKIFLSMCHHYVPFYK
FT                   RTNIMIFLYIKLLLHKYNYFDVFIDTILQKKIQTDLLTLEGREFLNLLIQCKNYSVSKY
FT                   LCDISLVYFDFFSVKYSPHGVEDERNTLDKYQRSNHHEFSLSQVINTHKDGKNKRFITL
FT                   KFNEKNKLSSYDGQFLLQLLHFYIEMKYYEGIFLFLKSLFSGVRDFQKFDPYVYYKINN
FT                   HIVDMAAMKQVQQVQRSDVYVRFNALQIIHLYEYFKSAFASNEDFITQQDNVKKAKHEK
FT                   ALYHHFYAFSGDNSGDGSVDDVSSRTPIQTKQGKQPLPCENKTQASPVSKYLFTDWKVN
FT                   YISANNANATSKRESNGTFGNVIDGGRNNGAIPLEKKKYNSKLPKSGELKNEHDKRNGN
FT                   MVQDATIQIEGNTFYVDNHVYNVLNNIFLYTPVDLFALYIHHFNSKNIFFLLQNIIFKL
FT                   NWVNVEYLSLVVAKIFARISEETCRETKKDYMVYLDFFHDYLLGEEGSSQKFSYQSKQT
FT                   RSTQNVSYLNGQDKRLLISRIHQNCITTCKDQDKVKKRIAYILCKNKSYSGYINNAIIF
FT                   DEKFLSLFVQLAFRKKNNFSSCSYYDMMNDSLLLILKSLRTRKKNPKYMQSVEIITNIF
FT                   LFRYIQYKYSEEANEGNLSKRCASEKVPFLDPPMVDMQRGERGLCLNLDLDVNSDEKLY
FT                   SHLYCNLSKRGPQGEATPVQQNEQRGNITHDNVVQAPGESQRIVSIPNATEKYTQKGAS
FT                   NTPSSVDEGNLNGENQMTKRKDALMRYIRIYYTIVKVRYFHEMSINKHIFRELCLNREY
FT                   IDNAILLDLLFYIYKYKFDEMRYILLLQKKCTLYKDLYYTHSNCRIVEFLCKKLKINLD
FT                   DSVRTIPTKQTSYDYENV"
FT   CDS_pept        346720..347970
FT                   /locus_tag="PKH_140760"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140760"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KXF6"
FT                   /protein_id="CAQ41858.1"
FT                   /translation="MHPLKNDKLEKISNNELIRRIMELQNSLINISDHMELLKNRNRIL
FT                   DEENEKLENRIRDIVNDVKTELTQKFDKKKSPPFTGAPDIREEDTATESTNCCDKEKYV
FT                   QREPSKGQSFPTPDSVAPVPTDSSSRYRSTSYGESSLNAHTTNTQSRQHTNCASSNENE
FT                   TKNAQTVFIKNSEQHVNNMSPQKKEGQNFNLLKEHTKNNIYNLLMETEKLNSIFNIASN
FT                   VLNTSFFSISKEQDGKGKGSQCVQVCRRMVDQRELDKNAQSGDSKFCKLQRNRAEENAD
FT                   TKNYMNFPGGDVPHGGVEVKTTAEGKDNRDIMNSVEIIKEVDVEGDDDIMPEVLSLGEN
FT                   RTGSDMKRAEEEMPKEGERSPDDKMITPLHLHQMEENINGEKDKRDGDHQVDLNTPDQG
FT                   DIIKRESENALQSDKND"
FT   CDS_pept        complement(join(348561..348659,348808..348868,
FT                   348975..349034,349271..349307,349534..349628,
FT                   349750..349900,350008..350068,350243..350356,
FT                   350527..350587,350752..350810,350919..350982,
FT                   351091..351181,351315..351780))
FT                   /locus_tag="PKH_140770"
FT                   /product="phage integrase like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140770"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140770"
FT                   /db_xref="GOA:B3LBQ0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBQ0"
FT                   /protein_id="CAQ41859.1"
FT                   /translation="MHHLAKALCFFIILKCIEKATSFFVQKLHIFHLTASRNGDNLPYI
FT                   GKKCPNSMGMSVRRKGSCLKSHDEEEDGETDETEEMEDELDEELDETDEENEQSEVEET
FT                   DSSDSTLASRGSKKVTTGGNKVKAEKIKKRKRKKKSTNVIKCRTCNKILKPRVKFCAHC
FT                   GTNVSVEKIKLKKYIEDIYLPLRKEEVSDNTYRVEKGFWNDILPKLGKYELHELGANNW
FT                   EGFLKYLKSKNCSPRTMALYQSTYQQSLKYALYRDYLKSVHNFRKIKNSTIPRRKITPL
FT                   SPKEIELLLTNSGDMHRAIFALSIGIGLRPSEVLRILWEDINFEKKEIFIKGQKTKYSN
FT                   TAIPMTNFAYNELVKWWEIEKKPLKGLCFYSETIKNKFNYTNTKTPLKTFKTALKGAAK
FT                   RAGLEISEDGKKRRIFPYLLRHSFATIAATSNPPVPLPVAQAIMRHSSSKMLLDTYTKA
FT                   GNNIIRDGLDNFKI"
FT   CDS_pept        complement(355608..359843)
FT                   /locus_tag="PKH_140780"
FT                   /product="NUDIX hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140780"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140780"
FT                   /db_xref="GOA:A0A384KFS1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR007722"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR036189"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KFS1"
FT                   /protein_id="CAQ41860.1"
FT                   /translation="MNLIKGAKNKPQKHSQNKHVNNNAKCKKIFSSHRIKQLAKDKKLL
FT                   DDALLDCYGRFIALLPEFLLKDHVHLYFQIQEAYWWYDDMWQEKYPDKLPKLSLKTFGY
FT                   LICDDCPILKKYVPPSAHEKFSLNWRRYCRTIPLRGAILLNHNLKKCLLVKGWSTDSWS
FT                   FPKGKVDELEEDSVCACREIYEEIGIDIFPYIDEQVFIETHIEDQPIKLFIIPGVKEET
FT                   KFQPKTRKEIGAIRWFEIEKLFQHINLKNKKSILFESKKERINEWFVGPFIPNLVKWIE
FT                   VLKKSVPAKDLKGGNSFIPGSIQAHKYQITGLDQAVIKKLQTVNLNSKEIINIGLLKSD
FT                   DDLEEYDYENVDQNMDEHVSEDVNDKLLPEDVDDEVVSKEVTTSYANYNSAINFPGVDK
FT                   NRGSFTNEEGVKNSSTCSSVSNRRMEKGSIGPNRRQTSTNYYNQEMVSIKGEGTVGQGS
FT                   PLYDGVNCNDSRHPLDPTVEEGAYVEESTYSRMEKELMGNKKVYEHIDDAIVPLRRKDI
FT                   LLSSSSHYPDRAILGELINENNSSNDVRDNYQNNAMGSTNKMISTNSSCIKSMNNEMKK
FT                   GGNGGNDAHKDLYGVESYPSPIREVKNSAIKMPAKQNSFRLDHSDNKKNSISINSSGSG
FT                   SYNKENSSSNNNKNRNNNNNEPYHGASSINTYKRTSHMYGNNYGKHYGEYDPAGGKGYR
FT                   YSLNRMRMGGHLSALRLKEVGLRSFDDQDMEKRKNFHLQVYGKKDKLNCDKKEIQNRYK
FT                   KLSLKNPYHSLDDSSVYYVPTKNRTLDACNDKTFGENRTNGWSAEDMFKLNEEKFGIHS
FT                   TYNIEEYTTPLVYKEEKIGRYNKNDKMKEGMNPHMMGRSNKQVGRYNIKMGDRAERGNY
FT                   IPGGRIYKSNSSSSNNNEMNENNPVEWSKGSSIHSLNDNAYINVNALLESRSNMTPNGN
FT                   PRLVNDKNGKESISCVSSNMSDSSRGMGLVKSNNERVNFINGYYVHHERSVDEDPRNEI
FT                   QAGISGSSHVHVINGMNGVSGMNSLSASNGKNHPRKNANGNMNSAMSHMEERGSNVNED
FT                   MIRAEMLRKYKLNEGYDIIQRGNMSQKKVNNFSDFDKSSIRYSDMKHEKNYKKDTQMNS
FT                   STNDPFSNEYILNGANRKEKVDILSGDVNYKSKSACYGANYMNTRKDNNHLVNKSNVGE
FT                   YLNESILGITTDGMSGEGHPEYRSVPSRSSFGGSSNGKNKLTLSDLRINREVIDKREYS
FT                   HLDGEGIGLYKIKEKEIPFSKKTSQDSNNSSTHSNEPGKYLLNLIKGTVKSDVASDPNV
FT                   TNNNRNDMSRGSVMSSGSAKPLSEKEILSKFYSNETGNHAFTKNVNSAHNSMGSRRNSI
FT                   NNGERNDNYRNVIPKDNLNMQKNRNRMNVEHDTYDDTNRHDTQEESKFNEMEMMEKLSK
FT                   HLNSYNPFE"
FT   CDS_pept        complement(364317..365399)
FT                   /locus_tag="PKH_140790"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140790"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140790"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KSF9"
FT                   /protein_id="CAQ41861.1"
FT                   /translation="MEFFEWKEDNVCIDEETKKKLNESIVKSEDVYNVSELLKRFRALK
FT                   FDNLNYHSDKCILARECALIYILTYKKHIESVKEENIQLVVRNIRRSILSVNNIISNIT
FT                   EQILKCFIILRNLYNDILKLNNVYLADYCLFSIIDGILGNLNDEKLHQSKPSLWGMAGF
FT                   LSLIISNYKKAYFMYKGIISYKCIFTIPIFLEESTELKKMAKSDLYNIILKENDEDICS
FT                   NFSRFEAYTKLHLSIFIILNDTREVWSYISELFNSAYRRKKYIYFCLIYSALDVSSHYC
FT                   RITFTTHFEKLMHLLKTELMPVLEEELKKNPPPSSEEKVVQYYIKKLHVEHLDNLSNSS
FT                   LPEGVVVMPDEKLLYMGLGI"
FT   CDS_pept        join(368413..368592,368714..368863,369565..369723)
FT                   /locus_tag="PKH_140800"
FT                   /product="60S ribosomal protein L24, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140800"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140800"
FT                   /db_xref="GOA:A0A384L7W2"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L7W2"
FT                   /protein_id="CAQ41862.1"
FT                   /translation="MSSIKTTVKTEACSFSEYRIYPGRGQKFIARDGKVYFYLSSKFAS
FT                   LALQKKKAAKLRWTQTWRRNNKKTKIETTQRRRYKKTIKVQKAVCGLTVEDIRNRKAYV
FT                   QSIEAKNKSRMAGKEKDDKKKGKDDKKKNALQFQQKKDFSKSKQINMAKTKMHKMMKK"
FT   CDS_pept        join(375071..377165,377329..377384,377590..377616)
FT                   /locus_tag="PKH_140810"
FT                   /product="protein phosphatase 2c-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140810"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140810"
FT                   /db_xref="GOA:B3LBQ4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBQ4"
FT                   /protein_id="CAQ41863.1"
FT                   /translation="MGNCMSFISYSKFKFKKKKYVQSDVDSNPEYERTADSNAYSTSEK
FT                   SRRGNIPGGHATVYNPIWGSHSFNGDHKNGLKYEHSKTPSDNDKSDEEMDKERRANEHI
FT                   SNSSSDQSDMLMINDKGKRKGKKKFKRRSEVDSMEKHSSEADKDETKSYMNGKIQLDKS
FT                   KGNSKKEVSQSGSSSDDNAKENGTYNHHVEAPSRKNSSFYSNLINNNDLYKKNKRENLL
FT                   NIKYSNMILNDIRDVDIIVVFLFSLFLYFNANNIVDMLDPNKKDRYALRNSLNINHDIM
FT                   KFPTFPKEIVDSFLKNDFTLLRKYIKNKCNKLKKKYKNTYLKKVMPSDEDRKGEQQNGE
FT                   KNKKEEKFVKKKNFKYELKRKKEKCSFSKIVESVDRNQWIKRDITEIPCDQNLPDLNIT
FT                   FIVMGAYCLYQKNTKPFQDKNTFFYKSPSYTCDAEISVACKKGRKLDFPNQDDFTIIQT
FT                   NEWILIMVFDGHGPSGHDISNFAHVVLPLLFSYNIERIFENPVRTMKTLFYMINCYLVN
FT                   YSYCINNNINPININFIDYNLSGTTCTIILYNFQTKKIYSAHTGDSRAVMGKQNLQTNA
FT                   FRAYNITEDHKPSLKLEKDRIVAFGGEVKKLQGDVSYRVFVKNEMYPGLAMSRAIGDIT
FT                   SSFIGVTCEPTIKIFDKSEEDKFIIVATDGIWEFISSEECVQMVSRKRKKKVHVAMGKF
FT                   TNTKQEIIKESWRRWERIDTVDDMTLVILYF"
FT   CDS_pept        complement(378288..380498)
FT                   /locus_tag="PKH_140820"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140820"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140820"
FT                   /db_xref="GOA:A0A384KFG5"
FT                   /db_xref="InterPro:IPR010541"
FT                   /db_xref="InterPro:IPR013881"
FT                   /db_xref="InterPro:IPR027104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KFG5"
FT                   /protein_id="CAQ41864.1"
FT                   /translation="MEEVQKKRKSRWGDLENSTDNINKTGGTVQVNKSIEPIKTNDVNA
FT                   LLNRTGNILGEFNMSGASRLATSTPGIMNPPVGLNTAATGLPTQFPLTGKSFPALSPAI
FT                   HLNILKATEAAKLAIERAKRASRFKEDMKENVKKVEFVPKPLKFDEQGREIDDEGNVIN
FT                   IKPITFSTLKVNINKLEENNLLKKKNELGNKNSEEYVHEDNKWFDSRIKNVQKKKKKNA
FT                   FNFITPGSFMKLANSRNYNTKSQMNFDLKKFMQDKKNVQSLQEMSLNFLNSDLNDSINP
FT                   NLIDINNKDVRRRKEWKDNEKYDAMEKWDLVLFKKVENKENLKEYILEQMTNWKKGNLH
FT                   LGGGTTHHGVQKPDGNSHVDADEISKNDKNDPDEYMSSVCLQVNKLIQKRSANILLLQC
FT                   NEIIINEDLYKINLKKITNYVEHPISLNEDKKEEKMTTPHMFLTPLERKKLRKRKRQEK
FT                   EREKQDKIRIGLMPPPPPKMKLSNLMRVLGDSAVSQPSRIELEVRQQMKERELRHFKQN
FT                   QERKLNPEEKSKKKMKKWTCDPNQENEVLVIYISNLSNKKHIFKIDINAQQLHLTGVCV
FT                   MTVLYNFIIVEGKHISIERYKRLIFRRIKWNEDEYNDEEEDDDGDDDEDDEDEGDEEGG
FT                   SGGIDHHHNSNNMNDKADTSKIKSNLDTQTDYHPNDPVNINVKQGCTCSLIWSGTVKKK
FT                   NFLNWKMIIAKTEMEVTDYLQKHDALHYFHIVKKHRNVSDDV"
FT   gap             382769..386768
FT                   /estimated_length=4000
FT   CDS_pept        387732..391109
FT                   /locus_tag="PKH_140830"
FT                   /product="HORMA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140830"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140830"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KX05"
FT                   /protein_id="CAQ41865.1"
FT                   /translation="MISRMSVRTHTQSETLTKQDSVNMLKNIIKLGISLVTYLRNLFEE
FT                   SAYEEVHIQELKLKRLLPINRESHMIINWLEKGVFEAIEKEYLRILILDINDIYDNSIE
FT                   CYKFSFSYNSVRGSKIGISLETSQNNHNNGCTDIQLEERKKNLNLNRLKDIKDRLLNRK
FT                   KTTEETSSCFKKDAKQKTYELLRSLVLLTQTLNPLPERTYLSMKLLYYDEVVPYNYQPP
FT                   YFRKPDNKDLLKFVNLPHEDYVGKVDTGHHYLSIVVNSTNAGNEQQVNSYNSSEMHNQV
FT                   MFNTNRHSYGKMADGDYYQYDGGEGAHPRRAKNQANYYDNPHGDYHYDHNGHINKYAGG
FT                   RSENRYKEGKYEEDRRGFLKKRLVKSRNGGKNRKNYIVIDDDHIGEEGNDDEEEYDRDY
FT                   HYDEVGQEEYIGRNNASGRGVADNRTGRNLKRLDTRYEEERDSDCDEYNEEEDETEDND
FT                   EEEDDDGDDESDGNAGSDDNDSDEDDSEGGDDDDDETYSSLSDERSRKRRRSDRKSGTK
FT                   RRRTLSLSSWDSRMNENISASLVRVIKCSNDEDDSSNSDNNERYSKIGKILSQTNQDPD
FT                   EHDCVKVEKREIEDYRKKKNKYCVKNKSELGNSYYSSNPYRSNLDKMATRLYDNSCASN
FT                   APYRNINRKPSNELNKPYGIQNSSKANTSRLYSSYGVEGANDYQDKSKERDHCENRKNH
FT                   MKTYKDNSATKKKKKNEEKITYQNLKNQKSLRRTLVVKYRKKMINKLRMYIIKHKILAK
FT                   AKIREKFPSVSNYDINSVLHKLVKENIIRRMGYKYYKFVEPKSDEKEVLEKKHEGEPRP
FT                   TEIEQTEQIEQTEQTKQIEQTEQTEQIEQTKQTEQTEQTEQTEQTEQTEQTKQTEQTEQ
FT                   TEQTEQTEQIEQTEQGEHSDQKLKEEIRKEDDSVADTVVGPDVGSVSPVVGPVVGPVVG
FT                   PGVGPGVGPGVGTGVGTGVGTVVEAPHDRTAEQRPNADTNFIDMSKEDSVKNSQTANSY
FT                   ENSLLNNSSDPPESQETMQQIEKVDENNMNQINNDIQKLYNDVYNLCIRTKYVNKEIVT
FT                   KGLNIYPLLAKPLIDRLLREGVLKKKVVKNKGYESNIFVPIENAYIANNRADEVSVKSD
FT                   APDGNCALAKNIADEEKS"
FT   CDS_pept        complement(391773..392366)
FT                   /locus_tag="PKH_140840"
FT                   /product="snornp protein gar1 homologue, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140840"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140840"
FT                   /db_xref="GOA:A0A384KTU1"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR021154"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KTU1"
FT                   /protein_id="CAQ41866.1"
FT                   /translation="MGFFKKNKKGSFHRGQESEMKFDKIILGGTFYKHCENDLVIKNKL
FT                   ENLVPYFNGRIFLENKQEIGKVDEILGPINEFYFSVKLKEGIHAKSFSTDTKFFIDQSQ
FT                   TLPLSRFLPQEKKVTHQPKKKKRSNREKKQNNLSPSVKKPNNFTFRGNHKNDRGGRKDN
FT                   NQFKRNSGNFRNDKNNFKNRPNSGRKFGNQRGRF"
FT   CDS_pept        393792..394592
FT                   /locus_tag="PKH_140850"
FT                   /product="ribosomal RNA methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140850"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140850"
FT                   /db_xref="GOA:A0A384LHF9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHF9"
FT                   /protein_id="CAQ41867.1"
FT                   /translation="MKILYPTGRKNFLFQNMQMRLYKEAPPKVLNKKSSHSSQWIQRQI
FT                   TDRYVLKAKNDNYRSRAAYKLIELDNKYMFLKKNKIILDIGCYPGSWCQVILERTKNYS
FT                   NEIIGIDKKIMDPLPNIHFIHAEIGGAKDSTNHNNLVDVKLREILQGKKVDIILSDAAV
FT                   PCVGNKIDDHLNSCELTLGITNFMEQYINMGGTYVVKMYLGSQTDNLKTYLKTIFQFVN
FT                   TTKPKASRRESREVYLVCRNFLGRKKIGEDVQVKGAFSLKEGYY"
FT   CDS_pept        395678..400336
FT                   /locus_tag="PKH_140860"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140860"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140860"
FT                   /db_xref="InterPro:IPR007810"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L2E8"
FT                   /protein_id="CAQ41868.1"
FT                   /translation="MNKSDKKFTLKLFKIKNGNINLLKNRITHFSIHNKCIHMVLCNNS
FT                   LIKYYMDKNELSHVDFYNKKTTNSKAEIRSMFFDNKCYHGFICLANKEYIYVHFEYNIV
FT                   LNLVKLKKYNISSVCFNDSNELKNTAPLLVATKDGEILEISINNKTKSSREHEVIFSNK
FT                   QLSILDIAMINLDISNQSNNTKHTNDDSSILRIIYFTTCKSLHEISYTYKSTSVKKPSE
FT                   RSESYAQETKVKTNSENLNTIQAEDETKVYECCIESLTSILKIENIRNRNYLFWLNGCC
FT                   IFISKINNFKGRKPSNPSNSSNPENPVNHEKNDFANGSKWNLNQDDNNLDEPDFLSYSS
FT                   QSDTSMDGINFASFSDEDEEEKNAGMRCKRAVHKFSNSANRKKNTQTKGAYRRNHHYRK
FT                   SSETEEQSKNKQMNKRNKFMNEWYLDSNYVIVNFLDLNILTSENANNFAFTKSFYESLY
FT                   CQKGNTNVFASHMEDLPTEQQGTEPVLTTPETKIYENTVSAVVDMCVSELYIFLLLEEK
FT                   LIIVNSGTLKKVFEQTLAIETYGDVIRIMKDNSDDQVWLCTSKYMFKIVVSKKKREGFY
FT                   LNDYTEVNDCETEYANLKPSLTKKYLSKMLEACTNSERKKIKKYILKSNKYQIDQFKNL
FT                   HISTEEMLISFLHKRQYFLLASHLYNNIHCYNNVVKLVFFIWLIQLYSYSLDLYMHLYL
FT                   ITRCSFPRRQLQNDDSVETTPGEQSSGTSHKGSIDSDEPNIDSDQLSGMDSNCTDELGL
FT                   SDEAESDTTPHPRGRPGDYSDASTDPSDEELSGKDNQSVYQTEEGKPDKVHKTKRKGKT
FT                   HSEVTGTQASAYGGEDMITKEEMLNSTKGRNTISGQDQHTGNAEKKQEGRTDVYKGNIE
FT                   SAIKNDKYLRCGKKSFIHFFQKMIEKDERNDLKYSFDFSKGKKMNIKTVTESDNFYVLL
FT                   KIYKMKNVEIFNFLKAQKGLILDDLDRYRRIFVEGEAHLEGKEGRKKQREISPTGTFTS
FT                   EEELSMEDTERATMPETSTMSPTMTADRAKRKLYRDIYAYKCLEATVYMIILLKHFKTF
FT                   FQLNEVIAQILENFNKTNFLLLFKFMCNDYNYIINYYINTNKYSALFNVIVLFPQNVLL
FT                   DVLKNYAFILYLHKPHKYVDMLIFYDNMIDEYSDIIVCMFVIIYFFKSRQTAKREDIHH
FT                   QNGGADSHNNNDHGDHRDGNGDYHRDDHRDDHRDDHRGGSPASHKHTDECIRFLEYIAN
FT                   KIMEENTLTEKGNYMYTFECTWKKNHIINCLLILYIEKEEDEKIKLFLNRLKSSGIHFD
FT                   HLFIIRFLKEKKKENFIPHFYIIMKYFEEAVDKALELGDYKTAQNAVILCEDEEEKKKL
FT                   FLKITKNISNNLNEQNLKEIINLVRDSNSILNLQDILPYINENTIIDYLKKDICSLLGI
FT                   YNLKIQAKKEEIKENLQTIDLLNGDLNNLRKKYLLLDKNDICYICKKTIFYKKFYVFSC
FT                   KHYFHSTCALNIYLNSKPKDELFQFFCTLHNYKNALINKNEKDMLTYETKIDDILTEEC
FT                   FLCGSISISSISQHFISQSEGDVVDSWAISKE"
FT   CDS_pept        complement(join(400642..401507,401681..401762))
FT                   /locus_tag="PKH_140870"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140870"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140870"
FT                   /db_xref="GOA:A0A384L1S8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1S8"
FT                   /protein_id="CAQ41869.1"
FT                   /translation="MNKLLSRPFRNARRIHTSALRRDSDDTGPLLKKKRRFFDLKLFRQ
FT                   HLRRQKTEEIENEKREILKSCAKDPPENWNVKTFLTKIEIGENIDEIESAFKSWTDLIT
FT                   VTPKELYAMECLTNDQRRKIWKYVNQFNHGLYPEDSYDDFVRNFQAPPLENENKPWTKE
FT                   DEEQFEFYLNYFDVNFGDPWLYISWKMKRTFDDVQNKYIELYLKKKNKNRKCEICLTKS
FT                   TTPLLMNRKFKLDPPFLFFIPSSVNFPPMTIHDYCKKKESLSVSNHHLNSSDETPLRGS
FT                   SSQKPLIEDDVLYPSYASFIFSPSYLRYVDKACF"
FT   CDS_pept        402338..402955
FT                   /locus_tag="PKH_140880"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140880"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140880"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHX0"
FT                   /protein_id="CAQ41870.1"
FT                   /translation="MISVNVHEMTLFKLLRRSLILPQHSLPPPRLFTTVQLYKPSKFKR
FT                   IARNLYFRKKLFKVLTIKPCSEEVAKGSNEVKRTTDDEAVFYNDIVDYPTRKRRIYRNN
FT                   KFSVDDKVKIENGEKPSFEKVLYKCTTLGYIELQNIISTFVSHEKNTFTGEDICALDNF
FT                   LNLPEKEILDYLNGDELIPQDHLDASVIKRLLRFVHVNHPHL"
FT   CDS_pept        403998..404741
FT                   /locus_tag="PKH_140890"
FT                   /product="mitochondrial ATP synthase delta
FT                   subunit,putative"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140890"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140890"
FT                   /db_xref="GOA:A0A384L893"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L893"
FT                   /protein_id="CAQ41871.1"
FT                   /translation="MKGITVARSITHLAIPPRWSCHVEKKNLCLIPCRRRESTTNGLTS
FT                   WIRPYSSTAEGKKAEDEYYLSMGDNIEKRYSLALYNVGKKNKKINEISSDILFIKNNFL
FT                   KDKTFLNFLQTPNIENKEKLNFLKTECKKYNNNFSPITSNFLESLFDSKRINFLQKIIE
FT                   EFELLLMKERKEIKCFVYTAKEINNTEKQKIQESILFKLKNELKPLIEYKIDKSILGGL
FT                   VLQIGNQVFDFSAKYKIEKIRSNLS"
FT   CDS_pept        406141..409203
FT                   /locus_tag="PKH_140900"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140900"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140900"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KA50"
FT                   /protein_id="CAQ41872.1"
FT                   /translation="MEALFEDLNLAEIRKRLEQDKPQVERVAKWICSNNLYIILQMLEK
FT                   CKNGEKPNLSIEVMEELDDQISNPKNEELLSCIKMYISLLEQIIFHYEELDVETNKKIF
FT                   EIYSTLSVRILISSYHDFAPFMQKTILSLIRNIHVKKQHSCLNKNAYSYSLLNCLHNLY
FT                   FFIFLPDFIFLHCLLIYLCSNLNCDESSVMEKEEEDKLIIHTLKKISQLFEKLVFPLNS
FT                   GKTVLPEAPFDESHRQGQVYSDRIHRISDTLNNTDTKIIYKGGRAFELMYENICSTFDT
FT                   NKYPINEIEFGENYCPENVNINNFLLLLKIMSPNFIAWVSKKKEKKAATEEGETSRGII
FT                   PISEKPQPQCYSFRYLYIVETSQSYPYAKEAFDTIFFFYFLLHALHKMGKDKWGNQIDH
FT                   LISSTISNYRCLLERNSSFPGGCTPYTRIRHIREEKEVEHMKEREKEKRESDVPTERTT
FT                   LGDPSHENEKEEATKSKEILLHLRGNIQKGAPYTKLRNLQEEEKTNFPDATFKCRDKLM
FT                   LKLKSLIIWGYTPADHVEEWNFLNLANCFIFKDDAWSRLYKKGNYLQEYLFKKNNFFTY
FT                   NYSVFKSTYECKTLSFKYMDSFSSFVALLVLNIVSALTKFYLKMEELYNQETKKNNSKK
FT                   YSNTQSEQDNPFPYEMRDSSSIVEEADQIGKNKINVPPEIDAENGEHTNKCNKCGRLDI
FT                   FEISLKELSHNVISGNPPFIPPETSEKFESLLNDFVFICLKLISCPSDDVQSKCLSVLS
FT                   RLTPKISNVSDSYIKYMNTKIEKLFTLIDGGDNDYDYTDKGCYCWKNQVVQNYVHLKCK
FT                   MDKKINTNLITSLQKLINICILKNYNKDICVIVCKNIITCFYYHPLLFPFLLHKYMNVL
FT                   FYLMETNDVDVVADSLRCLFLLFQINSEDIKIYCHDIVYRLHLLFNIFNQSDLTDLRKE
FT                   EKNIQLDTPVENSAEEDISTSVTYFLKKFYFQIKHIDRARSEILTLMKLILRCIYITIS
FT                   ATEYYQLISIFSDDPLEYHKYSKGFHVFATF"
FT   CDS_pept        join(410156..410258,410472..410803)
FT                   /locus_tag="PKH_140910"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140910"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140910"
FT                   /db_xref="GOA:A0A384KX59"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KX59"
FT                   /protein_id="CAQ41873.1"
FT                   /translation="MKKYLVLLCLLIFSAGRLSVEAIRKNDLRRSLKGGNRNNEDHQKR
FT                   KNLLNFEIMRDKSSVSNIELNSSTLFNILASTRLMQNSASGPSQPLIYRYVHNIHDHNE
FT                   NNGAVLVFVLFGILIFAVLFFIFYFIFRHHVKHIKFMNSM"
FT   CDS_pept        complement(412318..413064)
FT                   /locus_tag="PKH_140920"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140920"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140920"
FT                   /db_xref="GOA:A0A384LBS4"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LBS4"
FT                   /protein_id="CAQ41874.1"
FT                   /translation="MNDRISRDLTKSFLEKREMAKEEVDPRKNWLKRILMNNNSYDMKM
FT                   FLKAGELKKKDGDYCKTCKTSVKQIYYINTSKVFCEVCEEIFCIYCVKTIDVMKDSQLK
FT                   YIKVRLCKNCFIYINELKYIIHPNLSIDKKAIDLVNAFDEISNRYTTMCSNVSQLNGLI
FT                   MLCENNKEYLDNFKTEIKQLMDVIQNDVDFLNAMKKRNNFAEDNTLILNKMGKNLILYL
FT                   KIIRNKIIPSSVDVINKTKELLYKKK"
FT   CDS_pept        415402..417942
FT                   /locus_tag="PKH_140930"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140930"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KQ65"
FT                   /protein_id="CAQ41875.1"
FT                   /translation="MKGKKEKKEPSEIKGSQKKEPTNLKRKKCPSNEYNYDSNGKYKQN
FT                   DENYKISSSEVNIVRKGKKKKLTEESEKKEAENISFPLENNDGEYQSNGDGPTMSNVEI
FT                   GRVKKAPHKVKGVKESISRGEGEKGNSKENVNQKDGNKKKKKDGAHGSNSSSMPLARGT
FT                   DMAIDGEGAKGTTNRMVGRMDNGVAKDEGKEEKQKEEEHAQQQQQQQQKQQQQQQQEKL
FT                   MMKEIKKYYGIVKVRKPNSQFGQGYLSTLKIKLNTNVKVSDSLAIVQLSSPEDADNTLV
FT                   SPFMCEASKSLKAECIKGVAKDVSQLDDHLKYVRGKLPLEIIDNFIFKNKTHDYDKWVP
FT                   ECRILLVTGLPFDQREENILHSLIDIYYENQDRDPILDMLDIDKSDYLLDCVNLYTAVE
FT                   EHPNKYELFANHLGIIKFALLFGTKTNASINMIDQTHLLFNLSELCRTNHCPVGSIGSL
FT                   YFKNEQYAKKFWMVFKLSANCMYEKYVRLCPDKNELKVYIEASIYFIMPGALFVNINYA
FT                   QLNLVLNILQQKRPIVFEKINNVKLRYPGKTIWDLISANVTLDDVLYAEATSKHVAGER
FT                   IPEGNDHMRGSSIGYISDEMVSVAKGKMNQHSPNRMNEQKDENVMKDVLGGVREGELNY
FT                   ERDYDDSQSPGWATDHILNECDSEKSFDENDIHEMEDAENAFHYKIHCIPNFLMRIYNT
FT                   HINRYLLDNGLCLLACPYLDMESGGKVANFLIKFHLLDWTYSERDDACYFYLFKSILSV
FT                   FAVSKRVFKGTFNYVVTTLFLKLPFGLVPALYIRVNPKLLGNMGDGLNVTPAKMLEEMT
FT                   EMRQMKDATEVRGSTEKTRNDEQAHTENSILTPA"
FT   CDS_pept        complement(419334..419939)
FT                   /locus_tag="PKH_140940"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140940"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140940"
FT                   /db_xref="GOA:A0A384LL48"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR019008"
FT                   /db_xref="InterPro:IPR039163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LL48"
FT                   /protein_id="CAQ41876.1"
FT                   /translation="MSKMNIVKTIVVTITSCLLLMGVTETKGPAIELKNNYIEGTIKAN
FT                   ANVLANCTVYLDSDIYKKPNKNGKFIFTDVKEGTYNMFVNHPYVEFNKYKVNVKKSITK
FT                   NNDKIYVVQAYEQISPFESSNLMVTNIVFQAKNVYDFLMPKKNFYLFNLFKSPIFLIFL
FT                   FFLILMSVLPQMQKMSESASEESIDPPTYKSNFVEALK"
FT   CDS_pept        complement(join(421331..421383,421528..421564,
FT                   421774..421830,422001..422124,422253..422364,
FT                   422567..422801))
FT                   /locus_tag="PKH_140950"
FT                   /product="Rab5B protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140950"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140950"
FT                   /db_xref="GOA:A0A384L8L2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L8L2"
FT                   /protein_id="CAQ41877.1"
FT                   /translation="MGCTSSSQRPTSTRNINIVTPASEQQKKNDTKVKIVLLGDSGVGK
FT                   SSIALYLCHGRFSDKHQVTIGAAFLHHTIELKNGVTMKLHIWDTGGQERFRSMAPLYYR
FT                   DAYGAVVVYDSNNVESFNSLKYWINEIKSNGSRNCCIMVVANKKDLPQKLNSEMVMKFC
FT                   EQENVSFIECSAKTGENINTLFEKIASRIYLRFKEVLYYNGP"
FT   CDS_pept        complement(424796..425266)
FT                   /locus_tag="PKH_140960"
FT                   /product="RNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140960"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140960"
FT                   /db_xref="GOA:A0A384KCD7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KCD7"
FT                   /protein_id="CAQ41878.1"
FT                   /translation="MAFTHLCGIQAPQTPSTINTFLTKAQHDITLTAADTRIFIKNIKT
FT                   GVTIDQFKNSLEQYGAMQVYFYEPGTNDDGWAWVGFESKEAAQRVVEESEKARELEEAN
FT                   NENSENDNGENGENNENNPKDEENERGDSNSFYAENDDENQNEEEDEDSDDY"
FT   CDS_pept        complement(join(426989..427100,427221..427339,
FT                   427506..430889))
FT                   /locus_tag="PKH_140970"
FT                   /product="protein, phenyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140970"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140970"
FT                   /db_xref="GOA:A0A384L6N4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L6N4"
FT                   /protein_id="CAQ41879.1"
FT                   /translation="MEDLKSILWSVEELIYLSPENDAFYEKEETEITEKLIALCKSHAE
FT                   EAPSEACEINCQAEELISQVRNLFHFLKLIKAGNHKECIVDPWVRDIFQFILDTLKNDC
FT                   ISSISLVKKELFYYISREKIDIKKRWHPKAKEQSGGLNGNEVPFFQVCFTFLHEIKILL
FT                   CCYAFLNMFVQYNWTGPPPPTMHSEKERVQTSQVCDEDKNFCQFIQTMKIKNEEFLNSC
FT                   LEFLSLEGEIIYAHCELLNAFCLSVILLDLVNNFNQIDQPIMYSNEYSYFEEGTPKGVR
FT                   ENSQDDNSSTHQITCVPTNEKSVGVNQKGEKKKKYNETKLLHFVKSKYLWKARIYFIWQ
FT                   RLFAASSNDCFYSLKIHVVDIPLRIFKNVKLLTSDFELIDQEINVIEQVPEIFAHLREN
FT                   EKDLQNCDLFCENYMSQNFQICALSNFSIYLAFYNYVYAYQRLLDVLAEMSQFSYSFTG
FT                   RMGIKRKYQKIPATILVLKAKRGQEEDNTSVVLKEIEPLSEYDILRSDYRIIDDKEGDN
FT                   VLGECKDTEGEDGHKEESEKREDGTGEEPPSSLGTSQNMTIQECTDGISYNCEKKVNEI
FT                   KSEVEKIGEENIEKKICTIGEAKTGEAQNGEEIDQKDQKSADHSASQIGEEKSPEECTP
FT                   VADKSATSIGPDECSSNRDEQGKTNQSGKVMWKLKDLDPDTDILEEPYFMDSQNNYFKI
FT                   LTFDEQITLINFCYSMIRFNPHYDEIKFEKISAVISRCLKCYDVNVESSKKEQNKIKNI
FT                   ENNLLQIKYQNWLLHSCILWYKCKCETFRLKTVDRAAAQLNELLKETYDMKPHGGERVK
FT                   FLFDVYYPTTWELKKEIGNVMVKTGSVVSAFNLFKDLKLWEEAITCLIQADRKEEAKEL
FT                   LDDLLEKKKTPSLLCLYGLVDTKNALNYYIDAWKLSNYKYAKAARFIGNFYYRKEMYNP
FT                   CCEYLEKALEISPLFPDIWFILGCSYMKIEKIDESVKAFTRMVSMSNEDSGKAYGNLAY
FT                   LYMKKEMYRAAKICINQAVKVDNNEWKYWDTYLKLSIMQNDVDSFCLALITLCQKNKVK
FT                   QIQPWVYEYISDLIVNDKQTLIPDKNGLSYLDKVITTMGTISAYISECDSYWNAFSFFL
FT                   FIKGRFVDSYEAKVKEIRSLESVAQKCTTKDVVDMLISKQVAAVKFLYHIIKTHYVEEK
FT                   RGYFEYQLRNIIESILRQYKDMNQQEVTELSQIMQIIK"
FT   CDS_pept        432382..433290
FT                   /locus_tag="PKH_140980"
FT                   /product="ribosomal protein S15, mitochondrial
FT                   precursor,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140980"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140980"
FT                   /db_xref="GOA:A0A384KSD3"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KSD3"
FT                   /protein_id="CAQ41880.1"
FT                   /translation="MNIFSRVLKQNKLHVLTPKDHHVPFIRCAKRYESRVKAHRYTGIT
FT                   AIKTHAQKTEWYLKAERDFLAERNQIPNGFIGLWQYDDIKHLRKNIINMLHLNCANNKQ
FT                   LHKYKKLCIRRCLQRRPFDTGSAPVQIGCLTEKILNLRAHLILRCKDHPKKRTMSIWLA
FT                   RRQKLMKYLYKTDFELYKHTCNLLKIKCILFAIPDSRDRSKAINAAAVDGDRCKFLIRQ
FT                   KLWKGKYRPRPMKDPKGQTIRYTRHPIEQPPSDYALPKEYKPQISNSWPYGVKENYQKG
FT                   TYTVYNPTAPGLGYCPVPMLF"
FT   CDS_pept        complement(join(433709..433873,434029..434127))
FT                   /locus_tag="PKH_140990"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_140990"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_140990"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPA1"
FT                   /protein_id="CAQ41881.1"
FT                   /translation="MNNLKNMKLLYRHILCEASKFENINYSVYFRNKAKDTFREFFRNN
FT                   HVKHSDEELKAFEKDCREYLNMLRRQTVVHNMYHVDKPLVNK"
FT   CDS_pept        436429..437916
FT                   /locus_tag="PKH_141000"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141000"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141000"
FT                   /db_xref="InterPro:IPR026504"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LQ63"
FT                   /protein_id="CAQ41882.1"
FT                   /translation="MKRYNEKTINARIQREQKNEYARERIQNDLKLDTYSKIQGISIDK
FT                   ADAAQTKNQKEDSFKRENETEESQLQKKGNTSNGGDEQEYFTSLQFDSEKIKENRLRQC
FT                   ELLNEKQKKEKEIADEALRQKAIEQTLQNDEGYKQLKGKLEEIATLKIRENQIRDAKYC
FT                   KIKEADDEKKRIEKQREDLLKKEELEEEEKKKKNYEKVMETKMELQQQIQENLNKKKNK
FT                   FYGTAQERSNIENVVKNYNEEEKKKKEEELLKQKKLLKEFQEQIELKNKKKQLEKKKEL
FT                   EEELKNQEYIKQKEEKIKNLQKKKQEKSLEKQRVVNELAHKEYLISKEKETLDELLNKV
FT                   YIEEHDFKEKQKEIKENEKKLQLKNEMIKQLEIDIQLKEQKRQKEKEEDEKRKIEILEE
FT                   KKKLDKIDQYTDKKRKEKLLQYRKEIYETFQQKKEAVKDERIQEEIEKNKLLEEQKEYE
FT                   ELINKEKMKLLQKYSKDILQNLPEDVYDSLKKKNIIT"
FT   CDS_pept        complement(438807..440381)
FT                   /locus_tag="PKH_141010"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141010"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141010"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KMR5"
FT                   /protein_id="CAQ41883.1"
FT                   /translation="MANTLNVAAPDVIRLILQYLKENNLMRSFYVLQEESNVKLNAVSN
FT                   VEMLIRDIHKGDWKNVLYSITTIELSDETLINLYEQLICELIEYKENELAEKIMNECII
FT                   FKKMKKMYGEKYQKLEDLITMNSKHVNKNVLYDGITKEERRNNICMMINNEVTSCAPSR
FT                   LLALLGMALKWQNHHNLIKKNKDNDNFDIFRNLEKNESKGIDVYPERILKTISFGKESN
FT                   VECCICSYTHDYLITGSSDGFIEVWSWLTGQLNSDLTYQSDNNIMMHDNPIVALCISKD
FT                   DEILISGDSKGLIKIWKIKTGSCLRSINAHTNAVTSIHFNNDQTQILTSSYDLSVKIFG
FT                   LKSLKCLKEFRKHSTVVHSCAYSLDNSRVICGTEEGKIFIYNQKTCECITSFYVYYNIK
FT                   DNIIFPSIHTITLLTKTLDELILVCSKSPYCYLMNFKGQIIKTYTYLADKVEENPVHFV
FT                   SACLSPNSKYVYCLAENQYLYCFNYNTGKLETQLKVLEEDALGVLHHTNQDLMATWALD
FT                   GTLNLIQ"
FT   CDS_pept        join(441448..442242,442447..442536,442733..442786)
FT                   /locus_tag="PKH_141020"
FT                   /product="ATP synthase gamma chain, mitochondrial
FT                   precursor, putative"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141020"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141020"
FT                   /db_xref="GOA:A0A384LPH0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPH0"
FT                   /protein_id="CAQ41884.1"
FT                   /translation="MAWNNTLLIRAEQCALNNLSIMAKRNFASDNLRSLSLRMKSIKSI
FT                   QKITKAMKMVAASKFKGDQRRLENCKHFSTPLTDIFNRLNKQEMHKKNEDLAIIAISSD
FT                   KGLCGSVNSSVSRVCKKLLENEQVDNELVNNIAPNKIYLYGIGEKIRSALNRLHGDKFE
FT                   AIYNEYNKIPINFLTCAYIAERIIKKNHSNLLIVYNNFKSAISFDTKILSVFSEKQLKK
FT                   MNKKELATFEFEPELDHIFKDIYEFYFASLIYNCIIENLAAEQSARMTAMDNASSSATE
FT                   MLDALSLRYNRARQSKITLELIEIISGANAL"
FT   CDS_pept        444788..446164
FT                   /locus_tag="PKH_141030"
FT                   /product="clathrin-adaptor medium chain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141030"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141030"
FT                   /db_xref="GOA:A0A384KUM3"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KUM3"
FT                   /protein_id="CAQ41885.1"
FT                   /translation="MACISAIFIIDMKGKVIINRNYRGEVNLNLTEVFYNCVIDQEDNL
FT                   IKPIFHVNGLTYCWVAYNNIYILAVTRKNSNATLIITFLYKLIQVLKDYFKVLEEESIK
FT                   DNFVITYELLDEMIDNGFPQLSEVKILREYIKNKAHQLTVKNIKIPSAITNSVSWRNEG
FT                   IKYKKNEIFLDVIESLNIIISSNGTVLRSEILGCLKMKSYLSGMPELKLGLNDKLLFNK
FT                   NVNNFSSTNSGGTGNAGSGVTNSNSSNVANVNTQTGRTKLVELEDMKFHQCVRLSKFEN
FT                   DRTISFIPPDGIFNLMTYRLSTHVKPLFWLDINISKKSLTKIEYVVKAKSQFKNKSIAN
FT                   NVEFHLPVPADVDSPHFQTYIGTVKYYPDKDILIWKIKQFQGQKEYIMNAQFGLPSIVS
FT                   NENKDVYYKRPVNVKFEIPYFTVSGITVRYLKIIEKSGYQALPWVRYITQNGDYQVRIS
FT                   "
FT   CDS_pept        complement(join(447520..448776,448993..449061))
FT                   /locus_tag="PKH_141040"
FT                   /product="26S proteasome regulatory subunit 7, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141040"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141040"
FT                   /db_xref="GOA:B3LBS7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBS7"
FT                   /protein_id="CAQ41886.1"
FT                   /translation="MDEDAPTQSKPLDDEDINILKSYGSGPYSTTIKKVESDISGLVSN
FT                   INKLCGVRESDTGLCLPNQWDLQLDKQMLNEEQPLQVARCTKIINGDTDQTKYIINVKQ
FT                   IAKFVVGLGDKVAPSDIEEGMRVGVDRTKYKIQILLPPKIDPTVTMMTVEEKPDITYND
FT                   IGGCKEQLERLREVVEMPLLQPERFVTLGIDPPKGVLLYGPPGTGKTLTARAIANRTDA
FT                   CFICVIGSELVQKYVGEGARMVRELFQMAKSKKACILFIDEVDAIGGSRGDESAHGDHE
FT                   VQRTMLEIVNQLDGFDNRGNIKVLMATNRPDTLDSALVRPGRIDRKIEFSLPDLEGRTH
FT                   IFKIHANTMNMSRDVRFELLARLCPNSTGSDIRSVCTEAGMFAIRARRKTITEKDLLLA
FT                   INKVIHGCKQFSATGKIYGVQLGDSHVLLATLASRFTQIDAM"
FT   CDS_pept        452682..454295
FT                   /locus_tag="PKH_141050"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141050"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141050"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LGJ5"
FT                   /protein_id="CAQ41887.1"
FT                   /translation="MIVNHDNHDKEYSAEISEEKREDESCQISESALCPRNRDNGGAGL
FT                   LGTIHNGEELHDGRKNFVGEKCNMFGEGRSQHVEDINSDNSQEESKKNEREQAQRSDTN
FT                   EDSGNSDRRKVTPNELSKQEYCEGAVDRTQACGAVQSDKRFISDYTIKGDSGGGAESEL
FT                   QIEVAHVPRSDAAGAVEIEEDDLQEETEDGSLSGTLYGSIVGSLNSSQVGSHNDVLSSS
FT                   LRNNPDGGEDETVEAVVAKEEMINITGLYHRGINKIEAVIALYKYYRNNFNQRFREQMN
FT                   KYNPLIYFYSNNNFENHISVDYINYRDKMNAIKTERLSRLVLYIEDINKIKQALKVKQH
FT                   NELKLEDDGKKEYFYDANEDIEDFFIFDNTVSYLNNDVESIFSEGENSSFLKDDASIDN
FT                   FLEEQKNKTGDEYNMLNLFNRFSLKNYYMFDINKNLCAIYARTPMIIKRFAEKINSYSN
FT                   AEKPDADLDDTEQDGGNFPGERGIEENGNYYPAARSRENNQNLDAYIQFHCEKWQENMY
FT                   DIVEVNSLEFDFNRLRCNIM"
FT   gap             456955..460954
FT                   /estimated_length=4000
FT   CDS_pept        join(<461532..462215,462411..463055,463363..463791)
FT                   /locus_tag="PKH_141060"
FT                   /product="SICA antigen (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141060"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141060"
FT                   /db_xref="InterPro:IPR024285"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBS9"
FT                   /protein_id="CAQ41888.1"
FT                   /translation="EEINDVVKEELTKLIGHITNEDKWKDVAALCGNVSSSTSNDTPGE
FT                   EKAKQKACKLFASGLKHISEIKDDTNKDVVPLRKTMMCAALNLYADQLINKSTDQCPLD
FT                   NKKLEEAIKYAFEEGNATIKKGKSSCTTQGNNSCFVCNRQDKNDFANCQIGSNSTDKVG
FT                   KKMTELLLEQDKTNSKTKSNTPNMTKTLEEINKIESFCTQVQCAIKQHYRKTPNAKALP
FT                   NGTPSWDDILSDAKDELSKLLQQMTEGQTKGNLAKYCNDKDAKWNTLRTKEKQTNRAAC
FT                   LLFASGLQHIYKQKKGQFNGPSFGQTMGCLFLKEYAKQLKEMALKQKDYKVHPRCSVDG
FT                   GIDHAFEKSGNIMNASSQCKNNVPNSCFECKLKEGYDDCKIGSDSVKTKVKPMLKDDIA
FT                   NKEHMEKTLENTLCPILPMDFLTPFLPLAPVSIGLSAMAYYLWKYFGPLGKGGPRFRRS
FT                   PAEIPGPSVQEQVLDHVQQDSSHEYQLVKERKPPSVPARTKRSGRVNRRTIIEIHFEVL
FT                   DECQKGDTQLNQKDFLELLVQEFMGSELMEEEQVPKEEVLMEGVPMESIPLEQVPMERV
FT                   PSLGSGFMV"
FT   CDS_pept        complement(join(469103..469531,469872..470534,
FT                   470726..471415,471910..472584,472803..473429,
FT                   473835..474485,475300..475944,476116..476216,
FT                   477276..478041,478204..478299))
FT                   /locus_tag="PKH_141070"
FT                   /product="SICA antigen"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141070"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141070"
FT                   /db_xref="InterPro:IPR024285"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="InterPro:IPR024290"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBT0"
FT                   /protein_id="CAQ41889.1"
FT                   /translation="MAQKFAGVLTKWMQNEGGSAGQRGQINSNTASQKLQDELKKMFEE
FT                   LRTRIEEMNFPKEINNACASAGTKYGDHDKLICKTLLRTVYWMNGIAESGKPKVGGSDQ
FT                   GGEQGLRDYFRCIVGYSAMAKLLSNKRDVQKIVQAVQDAATGGIKDEGNENINKKCESV
FT                   TLEDMEFGSQILGGSLEEWVRQGNRNRRMMSLYLSWTLGGGGTGTEGEEIDENKDQKKG
FT                   ILELFKDKKAAALYKKVDPGVQLPGGSPTSPEGKFGQVLKDADSCETEDSDNIQNCLKK
FT                   KLELTIGKPCNSSEFCKRLECVLRKKRGLDGNSANTTTKDDKVQEEVKAEVTSAATNIS
FT                   TSGTSDTDVDQYCSTVQCTNGNADGCVSKETCKIIVKALKEVHKIGKGGQGSDGDKEIN
FT                   RIFKSTIHCMALNAFIQKLKQQADQGGYGCAVQRGIDKAFDEKNLKNKRKEWCGKSSNV
FT                   DGSCEECGKDLQVCTGSSIGKDFLSETVKQELNKDTNTNIQPTLDNIHSQATLCDRLHC
FT                   AIDHWKIAKGAGQTPGSNDEEFWTGNDSPVKTLWDELARKMKDNGGTRTTGNGTDCDSF
FT                   ETDAEKKACNYLNTGFKQLYEPDPTTSSSSGTANSEVLGNPSFRQTMGCFLLHSYAKYM
FT                   QKNATCNIEEGIKQAFDSWQDLKNKAPTSCNGANGKGPCVPCQWNEDNFKNCSINTNGA
FT                   AVAAPNYKVEDKLKTIFEDGNNDTNISAMLTKINKRDKLCDHMKCIASHLNSTNGQHKS
FT                   DNFWKDDVKKLWEDLAKAMMQTNGKGTVTECNGFDNPSAERACNYLHAAFTKLKELSQP
FT                   TASQNKNGEILSKDPSLKQAMGCFLLHSYATHIKGKSTCVIDAGISKAFNSWHDPSKKA
FT                   SSICNGSGTEPCVLCQWNDKDYDTCKIKTNGAGGTAPTEVKTKVDAVLTNDNSNISTML
FT                   TEINKMTTLCDGLQCIASHLNSPNAKTKIPSVDKFWDKTGEVADLWNTLSKEMTDKGKN
FT                   GSVAECNTMDDGSATGGTANGRPATKPEKKACNYLHAGFEKLKQLSKPSTPQTQNGKIL
FT                   DENPLLRQTVGCFLLKEYAKQMQSKSKCVIEAGLKSAFNSWNSSNNGNCSGTEPCVPCQ
FT                   WNDANIDECKINTTGADGSTTQTEVTQKLTLVQPKIDGTATTTMEEVNKTEFLCDKLQC
FT                   AASNWFKQHATTTNGTDKKTWCNFWDEGVKPKLEEMFTAIETNGGNPNSSCSDFGDGNV
FT                   DSVERKACNHITAGLNYIDNIQGIHNGQPSAKENDKFFKQTMMCAALNFYADQIKEKSQ
FT                   DKCPIDEIKIREMFNEWNGSNNKCLTSGDNTKDCFVCQRQREDFNNCKLLVDSNLVNTS
FT                   STSPQNGTCNNNATEVKTQIDGLLNDSTIKMKETLSNINEMKTFCTQLQCAAKKWKSSK
FT                   NRKNGKNGQIGTLSWSDIHSAAETELTALLHHMTQSKNQEEVAIYCNDDANWSKLGHKQ
FT                   SKTNKAACLHFAAGLQHIYTHGNGYQTGQFKGPSFEQTMGCLFLKEYSKQLQTMANDKK
FT                   RGNSWVHPHCSIEDGINHAFGESNAIMNASSKCNNGPNSCFVCTLDDKNDYKDCSIGND
FT                   KVPDKVEPMFTDDQTKQKQMQETLENTVCPILLTDILTPFLPLAPVSIGLSAMAYYLWK
FT                   YFGPLGKGGARFRRSPAEIPGPSVQEQVLDHVQQDSSHEYRLVKERKPRSAPTRTKRSG
FT                   RVNRRTIIEIHFEVLDECQKGDTQLNQKDFLELLVQEFMGSELMEEEQVPKEEVLMEGV
FT                   PMESIPLEQVPMERVPSLGSGLMV"
FT   gap             485503..485602
FT                   /estimated_length=unknown
FT   CDS_pept        complement(join(<486359..487241,487353..487463))
FT                   /locus_tag="PKH_141080"
FT                   /product="SICA antigen (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141080"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141080"
FT                   /db_xref="InterPro:IPR024290"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBT1"
FT                   /protein_id="CAQ41890.1"
FT                   /translation="MSGTSSEGLLKGWMEHWKSTNGVTTGQAPEAKAEQIATTLKDNLE
FT                   TAFSTLDSWLAERSESNEIRNLCGKGKEDGGKFWRGSGVEPEYRKILCEAILEIKYFMN
FT                   GVETKKAGKGTSPQDETPFVTPLTPEKAYARCIVGMLALSEIYGDHCKLDEVIERVQDK
FT                   VSAGIQQKLNAYLVPNYRTNLDICKKITNTDLIVGRSLLHDKIKGWTDGKRAQGNRAIG
FT                   WRIKMPWQYWQSVCNKNKKPEQDDPKLNKLRQQNAESMATFMNLNDTKSNTNDVSLSDI
FT                   LVKDEYKLPESTLKRIVRSAVSDDSGTPGASPLNMENLKQELNKEVQTQK"
FT   gap             493771..494770
FT                   /estimated_length=1000
FT   CDS_pept        complement(496392..496856)
FT                   /locus_tag="PKH_141090"
FT                   /product="cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141090"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141090"
FT                   /db_xref="GOA:A0A384LME9"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LME9"
FT                   /protein_id="CAQ41891.1"
FT                   /translation="MNLARNKKNNLIDDELPNDFVLPEGDKVKGEKLFKKHCKQCHSIA
FT                   PDNTQSNSGFTSWGPSLFNVYNRTAGMSKGNSPFQVSPDMHTSGIIWNDLNLMKYMKNP
FT                   KDFVEANIGMNFKGISNFQDRVDIVHYLRTLTYDDPHGKEIVEKFSKKGK"
FT   CDS_pept        501147..504440
FT                   /locus_tag="PKH_141100"
FT                   /product="m1-family aminopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141100"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141100"
FT                   /db_xref="GOA:A0A384LAR1"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LAR1"
FT                   /protein_id="CAQ41892.1"
FT                   /translation="MIRERMLNLYFLFITVLAALAIYTPVDYQNTCMISRSCRKNSCGI
FT                   TSRVLSGIHVNKASTRARALISLSSLIYQLQLPKLVSLDLFRRDLFTGVNQKGRRSPVP
FT                   SYIIQSRLMSENIDSGNNNMSATGNQEKKRPVTGDASDAKNPDGSTISAQDKRMKGIDQ
FT                   NEGTSSVSGSTNAAFTNGASSIMEGGENNNNGTGNEGKNEPTIHYRKDYRPSGFIIDNV
FT                   TLNINIFDNETSVRSTLDMKLSDHYRGEDLIFDGVSLEIKEISIDGNKLMEGEHYKYDK
FT                   EFLTIYSKFIPKGKFTFGSEVIIHPETNYALTGLYKSKNIIVSQCEATGFRRITFFIDR
FT                   PDMMAKYDVTVTADKEKYPVLLSNGDKLNEFEIPGGRHGARFNDPYLKPCYLFAVVAGD
FT                   LKHLSDNYVTKFSKRNVELYVFSEEKYVSKLKWALECLKKAMKFDEDYFGLEYDLSRLN
FT                   LVAVSDFNVGAMENKGLNIFNANSLLASKKKSIDFSFERILTVVGHEYFHNYTGNRVTL
FT                   RDWFQLTLKEGLTVHRENLFSEQTTKTATFRLDHVDLLRSVQFLEDSSPLAHPIRPESY
FT                   VSMENFYTTTVYDKGSEVMRMYQTILGDDYYKKGMDIYIKKNDGGTATCEDFNDAMNEA
FT                   YKLKKGDKTANLDQYLLWFAQSGTPHVTAEYSYDAGKKEFVIDITQVTHPDPNQKEKKA
FT                   LFIPIRVGFINPHNGKEVIPEVTLEFKKDKEKFIFSNVNEKPIPSLFRGFSAPVYIKDN
FT                   LTDSERIVLLKYDTDAFVRYNVCVDLYMKQIMKNYQELLQAKAENKQESTEKPKLTPVS
FT                   EDFISAIKYLMEDPHADAGFKSYIITLPRDRFIINSIRNVDTDVLADTKDFIYKQLGDK
FT                   LNDLYFQIFKSIQAKADDMTHFEDESYVDFEQLNMRKLRNTLLTLLSKAKYPNMLDHIM
FT                   EHSKSPYPSNWLASLAVSAYYDKYFDLYEKTYNQSKDDELLLQEWLKTVSRSDRKDIYD
FT                   IIKKLENEVLKDSKNPNEIRAVYLPFTNNLRYFNDISGKGYKMMADIIMKVDKFNPMVA
FT                   TQLCEPFKLWNKLDMKRQDMMLNEMNRMLSMENISNNLKEYLLRLTNKL"
FT   CDS_pept        507348..509183
FT                   /locus_tag="PKH_141110"
FT                   /product="vacuolar ATP synthase, catalytic subunit
FT                   a,putative"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141110"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141110"
FT                   /db_xref="GOA:A0A384KF94"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005725"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KF94"
FT                   /protein_id="CAQ41893.1"
FT                   /translation="MTKASPENEEPGIVYKVAGSLVIAENMSGTRMYELAKVGWNKLVG
FT                   EIIRLEGNYAYIQVYEDTSGLSVGDPVTKTGNALSVELGPGILDNIYDGIQRPLERIAN
FT                   VCGDVYIFKGIDMTSLDHDKEWQFYADKKVKINDIITGGDIFGYVDENKLFKEHRIMAP
FT                   PNAKGRVTYIAPDGSYTLKDKIFELEYQGKKYTYGLSHLWPVRDPRPVLEKVTGDTLLL
FT                   TGQRVLDSLFPTVLGGTCAIPGAFGCGKTCVSQALSKYSNSEVIIYVGCGERGNEMAEI
FT                   LSDFPELTTKVGNEDVGIMQRTCLVANTSNMPVAAREASIYTGITLCEYFRDMGYNATM
FT                   MADSTSRWAEALREISGRLAEMPADSGYPAYLGAKLASFYERAGKVKCIGSPSRMGSIT
FT                   IVGAVSPPGGDFSDPVTTATMSIVQAFWGLDKKLAQRKHFPSVNWSTSFSKYVRQLEQY
FT                   FDNFDQDFLSLRQKISDILQQESDLNDIVQLVGKDSLSEDQKVVMEVAKIIREDFLQQN
FT                   AFSDYDYMCPLQKTVGMMKIICHFYAQCLRTLQEYDSRERKIGWGSIYNTLRPTINKIT
FT                   HMKFESPKNSDEYFKKYFKALEDEITVGLRNLVEK"
FT   CDS_pept        511767..512966
FT                   /locus_tag="PKH_141120"
FT                   /product="malonyl coa-acyl carrier protein transacylase
FT                   precursor, putative"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141120"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141120"
FT                   /db_xref="GOA:A0A384L3K5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L3K5"
FT                   /protein_id="CAQ41894.1"
FT                   /translation="MHIITSRTVLTISIIVIKIILWNSEECKGFILKGKERAVSGVLRR
FT                   GMDKKNRRRLTKEENLRDQINEQIMTSSENDNYIKKKLKEFEKYRIATYSSQYTFFFPG
FT                   QGEQYISMGLDTYNTCKNAKEMYDRASKILGYNLMDIIKNGPIEKLKDSEISQPSIYTV
FT                   SIAAYEKLKQEKQDIVMKLNLCMGYSLGEYSALTCSEALPFEEGVFLTKERGKAMQNCA
FT                   KLYKTTTIAIVGLTLDRIHNLIEDVNKEMDDDIFIVSYMTPKKFGLCGKPESMQYLNKL
FT                   AKEKYKAIFTKELQISGGFHSSYMFPARKALENALRQIIFRKPKIPVISNVDGCAYDDP
FT                   HIIKQLLLLQLTSPIRINACLENVLKHGYETGYELGPGTINSNLLKDVSKKQKEATPYI
FT                   "
FT   CDS_pept        complement(join(513852..517205,517384..517764))
FT                   /locus_tag="PKH_141130"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141130"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141130"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="InterPro:IPR035445"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBT6"
FT                   /protein_id="CAQ41895.1"
FT                   /translation="MDINLYIHSVEVELCTEDTAFRENKQEEENVVYCLHIKVESGDAR
FT                   GESSNRGCNGSANLSGTWTNAQPSGDVSGRPYGAQRSLKNEIPNGLFYETPWYMCVKKE
FT                   QNEICLMSYEVNISHAFNMLERDGLILYVLRKDLNKDKVDYLHRSELNMKNKRLYDKNY
FT                   CILFENDKLKGKIKVHLKNGIIYNHTLSEIKTGNYLKDVHEQIFLPSEFSTELDQTEME
FT                   NKINHDQKEQSGLSQDKNIINEFNDLLNARRILYWVYIDDNGKEQGPFNSNTIFTWIIN
FT                   EYFEDDTLIRLHDKDKYYKMCEVISYIEKNVLLNSGSHELLGDNLTNNIEGTLSQGVNT
FT                   KLEDSKGSQTEKHKFFIQGGVTTPDGMDDYVIRRSEIYFPEGEYVGQYMEKKSQKLNDK
FT                   HNNEVSEKKSTSDIHSKREDFTKGANATIHNTAHDNKNGKKKNQVKRLKREIKRIKDEM
FT                   VKLKESAYSGRHVVCEDIEVEARHGWSSGCGAEKALNLTSNGASKQDSCTTPTESYVST
FT                   NNNATHERTNIGSPQENDKSHTYPCEENAGKSTVQNNGQSVTTGHIKASVNYANDSFSS
FT                   EADMIEKIISDINEEFRIKEYHQKQRCMEIAMSSISQAQECLLNIKKKRMTSYLNRIIN
FT                   LSIHDEAIYIGEDNHEMVPMERRHLRKKGTNKVTFGGIRSVAYDCSCEICPACATPRKT
FT                   IFKGNSFGSIEQVADKKGYLHTRGKFSNGELESSPRKQKKVEYSLVINKGSLKSVERVK
FT                   LMNEEGRAQGRAEEWENKREHRRPQGRSCKEVSKEQSTTLCLNHKNNAEVVYNYYVSYD
FT                   EFLKCIILIQRRVRMWLNRRRRRSSRWSKNQYDVYNAEELGHWCSARNSVLSDNYGEKE
FT                   EDPGENTSQIKKEKYKADVINRVLENCHSLNNEKKEINELYVTFLEQEMRNKMEGRKKS
FT                   ILSSLLQCADGKKDDIPVNSPANSDFLFNKKNQMNNYEENERRRGCDEMGLPNRVDKLD
FT                   VDIFESEENSLRTEEKEMAKGTYGVKSDNISFQQDEVTSCKRNVHELLCNMLSKYKNAS
FT                   EENGTSGKLRSLLPNEDFTRNLKKYNSFLKSIEKKNISAKRDTLLSVVNNLKFDNILDE
FT                   KKKRCQVQKGLKNSSPIPRPCSFLSYRELSGHNCSYKDKEQNGVGDDMNKGESDMGKSD
FT                   NKLAKIKFLSKGNFFCKNFSEKEGNVIDYPVGKNNVSHFLLNKVGNKNLKSTVTDNFYD
FT                   DCYSDRFIGDRHRVFITKR"
FT   CDS_pept        join(518859..519604,519891..519972,520103..520180)
FT                   /locus_tag="PKH_141140"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141140"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141140"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LQK1"
FT                   /protein_id="CAQ41896.1"
FT                   /translation="MSRALRPMGKILHCVGHSVGHSCRTYDTTSGVTPYLFSKKQITYT
FT                   QHDSRNINSKNAYLYDLYRSLENCKNASSLYKLSCKIKGCQIYDLYIWRLMEQKFYEFH
FT                   KDLTPKEISCIINHFKQIKINDSKIYERCVDIILPSIGSYSLQDLSVLCLSLTYFNKVN
FT                   SSFMLRVADAIIKLYESEKSKIQQLSKKELQQIFISYVHIIGAYSKVGHKHIELFKIAS
FT                   VYIHLALTADIYIPSKIFIKIVTSYSTVKIKHSKIFEQIAKHIPTVKITDDELKSIKRS
FT                   FDQLGYSCETLDKYIQYRLS"
FT   CDS_pept        complement(520367..521155)
FT                   /locus_tag="PKH_141150"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141150"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141150"
FT                   /db_xref="GOA:A0A384L5Q1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L5Q1"
FT                   /protein_id="CAQ41897.1"
FT                   /translation="MGSIVKKWDLVKPKILLSLKWAEKYFHHLSLNNELKYKNVETQQR
FT                   YYMFNQMRGKKNRKKRERVNLNDEQKRTKLKVPPVRLEDRTTVCEPPTVISKNIKKEIM
FT                   KVCVGKERTRRHFKFRNKYRLNKLLGLTHDQENIKEKKKNPSTFVTPLTKLQHEATLPR
FT                   TMHHDRFSFPHSFQYSVIWHGSSIVDHEENNICFFSSYIRDLSLSPRERKKVMDILGEE
FT                   RVHAKNQMIFLESNFFNTYNHNAAYLGDVVQFLMRRVRNL"
FT   CDS_pept        521989..525210
FT                   /locus_tag="PKH_141160"
FT                   /product="translation initiation factor if-2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141160"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141160"
FT                   /db_xref="GOA:A0A384KBD7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KBD7"
FT                   /protein_id="CAQ41898.1"
FT                   /translation="MITLCCKLLYKGKFIPVGRRIFREKLISGRKQKSPIILLPPYISI
FT                   HELRLMLNINYETCFKAANVYKSGNQYKWKDSEDRTFQSVNKRNVIIPYSTAAYVSKIF
FT                   KFKPRLIEVELFCEEEEKKSGTLQDVYRKVYLAEEYHANVLRLQGESTNDASHGNHANV
FT                   APKDTSPSVQANPNEPRSQSSCYDPPCLPPKEQRSPLDEKKKNYYTVVSVIGHINHGKT
FT                   TMLDKMTNNNLALSEAGCITQNIKPIHFERGPFKFTFVDTPGHKVFQIFRGRAAFLSDI
FT                   LIILISLEVGAEIQTEEAIKYADKFGIPVVFVLNKADLYGENESIVKAELRKQCTNMYD
FT                   QGNLKHNFSKEIENAIAISSLTGYNLDKLMNRLFFISHYIDLPYHSVNRFYNNCEAIRD
FT                   ADLGVGNSLGGGSARDNPLHGKTLSDNNPDGRTPHEYTLHEEKTHPSMYNTEKAKERRK
FT                   SDLNLLQKYIRKSDCLLAIDKNPVGMGMVVDISKDSSKGTILHVIIRNGFFIEGSYFIC
FT                   GSAYGKIQKMYKFNSNFKESCSYASIGMAVLISGMKKHGNATTDDLIFTLPQSNAFRLC
FT                   QYRLMVEKLATLQVSGKEIKVSWENDMKKNEFHSEDIYQNRLAMSDKRKAIEEFGIEKE
FT                   NIFEDVSVEEFHKSNTQRKKEEEEEQKSVVIELEEENKYEDLSRVKKKKIQSILSQGDS
FT                   DESILVPEENTFSFFESPKQGEHLDPLVSSHWGGVHYQEKDQPNSSSGAQKINPLTHDQ
FT                   QETENDITNERNNNFQSRPYNTESATLYERTEVGKEEDAHEEKGKTHSVWRTSSHGRGR
FT                   KSRHALNSDAKNGQPSQEASDSNSEQYTDEKKLNDPWYYEESEETWAKKVLQRNDELME
FT                   TWRNKTRQREIEKERQIFYEKQMILKNEILRRKLLGEEKLTEEEINAYLYEEEKSNANN
FT                   SQESSSDEPIELPQKNCPVIPIIIRTNYVGMFDIFLDEFENLQKIYNVKISVVHGGIGP
FT                   ITPNDVVHAEVESNFGYCCIYAFQVKVLPDSVKQSVLSNIVIKQFDVFTDLIDDVVNRI
FT                   KNVKALIAHNMYVRSLKSERTQEGV"
FT   CDS_pept        complement(527986..528189)
FT                   /locus_tag="PKH_141170"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141170"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KBX6"
FT                   /protein_id="CAQ41899.1"
FT                   /translation="MFATVISPVVTVRPAPVVYTTTYSVVPQTVVYTIPQTIPIIKNIQ
FT                   VIPSPQVCLSYSYAAPVTTVIL"
FT   CDS_pept        531595..532890
FT                   /locus_tag="PKH_141180"
FT                   /product="branched-chain alpha keto-acid
FT                   dehydrogenase,putative"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141180"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141180"
FT                   /db_xref="GOA:A0A384L0X2"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR034616"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L0X2"
FT                   /protein_id="CAQ41900.1"
FT                   /translation="MKNLVQRYLFRKSSFPRFCSKRSICTLSQKRNLSAYKIYTDGLIH
FT                   SEFSTELKTTNEVNRLPIFRILDTEGNLLDGHTAPFSDEEIVNLYKQMVEFSIWDEIFY
FT                   GIQRQGRISFYIVNDGEEGIQFGLGKVLTPEDHLYCQYRETGILLSRGFDYPDIINQLF
FT                   GNKYDEGKGRQMCICYTSKNLNIHTITTPLASQLSHAAGCGYALKLKNQKAVAATFCGD
FT                   GSSSEGDFYAALNFAAVRESQTMFICKNNLYAISTSIKDQYRGDGVAPRALALGIESVR
FT                   VDGNDLFATYLAAKKMREICTEQSKPVFMEFMAYRYGHHSTSDDSTLYRPKEENDAWKK
FT                   DGVHPISRLFLYLKNKNLYTDEDDKLHRKAVKEKVLKELKKHESIKRYNIVGGLFENVY
FT                   HEEDWNLKEQRENFEEFFKKHKNCYDTSKFES"
FT   CDS_pept        complement(join(534740..540839,542046..542110))
FT                   /locus_tag="PKH_141190"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141190"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KF90"
FT                   /protein_id="CAQ41901.1"
FT                   /translation="MSYSLNLDTFKKTQDVSGTSDITENVYEKEIKEMKEMNELDSSNA
FT                   IAQMEEDREEEQEREKEKEKEKVKKPPSYDQKETKATKKNNFMNIFKKKKKSEEIEENV
FT                   SKIYDSNCILSNPNNVDEEKYYLSFSELNRGDDLSDKIVEERSPRDTKQVDKSLTGKTN
FT                   KKDKKVDKKMSRESKKKMKIKKKKKKNSSMGEIKSESKDELAQKQTSGKKFNEENEAED
FT                   RNYNFEPHEDLKKEIEKIKIDIDKIKKKGNVKRIYDDLKYILLFQNEIIDILIEDIRKN
FT                   KLRTKYDMLEDSTVKDDVNKIILNHITLDLLKFKYINTKLKELILCVYDTKKFNSLIRK
FT                   IVYNKLDEMKKIVDKNGELTFAKTMLSFLYKQLKYCLEEEVQSYYEEVKNMNDDIHNLK
FT                   KNVVQIIFEAINNVCSLPHPNEIYHTNGTNAKYEAEQRKKQIMCPEYQKDLNSFFSLYD
FT                   CVHVEGGSYHKDGVNQNKFKNFCVLTNERKDNHMPPPQMMNKNVTFGDHTGGVLDRAHL
FT                   INSEQLLNYPPSTTILNHSYVVADDPRRMGSNFRTHKIVSHTAPIDVHYARKETQQPCT
FT                   YVSNLKATNGGTYSDDLNSYYGEATSAAVTNGYDANGLRYIYGKSDGRRMQSNSNNIMR
FT                   GVAKECSLFCNGLDKMRSFRNFTEHTNVHPMMRNNPYAEYRIGCNDLHGGDVFVVEKMN
FT                   SSPRIMQPVDSNNHSGGFTVRSSVDVQNGDLVERGRIDPLQNVYLGNGHDMKNYVCTPS
FT                   TGVTSSTTVHIADPIGRAKHMSNPMEYTGFEIVSSKEDIKKLETLLNDKWGSFKLFEKW
FT                   VKDCSKWQWIDLKLQREYIGSNVDLEKLKEEKKKYLEKCINKKIKELWCGRMKGLMNLK
FT                   LCDMEKKIAKNFTSNNVISKNIYEVILDFERSSMCYQDLYAKILNAQGDNKKISSLFKK
FT                   YNVYGEKNSDDEEANFTHGEGKKNSISNTEGTKYANKKKGYVQSLIYSFNKKTHKQSNP
FT                   KDGSHLKKENEELNQKKGGTTSVKESTNLKEHMVVENGDNAKKGDATMKMNTHTNANND
FT                   KDNIGEDVRSSHPDRVNNSYIYNDSYLHTDSRLRSGSHTGCESHNGKNPSERKSDSHGS
FT                   SSSSSGVRIGRSSINKKENNGSFFDSFFFFKSEQNKKSSGSKSGSSESAAKSKSKSNSS
FT                   QNEDGYPMEYSKIVDSSKYNKKKKKKKNKKSNMSTLKKIFYLNRKKKSKEKSSDSDESS
FT                   SDNSAKGEKKEKRVKGKEDTTRGDKKNNSRKSTRENGTVKRGSLDQRDKALERQSSSDE
FT                   EEYKYDGEFEYQILEKEVGDHLHLEEEKEKIVSIEELHKDQSSELPAKSNASMGVGARK
FT                   SLNIVKDGGKEESKQEMQEAKQGHSQPEKQQGKEGGRHQGKHEPTKNGRPKAAEPILTS
FT                   QINEDMEESKRRASYNKETQINKVYSFVEEHSMSLGRNSKENSSVVNKKANSFVDYGSG
FT                   SLGEHKRECSRYGEGKEKEKNVVDQIGADEETGRGEKSRNNDAHQGEHQNRSKKNNSIT
FT                   HSDISYYSHDEDEEEVDEGGKEYDNFSSIGSIKKGNKKNKINKFFKNLGKFSFKPSKKK
FT                   SKQMSTRMDEMILKSAPSVASNENNEEHMDDDILEKDHEGVGPKRMSGHGKMFMSKSFM
FT                   LSSDVNNKKGGGVTKRKMSHQVDKLYSYINKLKEKKKNSTKMEVNLNDEKTNGAVEEKQ
FT                   PHREGERKPSEKEILPMRIISRIETANSMSISNENITKEVKENESEGNALTKRPYSSGN
FT                   INKVDNYFGEKFLDKSSPRGQKNSPRFGYSQSNQEISEGSGNSVGSASSAKNAYEDSAG
FT                   KGGVEATEEKKYQSGKFDEVRNVTGAKRKERKKNKGEKLDTWNTRRGVKTPSLSFSSEN
FT                   LSDYVKSKYQVKENEEIHREEMSSVSAMDSKLGDSMYSSLYLEERDQKFKQNISKKFLN
FT                   KKKSSRSSKGSRSARCFKKGSRNGDENSSNSLDIVRLSSFKSKSDVKLSCSNSKGTSFS
FT                   LSDSKESHISRGYMSDSKKENNSYYNYVQSILPFGMMAHRENASHDENSEDGRKEYISE
FT                   RNG"
FT   CDS_pept        547857..551048
FT                   /locus_tag="PKH_141200"
FT                   /product="Plasmodium falciparum asparagine-rich
FT                   protein,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141200"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141200"
FT                   /db_xref="GOA:B3LBU3"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBU3"
FT                   /protein_id="CAQ41902.1"
FT                   /translation="MGSDINNLSSGSSHTFRNANKSIESSGFSSMNNRSHVVQQGNWRT
FT                   KEYGNSRSYRNNNYYSNEMNSSMNSPERSKYHYSKSMSSSDTVRYDNGRYYSRNSYNKN
FT                   IYRNESAMKNGSSVISAKEVNRNISNNSSNANNSVSVGSGTMNSANGMNIASPDDHINS
FT                   ETVPINQNNANKDDFTNGEGNHTVNFSNMNNKDFCVSECKDNQFTKSSMQRGDGTVNFN
FT                   SSPDEKKNINYQNNQYSGNYKNEGSESDVPSRNMNMDEGNKNNSAEFNENMNYNSTQTK
FT                   YNTQIENNAECKNANSTTAGFNNQSSGLNNSTSYKQKYEGNSTVNSAIRGKDEYVPYGG
FT                   QGASNKYYAPYRGGNSGSNDRGSVSRVHSHSAVYVSCNNQSSKGNIYSSENANRNRLNY
FT                   AFNVNARNMVQMGTSGSNGYPEKNSTPDVNRSDVDSTNNSYSHSSGNPNINNQETSSAN
FT                   HLNNMDPSDEANFTKRECVREDNNYDAPNVQDEGGCPFENKGDANTNGNFNTQSDFANK
FT                   ETTNTFNSTTVITSPDAPDVSSKPSWTNNNAASNTNFVPGGARPDVSTINKPNMNSADS
FT                   RNNNNEEEDNDDWGELGEDKYIDINSIIKKKNVILNQLADLNMSKKGNDNKNKKKAKGK
FT                   KDDEPFFHAGAEASTSLGEKKKNKKNKNKKGAGNNKEKENDKGGKNAKDAENGSNDQSG
FT                   SKKNVKKGNVGSETDSKMNEGNVADDRANETNELDKNDDPQQQQNEEKKEEVTEKPAKA
FT                   IYVFKRKENMSPLEYMERQVKSLLNKLTVENFPIITERMCQIMDSRTNTDEIQTVVNEV
FT                   INKAVLEHDWSEMYADVCQALKWRSPNFEMKKKSSFEIALLKKIQEEYENLPSTFESTM
FT                   KEKLKNDENEEELSFVEQKQKKRLFGIVKLIGELFQRQIVSISIVISIAHDLLIAFEEP
FT                   KEYCIEAFLQLIYSTGFFIDKMEKYKNILDTWFGRLKELQRKKMYSKRIKFVIQDVFDL
FT                   RLSEWRKKTHKDTAKGLNELRSQLETEEMMGGSIHLAQLGNIVIVGERHNIRNNESYSK
FT                   YMQEQERLSKANQKK"
FT   CDS_pept        complement(join(552669..552760,552994..553132))
FT                   /locus_tag="PKH_141210"
FT                   /product="ubiquitin-like protein nedd8 homologue,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141210"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141210"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LGS4"
FT                   /protein_id="CAQ41903.1"
FT                   /translation="MQILVKTLTGKRQSFNFEPSSSVFQIKMAIEEKEGIDAKQIRLIY
FT                   SGKQMHDDMKLSDYRVVPGSTIHMILQLRGG"
FT   CDS_pept        556377..564581
FT                   /locus_tag="PKH_141220"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141220"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141220"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBU5"
FT                   /protein_id="CAQ41904.1"
FT                   /translation="MEEAKERIPLEDKCSGNEEPKKEKRSNRCKKVEMLHKTKSNEKRK
FT                   KSSKNFKPFKTFRYFKPFRQFKNSKSLKKAKNCKTHKKKEKERAKKRAKRKAKKNAPKD
FT                   LLPVGLDTPTTLPNEGNLTLENVAKLPSNQRTPTEMSASSRNSRKIEQKNNSSNAGYVA
FT                   LAEDNFSPNHSDDQKSGRAKNYYEIKHSVDEDHKFPVHTYVETEKTPPVEVQVGDNLDC
FT                   VVEENSPKKKTQLGITIENCQKNACKEEHWTTLKPHLDDPQRDYCGGEEEITQVKGRET
FT                   SRQNNPKELLQYDMHRGEHEVGAPHNLIDILGEKKTSRIQFRELMISMNYDTKNIITVM
FT                   EKLSEEKLLYLTIPFNENYDIVKYFNFLPLEKIEKMINLLHIDNYKNFILSFSQKKIIE
FT                   IVNYVSVNTSINILLNLSNNKVAYILNHIEEKIFINLLNGIPLCKFYHIAEYLPMQKIS
FT                   LFSNSITYEKLYVMHNSLPSKKLHQLANNLPVQILNKLINELPLYKSVKVLKMLPPCKI
FT                   AESINVKELTPHFASEIGRSFNAPEIIEIVNYLNEGNADILLSRCNLTKIILYINYISM
FT                   EDFKSLIPKLPTQFLTQIVNDISLKLLVELFLSLQEEKAIPCLYALTERKLNFALRVIP
FT                   MQRVIIDTVLRQGGTVLPGYHQTEAIMGATTTIGTTDVTPTCYAHTGADHPHRHLINMI
FT                   YEHNLALLLNQLNADEYAPFCNLMCADKVEEMANSLRVDCRTAAALILHLPLTKMVEVL
FT                   QRVREKRREEMTKYMPTFISQMVLHKSSNTKGISKIEQMFITCKLLRLRKIFRNSKKIP
FT                   TLKKNKRKLKCYHLRKKTNDIIRTINVKNYSMFLNFISCAKIVEMYQVIDDIMCRHPYT
FT                   EPKVMDCLFFFFNFFGKIRASKWKTEEGILRCINKDNSKNREKLHNAENSQNGEPPHDT
FT                   YKQTKLCPLHGSTKTEQLSPSPSIKKMNPSTDNTTIREITTHEIHTNKRETKHLVVKTG
FT                   KCNSKTDSVRSSFYTFLVHFVCFIKMHIENYVLQNWENLHNGEGEEEPTPNRPQRSFPL
FT                   KGAFPPNHEQGSSAPLDEDSSMIEPHPHSRKASRILITTKSKLIFNSVRKIMKNIFFSI
FT                   RKINQIGNPSLVLKHISMFNIIRADIVKGKSERQKEDLKNSSGWDYSKGTPIKSTNIKD
FT                   GKTTIIKVKNTADFLTHSGNFLNEKYPLVKNILNEMKKKNCTNGTVDGEKTNEAMTIED
FT                   VVKKDESNYMGMSQNGITTCALKEGESPMLRNSRTNGRGIIGSAFSVNKRETWKYNLLV
FT                   NDEGDNHIEERNDRKKDTYEHRALIKKSKKNYFKKLKNISQMTSFKRFTRSDKHHSNMP
FT                   RKDTPTNLSINAPMETCQIDRQSRNTTVNPRINEKVFFPTPNSQTEEVPSDVSSKGKKN
FT                   KLSLLKFIFALNDSNDEKYANNITLIINFFFLKKKIFLSKCKNQIVGSSLNVLINDNGC
FT                   KRLLNFNAPPNDTSCYINSNIVSVQYDDTDAIKNLYSLTSSKSIPMCTTPGIIPSIDMR
FT                   TDFSTIPQKGKTKKPFKSKILSTKMNKENNNMSIKNMCNDLNSSIILFWKSSQFGYILL
FT                   DAHNSLHINIHDPSTQFSLNLFRQHDDVSVGGGAYRKGSIFFSKNGKKKVSFKKIKSMF
FT                   SRILEKKSDPVAITSSGAIVKTGQCGAGGYMEGRQNGDDFLDRTVLLPSGKNNLSEGKG
FT                   GAPGDVSSRGDNFVHANDPKPEEHLISDDNEVYFGDEYYKCYEGEVSSVLANEVSIRNG
FT                   ESASVSGPFERPSKSGKNGEVATHLEGATNMRTPKREHEHHAEKSENEKIGENEKDASN
FT                   EHNRKNSLKNKHSIVINKFSNIINEAQRILSIKEKMINQKILEQIHPSYISPSSLTESE
FT                   KEKMREIKNNELNKIMEEELRKVNKNFQSKDTYSFGNTSYTDDEFNIILYLEKKKKKKD
FT                   QKGAKRKKQLMPLKRKEKYFIPFRFNRSKILKLKLLTLIENALCSYDVNVGEGTFISEL
FT                   NQQGQGETTKEYVDSSSENLNNVFPFPLEEHIPSNSSHNVAEQSIFSFLNSNASQQKTN
FT                   LDIIPLNDEPNEFPKNRLTLSNQVGDINLFDLHDDMCNNDPPLEINMNTEKNESSTLNT
FT                   NSNILQNGMNRKGEQDLQNELLHNDVDIVPFEPSHSSSSTRLADKYLTNECSSIHLRNY
FT                   SHNKINTHTNRICESSYENLKSVPIHERNNSTKGSSSSESNGRLNDDTDVNKMSTYENV
FT                   LQMFNQSIHHLENGNVEKDTAAADKGKDEWGNCPEEVLLTHSRLFYRHGYNNLEKHSKE
FT                   RDSGNHMNKLDQVDRASPMLEKGEGNTSSKIVEDAKRCNYSTPHIVDHCKESEDLHLEL
FT                   SPLEKCVNRHDMYMNVEQNRVNQNEESHLTEKREHFLNGLLSQIHNERNGDDHLGGDFD
FT                   GNLAANPHNMFSVGAEKVGLLNLHCLFEKKSENFCLISEGCAKASNYVNDSMLIHTKLY
FT                   NEIFHIKKDDMSTPEKCSMLGMSIAPNWNNSFNSFNSYNSDKRHKDSTEKQIMCIHKKK
FT                   KILCNICGNVLKKNILKDMFFFRISIINKKYFLSKRAKIKIYYQSPLIRANFVSKDNVT
FT                   YSLEKNMTEYKLRIIAINKKKMRKKLSLSKSKFFRKCLEIELISSLDNMLISQVEEKKE
FT                   VITYQRDDSSVQSSMDHFNTYKHQGLRDKIETRKNLSYEQIKNYSKRLSSMNQSSNDVP
FT                   PAIYNSHFAILNFSILDDKNKKYNFFFFLSPRCA"
FT   CDS_pept        565756..567765
FT                   /locus_tag="PKH_141230"
FT                   /product="methionyl-tRNA formyltransferase, putative"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141230"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141230"
FT                   /db_xref="GOA:A0A384LC30"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LC30"
FT                   /protein_id="CAQ41905.1"
FT                   /translation="MNITSYHVQIFFVIFLKICTCKLCYINKVYVGKEGQPPQKISQSV
FT                   HQISAKNVKASGTKERNQDKLNLTKLNGASGLSPSWGSCEALDGGRAFSEETHKVSCNL
FT                   LSILSSRDHGHGFHSGKEETVIHLTNALIGPKRFLNKYSFFKNNHEDYQPHPSEGRTHK
FT                   RPTQLFQWTNIPLHNVLLHNVFQNEVVNLHLHNVYLEIIRTAQSTLRSKIFYVDIKEEL
FT                   RKRKNTIMDMLHQIYALEYKRNTQRSDRIRDKDKTKIRILFIGGNEFSLLCFKVIRLII
FT                   KYVRNDIVLDHVITKSPRKKGRHLKLKKSHIEEEAEKEKIKIFYYDKIRNDTYMLKNET
FT                   FDLCISASFGEIFNASFFKNIASNVYTLHPSLLPLYRGASPIQRSLLNNESLFGYSIFL
FT                   TNLRIDAGPVLIRSPHTFGDAFNFNDIITILFTLGSLHLMRHIFFLANYKLGSTNGELQ
FT                   RTVESPNPSTISTHNNNKHLKIRHLLYDEENITPHNVKKKQFMLHTDIGQDKMNYAWLR
FT                   NYLMLSSTHNNNTYAPKIKSEERYVCFFCSTALHIHNKVRGFINWPKVECTLYLVHKGG
FT                   LKAMEVKLIKTSQESGDHISHQHLHQFKHLDALQSHKCFDGIPRKLAIFNRGAINILCK
FT                   DNSLLKIYKLQRKNKKIMDASSFFNSINGVDLLY"
FT   CDS_pept        join(568375..568628,568781..569054,569215..569337)
FT                   /locus_tag="PKH_141240"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141240"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141240"
FT                   /db_xref="GOA:A0A384LHQ7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHQ7"
FT                   /protein_id="CAQ41906.1"
FT                   /translation="MRSLARRWGTFFKYYDRGKVSFRSFYFAGKKQFFIHLFFISLNSY
FT                   FVKKYLFSNTSTVFHLEGKGVDAYLEKKYKSDKPYIKTESGILYKDLIDGEGDPIEEGD
FT                   IVYIHYQGKTTNDFRIIHSTFNSIIPPKIRAGQYDKKHIRAIYEIVIGMKKHTRRQCIV
FT                   PPHLAYPNHFPSQPLLYEIDVVKVVKKNSQGKTFIENAEKKIEQIKSFISSFF"
FT   CDS_pept        complement(569801..572197)
FT                   /locus_tag="PKH_141250"
FT                   /product="DEAD box helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141250"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141250"
FT                   /db_xref="GOA:A0A384KPR4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KPR4"
FT                   /protein_id="CAQ41907.1"
FT                   /translation="MENYLTAFFLLLKSVLSNSNRVRTGAPRRYLLFFVFLNTLVATKW
FT                   ITGGRRHSNWNFIRRGTAPVRTKFVLKSGNKGGVDNISWVKKKHAKDSDRRKNIVLIQR
FT                   GVNIDTNRIRYTGNILESNSSVQEIKHLSNLQKNVIYLLERNNNILVHAKTSSGKTTIC
FT                   LLYLILKFYYNSEFIFDEDIEREKYLNSDEYLNSYKKMLLLNGTRKKVQRSKLKYTPFS
FT                   EKYAQICDIREDTDLLMEKRARNVLKKGEKILILCPSKELCVQISQNILSLMSGKDEGA
FT                   IRLFIDKDGREDDNGPKCVSSWNLSNDVGIKEENGEEAKGRSADIGGVPTLTKCTSTND
FT                   LSKRTTNLRDNLFLIGTPICFKNFLLSLSKENLKDLLQKIKYVFFDEIDRMFPALKTRK
FT                   SRGRKNSTKKKTAYFILETIMYMNKKNLVFVGCSSTLNRELHRRIFKLLSLNRNNAKKK
FT                   IYLLRESNSSSNGDTSSVEGNPVDTIHPDSPHWGDTFNEPPTWDTNQERGDPTGGDKIV
FT                   TNAYQEKENIHVDDYADEDERACLFTQNGEDMSLQKYIIKVRLPNSIRHLYSVVKDQLY
FT                   SSKMEEAYKIVKHFKNRKVLILVKNGFSLLTLKRYLSERNIFSVLLHEELQISLTGNNK
FT                   HLDRMCQQYAHIKDLKETVLQNEEEIKRKYINKYPVIISSFDSIRGFHINNLEFVLLCS
FT                   RPKNVNEYIHLSGRVGRRNNIGYSILLEDERNVNIVTNWLTNIRVRFSKLALNGAISAD
FT                   VVSTDNLKQPDNSAQNGSAPDTDRGKDNLNYITSCIMDELNENLP"
FT   CDS_pept        complement(join(573266..576681,576900..577983))
FT                   /locus_tag="PKH_141260"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141260"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141260"
FT                   /db_xref="GOA:A0A384KPZ4"
FT                   /db_xref="InterPro:IPR029365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KPZ4"
FT                   /protein_id="CAQ41908.1"
FT                   /translation="MERKGKNNCNEGNLKFLKVYSKALFKYTEEEKDKKSREIVLLSEK
FT                   IESEKKLIKISIEIILIILFFILIYTSNDLVKIKNLENHIYNNINESKTYSENFYKSIS
FT                   DEIKKVNNDFSYQPRKKDYIIFKNLRSKFDLSSWIKNALTQRVSQDNFLNSNVLFGKCW
FT                   RITMRLYKKDNSMMDNIFMYRKLFGVYPDSSFLGGLEDTRNVNSSYFDTKWSYLFSHYK
FT                   SYKKIGGLYQVICGEDFSKIEERLSQGTSYSIDYPYFIPALILTNYNIASVAIDFLLFN
FT                   PLLNVLSYNVLKFSFLPNGDTYKEVVTQSASYNRFDAYFIISLSVFMAIFIVYVIIHLR
FT                   KFSMVGFTLYVKSYCTSFLLIACFATNLVTLCLFLLSRTQLPKLLVGYENGKYKVDSMR
FT                   YQTHEDGIIELLHDMNITLSRIELIKNIFVSNTIITFEVCLFVCVKRYGLLIKKYSNVE
FT                   NNIRRDFLHPFFIILCIIFGCLGIFSVFSYTLFHIEENVSSSIVQTFIFNVCIIFANFQ
FT                   GINISSILNEENILSYLYSIPTHFFIVTMSFAFIFFLAIKSFIKRNKNLYNSFMHNYGH
FT                   KLPKCRTSDKGGMHGRSDHLNAKEMYATSLQKNDAQKAKSSGQDLNDNSTLEITAYSEV
FT                   EDEMEEEGDHKEEDTGYSIDHLTDGVKKRDKQALSSDDNSTYSQEESNEYEVDPGNYGT
FT                   NKSLNYNDVMSITKGLNKDKEEGTEKKKTKEKAFFTIEKMLDLFLNLKNSTVLPFSNKE
FT                   KKRISKEYTTNKKRSEGVVVSLSVYTSLLIFIMLFLINNYKKGRESEKLLHYQIENIGY
FT                   YPSNGHFSNMTFHYLKKNVNVNVREIFNFQKVENKTDLILWLKTCFASFLDNSSHAMEG
FT                   GANDLSSTFIWKDIFTLKHERVRINITSRETIQSSNSSLICNYMRKNCYMDIRNESKDL
FT                   QRGINEVTLLINDAIEKVEISFILFDKNDYHNILVNLHFIFNPSGYISKKIYFDHLFFN
FT                   SFSIFHLRGVLINILFLTILLCPFISMYLYLFKNFSYFYNACVAVTVRHDRPDAQRGGW
FT                   LEGQFNAQSGGQVGTADNANGFIYGGYSPWEYNVGDYTQAYNWDAYANNPAAGDTNWGA
FT                   YGNNPTVGGANYRYYDAVNMPQGALNYGFNYGNMNTPPNRKSGKTHQMDALLKFKVYLT
FT                   YLFESNVLNLLIQLSSFSIVALWLTVCIYINKIEYNADNSGSYFSEYIKLFSFFSKFVN
FT                   IFYFFLFLVIINMFIFSSNYVKREKLYEALYVNRRQILKCGFMLLLVYLNFFLFHYFFY
FT                   GIDGFNDLLTSQQPIYSILLLLGLVNIDVYLKCKVFYFILFVLPHLVFIRFLLMYCFLA
FT                   PVMASYLIFLKKRGEKKKKKKIASQKGEDYSSFTLTHLSNEQWKYLNEDIKEFAANETN
FT                   SILHYFENVKDQIRSKEDISKTLKNECNGLKERVHELQLDLRKIELKWKFRSKLLSSSK
FT                   VYLDKINNQISMSEEMIVEDKNRMSSLKQYAQQMKLDQ"
FT   CDS_pept        complement(579286..585366)
FT                   /locus_tag="PKH_141270"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141270"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141270"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025697"
FT                   /db_xref="InterPro:IPR033646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L2Z0"
FT                   /protein_id="CAQ41909.1"
FT                   /translation="MGMLKNTFSSLSMKNRQQSRGKKEKGYDSDSSCQAPEDYLIDSAK
FT                   INTSGGVSGDSKSGEQNGTKLGGKYTTLKGKAQNGQQLATQRKKKKRKGKLKRIIRNTM
FT                   RLFKSPNLGRLIFKERQIIDPQNILNVKFVLNKPTHNLPPNVVTQKKSIQVSKSAESKK
FT                   EIVTKITKIIPLKKPIQFVMDKPVSKKIELKEKTTQDKLPKSVSPVPCNEPFENCYKVR
FT                   INKCQVPRLQELFGQMRKGSDFTDMDEGTAVDKGDIPVGRYNMLEDSTHNSSGGINCSD
FT                   ESGESSQSDEIGENCKLRDKSASLGEEHKENTPLGDKTNIFNDLLQSVKPCRSYNMDVS
FT                   HPLYNFLCKSEDSFLSSNWHDRINYAFRNIWALKEYMQDDKSEGEREKEFYNELELFHM
FT                   SSKIGACGLIYSLFFSKNKSENNSINYFKKCFVQLSKENYPHIYKIYKPKFDDDLVFLF
FT                   DSLVFTVILGSKRNGINYNMARKIYSNDIKGKKVLCDCIFSLKNSSKFSLPVASQIDFM
FT                   GMRVISEPLMPLTEAHPPVDVIKDIFRGFAFNNYMSDGISSDDVNTNDHLLSDKQTMKK
FT                   KPQNKCMNLHNEEKYLKKKKEKVFYERILLEMENYDHELYQQIRQMSDSMNYHSCIFPF
FT                   GFSNYYKCKIFKKRNNVKIFKSIIDNLFVVRGTEEVLPPYIDKSTEGNFTKRIRYEFIK
FT                   NYYEHSLCNTTLSIDIKNYKFKKYKNNVDLLKDASRECLHNIDNYILPKVVNIISNFSD
FT                   SFDITNVYHSHGVNMHHLGYVLRTDGDTTHPEFLSEIICREIICRTLKSIYYEHIHSFL
FT                   LGALGKEKNGTSGNCKRENQPCSDENPYPMPHFIYEENVHHCDDPSGSSRRRRNDQWDE
FT                   GALEECNKFICFCEKCSTEWDYFPEYVPHKFLIRLVNLTLNIRTFDSLQFWHQVLLPEC
FT                   MRKFKINLNDHVNIKEIEIYGLLICMEYHLGVYFNKECKRNYKVRLPLTLEDMSSFDSK
FT                   KESVLFPNVAHLREVCEWAGRSEIGETIEGSREAVSEISGDHGDDEANASNTHGYIRET
FT                   VRSDTRARRRGHAYKSLYKGVTTVAQRSYCSSERSLSGGSENRHTLEKNVIRRHHDDSS
FT                   TSSSNGNSNVSSNVSSNASSNARHQNVYSLVDKIRKKKLLSLRRGSRAAEKHKRDFTPS
FT                   TSVSSRVRENIPSSMNLCNKFQRSNIALFYPKTKGSFPKYATWSFKTVEKLISPNFIMQ
FT                   EKFKVKNMLKENVVNIIHPKNSDFLQMSNICTVGSCNKIKSFIHEYNIPCHPYCILNEK
FT                   MKCINYVRAKKCIYLLLNVSLDKNIFELSKQFLFLAYLHFEHGYVKKCLDVCYYIYGVI
FT                   PNIGTIRRDILILILQCKVKEGNIDDALIIYKLIVIFNKFYEGHGNSVHTLICNVLLAS
FT                   YYYDRANERRGKCTSGRGICDKGRENYLSNIPNADRRNHNQGDYQMEVFTTDEDCGKNK
FT                   VLLDQVDHFELKKRYLLKALHYAEESYGAISTTLCDISTHYVCIFALMLQGNILMGLHK
FT                   FQSAIKYYNISLQNCERAKVPNFVTLQNKCLLAESLKNNGNYDKAIEISEECLKALSSC
FT                   TQSSRSLTLYVLFRLAEMKQYIGCRDLVYPNIFLDNIPNAHIKKKITTSDFVIFEKNYL
FT                   NEKNKKYRKEAIDLYIKLYYRLKTQKNYNLVFAKDIFGCYYTKDDLLSQKNVKTDMHQD
FT                   YMEKIFLVIREILKIKVISLSMKKQVMLASKLLCIVLTKNSSPFVRELTLLKRGAKKNV
FT                   YEKNLSYDKFHSDECSPTMVQPSVTKRKDHMSRTPYKHNNDQVYITDLLSDIHTNGQEI
FT                   YARKTLPFQLGDFHQSRQSNFFHRSCYTHEYDYISIEKLLFDETYFVIEDICKWCYTKC
FT                   DSFNSKQKVATETNLSHLLNPSIWFDLLFFSVMKGTCSYTELLILIDLVKFFLTPLQKQ
FT                   LVLFRVKSLSNIRGDEQYSEYMEHLLNNEGKEILRIMNILDREKNSGNLCVDEHPELCN
FT                   LHKKDVVKNVDYLSNIIVTNPWLMSTSNIFDNAR"
FT   CDS_pept        complement(586871..587698)
FT                   /locus_tag="PKH_141280"
FT                   /product="septum formation protein MAF homologue,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141280"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141280"
FT                   /db_xref="GOA:A0A384LA30"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LA30"
FT                   /protein_id="CAQ41910.1"
FT                   /translation="MKQHSHIIGLGDIFTDAKKCWVLLASKSPRRIELMKLMGVSNLYI
FT                   CESGFEENLDKKQFASAEHYVKENALQKGLNVVKHVWFGEQANTHMEQNPKEAEKENTQ
FT                   QGSNNGHLSNGQPDNKEHCTDATKKYELRNLYSTYDPMPNVIISCDTIVTLNDEIIEKP
FT                   LNREHALEILKKLSSNVHCVYTAVCIFLYKTKVPITFIEKTDVYFDHLLEGDILAYLNS
FT                   SEPYDKAGAYSIQGVGCQFIKKINGCYYNVMGLPINKLSKTLTQLYVEGKISA"
FT   CDS_pept        complement(join(588834..597964,598140..598653))
FT                   /locus_tag="PKH_141290"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141290"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141290"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LQ00"
FT                   /protein_id="CAQ41911.1"
FT                   /translation="MTAEGEQHHVGGDKMMRHLRELEKSYHIMTKEYENITNINTRNNV
FT                   ENIRIIKNLFILNTLIHQVNKKHLMNAFENVENTLIFILKKNNTNFVLKLIAIFYLNLC
FT                   TYTSYNVRELYGRLFEMTLNRSLVNSPSELKKLHEHFLKNTLLFTSLILAHVHSQIGPH
FT                   MTALIEYSKKIKKSDSKESRYFYLKCVNKIIKTVQMTPADSEKIYKFLKRQFNEKDELI
FT                   KYRIIKCVMSMFIVHPEYSLLDFDFFVNCILDDTYLSTCISLVNLIHIIKLLTVIFCNC
FT                   TNVSYKRSINDHGAGRSRIGKAEEDAFIRNGATDEDDEEEEEDDVDIEEREEGEDDQDH
FT                   EEKESYAQEKEKKRNNKGSKTTNVEGKKKSFFSDFLKIATDEIVSKISNIKLEEKEGGK
FT                   NYIKLEHVDGFLFLSDNLFNKKFVRNKKSVLFVYDFPSFLVFFKKTLLNMFSDYHHDYT
FT                   ELKKLHFLRKLEKYTYYADVLNHFGTNVYTPGKGGDAIAVAGKVYEFFRKQKKGSRMRG
FT                   ASSVSVGEEASDSDTFINYLLEKDYKLMKEKEQLRYDDLQASIEEKKILKTYYSLIRNT
FT                   LLRSIFFQSFKNLLSFSKKFSGKSIIKIIKLFLHLLDVACTNCAKKKNLKNRLHTNNIT
FT                   NSFEINFLLFYFTDIVQQLVREKKRDTYTIVKEKEYKAKEREKWKMDDTNEYDDRAERT
FT                   RIAHEEENEKRQNSSLFCEQIDQKGRTIVQSNTTQCGEKGTKNFEQIGTTKSSDTHPGD
FT                   STHGGENDSNWYNRKSSTSSQNGMDSSNSNKRYNEFRAIKGKNRTKEEEKKIEEDNKVR
FT                   VYIQNQVKNYLIRNNDTNMDVNEKKKYNILLKGLIILYNKIIVNNSSIKKDKYNKYESF
FT                   LKIILNNMNGVHIDIDLVRHIIHLFVKVFLKFPQYTYNLITLLVNYITIINANFMTSLT
FT                   LNTFDDIEKQVSILIISSVSLEKILYSSCRFYRLYHLNNLILCVFDICKLFLSKVQTHP
FT                   LKTINEMRRIISFSLIHAISSVVVYEEVRNRRTVQNCGQIDAGERISEMEPCVATTQEK
FT                   MQEIFDKHEQLYDNILFKLLTDILREMLNEIEKEKMQCFISSYEEQIKKKKMNSSNFFI
FT                   VDNLFILVYILKTVHTILASDILTFLFFDHIYKIVQTLFDFLRQVYQVKKDHYDKGSEN
FT                   YEVQVPTITSSKKRKEKSATTGSYSKKEGTNSFHFFEYGFTQMCRLINIENVFLIFLIY
FT                   MLKIFCRVFKFVKHKFGKGAKTAGSSEYVALGRNGTNIGIKSVEERSPCEGNYREKNYK
FT                   QDSSSSGTTIVAMEEVTNTTVNAATVTVPMKKPFTPIWEALIEAKSFEGTPFNVFLDLL
FT                   IYLVKNKDKDNFNNAVINILQRGEENHRAKKKRKEGIKDIGKRKRQLYGEEPELDVLYM
FT                   LTNHYEVYYELVLIHFVQLFQLCVEKKKYFNVIIKNIYRCILNVELNKNELIIYLLILD
FT                   KFLKTKFFNKKKGKIFKCMLPIFNVLNSHFVNKNSGLLNALLIKNLTHFICQDDNIDSY
FT                   IFSYVTKFYQAYSRQILQEKYLCVIFSIFLKSVILSYIKIEDNNSYVVKNVTSVKKENS
FT                   MSNLEGAFPSSNLSVGSFCSSTFLDTPSSTPSRKVLVDKGRATKKIKPKKATFTLANFR
FT                   TLDLCQPLSFSGRRMRRSTSRRINHSKFYNRSEKGKLTKYSNSGLSRCTQGKISHVDKL
FT                   ANDNLFNEKKGKILEFFDTYLNMLKVIAHDNKVFSVVLRNFNVVIRRMHTRVNLCRIKD
FT                   CLYVVLAYILKAENTNTYRFEVNRGGCVIELFNNLLRILRKGGMRIGRKGDTKLGVKKG
FT                   HKLPTRKKGSTEMKLSTSQRQMYSEVESHVVNIFELFLTCYEKKTDRRLFTTINIMFRL
FT                   VKKKKLEKFMNKISILIQRNIFLQSDKNKIQVAIKCLCKLSKRKIQIPLSDNFDYHLLV
FT                   IYNHHSGDMLNKCFTEFLKMRIQTYGFYNVSQWIKLFDRILNSKNMFLYDLIKYRSKGR
FT                   YAKYERSDCNKNLSEHDATKENNLLTNEKQPSEELKDSVTFHTSLFSKHFSQNRHINLQ
FT                   EENEEKGGDRVMYFFNVFKLRQSDFTFSFDTKYLVMKLLLFFLKTVSLSPLVCVHNDAY
FT                   YVSYVKRRLKKGILNVGGPANGQEKHMGGRIRDARSLNGAARKGYRKEGSPRSNGKDSG
FT                   TCTRRSHDSDSSCNDLVSAQQSSTWNKMNKPEHIPPGDNFLLREGKHMMKDKISYIEDV
FT                   LIRKKCSKEEIKFNNVDIESVVENFSLYDNIEQMLNIILHNINYGIRFEKLSRLAIKAL
FT                   ILFLKIFKSSKIILDEFSTNHEIILLANYEINIFTSLKMYYESFHFLYFSYLEGDPPRG
FT                   GNNSDLVGDKPNEYLQFSHFFLKPLMRVYNLFLLLNEIGLCNSHSKFVEYFFYFAVKGS
FT                   HAVREELADSTVYVREKSDMINGNISMDGHDASNGDALAHVSGRKKIPTINSSLFFSEF
FT                   DSSVYYLFSYKAFCLYIINSEKAQRNLGNFNIKTVVKNISYILYDTIVMYFWSFGHNRE
FT                   GGEKDFQDQVVHRFFTCMNDKARSLSIFYFSAFVIFLQFLNVIRRSNELIISAKNCTLY
FT                   KTLIYFLCYHLKEHKDKLKEETKEIYFSFIFGYLSLTGFVSDLSHDAINSISDQGDIIP
FT                   NETQLSSSVAAENREKKSDRIENSSKSNGGGDMSKPSSVPSEIVQDSYNASRISFLKTI
FT                   LDYVLKHLVMLVNEKVLPSVLEFVSVAHEHFANVYVEGGIHNGVIGKVFTLHLFVLGMF
FT                   LKKRRYGDKRGGGEFRSVHDGDMLTLLWNSVLSCYALLERLEGAQLEEGKAEEGKAEDG
FT                   KAEEGKVEDGKSADAEVMDAEATGAKKTEDKMAQKIRGLLQALFLEKMKLLKEEKLSTR
FT                   LLKLFFQKCRESDLQNYLIHMKSYKGEIAKIVKEQDLPRLKLFYIKVIIFIHFINTTDM
FT                   MNRNSKVHYTEEILNVFITASRRMKMTYHNIGIEMRRRNISSKKREEGNGHTKNQIIHS
FT                   FLNAIKNIFTLLLKREDSIVSYFTHNLIKNDMLPILMVNHCTDNLQYEELVAANSWEED
FT                   IITYPVKILNSFFDTFISREALLRKIIIPYITFVHQVCRLCDAKRVDITKSFFTIQADG
FT                   DEMTNPLSVDEGSSCPQKCFSHAKVIRTESGTTTVYFKEVTNLFRNIAFKNASFFKNIL
FT                   TDISAEEKVMVYNLIKEAIAAEKHTEQRSKQEKEKLDFSFVN"
FT   CDS_pept        complement(600499..601701)
FT                   /locus_tag="PKH_141300"
FT                   /product="Ankyrin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141300"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141300"
FT                   /db_xref="GOA:A0A384LLS0"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LLS0"
FT                   /protein_id="CAQ41912.1"
FT                   /translation="MSSKVWKAILKDDVVKFKNSIESEGDVNLNSYNKEGLTLLLLGIE
FT                   KGCGECCHYLVNECNVNIFLKDKKEKDNALMKCMVLGHDMINLSRLLIEKKIDVNEKNK
FT                   NGKTSLHVASEYNYVKGIELLIKNHAHINALDNENNTPLMCSIKRSKEEAAILLIEKGA
FT                   DVNIKDRDMNSVLHICAKEHLGNIAQSILLTQKVDIKNCLDNENNSPLHIAAKENQKGL
FT                   CELFLKHKFDGCLKNNNNETYEDILKKNEKNDILKEEEKKKNYQEKEIRKRKNYEEAML
FT                   KTDVSNFLKIHNLESLAPHFYKHNYVYVDQAFLDVNDSTLKKMNLSKEERKLFYEAVDK
FT                   HYSQIEDEQNEQELVNRQLQEEQRRTKRLKLVSYVVSLIFTAIFIYSLVISILKRGRIF
FT                   F"
FT   CDS_pept        602901..606467
FT                   /locus_tag="PKH_141310"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141310"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141310"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LFI6"
FT                   /protein_id="CAQ41913.1"
FT                   /translation="MIPPRNVLLKIEREITIFRQLKRLNKIDSETRRLQGNGEGTLEAS
FT                   SARNRHRDSKVYLTSSKISKDNSRVSALHLKGKKDARWEDSNANYTNIHTQIHTHGDKR
FT                   NVTSQNEGERYNNRILSSRLQNIRDSNPPSGKGSQWPLPRNDQSGSTPTHGNGNPNLYI
FT                   NKLHDYLDIAQKSENEKIKINKILNRLRNENLTIHTILEVLKSLCIILLKRTPHNLDNL
FT                   IPVDYLNTKNAVKKYNSYFEEYFTHVERYIQNYICLINERNIFDLFKYMYYLNYALNLE
FT                   VIELLLEKFYLHMEKLDNLKTVQIFYMVQSFYKHFYSKEVDSYLTLIVDDKISTTYNDE
FT                   LVRGKPTYWSHPSQDNKYTFGDLFGESSSKWTLGSNTSGLFTSGSQERNDDFLRRETPP
FT                   LWREELKGEHNDGEITNFVSPNNARVNERRIGESLFFKSPGSGNPMEVATSIQGQEFGD
FT                   SSKHMNDPTAKRRKNIEEDEILTIFKYMENFHHKMNFYYTDKVMTFLKKNRNELSTDTL
FT                   LCVANIYLNGADENMSRNLTQVLHDRVDHMNEDQLVRLADYLKRAKNVESIIIEGVMVR
FT                   DKKDGNQDIPLVSKILQKIKKDNELITPNNLAAVYLNMHEVFNKLLPSSVNITYGKDDP
FT                   LQRQMKKKESNQDPREDGTLDTVADRENIPTMANMSIGDDKKGLVMTTGGVLEKNSLTQ
FT                   EMIKFCDNYVNSITHFPSVLSLYLLYIKNDAIKNKTIQAFEKKIKMNKHKLTQENISNI
FT                   ILSLSIYPYHTTQMFTYLENVIGEKLMSGGGRADEAGVISSGEETTGVATPVVATTGVG
FT                   ATVENDVNYSKHPMYVDANYLIDISLAFGIAGRKNLNLWKFIDVRKIVLTCNKKLLLYL
FT                   SYSFLLTNYVCPVSWFFLIKRIVDDVRAFNKKQYELLYEILKCAMMFNYIDLNNFSNGN
FT                   SFGYVDRWKGNQLLEDNSFNSYNNKNSNSPSHFIKTFQYLLNSSYFHYKMKLINNQYIS
FT                   KVPYEEVFNYLKLKYEKNVEFKQLYIMPYLLTDYNVIIDPLPSTPIHRCSGYIMGEIQL
FT                   KHKVFQCDNYVVLSFYDGMWDEFLKASHTGGEVAYDIKALAEHFKTYTESHIKIKINKA
FT                   PTARADVGMHNSGGTNAPFAIDNKNKAGGPPPGVHYLKYIKKDSTQEQRNKYLTHKPNS
FT                   MSSNQDQNKYLKIKTKVGRKAP"
FT   CDS_pept        608263..610452
FT                   /locus_tag="PKH_141320"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141320"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHZ1"
FT                   /protein_id="CAQ41914.1"
FT                   /translation="MSEKEVSTLPDEVKDLLQCLKEGCSKFQEYLSKLKEYLEKDRIKN
FT                   TNTLVEYILKNIHERDFQKNTCYFLPDVIVYIQGVNKIPKKDELDCVDVGLTLHKQDVR
FT                   EKWVDDNYDEVYGQFRIEIQDEKLRRFKGKDYRMDLIMTCTKNVNYMEIMYVLSKNMYP
FT                   RNGYILFNNILHNSEISYRYKLLSLEYFAHIVNKISLERAKYIAQILPLVLGKFYSIEG
FT                   KPYYNDNITSIDVLISMCKFSNVLCDESIKTQEDDKQDVALHSIIAFIMKIISYHNAEL
FT                   PINKNIEKMIKYIHYDNLEYEKCLDIYSKLSSNLYQDRREKMVKDCLSGLVWRLSIINS
FT                   NIPRLLENVNILMPNAKACALENSTLEISILAYLIFVEKINESSFPKIYSELYLLNLII
FT                   RNSYNLLLCIPQADDDVKHNLLIKAYHLICLSAILSNIIHKRDETVFCNIYNFRWRPME
FT                   FLKTVYRTIHDNRTLKTYSKVVYNALCIIMRNFKWDILYSLYYKLLNESLPDNARSLIA
FT                   SFVKDEMHKQMVRVVKKAEMIKQEFHQNEDFEKLPNQVIQVEKNKLSCPITPPEDNTQL
FT                   AKMKQMAEEINKLGAQVKNIIYILISEESVLLNVDAITVVLNIIKMILLNKTLKPFYNF
FT                   IVNIEEPSSCFVQSKIKHFYTQIKLEKAILDKEKKEDANSIFYTNMNGYSRGHGPHREG
FT                   LTYQNTDVTMNELDIVLMLLGDVEQCVDDIKASQR"
FT   CDS_pept        611997..618851
FT                   /locus_tag="PKH_141330"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141330"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141330"
FT                   /db_xref="GOA:A0A384L6N0"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR003545"
FT                   /db_xref="InterPro:IPR021891"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L6N0"
FT                   /protein_id="CAQ41915.1"
FT                   /translation="MMQGGTCEDGGHHVRSDNNVIRDNCVIGQNYVVRENYLRNVFQCT
FT                   DKKVKIFKTYLKKKLKVESYTLGEYSLKHDEKFRRIFFANILKEHVIAKRNKDKLFILN
FT                   EVIMDRKFFEEDFFYQYFLQNVLLLEDLTLKRLEGNHHGDFLFKEKKKNGILNWKQGYS
FT                   HIKKKLNEKGNDQKSKIYKNSVLLFNSTKFSYEDKNCCDYFYSLKVWDIFFNYVSFDFL
FT                   NYLLSNTLIFISDFFFINLTHKLPLQNSFLVLVSHVDLKYDQNKQLQDTIFSRKRKLPY
FT                   NTKQVKILYQRDHPRRTLKKVLLRKETHEVVGLQPDGNPPQEGPSPLHINGTSEKRHSH
FT                   RGDESVEGEAKEEFQSVSKSNCARSGSKRKIDQGGIDDKVIAGRKCKKKKMVPEDTSKE
FT                   EKQIDIDGLKYGIENREAQRKIDTHPDDTQIDGQQYKYLFKKKKEAVRRNEVNSYANHL
FT                   YLVQCSGRIIKNEFLNEMKQIQKETEQAEEAPGDDIEVSEKGIENLNEEEQSAQRKVLP
FT                   QISFFSNNKAEGGPPTNWKCKTPQEEKKKWSKIIINRNNILQHNTTNKYKNFLLNKSIL
FT                   FDKIDNVPLFTYHLLNYIFKSDQKYFFHNNFIDEYKNKISKQIKCNTKKNDISSLLLRK
FT                   ESTTSSNVLLCSRSEDKRNNVSARLKKTKILKYVYCHFEEFIKNTRNANFDKMYRQYFP
FT                   KNKMKNRIRKIFKTIKSHIIHKYKIVNIRRNRKFIKQKMYDVFFKNYDFLSFSFKTYQV
FT                   INFLVHITKKCVPVKLLGNRHNFKVFIKNVKNFVLLNYKENFTMDQMMKHVRVKNVFQK
FT                   GEISHRYEHRQGRSAEVAAPEGNATQTMTHALPNLCSTDTIYQKDKTWKSKRSTKQIRF
FT                   FDPEKNKSLFETLRRKYLKKKKKIHIALLKRHLLNRLIYFLFNYFIMPVIRKYFFLTKS
FT                   EHTIYKTIFFDRISWNYFTKVSNFCLYHQNFRGKKLKRRSESGGKDQTRNGKLKRRKLQ
FT                   KDHIISKGGKLETTRAEKVINEQEGINASPRVIQIRGRQIEKEKKFRSPALPNRKEKKR
FT                   KKSQNALIRSTKKKETSKCGKNERRGNSSSGEPNKRIEDLYEMTILSKKTVRPYLRKFY
FT                   YKVKKKYFSLRKKYLLHGRKRIPLGDKQFAHYLHFVEQRGHLFRFICRRFFKKTRRNYV
FT                   KRFYRLVKRIKRRMMGIKHDPDGGVKRRIDNKVIVLCGKNDQIKRTKKRALAITTLSMG
FT                   ATMRENLPERKKKNIHIHKLKSMIEKRNFLLKLNSINRFFSKKLRINWVPKKKGLRPLI
FT                   NLSTLNIPESVKNRIREILKNKKSSEFYFHNILNNMERDSKEKKSGKKKYNRKNFNPVS
FT                   LNHICNFSLKCLGNVRNNNRALFQNTLTKTNDTELKLKKWLDYLKNWFYRKKKNKKYIK
FT                   NKLKKGKVIYAYICIGDFSNCYEHIKHNYLFKILKHFFHGISNFEFIYVFKRSFRLYSH
FT                   YMNNSLLTYYPVNVQEFGIHCIKNLRELIVKSNLNKSHSFLLRQFFKNTSCTDLYIFSD
FT                   SYKSVQVETRDIFMTIITIIRYYYLNIYFSIKEIKMQWKNIFYFQLFQHEKREGIYRSF
FT                   RSRRKLDHLRRLQEGEEVENTLEGGRCLPDDESGNRMNSIQVKHLPLSAAITTSTSERG
FT                   DGEGGEDEKSSSTKLPRQNKDQLMVRKPGENDKEMILLTKGEGANIICSDKVHPNCSNR
FT                   SVTNFPDRNPRAETEAEKGVRTYAEKNFLTFQDKKIISDICGLPQGFCLSNILCSMYYA
FT                   YLDRNEEFQNILYSEKYQDRTSTSHLQKKNVNEVNYQSLNSLLIRFIDDFLFITVNKKN
FT                   MKQFKRLLLTRKIWGENINSSKTKIFKLPLIFKSNLFLDNFWGEKVVSGGKRCHTEGQR
FT                   HPTVLNQPCTSEHPPSLTNEYTSPDPYLMTPEEECRTPSGSTVSSAMSEPKRRRKIIPE
FT                   RNETVQKIPTNDNLARSAKCNMSRGEEKRRITSVKGTVKIVKKKGGKLSEGQTRKIIKE
FT                   LLEKRKRFRGKSSSTGRQKIKKYLKRLSRLLRLKRQMRRSEKSSCVNRYYGIHPRTVMS
FT                   IEWLNNTYTFDFANNCVHSISSQWKNKQDATIRNHLHLTNGIGEKSSPINYMKFLVEGR
FT                   IMRNVISKMKKNKMIYKNKQNIYFAYKNNFILLKSSILKFICSIKSLKKMFNAFYNDGY
FT                   NTKFIFHLISYLRKSLIKNRKIKFVKLFLVDTAMEALRYARVFNSSSPLFPCLRRLRTV
FT                   RRRLINRYKRRNMRTNRRDHLVQYYGLFGLLREELRNTWPYMFKIREDSSLHNPLR"
FT   CDS_pept        complement(618925..620355)
FT                   /locus_tag="PKH_141340"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141340"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141340"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR039658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KRI8"
FT                   /protein_id="CAQ41916.1"
FT                   /translation="MKAPAWLSFARVGRRNFGSSYLTKKLKTINDRALRYHEDYIKSLD
FT                   ILEGKNRSVIKEIFPNKKSEINELFFKRCGSSTGVDTSNGVENLDDDVDLLDLHKSEKL
FT                   KYQHEMKSMTLDEFGIVRVVHNDILEEEADCMLIPMVSNFVPLSGFGAYVLHRGGRELV
FT                   KEIFITIKTLIKKRIDVLNEHREEYLSGSQDKLSSEKEFKKMVENAKSLQVGDVILCKP
FT                   HNVSDKVKLLAFLIMPYFWQGNNYVSSNKLRYSFASALKQLNELCISSVILPDMASGIY
FT                   GYAPSSSSHILLDEAVQSILQIGATVPLYNLNSISIVDKDINTCRTFSEALEDVSRNYL
FT                   PHKKVLPAPKYWNVVNRRLLEIPSNVVYFCRKQNKISFRKYHGIIRRKFQHYYSNIRPF
FT                   KWRASRVIEPNPFLLYQKSGEPSSYQYGPKPYYYKGVSHTLYNIGKKGLLNIRVGRHGR
FT                   LQALKKVSSISLETKPRL"
FT   CDS_pept        complement(join(621352..621566,621752..621908))
FT                   /locus_tag="PKH_141350"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141350"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K9I5"
FT                   /protein_id="CAQ41917.1"
FT                   /translation="MVPVLARKVFAKNKLNGNVTIKIKYMCRRNFSGVKFLDGNRKADE
FT                   SIYFKKEDEALLRNLLKNNPDLNPDFNFTDAEGGINNLSNDLCMVFSKHGIKGLSNSDA
FT                   IKDIIKVFELNGYRKALDQ"
FT   CDS_pept        complement(join(622845..623030,623253..623423,
FT                   623661..623778,623973..624115))
FT                   /locus_tag="PKH_141360"
FT                   /product="cop-coated vesicle membrane protein p24
FT                   precursor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141360"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141360"
FT                   /db_xref="GOA:A0A384LJ24"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJ24"
FT                   /protein_id="CAQ41918.1"
FT                   /translation="MAFLKIPVVVLLLLVFLSHLARCTHFIIGPLEKDCIHFRVEKNNT
FT                   IVGSYEIIDKSALCLMYIVNRNDKKKEKIFKSQSIQDKFEIKVAKPGIYSFCYANQKNA
FT                   EITVMFTLRVKESHDMVDMELGTADDVEKINNQTFQLYEQFFEVYEEQEKMMETADLYK
FT                   QFNEKMNSKLILWSEVQIILLILLTIIHIFYIKSFFDIKTIV"
FT   CDS_pept        625314..626570
FT                   /locus_tag="PKH_141370"
FT                   /product="lipoate-protein ligase a, putative"
FT                   /EC_number="6.-.-.-"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141370"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141370"
FT                   /db_xref="GOA:A0A384KAT9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KAT9"
FT                   /protein_id="CAQ41919.1"
FT                   /translation="MKQRMNVALKRWYSSERTKNAKPLILISNNQNIHFNLSLENFLLN
FT                   NYSDLLKYLNVNTVEKFDNPVLFLWRNNRSIIIGKNQNIWSECNLENIKEDNVLVARRF
FT                   TGGGAVYHDLQNLCFTFLNNTLNTDNNFSIILKTLKRHFAIDAKKQGRNDITVNDRKCS
FT                   GSAFKKIKNVFLHHGTIMVNLQKDVLQMYLTPDKIKYIKHGVSSVNARTMNLKEVNPNI
FT                   TCQNLCHALIKEFQAFYKNEVSEEGEESHTTTLNVEDYNDGNEGATSSEQLSMNLKEGE
FT                   KNLENLVDNSSPISSHFNIHYIDTNESITKNPEFLKYFNLLKDWDWCYGKTPKFQNRLC
FT                   KQFNFGKFEVFFNVSDGMIKDGNIFSDCLDVNLVEQLKLIFNNDVKYSKDSVASFLSGL
FT                   QVDNKETLSEISEWILQEL"
FT   CDS_pept        complement(join(627223..628530,628660..628692,
FT                   628969..629030,629248..629371))
FT                   /locus_tag="PKH_141380"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141380"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141380"
FT                   /db_xref="InterPro:IPR006786"
FT                   /db_xref="InterPro:IPR039853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K863"
FT                   /protein_id="CAQ41920.1"
FT                   /translation="MKSFLSEEDKLKLTIRKNYLERDAIKTKILNYLNRLSHLCSDDKD
FT                   ELNRRERQKRGFFEENSESFPEFKIEKRPKIEQDETTVTRNRRLLQVGLLEHLKKAKDA
FT                   LEQEKSNEKVIRQQMQNKRVEQKLQEEKKKFEKHQLDDIEKRIITHIKEIKNVDTHIKT
FT                   DEAKLMKLTLINHYEKMKNFISTNCQPTIFWCPFKFNSKTEILQKETDNFIRKKIEAIK
FT                   ESNYDVDFEEEPWVVQFENLKEIVRRRNGQEGEATGVEDKVDHEEKADQEGDEAKKEGK
FT                   ENHSEDEEENNDEDEQNNGDDENKDEEDVENEDEENDDDKDDEDDEEVEEENYKDGEDD
FT                   DEKEGTENEEEEENEERNENQVGKESSNGSHYTEEKEEDTEGTPKKSPSNDSEVNTSQN
FT                   SNTCQERDNISNEDFYPDNAGDEDLKCREVSEANAEHDADRTGEQNGTDEPNETNETVE
FT                   LDEANAANVTNETNEANEANETNETVGDNDGVAVKKNARKRRGRPKKKRR"
FT   CDS_pept        join(633326..633340,633564..634301,634476..635303,
FT                   635485..635814)
FT                   /locus_tag="PKH_141390"
FT                   /product="KIR protein"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141390"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141390"
FT                   /db_xref="InterPro:IPR008780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHF7"
FT                   /protein_id="CAQ41921.1"
FT                   /translation="MGPPAVMAQCDVNKLPSKRVYSKLSAGWACRFETRDKEDFTDTIK
FT                   TNIWNALGVWNAGKSYLADRIYKAWCYTHGVMKTEFQVKKKDDRCRFFYFWLGDQLRTN
FT                   FGEAHFESLMESIYSTLGTYKFDGRCDNPYPNTKLELFERAKELFDYYYDYTNLEKKDN
FT                   QSKCPCKEAYGTLHQTARSSYGTVSSKCAQEWKESTYCEEFIKNPTNLNPKPLLKELTC
FT                   APGISKVEEESEDEDDRDDSFPIDSDLDKESKLNALPSRRNYYNMFDEGMTKCNEFTGW
FT                   PNQIKAALEGDENVEEHVEEIAKGLCHAYETKKGENSDSEKLSQDYCDFFYFWVGDIFW
FT                   NNLGKKSFKGIMEKIKDAVGKSTSDHGCSFRFKTKGLNYFFHSKILFDYYKDKDDMKSR
FT                   LQQKGEEVVAKCDDPYYKYFMAAQRAYQYMNKKCPSTDKESTNNEWCDEFNKMYKECTN
FT                   VGVGDDGKSHCKVAKTPLPPPEQCNSHSTPIAVDTTSSSSETGSVTPATVVGGTLATVG
FT                   LPAIGFYLYKYTNVFDGIKKSLFGGSNTGGRNRGRGRRSTVRHTDHFNGFDSSTMGDGS
FT                   TTLGGGGGGGGGSSTLGGSSTDVSTIYNDDDGGRRRRPSPPRGRAGANNRRPGNIHYYA
FT                   T"
FT   CDS_pept        complement(join(636443..636661,636808..637122))
FT                   /locus_tag="PKH_141400"
FT                   /product="ubiquitin-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141400"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141400"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K870"
FT                   /protein_id="CAQ41922.1"
FT                   /translation="MDELTDICERSSSEEVHAVYIKGSNNFVKRVEYKEDESIRDVLTR
FT                   NGILNGQDGFLYQIRSQLIDLDKTFAHYKICSGEIIYILPEPAPLPYLIYLFHQKSGKV
FT                   HCIELSHMDAVDLLHKQVEKILQIKEENQILIYGGKCLNSKKTLKEEQMCRESLVTILD
FT                   KRDIPEIENGADGV"
FT   CDS_pept        join(639694..639723,639874..639958,640093..640228,
FT                   640408..640498,640676..641539)
FT                   /locus_tag="PKH_141410"
FT                   /product="ssl1-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141410"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141410"
FT                   /db_xref="GOA:A0A384KQZ6"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004595"
FT                   /db_xref="InterPro:IPR007198"
FT                   /db_xref="InterPro:IPR012170"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KQZ6"
FT                   /protein_id="CAQ41923.1"
FT                   /translation="MQKSQNFENETVLVEEVVRDFDKNEVFEEITAKFTWEQDVERSWN
FT                   LLVENNGVLQHVSQENFEEKSKQKYKKNQVCALRKGIFRHIIILFDMSSSMKERDFKPD
FT                   RINVVLECVENFLTNFFFKNPVGHVGVVALKNSSAKLIQPLTSNMEDIMNALVKERSMG
FT                   LQGSPSLEQGLEIAHDLLVDIPLYGTKEILIMYGSIRTCDKKNILNILNLIVKNNMHVN
FT                   CVSISPEMHILKHICEETNGVYKICMTKNALMNEMNNVTETPLWMIGMEPQLIHICFPI
FT                   KKKISTQIMCSCHNHLNTDTYICNFCNSYTCKIPSKCKVCGMHLISMHDLSHITNNLQG
FT                   SPLFIEIKNEKNGPSACVSCNKPLYDKVSQCSKCKNIFCLGCDLYIHEDLNQCPFCLIL
FT                   DT"
FT   CDS_pept        join(644336..644693,644952..645238)
FT                   /locus_tag="PKH_141420"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141420"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141420"
FT                   /db_xref="GOA:A0A384L5H9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L5H9"
FT                   /protein_id="CAQ41924.1"
FT                   /translation="MAGTLNLKELKDEPILFYENALSYVFSNTRDDNKKDVPACVIYPN
FT                   ETIKIGFPIYSIKNINKNENVINDTDVQTNRFNEEPLITYASESKHIYPLRVKIYYGIL
FT                   YMLIISELSAMVFFKDNINLTTTGEINRGQAFVFLFMALSHILVILSKFRKIKPYVFDL
FT                   YTSLSLFFFILSILTINCFSSSVISILQFFIFFFHAKIDYYVMAHSCVVPP"
FT   CDS_pept        646364..647470
FT                   /locus_tag="PKH_141430"
FT                   /product="serine/threonine protein kinase, putative"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141430"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141430"
FT                   /db_xref="GOA:A0A384L2T3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L2T3"
FT                   /protein_id="CAQ41925.1"
FT                   /translation="MHLGRAKNTEEDFLCKGEYKQVYLCLDRSEGNDAVKIDISYDNNI
FT                   HDILQLGREKYNTQGEYITDSCGNIIHSIRDIIDGDTLYLKDRREKLAIHGKLKNNLIV
FT                   NDYIVQKRIGSGGFGIVFQGIHIQTKQKVALKFIPKSNFLDVTDVHRVFIEIQTLRGLI
FT                   HNNIIKMYDVNHFENYVCLIMEYAINGDLKNYILKNNGYLSEKEAHDLFIQIIRGVYYC
FT                   HSKHIVHRDLKLENILLDKNMTCKIADFGLSDFVNVDQNIKTEAGTKAYIAPEIIFNQT
FT                   INYSVFKLDIWSLGILLYIMTQGFPPFKYAENNDIKYFDSSTLNYPNDISDDLKNLISL
FT                   MLNVDPNKRPIIVEILNHRWFGKYVQTG"
FT   CDS_pept        complement(647571..650438)
FT                   /locus_tag="PKH_141440"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141440"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LQC6"
FT                   /protein_id="CAQ41926.1"
FT                   /translation="MYLLKKRLELNHAGRISSVALLRNPPRRAIKIRVKNFAYARSIYD
FT                   CSTLQGDENYTDTSQGVNLKKTLASKFLPPGKDASSKYNENLRSIFFSNTMDDVKDYFD
FT                   NNSNEMKNHEYVYLLFKMYEIIFSNFYKTYESCDILRLDNPQFRFVTLNQYVDDWVGRY
FT                   GRSSRKRDIGTVGENEIIFYENDEHDGISDNIFENEGINLPSHSSHKEVKEHNIREYSE
FT                   RLEETKGEMHQVEEHNCVVDTPYLDGDTNHTARSYYTPQFNLNTLMEIHLSYVQYIEKL
FT                   NIRESTWKDYVSSFMAKKYEELYANVLNVIYKKIFFFSYKDIINYLYITKRINLQSIEE
FT                   VSMLAENVISQNIKYLDEDALVKVAYIYLNNSNKEKNIHQIGRYGSKDFLETYLSLIQI
FT                   KVKSMNNENFVKILEYVNSNNYKHVQIFRDLKNEVYKRYNNLTEEQIVKLFFLYSKNMN
FT                   AADDVLMRNFLKSIVDIFSHEEGEEEKGAVAKGVSCQGGPGVDKVFQLDDEGNGERKPT
FT                   IGIPLSILLNGIWTSAKYFKDYPFLLIKSERIILENIKNFSASTVSMLIWAYSTVEGKN
FT                   PQVRFSNELYFELKERALELYQNMTPKQLSNSLLGLSITVGRTVSWDGKVDTEMHEVVE
FT                   RYLLNMGGTKKGDNNIGNEPRIRLPERTFLNLCTSEDLSNLCYAYSLVRSGNRELHSLI
FT                   QSAIMKKQSDLSPQEIAKIAYAYGNMYFYSSYTLLSSLQYEILQRMHQFCHHEICDILW
FT                   CYCINRFLDANFWKCMLRVIDMEKLGDSRCCLLYSSLSYVNLIDPSILDSYNTLRIFHL
FT                   VSENYWQFQIAEYLHSFADDVVDAMYKENTLLLGSEGDKEVQKEAQGVEENISDINRDH
FT                   PFECVKKAYDYEGFLIDIYFEYSGRRYAVFLYSALNTSSSGYPLGESVLKARYLRKKNI
FT                   KTVHLLHSIWSECRGNRIDLIYAQL"
FT   CDS_pept        join(652083..652151,652344..653996)
FT                   /locus_tag="PKH_141450"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141450"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141450"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LP48"
FT                   /protein_id="CAQ41927.1"
FT                   /translation="MENYSYGSGAGKMIPSEQSISNVPSKSTYKQLDSTNLPDPKEPAD
FT                   YSLYQHPGNINLVDQNGYVLEETPYYSHGEINTTPSMNLYHGADMYVVGASNSKDIMEK
FT                   PNNTFNIPGTIPSKGAPNYDYINSALNINQGNYYNPYQVINDFVPGSESMKYEPKSGMD
FT                   GEYVIPEISTKMNNSYVMNVNNSSNISGKIVQNSINGYIDPDSYTNLYEYGSGNYSEPI
FT                   MNGIASMPDMKNMASATYPSGMGNVNYDLLMHNYNGDLYNNINSVSNAQNSASMGYLGG
FT                   LDIPPLKVQPYGASFNSFNYDSMNYGGVNFEGTNFGEANLGNTHFRDSHIAGSHFGDVN
FT                   FQPIPKDEFPLLFDKHKGADLLGEREGKYSKLIRSNNHAEGSHTHKHPPEQLQAILCLQ
FT                   RLEEIPTPFLNFKDIKYSVSVYFNSYDDILEKYQSQFYSCKLNESNTYADCDLKNEIIK
FT                   LPFNNEEFIYLKVIETSMYKTEVTGRLQLKVKSLSQEYPLRIPIIGDDGNSKGFLIMNF
FT                   FITSSFYDLKNDLLITDQSSLPSRPKSTRIRRKNNGFHFFENFTKWCCEITDHHMN"
FT   CDS_pept        complement(join(655951..655991,656156..657177,
FT                   657325..657455,657596..657607))
FT                   /locus_tag="PKH_141460"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141460"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141460"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBW9"
FT                   /protein_id="CAQ41928.1"
FT                   /translation="MLLTIIKWQFLCADDLVESLPRFGLFACFALPFHIATPQQRQTKK
FT                   PTQNLHNLKLVDTFFLQRSYIDCAIIVHGPNNEIYLFTSVAPYTINVWIFVPGEGSKEL
FT                   DIKHLKKIEFELTPEEEEYGDDKTKGNKKMKKRKKRVLSLLYAEECIFAGLDNGLIKIM
FT                   HLPSSDSSTLYAHTDSIYSIVCIDGIIISSSINGEVKFWKYQESYLSFVTIKKIETKTK
FT                   IFKMIEIISSKCASGNINSNSNSEENKFNRTLWLCGDNITIINLLNLEIVNVVKCKYGS
FT                   VVSVMQYEANVITAMSEGKILAFSLKGDNHFEMNTLPIFCMAGLTNHKNVPILIYGSTK
FT                   ALYTFSLPEFNPYGYLKDRESMALKFNINDPDFILPLSGPYFIVLFSNAGNAKVWKWES
FT                   KD"
FT   CDS_pept        complement(join(657907..657938,658198..658320,
FT                   658453..658507))
FT                   /locus_tag="PKH_141470"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141470"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141470"
FT                   /db_xref="GOA:B3LBX0"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBX0"
FT                   /protein_id="CAQ41929.1"
FT                   /translation="MRGNYLRDGYKNQYRYANGSDGNNKMQNNYNNRRNFYQKKNPNKD
FT                   RDKGITFCPHYTLRGLCRFSDDCK"
FT   CDS_pept        complement(join(662139..662320,662521..662614,
FT                   662778..662879,663047..663226))
FT                   /locus_tag="PKH_141480"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141480"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141480"
FT                   /db_xref="GOA:A0A384LCT0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCT0"
FT                   /protein_id="CAQ41930.1"
FT                   /translation="MASSSEKQEEIINLKDAFNLSILNRENTLLINNGNDDECFPHAIL
FT                   MDRRSIDLFNMDLTKYQKSEYRRIFNLNSRQLTDEPKFTSEPSANEKSSDAEDMDKKKK
FT                   KEDSTLKPRIHTILSFFVPFIGCLSYLFSLKYDESSPRRKYASRALCVGSALSVIYSFA
FT                   LCSLLGHYVYQYNSEDFYGYTY"
FT   CDS_pept        complement(join(664674..664742,664908..665020,
FT                   665248..665343,665457..665536,665650..665704,
FT                   665917..665975,666190..666229,666367..666501,
FT                   666735..666777))
FT                   /locus_tag="PKH_141490"
FT                   /product="phosphatidylinositol synthase, putative"
FT                   /EC_number="2.7.8.11"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141490"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141490"
FT                   /db_xref="GOA:B3LBX2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014387"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBX2"
FT                   /protein_id="CAQ41931.1"
FT                   /translation="MKNKNVYFYIPNIIGYIRVILALWGFMICRKNLILFGFLYGTSQI
FT                   LDAFDGWTARKFNQTSVFGQILDQITDRLSTTLLYLLNGNVYDEYIIAIGLIMIADIGG
FT                   HYFHSSSCAIAGNKTHKKIEKGNRLLKLYYERPVVMVICIIAYESFWFAAYMFKVTPKN
FT                   DILHIIAHYALLFSSPLAAFKMVHKLEEAEIATSTYVASYVHIYFTNISQGIHGVKCLV
FT                   DMDNKKK"
FT   CDS_pept        668238..669188
FT                   /locus_tag="PKH_141500"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141500"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141500"
FT                   /db_xref="GOA:A0A384L8P3"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L8P3"
FT                   /protein_id="CAQ41932.1"
FT                   /translation="MVVKENDSVILYTDQENIDLVKLRKDGVLTNKKGTFLHKDIIGKN
FT                   YGSKIYDSGCRNYIYVLRRTPEFIAQSLKKKTQTLYEHDISFICLLCNALPNKKIIEAG
FT                   TGTGCLTYALASCVLPKGIVHTFEYNEERYLEVKNEFSNFENVKNNIQFHHKDVINDSF
FT                   VQFEPEEIDSVFLDMPNPWLCVPSIKRVLKERGSFVIFLPCIEQVYKIIEALEQNEFCE
FT                   IVTYELVNKSWEIILNEGSSTRSKRENYSKVDRTNETSHPEGDGKNLSGAQVVTGNPLY
FT                   RLRQKENKTHTGYLIFSRKQLSDEHEQMEIEMKGL"
FT   CDS_pept        complement(669499..670659)
FT                   /locus_tag="PKH_141510"
FT                   /product="Myb1 protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141510"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141510"
FT                   /db_xref="GOA:A0A384LJR6"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJR6"
FT                   /protein_id="CAQ41933.1"
FT                   /translation="MWREACEDEGDEFDSLWALEERAEKELSVLEKLIEQTKENIEKLD
FT                   DYIDRKYKEIKTLASKKPTRINWEKAQGRTHMSMFYQKEYGFAPSNEDALKITEFQMSI
FT                   SNYRKKYEYKKSEWTKREIELLFDLVEKTSRKYAIRYLIDENLPYDVKVQKRKEIEDSK
FT                   DVKNLLSKIKLHFDAFQKLSTGGEGFTDYPEGSPPDGITNFAEFSNHFWNEVASYLTNT
FT                   QTSRECQKTWLYHCCFEDPKQKKWNKEEKEKLLSLCKKYEKREWTNIARELNTNRSPLS
FT                   CFMEFIKLTKMYEQCHDKVKLERIGFNLLEDIQLQILVSILGDKNWNEVKLHMENLNSN
FT                   NKRVQMRKGFNPCTGEKDKRVKKKLSDEISYKRRYLRLVRGRRDMH"
FT   CDS_pept        join(673891..677313,677443..677532,677706..677867,
FT                   678027..678086)
FT                   /locus_tag="PKH_141520"
FT                   /product="Exportin-1 domain containig protein"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141520"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141520"
FT                   /db_xref="GOA:A0A384L6F7"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L6F7"
FT                   /protein_id="CAQ41934.1"
FT                   /translation="MDELEVAILCLYGNECTRISKSDAQKYCENFQNTADSWKYCVAKF
FT                   VDSKRLEVKFFCIHVIVEKLKTLKGEDLLYVKNALYNYLESKYPTANDDPCVVNKIIQL
FT                   YLSLIEFLYPNNMNDGFKFLINLIMVNNDMNAKNMYINFFLKLMNMLDVEYIDNVYSTK
FT                   GVQVATNLKEAIKNNDLPIIIECLYFIMSTNVEDISALSIFTLSKYVTWIDINYVVNDK
FT                   ILAYIYQTINGQNNSITESSFSFLTALVRKGMNPLNKIQFIENINIIYVLQNIPKILDI
FT                   SYDMNKKIMLKKGELVNYICLELVESIYEINKLKDYPMNSAKYNEICDKATDMLFLILP
FT                   HALEIYGIDDFFVASTVEKFFSLLFTKFKTVMGSASAEEGMSGQQVTLGASANGYKIPQ
FT                   AKMNLFINTLICSTVNKFQFPAYIEEFYDEEDEDFITFNNFRENIEKLFQRLILFNKLK
FT                   AIEIIKNAIIYMNENFDNLKWNTIESTLYAFYITTSIYTEYKGSTMQAGGSAAKDANSS
FT                   VVSTTCISKTNTGTANANTSGNMSKEVQDMQNGEYNNLLFDCLAELLKNRKILSCNNSL
FT                   ININLMEIFQRLNPFFIKNPQYVEYSLHVFITNGIRCSKNKVVKKSVHIFKKFLKANSF
FT                   VICNYMKEILQMLESFLEIPCVYQRVASKNPAGNNSANNTTLADMLSLDQDYIKSMYKY
FT                   IYAGVNYTHEDQNDIYEIAGLLLLHYDYSRAKRIAKGEVNDQIHLLEQQGMQGRGGNPT
FT                   NINFNRMSSTNSGSGDVKDLNNTTSMQGMCTDLNTRNEKINEELIPNYKDRIFFFKGIL
FT                   NKLLENLSNIKNVYINSSKSQHEVLCLSFTCSVVIRCIGALCKNVNINMTDELINDLDN
FT                   TLGIIIHEALELFYKNYIVRDSVLYTYRILSNLFKELSLNYTIKILPYFYNISYNMIMT
FT                   KLQKTNTAGATTSAVVGTQNPLLSFNMMTPSSHPTVGVGSSGEASTCFSNSQEELKYLF
FT                   NELNELAILVCHLICTYKEKSYDTFIKPYIQNITQIHLNIWKCIIVQSLEMQREQNSVL
FT                   SPLLLILYNISLNIPSAIHNFVSLDLIALTHKEFCQAFSNEDMVKAKCPDAITSILLVS
FT                   LNYSNTCDLNICLYAAQTFSNMLNNATCLQNAQEVLSKYPLVQIIDTLCVTLKSLDYSD
FT                   PKNKRIIQEVMNIFRLFCGFKVNAGCLPSKILESAQICLQNSLLSVFKNNRNDIGVLLQ
FT                   AVNANNQQQFRQILSNFVA"
FT   CDS_pept        complement(join(678587..678647,678832..678873,
FT                   679139..679221,679329..679368,679485..679544,
FT                   679711..679780,679909..679927,680035..680135,
FT                   680236..680281,680458..680533,680946..681134,
FT                   681314..681504))
FT                   /locus_tag="PKH_141530"
FT                   /product="protein kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141530"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141530"
FT                   /db_xref="GOA:B3LBX6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBX6"
FT                   /protein_id="CAQ41935.1"
FT                   /translation="MYTPISIYNNLVNLAKKVKMECVRKEEPKYKLVKLIGKGTFGKVY
FT                   YAIDLCTQEPVAIKRSPKWNKVSREVDLLQKMQHSENIVNLKSIFYTTTEKGFRIQNIV
FT                   FKYMTYSLGKYIRFKKQERKENNQICKGIKHLHEHNLAHRDLKPDNILIDTGSSPFKVE
FT                   ICDLGSAKKVEESIISIPYICSRWYRAPELLCGSMYYTTDVDLWSLGCIIFELINLCPL
FT                   FPGKFKKDDISEECSQIINLIEVLGSPGIFYESIKGQTSNRNRNLIKELCGLNIRPLSW
FT                   SSILGDILEESEWELIGIVDGLLKWNPNERLKIDAVLSNPYFAT"
FT   CDS_pept        685277..689224
FT                   /locus_tag="PKH_141540"
FT                   /product="Inositol polyphosphate kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141540"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141540"
FT                   /db_xref="GOA:A0A384KP67"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="InterPro:IPR038286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KP67"
FT                   /protein_id="CAQ41936.1"
FT                   /translation="MKVEEYRHQVGGHCKLIKPKDSSKVYKPLIENEYIFYEKLANFGA
FT                   SSAESGPLHILKKFIPKFYGVTEIVVEYSSSSEMEDNLVRKQKRRNEPNSSKGRKYFSL
FT                   EERDKKDKLDEQPSNEPTSQRTDQSAKEPSREPSREPSKEPSEELPKESPQGETEGEKD
FT                   TKSDKSAKGKKRKKCIPHIVLEDLVYGFKRPCVLDIKMGKRQRKIGASLEKRKRQVEKS
FT                   FKTTSHSLGFRLCGCQLYNKTSDKLFYKDKYWGRNLTKENIPWAIRNWFWNGSLLYEEL
FT                   IPLLLEKLHRFFNCIMELRHYRFWSSSLLWVFDGGLNDQKARSNSLDIRMIDFANTIYL
FT                   QDNPSVDDEYIFGLKNLIHSMQILNNTIQGMNFLPQEISTCFYSENYKLIENSHRPIFK
FT                   KSKSAILEENLRKKKKKKKNVYINFEFLKNAKTRRKSSNVYSSNMTGALATQLAAGSPK
FT                   GTSDDGLSFQYLNKFIGNNKKEKIWNQAQYFSNSDSPIGNHMSLSPYSTPVGTFINKEV
FT                   CISGWLDESLPRNVTHGPGVSPDLNIPLIPPTSVDDKNDGSVSAEHSHGSDIQEKANIT
FT                   TFNESEKGPMENELLALEAHQIDDHRRSDHHSGMPSKEDESVSPINLIQDPKGVHLDDE
FT                   DELVDMPKKTITIIKHNERSEQMSTNNSIDERRNVRFEGKNFAHGHFITAMHETDGRNR
FT                   HSEENAIEKEEVQTNFSFKNKNRYPVNHSEEETCGVTEKGEIPQSENYQKCVNKSGEKQ
FT                   IIDDKQSRDNALLFQTRENVSFMSAEGDLFGEDNSNDRNESNAYEQVIQEVIVKTLKVA
FT                   SRGRDNFSSVNIANKIPVDRNYKNRIEDERKNGGYRKEGEPRRHENAFTNFYESEGKDP
FT                   PYKHEYILSNEGNRNEVAENGDEGSDRKVSDAEVEKKEENRRSAKQDLGNKGSYAEKYT
FT                   QQYAEQYTQGGLNQGMLKKREHRIRSALGPKLRNDSLVRETKWNLLIRNVNLKVFINHM
FT                   IKKEIEGKKNTQEYPYLFVKNRNETDPRALHMENRPSKIGGLNRISRDSRARGGVPPIH
FT                   NPYVFEKSLSYSYSHRIAHSFPQNRNYSYSSDSGLIYNRNLQGGHLMKMLKKEGRITSK
FT                   RCSSCTDIPLRIKKGKKSQKKKKYIKKKLFKKINILSGVKNNRVKSPQKIIFSNYAVPN
FT                   QHSVTPPIEYTPRSDSICRITHSFDIFTPEYRRNRYVHSVISQRYNTDMDSTTNNQTGN
FT                   IPFREKNLILPLTDTNSNEKYLRRSMSEPNLYKFGYFRCILNDLNDTKINYNSLVANRL
FT                   DKMMKVPIYNQIYGFTSNSSDLDSSDTSWGY"
FT   CDS_pept        join(690588..690815,691170..691658)
FT                   /locus_tag="PKH_141550"
FT                   /product="ADP-ribosylation factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141550"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141550"
FT                   /db_xref="GOA:B3LBX8"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBX8"
FT                   /protein_id="CAQ41937.1"
FT                   /translation="MYEQKYVPARLQGNEVFPYFTKKFIYLFIYLFFLFILYRLFSLKD
FT                   PTKKKFIIFGLPSSGKTSIIYFFKLGYLITTNTFHQRRKFQRENQNRQNTLGERNYEVT
FT                   FFEVGTDCSYSLIKEYADISNDMIYIVDSTHRSALSEAREEFIRIIYDFRFVYRKCKFL
FT                   IFMNKQDSNGCLPSDEIINYFALPKELHFRCKFFSCSTLSGQGLKEGLEWLVSTNVFFD
FT                   TNDDAVERSERTFYNY"
FT   CDS_pept        join(694332..694407,694549..694670,694834..694910,
FT                   695069..695185,695357..695414,695544..695678,
FT                   695837..695962)
FT                   /locus_tag="PKH_141560"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141560"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141560"
FT                   /db_xref="InterPro:IPR032396"
FT                   /db_xref="InterPro:IPR038558"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBX9"
FT                   /protein_id="CAQ41938.1"
FT                   /translation="MNKNEVNNFLCQFDFSALEELDPSLADGYTACYRKEVPFEIKVEQ
FT                   AKDGPQEIGSLEVITVKLLTLGEESKPKRIKIELTCEADLFFHFTQTVDERSFEAMQTS
FT                   QKLMINFSEYLEVLIKMFNSCIGDPHSFLAVLTVKKDGKARLDFIKNVEYKFIELLVCE
FT                   LVQSSEETIRESISYRYNAIKSKNSIMYKRLQDINLLIKSKNPSLLMQLQKTVSKQMEL
FT                   RKNRHYIRSIYNAS"
FT   CDS_pept        697889..700477
FT                   /locus_tag="PKH_141570"
FT                   /product="FF domain containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141570"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141570"
FT                   /db_xref="GOA:A0A384L2M6"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="InterPro:IPR036517"
FT                   /db_xref="InterPro:IPR039726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L2M6"
FT                   /protein_id="CAQ41939.1"
FT                   /translation="MQNKSNTPSIPGLPGLPGIPGLPGMPGLPNMPGLPGMPGLPGIPN
FT                   MSGHPMNGQGMNNSGPYMNNNSMSQLPMPFIPGLMPPMNASDYYGKNMMHMNPGVGPYE
FT                   NYNTLMYGQHTNMNIPMPPGSVDIMGDMAAMHMGNPNMIKLYNKDFMNSSSQKGADSNM
FT                   MGGQLGGSMMNMPMNYMNRYSGENHGWCEMVAKNGRKYYYNSITKASKWEKPDELKSKV
FT                   ELRISQQTKWKEYSCGDGRTYWHNEEKNISVWDEPEDIKKIKLECATEDAENQESVDKC
FT                   PNSSSTTHESVNKGENANNTPTGSFAKEVPNQTTDDAMNNVSTDSTTGKANTCTNDFGM
FT                   YSYLHMQNGMPIDLNNNAMMPISSVDEANQKKNAPDKINNKITMVWKKFENKNEAKEHL
FT                   KILFEEKNINPKLTWENALKILENDDRWFSLSVLTKGEKKQMFSEYISHAAKRASENER
FT                   RKRQRSRELIFQTLINWKKLNEKTSYEEFAAEFHKEEWWDWITENERDEIFQDFLDDYR
FT                   HKFKEDRRKKRKKTSEILKEKFQQYADKKNPLKWNDVKVYFKDDADFNSLHKIDALAAW
FT                   ESFFEKYHNDEKTELKKKVFRILRKKRDAFIELLHEYHKKNVLNMKTQWIFFVSKIYKD
FT                   ERYTDLLGHQGSSPKVLFDEYIDSLQEQYLRHKLYIKCAYKEMNCTVDENTTFDEFLQF
FT                   FASVQSKYNIPHTNMNFIYHSFQKKLKEKKNKEIKHINKVAKYFAKVPELKTSMSYSRV
FT                   ISIVKNSSKWPVLCELCPNEEQKMAAYNTWKSSANSTKNCLSIDSSASNSNRNIRNGKR
FT                   KESFRNSDDDTEEEHNSKAHSKYRKYAREESDSSDQTIESLRTIDHNSPN"
FT   CDS_pept        join(703753..703788,704156..704228,704489..707070)
FT                   /locus_tag="PKH_141580"
FT                   /product="cholinephosphate cytidylyltransferase, putative"
FT                   /EC_number="2.7.7.15"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141580"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141580"
FT                   /db_xref="GOA:B3LBY1"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBY1"
FT                   /protein_id="CAQ41940.1"
FT                   /translation="MIIKVNSAQTLENEDSKQNQNGNACKHEKSVRIYADGIYDLLHLG
FT                   HMRQLKQAKQMEKDVTLIVGVCSDIDTRKFKGQIVQTLEERTETLKHIRWVDEIISPCP
FT                   WVITPEFMEKHKIDFVAHDDIPYANNQKKKKKKKSKSNSIDEPNDDIYAWLKKAGKFRA
FT                   TKRTEGVSTTDLIVRILKNYEDYIERSLQRGIHPNELNIGVTKAQSIKMKKNLIRWGEK
FT                   VTDELTKVTLTDKPLGTDFDQGIDIIRDKVHGLFKLWRQHSKKLLKDFAKSFDPMFIII
FT                   RKKSKKDNLSGMYLSDSNFFLRTVKEDLKKRKSLSNTINNIDEYYYSADEDDDNSRVTK
FT                   LIGVISKVANESHNNDMDNYETCFELEACLKDRHRWGGPIGGNAKSKYTRDDNAKLGPD
FT                   ELLSFSSEAQVKKGSQSNHSNGSQNEQVMNASSVNRKSDCNLYNKTTYHDIIDEEDFAM
FT                   GAIAHKGVVRKNSNEMSSCREHKSSSYDKDEYNSCSDHQYGDSKCSYMKIKRRNNCTKN
FT                   KLSNVGKMEDFPEESHFTCSEGGGSHSSSSSYSSANGGMGHTPESSDASECPKRNDKQN
FT                   DATEKGNGQGDDAQGVNTSNQEKTSESNKEDNVLKGIPKEKKKIVIYADGVYDMLHLGH
FT                   MKQLEQAKKMFENTVLIVGVTSDNETKLFKGQIVQTLEERTETLRHVRWVDEIISPCPW
FT                   VITPEFMEKHKIDFVAHDDIPYANNQKKKKKKKSKSNSIDEPNDDIYAWLKRAGKFRAT
FT                   KRTEGVSTTDLIVRILKNYEDYIERSLQRGIHPNELNIGVTKAQSIKMKKNLIRWGEKV
FT                   TDELTKVTLTDKPLGTDFDQGIENLQIKFKELFKIWKNASNKLINDFTSKLDTTSYLSS
FT                   LQNFVDNEYEFYDSASSVCDEETNS"
FT   CDS_pept        join(708460..708627,708836..709422,709596..710733)
FT                   /locus_tag="PKH_141590"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141590"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141590"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBY2"
FT                   /protein_id="CAQ41941.1"
FT                   /translation="MKAIVAVTIIILLFRQSANVSALKNIKGELSWLATTPDVGTLTNT
FT                   IENYKNEVEAQQNDKLTNEVDYQLNELIDVMRLVGDTQEQQKRELYNLSTSLEVTKDAL
FT                   LKMLSEYENRIDQLEYIIMDTKKYDPYKESFNYPISKYWLQVDFLKIKSLWKYQKRKRF
FT                   TSIIQPIEMTNIKYPSSILLLRHHIVVEGFINVEVFQKASSLQPEINQSASGIVFDFID
FT                   AHNFRFVQLSFLNNQAILSVEEVSTSLHSKILSKGVEADGKDFNTLTCEFVARKMNVFL
FT                   NYKKVMEVDFADRGIRSKGRGSFTIHGDRRSGNGANRFVGLFTKSGTAEFRNFLTGTLQ
FT                   FEHLLNHALVIPDKKDISTVAVTNSYRFSNRESKDDLSVYSIPYSSKDYDDNKEEDIIY
FT                   DVYPTPESNSRYDDVNISGHAKGIIIPGGSPKEVMHNSCEEYRSKNFSLSEWISDNREA
FT                   SNNWKLISQFGIKRIIFRNNYKYALINSALIYKKNLCNSINISSYIKVENDTEAGLLFR
FT                   YDNRDNMYTLTISSTNREVTLKRKKNNIESVIKTEYVKSINSFQRHHLLIRDTGEWGNL
FT                   TVSLDGVKLFSLRGENYFNSGRAGFYVEHGHAAFDTFIVEQLNGDMERNHSTFE"
FT   CDS_pept        complement(join(711058..711213,711344..711449,
FT                   711607..711661,711809..711975,712156..712245,
FT                   712372..712517,712878..713039))
FT                   /locus_tag="PKH_141600"
FT                   /product="Sec20-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141600"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141600"
FT                   /db_xref="GOA:A0A384L4E7"
FT                   /db_xref="InterPro:IPR005606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L4E7"
FT                   /protein_id="CAQ41942.1"
FT                   /translation="MKKTFLPNLGKKNENVETLSKISSMINHMKIIEDSLKNLFLSEDD
FT                   LNNHDAFLLFRGKVAKRIVHYSSLAAECKDRILCAEVSDEDLEDIRQQFEYHQGNVERY
FT                   KNKLSNWWNKKGKDYHRLCMNEFLTKRKSEDHGTFSVSPEEKQTDANLKDTRQMMIEEI
FT                   NRMKNVRSELLESSHKLRKQDQIFNMFESKIKSSTDLLFSLKKKAQNDTRYVWYSFFFF
FT                   LGVCSYIILRRLGVIWALITVIKLLLSLMLYLIKFALSIFHFVKTGDEEKGTSGADDLG
FT                   KTLVPIPVTTEL"
FT   CDS_pept        complement(join(714317..715652,715964..716790))
FT                   /locus_tag="PKH_141610"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141610"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141610"
FT                   /db_xref="GOA:B3LBY4"
FT                   /db_xref="InterPro:IPR024943"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBY4"
FT                   /protein_id="CAQ41943.1"
FT                   /translation="MTKGTPAGQQAKNAKNKPILLNKKLLIIKSNEDIKKLIKKENPTE
FT                   EEVNELKAVLESSEKKTEKKKKKNIVIPRFKICEDDETYTSKLKTFEKPAHYIRYELYK
FT                   DQVTGIKLTDGSIIHYDLLKEDELFLQSLNSSINIQLNDEDFCKLIDKFEKITGYSENK
FT                   EEINLKDAIKATADLKINLKSNVVKDIHTYWKSKRKKLGRPLLRMFWNSSQNILPHYSV
FT                   FRSRVKEKMTLRKHKKKNSEIILKMQELIEDFRRLDRILRKMKQRDEKKLLLLHRKINK
FT                   RAKSQGLCEQMNATKINRNEYQNVVLVKRRGRSNRIWVDRKFVSEMNNEDINCCDLSYT
FT                   FNDFVEASLNLKKNYEEDLSNYISGKQKHIPIKLGIKSGDIKNLDSNFFSNQKNGEQQP
FT                   GDGGAAEMDIAGIGTTAIGTSPLGNPDDGGVLFEKYEEMKKEKKRRKRKKESKDVAPNT
FT                   SYDPINASPAQPQPVEDELTASHRYANGITGVPVEGNHNYFDYPSNYNNQKEDKRFFSS
FT                   ICSKGEAELIGNSSLWGKYNTNTNEAWNGKTKPFEDESPYPLMNLSNDKMENTLNEYKF
FT                   TANGDANNKNANTNSVHSSEEASYNRALFQFEDLVNPQLNRDNYIFCLSKYACVQKRIL
FT                   FYLENMLNFDNYNFKSKKRESSTNVPRGASSGAAPVQLPHEGQNMDKGEQVQEVGNLVE
FT                   PNHRPQEGIETIAPDTSDLLHIDTHN"
FT   CDS_pept        720418..722466
FT                   /locus_tag="PKH_141620"
FT                   /product="Ubiquitin Carboxyl-terminal Hydrolase-like zinc
FT                   finger protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141620"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141620"
FT                   /db_xref="GOA:A0A384KLP7"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR033809"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KLP7"
FT                   /protein_id="CAQ41944.1"
FT                   /translation="MEKKGRKKNPDDKVHSGNKRGRKKKESLSEEVEKMDGNDEAKETD
FT                   QAGEANQTIPTEATNVTSLTDERRLIPRGAGRGRGRVCPYLRTINRNLLDFDFEKLCSI
FT                   SMSNLHVYACLVCGVYFQGIGKGTHAYTHALEKNHYVFINLETCKTCCLPENYEIEDAS
FT                   LNDIKYFLKPTYSRDQVEYICRNSILGKSLDGADFFPGFVGLNNLKHTDYCNVIIQLVC
FT                   SIIPLRNFFLVFENKKYVSKNIVSSLSELIKKIFNPRNFKGVVSPHEFLQTVGIESKKT
FT                   FKIGSKNDPLDFFLWLISKIHRYQERALRKGTKSMMGKKRKISKSGEKDKRADGQSGEQ
FT                   NKRQEEDEEDEEVDDEEGKIQPGHHLSQLNAMLSSSSESYMSEEAVPGIDLPTKRKKKK
FT                   KKKKWKYDKVNIIDYCFDGELIIKTKKKKKKKSSEGDENMSSTHNTKKREKNDTYHERN
FT                   AREDGKFSNHLNNEGGVENDMSNSDEDDTDLQDGEELNEEKNYVTEKIPFRTLSLKLPN
FT                   PPIFKSTTESNIIPQVSIFELLTKFDGETESFLNEKSEPSTLILSKLPKYLVFTIKRFS
FT                   KNNFFVEKNGTIVNFVIKNLDMKDYIHEDYLEKNPVTKYNLIANIFHSGSVNNGTYKIH
FT                   VLNQASNEWYEMEDLHVITVLPQLVLLPESCVQLYQRQDVQLNGEVP"
FT   CDS_pept        724051..726966
FT                   /locus_tag="PKH_141630"
FT                   /product="DNA replication licensing factor
FT                   mcm4-related,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141630"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141630"
FT                   /db_xref="GOA:A0A384KFX4"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008047"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KFX4"
FT                   /protein_id="CAQ41945.1"
FT                   /translation="MGTPRRRPGQNASPYAMSSSNIFGTNNEIFGSNFMNSPVSSRRTK
FT                   NSKGSFLNSMMNESKYLNESNAGSQFMRYGHTPLAIRRIKCARADIGDVGREAFMEDVE
FT                   SGRLPHFIDSNLEQIKELFNQFFDEFNITNYSDVLQFTDEDRSITEYILLHRDNLKVYL
FT                   AYYGWKMIKFIETGRQNECKLNNEMEETDSDAVKNLEHIKSFEVDLTHIYFFNKKLYKL
FT                   IIEYPSDCISEIDKIISAKYNSLLALVLDGDTKSNASDRYSLTNAKQDYCRVRFFNKKH
FT                   KDTPRKLGPNHIETLVCIKGVIIRCSNIIPEMTMAAFKCTSKKRIGVNNYEKCNEEVYE
FT                   HVIQGEVQEPLTCTNCNNKNTFELWHNNCCFSSKQLIKLSEVTEHLKQGETPQSISIYA
FT                   YDDLIDYTKPGDTVELTGILKASPVRLNPRSRCYNSVHRTYINVIHIRKENKQKMKLTE
FT                   QNDTASVILKRNDDGTVEENFEKLNEQGNLLFTTEVIQKMQKLSTDPNIYQRLVDSLAP
FT                   SIYGRDDIKKGLLCQLFGGSKTTDKFKNKYRSEIHILLCGDPSTAKSQLLHYVHKLSPR
FT                   GIYTSGKGSSSVGLTAFISKDSETKEYILESGAVVLSDKGICCIDEFDKMDDSARAILH
FT                   EVMEQQTVTIAKAGIVATLNARTSVLASANPINSRYDKNKAVVENINLPPSLFSRFDLI
FT                   YLVIDQANEEEDKKLATVLCKNFSYGMEDGSDTDTDDESNSEENSEYGDEFNVPSQFDS
FT                   GNDEDPYQRRKRNIREDQSVNPNKSYKKNSKKYLIDSNTLALYIAYCRITCNPIISLES
FT                   KKIIIDEYIKMRCKEGSKSPTASPRQLEGLVRLSQSLARMKLKDVVTPEEANEAVRLMN
FT                   IATFQSLIDPLSGRIDFDQVNLGQTSQHKKKSDQIKDIIMNALVLRNMTKDELLSHCHE
FT                   TIMNNRDYSMAMDRKSFEEAFHDLERSQEITRLCSGLYKKK"
FT   CDS_pept        736483..742734
FT                   /locus_tag="PKH_141640"
FT                   /product="AP2 family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141640"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141640"
FT                   /db_xref="GOA:A0A384LQE5"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LQE5"
FT                   /protein_id="CAQ41946.1"
FT                   /translation="MQTNAKILDMKDNCGGKQHLEGNYKVHKAINGIYNGGVYYYDEHY
FT                   ASVREENDAPSNQTQESNHSSEDNYYSNSMNEMNNYDSTLLVDKDNHENGTSNEYDMDT
FT                   LENEIVGNRTDGYGANAYDCVVTDNGNLVVNMNGTVNNHSKFVNPQNFGYAVNIGNSSL
FT                   GNVGMSQMGNTNYGDFINGMSAMNTMNFMGNMAVVNGMSGLNGMLGINCVTEENGTNQG
FT                   SSFSHNENPNFMNSHFLSKSKIYSGGSNHIDDATVEGSHMLPLNGHIDNNSANGIISTN
FT                   FQSYASMYYGRNVASQDNMNNNSYDDNENYLANYGRNDMTMQDGLLNESFQENNEEIMN
FT                   KSLDDYYEKGNEQHGYVRKSQEGTPRASYLSYNTASYGASDVWGNTCSNNCSNNSSDSN
FT                   ESCNKSGNKKRSNNNYAVSSPYMNNVEGAYIDGKGGSYSYEMDSSNGFYMKRQNGNMYG
FT                   NYVNIMNGMGSTVGGGNFNGSHSNAAMVLNCSNEIQGMSKVGGNNSQGMNTNSTVSHDT
FT                   AFPVNYEEDENDEEDVSNEEEGNGVVNVNTNGASGKDARGLICAGDEGYPKYADKKGHV
FT                   RIMGTTFDGTENEHVEQADSMFKPNRLNPLNYNYVSRRGSSYSRRSSTTNSMNISSMND
FT                   LDNSPSYSNCLNIVMQNQEQDMQHFVENGKNAYLDPTTNGYINLRPNASYNGDRTDCRI
FT                   NGVKMKNIDFPMDVKDNDDDDMGDSRMGGSVRIGNNSTNNNSEMEHMNNKSREKFGMYA
FT                   PNDEGVFKNGNCSTEQVNYVDMKKGNGEDHMDEYNQGAEYNLHESYDANMYKGAIKKEE
FT                   LEKDSNYVMYNGGKDLGNGMNNSMNNSMDNSMDNSMDNDMDNDMNRDVDSNHQVNNVEN
FT                   YPSELVDNAQMTNVGTYENGHNLNLDNGHAMYKVDHNVKLKGGGMPKTVGPRKSQSYLK
FT                   SKNYIRKTAVADNMYDDPNEDMNKSNNCDSYYMRNARSNNSLFLRQNGNQSNNDLCNGM
FT                   SYDGGNVNGMSTEEGVLPSATSAAAGATSVASASGVSMTEYRNNMNYFENVNKSIMHSE
FT                   NGYDYINQQPGAHSSYTNPWMHRMKGYASDQKVQSLMNLNGCYGNMNGNKYPMAHVNSQ
FT                   GKKSIVRGYSNVCNMMMLGKNMDDGTHANMNGVSNMNREENDHHLIDGTCDMNNMRLRN
FT                   GHHSRNNFNAMDLQTSQGELNTLNNIISMNAQNSLNHFNMLVVPKIKGVRFDKSGRRWV
FT                   ASWSQNGNQKRQYFPIKKFGQTQAKYMAIFARIRAVKFMQKRPHGASENKRNQCRKTSM
FT                   KDRAKSESEDENNEYYDDDNGNDDDALDDVDVDVDGDVHVGGDVHVGGDVHVDGDVHVD
FT                   GDVHGDGDVHVDGDVHVDGEREFVDQGTFNYGMHTCTEDNEGFYNQGMTNQAPNESGDE
FT                   SALNNYYGYPGGSGGSCGLTQNYIPINSNDGADDLGVHNFETCVPVEISEKSVDEEVNG
FT                   AENVCNNEEDGNPNQASRATDRTISSNCNNGNGNQMAYENVNSESICAEGVGNQELQYM
FT                   KTKYEVGDEQVIASEVHTGGDANIKESASPQMSVSNWVRGYAMKFGLCAENTISKEEHR
FT                   EDNNPREGTNREYMNGDSILSGAHCTDENPDEASGKEKMDKFDEDGNGSNTTNLHPRSD
FT                   DHPFCLYEMEEEVKHFPGRSDDVIQTCGLNGSLDGEVCHQGGEGNDEAEGQQDDNLEPE
FT                   NCEDGNGGRIDRGNVHVDDTEEHQMNDEDGAEDGEDRHDDDSETDGDPPSGMNRAMECD
FT                   RVVKDQTQGEENEVILLNVNLIEMNGIVDIERAKKHRNNVDEKIRNLFLMVERWKKRKD
FT                   EKMCTDANDKSLLNITNEMTKQLMSKLYELNELNENERMILFTQLKEYYLSENNLICHR
FT                   ENIKLGMRKNGKMENVNDEQGKEKGQFQIEEKSESYCAENASNDMWNVYKFKRPRIDAC
FT                   SAAFAANMEKSTHSIGIGCYDKLDRDGSSGKTLYVQSYQPDGYGECDIDLELTNEEIYG
FT                   QTNEEAQEETDESTLNDNGPHNQMNTYHGNNETMFLRDDTDGEITSWVTTSEGDDASSA
FT                   RILNHHISAISDDVQEHGEHIDWSGDGLVDST"
FT   CDS_pept        complement(join(743507..744168,744408..744480,
FT                   744615..744689,744899..744949,745125..745139))
FT                   /locus_tag="PKH_141650"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141650"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141650"
FT                   /db_xref="GOA:A0A384LLT9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LLT9"
FT                   /protein_id="CAQ41947.1"
FT                   /translation="MDYSEVDEDDEDLYEGLEADNLLQGSYEKRIEEKKKEVERVPVKP
FT                   KEQFFEKSRRSLYKKLSGAKVVYTKKEPCLFLGAPQLSEGADEEDNKVEFLLLVNLLYF
FT                   INDVVIKNYCEKIGKVKRVVILEDDKHGKSLGICLVEFYSLDSSQNYVAYLKEKLKADV
FT                   RKVSLDIEEQIKGDEMYNYGGYINSHTIELIKRDNLDVLQCTENIHDALSKSLNLNKHP
FT                   IFSWFNTSMKDVLSTYVKSELKKKKKNAIINNDYMDRKNESDSDSGSDISAHIIDYVSK
FT                   KNKFLSYGKS"
FT   CDS_pept        746907..747521
FT                   /locus_tag="PKH_141660"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141660"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141660"
FT                   /db_xref="GOA:A0A384KZI7"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR036443"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZI7"
FT                   /protein_id="CAQ41948.1"
FT                   /translation="MERTWRCNSCLVVNAEEATECACCMERRSKDDGKTNENVMKNANE
FT                   NDCNNLTDSEKKIKKKNDDNSSINTDTNVEAHATNSTEDTKHSENTNEGKSSMFDGDGF
FT                   MPSFKQSPDMQSSNKSIFITAALNSNATTATNGTTTATHEDTNGHIKENKTGENNTTRE
FT                   KTKKSIGKGKQKKMADKRERAPSTRIQPIRKCTQKKINYRT"
FT   CDS_pept        complement(748615..748884)
FT                   /locus_tag="PKH_141670"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141670"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141670"
FT                   /db_xref="GOA:A0A384LCD7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCD7"
FT                   /protein_id="CAQ41949.1"
FT                   /translation="MGFFYSGYHKPSGKNIRDRRAQIFYVLGLFVLPTIVTYAGSNYHV
FT                   LNFFIDTFKPIEVPREVDFDIIRKIYHNKKPTSKSADYDENTNM"
FT   CDS_pept        join(749869..751085,751300..751431,751572..751613,
FT                   751721..751796,751914..752034,752151..752212,
FT                   752325..752408)
FT                   /locus_tag="PKH_141680"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141680"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHT0"
FT                   /protein_id="CAQ41950.1"
FT                   /translation="MEDETENNLVGHVLSELEMSREYIRGKFKGTGKGGKNAKGGSSQT
FT                   GGEPTEVYKNYDKILTCIEDKIAFYKNLNEVEKAKRGHAENGESRPTEQPYQRTAKRRD
FT                   NFFEEYEKNKSSLQKMKKKTIAGYTEEGNAIIINNDKFCKMFINYNLASDRKNGVTDSR
FT                   LNGTVQGGDDLSELSCSSSSVVSLHSFVKSEKTKRIRGNREAYIRHKYHDHAFVNHKLY
FT                   PCSDCSSSSFSWYSDDYDDLFYYSNLLKEDKGFKKCYVEEKDGEEDKITKKKKDTQQCK
FT                   QKKNKEKHIKEFERDVAKESPFYNYIYFKLPEKDKSKAYPIFVNTINGKKKMYNLKKIC
FT                   RNTHKKNYNHNEANKYELDETLFSYKKCKLLPSVKNETNKKGNHPIEMHSDDVLRRKHF
FT                   DSDDVNYAIDKIIHQMGKISSSEKEEKRKFNHSDNFNNILNKNKEFLKREKNFTFQKLC
FT                   ETEKIRLKVKIIGTDGRVIKNKSLDNVLINKNKTFGDLATHLGHSFKLPKDKIENIKMY
FT                   FDGDLCDKDLTFDNEELGLEDGFQIDVKFPLSEDNVNKQDEADFSDDNYVLYLPDSYVI
FT                   D"
FT   CDS_pept        complement(753062..753544)
FT                   /locus_tag="PKH_141690"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141690"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KAS1"
FT                   /protein_id="CAQ41951.1"
FT                   /translation="MKTGFLEKAEKTNDGAKDMTQCGDHDEEKENMVSLRGFNLTYREK
FT                   LENLKTIKNIDNNKKIIKLVLEDVDLDPKVVMQHVVDMLKEKTTLYTIVEINKQKYKVK
FT                   YNEVTPDDYILFPENVSNIANCKYAYIGILKVAKYTKKCTFNEKSFQAWQNIPMDF"
FT   CDS_pept        join(755342..755344,755824..756258)
FT                   /locus_tag="PKH_141700"
FT                   /product="40S ribosomal protein S15, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141700"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141700"
FT                   /db_xref="GOA:A0A384KR31"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KR31"
FT                   /protein_id="CAQ41952.1"
FT                   /translation="MEDANKPKKRTFRTFHYRGVELDKLLDLSQEELVKLFRARQRRKF
FT                   KRGISKKEKSLLKKLRKAKKECEVGEKPRAIPTHLRNMTIIPEMVGSIVAVHNGKQYNN
FT                   VEIKPEMIGYYLGEFSITYKHTRHGKPGIGATHSSRFIPLK"
FT   CDS_pept        complement(757052..759805)
FT                   /locus_tag="PKH_141710"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141710"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141710"
FT                   /db_xref="GOA:A0A384L8C9"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR027193"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L8C9"
FT                   /protein_id="CAQ41953.1"
FT                   /translation="MGKTATENNPCASVANDICALFTALQNDRSKKAILTNLTKLFLLL
FT                   YNERMKRKLLYGSREETRCSGDDEDNASLRRIFKNDLIILDNGNREYTKYEEWLNECYD
FT                   KFLNMLFELLSHSDEVLVTKSLSLLFGSLQFEAKIYNKIVTSEMGKGTSQVGINLYSEI
FT                   RNHGSGTPQNETNNSSHQLGGGRPNFIKQNDMQSNSKKAFPIKLFRKIVFHLLKIDQIS
FT                   ISTIKYICKIYLCFYYDLNYYFLSILKAFCILRKGLRDDKFYGDDGAASEDDLSAERGG
FT                   NGGSTLKEQLGRGDKDMLRDNPNTNLLIFSILINSIKPEKKIKDAHIRRKDYLKRSRID
FT                   ELFFDLNDEEFGGLGKRKKRRISRKKEEKMSYDKAEMKKTFHNYDTDDSIVHSSDEEFD
FT                   GASSPNGESSTGGSDTEEGANFLRNANLMHRSRFSDEEFDVDEVEDYIISPKRKKKIQL
FT                   KLKNRKKNLFISENVDKRIYARLYASCWFYFITSFNHRHSMVLQLLHSIPLFVFPYTNN
FT                   PFYLIDFFNYSFYKSRGLYTSLAALPGMFHILTELNVGDLVQGGGEMGKAEEEDDSDRN
FT                   GGELNEEQSQEEGEGKNEDLSEYGISSQQKGTAEGENKLNDNMYTDYYKRLFELITPAS
FT                   FYYADTRFLKIIHASIKNQMIPLHYVISFLKKLLRVACLTSYNVSINILSVVYDSMSYF
FT                   QSELKDAMSLSATVFMNLEIKEDLFCYENLGKNFEKKKIVEMLKGNYKMLRGEDGSADD
FT                   NAHGNDEGDHQIDAPNTVDNPLCAKLQVTEKDINPLQATDAALQLNTTKNLFSLQECLP
FT                   NKYQINMNTLNKKEMYMANHIFYEIILLNNHLCENLKQYSNVYHYSFGNDSFAKPQTFY
FT                   TNPSKLNMQMENSLFGFLKNFLSFKKRKEADIVPSVKRKRFSTVFL"
FT   CDS_pept        complement(761308..761880)
FT                   /locus_tag="PKH_141720"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141720"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141720"
FT                   /db_xref="GOA:A0A384KI43"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KI43"
FT                   /protein_id="CAQ41954.1"
FT                   /translation="MSSSKCVSNRVAAFVLYLIPLIYSFLVVVFGFIEYEQKRACNLLV
FT                   LCVLYGVVIILVCSVGCYGIITENVTSIRSTIILLIVNNIIMTMLITFLLIDILNYPHV
FT                   VTVHRASKFLQFVVQDKKIGLAFCSIVYALIFFSFCFMWTIGDYLAHLDAKLCLDDLRY
FT                   SHDRMQHKKKRHATKLLGDESEFLIKV"
FT   CDS_pept        complement(764258..764848)
FT                   /locus_tag="PKH_141730"
FT                   /product="ferredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141730"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141730"
FT                   /db_xref="GOA:A0A384KUD6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR010241"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KUD6"
FT                   /protein_id="CAQ41955.1"
FT                   /translation="MTMIMLFLMLILLTEKSSTYRFSNNRTALKYMSGSRGINICAPQR
FT                   RACSSFINNLVSSKKASCLPVGGDRGVNARNTSSNLSNDGGKRRYFKSVNRNKLFYNIT
FT                   LRTNDGEKKIQCDEDEYILDASERQNVELPYSCRGGSCSTCAAKLIEGEVDNEDQSYLD
FT                   EEQLKKKYILLCTCYPKSDCVIETHKEEELHDM"
FT   CDS_pept        766112..767368
FT                   /locus_tag="PKH_141740"
FT                   /product="glycerol-3-phosphate acyltransferase, putative"
FT                   /EC_number="2.3.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141740"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141740"
FT                   /db_xref="GOA:A0A384KRP7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016222"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KRP7"
FT                   /protein_id="CAQ41956.1"
FT                   /translation="MLQIRKALLTVLLFITIRITNVESFKKNLLHYLKNYNHCDSAVRR
FT                   IRNRHTKGTIRGSQNPISNVPNGDNREVYTLPISSGNKLNYPTLKNNTYEEAFKIISEK
FT                   LETLKGENTDNVEHMNTFSGFLKNYFDEMKRHKSCPPEIFLENFLKYIESFKKYRYYTF
FT                   PNVHRYDESLHEWSLQFWSQLIDKENSKFRGTEHIEKMEKWIEQGHNIIIFSNHHIEAD
FT                   ANIIKYFFHIHNANNISRKIIFIGGHKIRADPLSRPFSVSANLLCIYSKKYIENPPELK
FT                   EEKIMFNHKSLNALKNLLTEGRNIIWLAPSGGRDRKDPHGKIKISTFDPKIIQTFYILA
FT                   KRAKVRTHFIGLALNTYNICPPPNTVDVDEIEKHRSCAYSPVGLILGEDIFDVYPTMDE
FT                   KEITEKLYTYVNRLYSEIC"
FT   CDS_pept        769206..773714
FT                   /locus_tag="PKH_141750"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141750"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L572"
FT                   /protein_id="CAQ41957.1"
FT                   /translation="MHTNQLNGMKAQLDGKGTKFLGGKTRKLNTKGSNQNTGAHFNVSG
FT                   EGQNDEMVNVFPFGEDTPHREIEKVRDQANSSIHNDIFVDMMQHPEWNVMYTRSKTENN
FT                   CYKKNALHNDESEVLTKKKSLPLSFNHKSNYVNKEENGKINETTFMRMNKGESENTDKI
FT                   LSFRDLKKGKSGTEGHVGEFTAEGWPNGGDKPSGHNDTDKFDQLKEKNNQNEQVAQSVK
FT                   NTQPYLPGKKEESATNDRMTEEKNYTQKRQLHGHNLKKKKKKSEKIQNEASKFFNGKEL
FT                   HAKNTRAEKAEEARKEKEQKEKEKGPIKKLSAAKINDELSVLELRKEKNREIRTKFEKI
FT                   SLNSQGKKEHTFGKLNNNQKCSDGSQKESSEEQIMIQKIFIQESDTDDVVQRKVNSIEH
FT                   ILEETEKRNMNNSLKRVSSFKTGKGKEIENGTTGQSVGERTNVGEHLCMHSLGTTSLSS
FT                   FSPLEEEIGEEKDIGSVNKVGLLKGNRKNQSTGLFYDNMEEEKDEESTHILNSPLGGEV
FT                   EKEVKRKINKKGSYHIQSSEHCNTKNVESINESGRTSSGSSDELVDIKIYDDSEIEEAK
FT                   ESELDKFWLNRQVSSLLNKSKLYSAKYSDEFNSSTAKCSGGNYINGWGLPTGEEYSQEE
FT                   GTNRRIISPKMKRYESDIFPAVKSGANFFQKRNTTDNIEMRERAIILEEHDEGGMSRTP
FT                   NRRDRGDAPFGKYTLSRNDTTNRAEKEGSMEDMASRIDAIKKKLSLINNTDIDLMNFEN
FT                   FDMYQIDFDKLGLKVDNLEKEEKYILMLYMSEKKVEYLRGEKGAHKMVHVTSEAFPSNY
FT                   NKMVDVGGAILGGDGKSVPMGKSPSGISSGESDGSDSSDGGFLQLGLLVELYRKLSKQQ
FT                   SMTSKVEDKEQPSQFSQSSQIVEPRQATTKNEKILLKKVLANFVYLFLQDECLDKVVRN
FT                   YENMKQASGKEEAKRANSKCLHYICSSLLQDISSCHSCEEKDPIGTDISGVFYKIVKEI
FT                   GSKILSNDKLMGKIKQVQIINSMLREEVRTYSIKVAYMDKFLDIEPHFIEEAEKVVLGD
FT                   DIGFFRMHTLNMNYNYNYHTHGRNTKLLHQNSNPVWNFFYAYFNDIYNWYSDKNGRDFS
FT                   PQGEVQNAEMNKDMASSKRVSRNFIKVKDESSGVEEGPLGKDHKEVGADQGPHNQNESN
FT                   STRNEMAPSSPLEWKSDKGSNQFQPGNSSSHTVEDKQSEQQKYLNKDREDAGMESFNII
FT                   GEKKYLANVNSVERTILSNSTKIGECPLGSNTSSVDNLISSEYNNLGNSGSNGDLTSFG
FT                   GDHLQAVQNDMPPDGDCIEDELGSHVTHKIGTDPPGGKLSNSHTPVEPKTESIPNNKKK
FT                   KQKEDIEETHLVSFQYKGSIPKGEMNLLGNMSRDKNKNIIGCYLSAPTGENLIAIQIKN
FT                   EKIENVPGAHFLVERCNKYNNEFNNSFVHILNSRTKRYLAVDLENGKFLFTGKYDDVLF
FT                   TDERNVEHRVCTYFQLQSISDLMKSVIIEDLVQSMADLVLR"
FT   gap             781964..782963
FT                   /estimated_length=1000
FT   CDS_pept        join(785932..785946,786211..787134,787237..787545)
FT                   /locus_tag="PKH_141760"
FT                   /product="KIR protein"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141760"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141760"
FT                   /db_xref="InterPro:IPR008780"
FT                   /db_xref="UniProtKB/TrEMBL:B3LBZ9"
FT                   /protein_id="CAQ41958.1"
FT                   /translation="MSEGEIKDLKKLPSKTNYYDKFESSGYICSSSGTEPPEQEKQLRQ
FT                   KLKEEYKEVYILTSLITKAYCVACKMKEGAPQDNTPCRFLYYWLGNEIRSYIGQHKLSD
FT                   VLQAIYRELSDVGGGHKCEITYKDVENDEELFKYRKKVFEHDHDYDTVQSYLRQGNTDC
FT                   LDNWTWYEVDILPACNAVSAYCSKPQNMRIDYCTEFEGKYKKHCYQKLDDSNCKLVLVS
FT                   ESQTHVTRPDSRDGPTAESAATCTGNQNTGSPKPGSTGTCNPGSSGSDGGGSHSKGGEE
FT                   ASSSSDGGNIVGSVSGGLATVGLPAIGFLLYKYTDVFDGIKKSLFGGSNRNRRLGRSTV
FT                   RRQHFEDTFTGNDSSTLGGDGSTTLGGGGGESSTLDGSSTDVSTIYDDEGRGRPIGRAR
FT                   TGTNNRRPGNIRYYAT"
FT   CDS_pept        complement(join(788488..788880,789135..792395))
FT                   /locus_tag="PKH_141770"
FT                   /product="chromosome segregation protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141770"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141770"
FT                   /db_xref="GOA:A0A384KUB7"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027120"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KUB7"
FT                   /protein_id="CAQ41959.1"
FT                   /translation="MHIEEIILDGFKSYPTKTVIGPFHPQFNAITGLNGSGKSNVLDAI
FT                   CFVMGINNLNLIRVNRLDELIYKQGQAGITKGSVTIKFNNEQKPSPLQEPYRDMKNITI
FT                   TRQIVLGGRNRYLLNSHNAKPKDISDFFQSLKLNINNPHFLIMQGKITKVINMKPVELL
FT                   GLIEESSGTKLYEVKRTNAIKLMGKKDQKLDEINKVLVDEIEPTLVKLKKEKEEYNKFI
FT                   SNNEEIEKFEKIEIAYKYYVAKNMMEKSKEKIEDAMDEKKVLEKDIKDIDKEMEIYKKE
FT                   KEKLASQTYVASEPMKILISEKEQVEKKISHLRSEAKIEGKEKEKEKKKKEEIKKEIER
FT                   IEKKLNDYEKNDEKNNKNLKSYEDLKKKIQLLREELSEKQTTINCLLSGGINNSEYTGS
FT                   FREQLKNNKTNLSQIETQINNLLQNSKHLEKEIMALKDQRKKFDKEFSEMNKEKETEEK
FT                   KKIACDEELQKLNSEYNNFQDLDELQEEKKLLTNEIEKLQQELQVLKNLINHVKIDFKV
FT                   PGNVNPADVLGQIYELIKIKKDYRQTALAIHLILGGKLSYILVQNKECSKSLFEYNNFA
FT                   KGSRRVTLLPLKDCIVSRDVNEKIVEECRRYVGVDSKDKKDVIYFLDIMEYNNKLEKLI
FT                   RYLFNGTIICSNVDYCKKITYNPNKKMSFPTITLEGDKFDTSGSMSGGSNKNINLFLLH
FT                   YEKYENKKKELLEKEQKLKEITAKLDMLKKAEEKKKKLCKDLQIYADNLSNIENRIQTS
FT                   KYGNISQKIEQSKEEIEKGRKELTELYAKQKKLTEVIHKIEKDISEYENNKDKKEEDLK
FT                   DSVRKLKNKIKLLENEEHKKKEEVDGVLLQIENYKKQMEKESNDLVIADETINQIDKKI
FT                   EEIENNVNASLEELKNLDKKILELQASFTCYENEIKQVIKKMESLEKRKSQHMLDLKKL
FT                   DNTLIDLQKDSQTASETVKYLNKTHVWIESYEPLFNKKCTPYDFENFRHDVIQKKIQAL
FT                   QNEQNKLSININRKAVQMYEQVQVDYKDLITKKSQVEEDKKKIQEVIADLDVKKSESLL
FT                   AMYEQINEYFQAIFSTLLNNAQAKLSVVDGDLSNGIEMKIAFNNNWKESLTELSGGQRS
FT                   LLALSLILALLKVRTVPMYILDEIDAALDLNHTQNIGDMIRTQFPNSQFIIVSLKEGMF
FT                   SHADVLFKMRFIDGISTVNRHSLDIRQSKNNREVTEVKRRRVTIHERDPDD"
FT   CDS_pept        796276..797919
FT                   /locus_tag="PKH_141780"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141780"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141780"
FT                   /db_xref="GOA:A0A384L472"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L472"
FT                   /protein_id="CAQ41960.1"
FT                   /translation="MRALFLPPCMSAGKTNSRHHKAPLIPLRKCQFTISSVKLNNGDSK
FT                   LLECKEINDQNYDALIKKRKTFLLYGYAHYSNRCFTHFDKLASLSKDFIRIMEVEKLPL
FT                   YKLNVSMNNFLVRKFHIKSVPTIQLRHKNKLVDELVGNELNEQTNVDKLIRRCGTYFNS
FT                   IREVDNMIDFLAREEELPNSGYDELLEREEFLHGMCPSIARTDGEDNIDITTHQNEKNN
FT                   FALEMKEKLFQKDTLNDLLLQYQCTTYVLFKKLELLLNRKKKNTHHIKLILNEIIVNHS
FT                   SYLDINERYSKLMAKAFLLLFDEEKLAIENLLDLKNYLEGTEADSSMHAQLIQSIHFNE
FT                   PIITFDDFKNIHLRHLNQVDEFLSNELEEEAPSEMISSTENHHSGEKAGEVQNGKLKSA
FT                   PKNNEKTRYLSRVCRILAIKYMQKEQYDDAFHHALQSYTLTFPLNNVDTSKSKVLIENL
FT                   ILYLGAYNPSVIKFLSDLQLLFTDKIFKVVRFPHTRAIKGGRPMMKRGKSGKWLWLSQD
FT                   WKPRWLKKKAKLILEEEWRCVPDKNVPFWN"
FT   CDS_pept        complement(798535..800958)
FT                   /locus_tag="PKH_141790"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141790"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141790"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCE9"
FT                   /protein_id="CAQ41961.1"
FT                   /translation="MRSPSFMTHHNLIPSSKYHEIKAPNEEKAELSNRDVYEYRSRNVS
FT                   PMYTTKFKSQPPIYTEKIFYNPNLVGPSPVIANYGAHGGNARRVSCIHPFPCIKGNTGG
FT                   CNEMNNGTRNGIHSGGIFTNPSVSSYTCGYNVAPTNKRIMRKVSKVPCLFNTKPAFMQD
FT                   SCEKVYSDVSGVPIHFDSPVHGRKGYVELGTHDGMAVYNINENKKNKDSEVTGKLNHVE
FT                   PFKKRVTKEKLPEPIIKNKINELIKEKDEQIKELEIEIQNEKRKSEIVRPDGAENDKEF
FT                   SNVENKKLKEKLLDQKIKYEETLKHLKRVEIERRSLKSSLNVRDKVLNKLENEIGSVDN
FT                   ENDFLLRLKENTSLSDVHNLFKFLQSQDKGTEEENYNKCAGKNNQKGTGLNKANEKRNG
FT                   TVDPYDRNDTYRVNETEEGKHKEDEFSWYKSKSTCEEGLLTLEDDESKENKISHRNGKR
FT                   VSMFSKPSFENNDMYTLKSTIVELEKEVYDLKEENKNVNFKYENTFQALSELRKDTLEY
FT                   MESIVSRDMRIAYMESMLQKSEKDLNKLKELLKKQQLLYTEKVGKCTSEISILEKQSSH
FT                   LQSMIQEKDSEIVLLKNEIIRNETLVKQYEERNKELQNELRLMCNNLENVIDASNKKDL
FT                   FMIELEKQIRENEVHRQNAYLKEVAKNRKVHANMKFKEMMYDKSAKHQVDELHSLKKEL
FT                   YLNKIQMQKARDAFEVLKKVPKAESLRRSKQDLSQDNDSSTVHNFSEDKNDQDGGNTTF
FT                   EVKVSSEVRPAYKAKNSVVKKKKRAPKSSASASISASTQENVHEIAQGVIHTIE"
FT   CDS_pept        complement(804031..806115)
FT                   /locus_tag="PKH_141800"
FT                   /product="DNAJ-like Sec63 homologue, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141800"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141800"
FT                   /db_xref="GOA:A0A384KUX5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR027137"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KUX5"
FT                   /protein_id="CAQ41962.1"
FT                   /translation="MSQFRDTFTKDSKKEPLLSYDDSAFIFFAGTVLICVLIPCTYIYI
FT                   KSLFNKIFNNVSNKLKKSKHNSVYRSCACALCKEKLEKRNKSTTLWEKLGYRKIIQFFL
FT                   LVIFWGLLFILVQQMLSTKPMQTFDPFEILEVHAGATVGEIKKAYRLKSLKYHPDKNPN
FT                   DTSAAAKFILITKAYQALTDEISKENYEKYGNPDGPGMMKVGIGLPKLLIDEKYQLLIL
FT                   SIFFLIFLVFIPATFIIYYQRQKQYGPNGVKVETLQYLTYTINENSRAKSYPEMLAATA
FT                   ESRDIEFRQGDDEYVKKMIDELVEPKKRTFRIPVITKNYFIILAHMQRRYDLLSEEMKE
FT                   DLKQILQFSLLITHSMIEISILRDWFLTAQAALTFRRCLIQALDIRSSSLLQIPHFTEG
FT                   IIKHVHKGKLAVKEILDFVHQNHESRKGLNEMTDEEILDVKSFCNIVPDIKMTARILVE
FT                   DESHIVKGDVASIYIHIDRTNLHENEAAGYIHAPFFPLPKFEEWWIVATYKGDDRILKY
FT                   VHVKNCEKIIEEKLQFMVDRVGNLCVSIYIMSDCYFGCDKKLDLPFRAYSQTEIKREIF
FT                   VHPEDIELDNEPTLFQQMIGDVGRRDDSSDEEETGAGGDPNRRNNFAHGNTATAAPRNS
FT                   QNNQTNNAGNGNSSGNNNRNNNGGGVGGGGNPPSSQKSVSRDHENYVPDDDTNEDSGDE
FT                   "
FT   CDS_pept        808928..810874
FT                   /locus_tag="PKH_141810"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141810"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141810"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L470"
FT                   /protein_id="CAQ41963.1"
FT                   /translation="MVYVPMAQNRGNMLRVQSSTEKNFHTNGNFDYAPDVSTHNDASIN
FT                   SNFSIGGNSLPRILKMYTRELQSSSEAQRSDGSHLRSENLFPHRNEHVSENTCLTSILH
FT                   LSDVITSQSESCVRLNDEHLNCYHSSVNSNVSRIESGVPSCLASSLLAKFCCTEIPIHE
FT                   EGEVVNCKTEPNCAKIAEATLSKNAQNNGDDNNTQFGTLKNRTNNEIKNIQANDSPAQE
FT                   DHLTSVGAPSIYFPIKENSEDVQALYDSKKHTSDESLPSRKRYALSNPTEDAKTTNTYQ
FT                   ISHPTVVPNPECEGYVNGNPEKERGQDKLQLADGHMKERMMVYYPDEEMQGGKTTFSTK
FT                   LSALNDDNFELTEISCNTGGDGIERRKKHGSEKNCIFSEEKKNSTASSLSKKPRSYSLD
FT                   DIKNGKIEIPNVIFTKLPFNSSGDNVIDSYRRNHKLLNFMKDCNESVDLILKYPQIERS
FT                   QNIPFKVPSEISPAIRSKIGSAIIYEDKFDRRNYHPQVKNLHMGKIYENHVFNILKNKK
FT                   DLRKKLFNRSSRYEKYKYNNTNGFWISNIDKKRLVDPERNDSYITELIYEKNGSYAEEM
FT                   GTLKRCTGYDGIPSIVEFYKDNNFYLFLQKEGITRDYLNPVMATTMRRYDIEKVSAYEY
FT                   IHTRECITPVHCS"
FT   CDS_pept        813495..815621
FT                   /locus_tag="PKH_141820"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141820"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141820"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K8C9"
FT                   /protein_id="CAQ41964.1"
FT                   /translation="MRCNSESKISREMTSGINQYGERKKESRSFGDFSDNYNFLQSNDS
FT                   IDNSFEEREKRKKMREDEYNKIMESSEEKSDFFNDDKNCYSYSDRSENSESKVSKSSSV
FT                   GLAFPMHVDTQTANTYKSARTSHVLKLTSATLEENILRNLEDDSSYDGNFGSETEKSKS
FT                   VRYSRRKSVTSEKSLEGDHLRHQRSSLKSGGSSRRFEKCSSGGKVKFDKGDSADYLHRK
FT                   AYIMAQMGDTQKTGLWFIDTMNEMLDNLCDGNEKEEHRNDGTVVNTSSNSIILNYGPLG
FT                   INTILRWPEYLKLNSLISGIHIFPIYEGIRSMFIKYHSQKLEGKNKKAGRSATLLSLPT
FT                   FPHENEKDRCIPKTYSNLPNLNVPTDSQHTAHVQYHHNNLHAKEGVTIYDDDYDDFLFS
FT                   NLPYLIQRMRNKYNKFCEHVGERLEHIDRENYTFKQYCFAVSKMFLQNLINIIPFSKVP
FT                   GLLSHMTNSFHTCIRPNENEESMTETDFMNTYNMQYSSSKMGTAYSVPMELDRSMSNLS
FT                   TTIQMNCMGQTKNVFPHSNEAFSCKGGGSQIFPRRKSLNVNEQQRRHSFSQIFHGTQRK
FT                   STILPGGILEERRNYLTGNFNTLPKYVKTCANSRKKLSNSLRPVDLIKMASVKNNALIN
FT                   VGTLRKCKSSYDSSGCHEGVPKVNTKAEAEEEEADAEGKQLDNMQKNSFDELGESFNAT
FT                   TNENYCTAKSIPLN"
FT   CDS_pept        818157..820223
FT                   /locus_tag="PKH_141830"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141830"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141830"
FT                   /db_xref="GOA:A0A384L9E6"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="InterPro:IPR033979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L9E6"
FT                   /protein_id="CAQ41965.1"
FT                   /translation="MTTMIKLHYDEKNDEEENMIIRSADYETFKSYVLKKYDKVYEIVN
FT                   YENENINYYSVKWINFINRRVPILLQNKSGPCPLLCITNILLLRNQLQIDRKIKKISQS
FT                   FLENKIMNILLESNKKNVTDNTASCNYRKNIIECVDILPQLKYGLDVNCKFTNIHSFEY
FT                   TKGLCIFDMLNIPLYHGWVISSEDVMFYSYLKDYSYNVIINKIVRYNEYYERKKKKNAD
FT                   DTSNGRTTALYQLEGVEEEKRDDCHFEESYKRDMLMDGPTNTSRGASNCHQKKAAPNDA
FT                   IGNINKGINKITEKNEKEKGINSVPIFPDDLDKISKENSKKTLFQDSSSVHLITDPPLD
FT                   ADTTKKKSTFFGKKITSRDGSSSKSRTQTNVINVKQSCSIDLEKGANKYSGETGHKSDG
FT                   FVVKESKTPSNLATSVKKNNANRNATIGANVNISTIASVVSAISSDNSSGDVNAVPTPK
FT                   FPEDPLLNNSTSIISVEYSSEGNTQGKSKKSSSDERNIRNNELFMQSNGIASLTSETAN
FT                   ADIADNYTENSENFIMKNYNTDINLTPYEIHEAVIISQFLETYKTQLTLVGLKLLQENL
FT                   NPNQLVAFFRNNHFNTLFKYENKLFLLAADISFLHLSCTWELFDNVDNDTSYYDNNFRC
FT                   ISNQKISEKNLDHSIIYLNYYDGSSAKNNMHCVRSNAPFSNDKKKKKKKCTFM"
FT   CDS_pept        complement(820923..823238)
FT                   /locus_tag="PKH_141840"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141840"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141840"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KDR5"
FT                   /protein_id="CAQ41966.1"
FT                   /translation="MAQSHVEIAKQLKHNSEEIKEYFEDLYAWQSEVSKEVGGNSGKEQ
FT                   SSTVRNGPAKGSKSFAAKLEKKKKDHDGQGQKLHGRSSEIVDPAAANILHRETELRQNN
FT                   NALKRDQNSLDSYYNAWDKLKIEDIDNGHDGSGEDREGHNGEASERTEKGGYSDGILHW
FT                   ERKIEELAPTIDTERRNSMNICNGIWGKAERKDGLSESNNCVLNRRNEEERLMKIDCKV
FT                   YDIYLSKNEEGKINYQKRWYNKCLENYNDIINYIDFELSNNNIFLQIEQNLDNELYIDV
FT                   LSQNKQIFLNKNIEQLSILRTKVLVNRSLVYQRLSSYFESINDCSSIILFYKYFLPEHK
FT                   NCASYCIGKNSLTVNIKYVLFKAYYLRGMARYKLKIYKYSLKDFKFAKECANDMNCCST
FT                   LNIDKSIQLLQNVITQIDTKRRARRQAEYTSTLLERYKLKPRLLTIQLISREQTEEIIP
FT                   LENNRNDVKCLTGLPNAEEPSTGCASGGWNSPSEERKYLRHFAQGGNPPKVHDGGNAPV
FT                   GKNSSLGAVSEGEHNTVGHKDREIERDNHHDTDSSLTLSESTALSDVEETKPPLLTMSR
FT                   GANLGKNKIKNKISFELLWNSNEIKSNFKKQIDILKTAFLEEHIFQFNLDRDLYVDILD
FT                   SLFKNNFLSLFENMDNEDIKIKLQRDACAGLPPNVDKEIDRTSKSPSDGELGCVEERED
FT                   EEKLLNCAECVVLIDILYILTNGGKENYVLLFVDKKERTLLLTFYNFILKYTNVFLCNE
FT                   NCLREKTLLLKGLLERIS"
FT   CDS_pept        complement(824802..827516)
FT                   /locus_tag="PKH_141850"
FT                   /product="N2,N2-dimethylguanosine tRNA
FT                   methyltransferase,putative"
FT                   /EC_number="2.1.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141850"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141850"
FT                   /db_xref="GOA:A0A384L795"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L795"
FT                   /protein_id="CAQ41967.1"
FT                   /translation="MIGIKNEVNSNDKRKRKFDGENRNHFHNKYNKPNKGNNIGNYGKK
FT                   NGREVEGGGSSFYNENSKYIFEGSVKIKNKSKHIFYNKAQVFNRDMSIILIKALEIYLK
FT                   NKNKDNGKILFRGFNIIELLSASGIRSIRYVKELGETINHIITNDIDKYACKQIRRNFK
FT                   RNNINKEKYTILCNDANSVMNILNVDNIYSKKRNTKKLDIGFTYVNSITDYNDYFKEAF
FT                   KFLKYISNYNRGKGNNEVKEGMNVDNPSHNNNGNKSCNNGRSNVGTKNKSIEDDHHLED
FT                   SDSTVFSSNEESSTKIDMLHEENDKTVYAKGASTTQARNGPAKATINGGTDNEANHTET
FT                   IPSGGKKNGGENPPLSESMMDEIIQRSKLSEKYMFDIIDIDPYGSSIDYLESCLKYGRS
FT                   NFFILITNTDMRVLNGKFPDVSFYKYNSMIFSKRVPYNKEYSIRVLFYKIKTIASKYKK
FT                   CVIPFSSLNIDFYIRILVQVIDDTLQTKDLCTDSGMVYQCNSCSSFHVNPLATKKDRNL
FT                   SVTDNRKYNKKWKQNKHKDGEFLNNQMEEEKEDSQIAGNIPDAQLDHLHDANKNSYEKG
FT                   KFASENFAHDATHGDTVDNVEDGVNTVDKVPCDNVVEKGGNCEQLTNGDEGGDVENVAH
FT                   SECTENAAVDVMTGVPSPKDQPMQNNPGLGNKYKSGKLTISNKCLECGGEMLIGGPIYI
FT                   GKMHNAEFINTCISLLENLQNYNLNTIKSRDRILINFRCLKQEINIPLYYNLPDLFRNF
FT                   RLCSISRKLFVNALLNLNYEVSYFHKDPDSIKTNAPNSVFMDIFRAIIYKVNSKKRNRD
FT                   TVEKKEEELNALDNKKKEGTEESSKKVYSINTIKDEKLKEKLLSYEFFKKNSTIDNIDI
FT                   SVNNKENTDNVKLFTLMNPEPFWGPMKKHYEKN"
FT   CDS_pept        join(831979..833809,833980..834042,834289..834369,
FT                   834588..834658,834759..834905,835104..835229,
FT                   835389..835554,835755..835835,835968..836053,
FT                   836205..836260,836350..836431,836632..836979)
FT                   /locus_tag="PKH_141860"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141860"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141860"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KWZ1"
FT                   /protein_id="CAQ41968.1"
FT                   /translation="MENTAKKKANEKKGKKKTDDVKERILSGRPVLCFDEEIDFDKCGP
FT                   VSAEQIDDTTENKKKKAGYENVKNASLDSIEIGTKKKGSKKTKEGKEHDTHRNSNDQEK
FT                   IHQRKGKKKGTGNANSSNGNDFDDEDGISIYKNVDKHGASSFNEDYVFNEVDSTTNSSS
FT                   ILRIQRNNIELKKKGSSKFIKLQSNNNGEVLNKENNEQLNKWIETLPSINSEIGILLNN
FT                   HLPCYRILDNIKRINKIKSVVYNDNENDEMLNTIEKSNIMFNSIKLTTKEKYIIRFLCE
FT                   GSSHTLSELVELLFYVLNNEELVLDRFPIKIAPTSDKEGGNVIFSLNQANNSEKGEENN
FT                   ISLSKDNENDESRENECNISMDNFSDEEYYSDDGEKKNYNIHISREDLLASIPILLSRK
FT                   SLGDNMKKMNVSKNENNEKECLWVWENDNYELFPPYYKEIFKYFKEFRNNQSKIYRTLI
FT                   KLKNSILSKDLQSIVKTHDYLNELKKKQYLESEKRCKKILIEKKKIIKRKMDIKKQEEK
FT                   KKKIEDAKFLEEKKAATINKLDSVVAQNKTEEKKPKQQNLILSWLTMKKNEKANSANSN
FT                   ENSEQFIKYPIANVLSFNEALRDKLMEAQNQLPIFTCNRKGAIGSSSIFKSNGNFDKQK
FT                   LLEDYEKMCGNHKRTVVDYFKVYVDNKEFFEEIPSVDSIDGSKLIVQNEKGVRSKLWED
FT                   NEFYCKLKNSEYIRSFYFYDNSWTRPYMSLLVHKVLDDNINLLPYYYNDDMEYENDTNE
FT                   DYYEKFETIDLTTENEENETESDGSSQDMFIVPDNELNTDINITPITIPTSQDIHFFSL
FT                   FNWEWKFEGNPKRNYDIINKNTWKEFNLIYKENIYGCQYMSWGKENNPFIYLSERNSPK
FT                   NTLNNYDIKKLIKHSHGKVTKKDVLVDQFKLKNEHLTKADTERKFKTYLVYKKCEDNRK
FT                   KWMASEEGIKLFKNEQLLTKIYNIRKRKLNLITQKMEQVKRQKRMDRENLKKEEKIKRK
FT                   EKSNQEKLLSKDNMKKEAVKDPEKLEKKETMTKEATNIIQKIFSSSSLTGSKNVKK"
FT   CDS_pept        837677..838240
FT                   /locus_tag="PKH_141870"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141870"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141870"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC10"
FT                   /protein_id="CAQ41969.1"
FT                   /translation="MQEWHHNRVAMACPASKSAKSVNSFFFFFFFFFCTSKCTKIHQRR
FT                   TSVSTWQTEGFTCGSAHIRLSSSPSHGESKDCLFPCFFVCMYVCFFSPYYHPTPCNQVT
FT                   ISLPHGNEMMERNILSKYKSFFSFVNTVKNKAEKEKALRYSQHLYLKNISRSNYNVKNN
FT                   VDQIYDNKLFLKYWMRKKRPGARN"
FT   CDS_pept        841224..846845
FT                   /locus_tag="PKH_141880"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141880"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141880"
FT                   /db_xref="InterPro:IPR028078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJ94"
FT                   /protein_id="CAQ41970.1"
FT                   /translation="MNCKCCHFPNLSIERYETLNFTQNKKNIKVHSKTQSKKKIATGER
FT                   VNGPRAFTRCNTKCFNNNHFVNISRIRTIRQLKGGTSNGTLLPLKKVKTNGPSEKKNRK
FT                   ISTRGKMNATNQSHFSVSLGHGEKKNSMLLPDEELTGRSYAEGRGHNGSSDECSSEGEV
FT                   ASKIGNAIGREVGTEMKNEVGGENGCGPNAHIMKNCTHQEFTGINKINSMEKNKSKSCS
FT                   LRNITGSNSAPNKDIHEDTSNWGQLRENAERDPEVYTPSNELLEEKNICECAKGKKKKN
FT                   KIMNIANVYTVCQNESPLSIDGKCPLVGKHNDELVGGEETADSLKMNEIGFGEMLINKK
FT                   SYLITGLANMPHGENKDGSVGGKSGLSIGRSSDPISGRSSDLISGRSSEHGSDRSNKLN
FT                   STTQHEDGSAKDKKKAQGSLPNGIQAEDITHICDDMPLLPIEVEECKNTKNLKDEEYAK
FT                   SDHQENILMFNLIRNICKGSKGVKNKEGEVLLNLENLASCEIVKKSTSSQKEINHVKEK
FT                   ISSIFHANEGKEQDPTCAGGNLNCNNQICFPNGDAVEGNREKGCLERGMEKTGEHENEP
FT                   TDDTRGDQMENLRNQLNHHLYKKLTDDTITESTNNTCSDFNESTHNNSSPKSTKFLFSM
FT                   NNEEERELCEKITLPKSTSNSAVNSMSVYMDSSSSMSDGSLFNDINRNKSNITEYEKKE
FT                   NSSCNVQKNRDCPNITPLKEVPLINHTAHNKNSGLRMTSAVPSSSFHIHGKIINLIGNS
FT                   QVQEVNEENKKDTIKEEGNKIGNLKRSINRDIDYSFKKKLKIEDYSLLNLNIYKNNPAE
FT                   LYRNNSYNTYILKSLQNSYLRNKLFNGTYSEIGNDSTKKEGGVSSYVENIPFNSTEKYR
FT                   YKYNKKSGSTEKYDEAEGWDFIRLTNNEMDEKVNAEEMAKRKRKQLKDMNRYYNDVLLN
FT                   GMVCPQTTQLINVGNGACKSIHFKEQNFNATYKAGEATDNHFNTIYTSEANYSNMLKEK
FT                   QLDNVHLNLRDIINLLEKERVGNLYSEEELESIIIPVGGIYYDTDKLKWLYKYDDMDKM
FT                   ANMGSKFLSVQSYSYHQSRQMALQHKYNYIRNKYNIFNDIDDEERMFFVSISGYATGGS
FT                   PTEGNTNQSVNTPQGKNPLAKLFNEYGHEASTTYGCTANESGHRRIEMCKQKIAPKELQ
FT                   PEGEEKGINKYQNGTDEKRTPFYSINKSPSDIKEENLNDTINPLNIHIPLSSSASSSHE
FT                   GTHTGSAVSGKGKEDTPSYNIINAQKDIHNWVGEFSKSNIKEKSFSDGVQNASTVTQSG
FT                   EIYGEFFPHSSITSKARAVLYKTLGVEFSNDLIKKMQNLPKENIFYEKDKKRWVIKIFE
FT                   KKTNTLLYFKEFDCTVFGFLYACILTIEHKQLYLDYFLNEKNYDFLMQLIQNSSLKRKL
FT                   YFNSAVRSTGLGCNGSLAGTNMFFMEGVNEEASLEESVPENVEENVDEGVEENVDGGVE
FT                   ENVRASAESGAKLNYDADRQRIKSGHNPNFAYLVNNSDAVWNEKMLSRFGEFYKTEEFG
FT                   RENLTMYNSGTSLSKPSQVEHIFPHKKYPSKNDLQATKNDIADRRKIIPSRLQEQMEGE
FT                   YFSNALGTNVCGVNTECSRGKENEMNWLQIKLPQKEWPNKEQFKGAQKKEYHITERGQK
FT                   NKTLEEGSPNSFLAQVEKMQHYLPHDEDNNKTMVISNLRRDCPKDVANCNGNNDTLSPH
FT                   SVFQNNEICKDEVINANETDDKSKKKTRQTNQIKAKKDSLYYRKTKNSKDAVGNGKDST
FT                   LTADLMQEETNNLLKLDSYIESLESNRDVISLAKETILLLLKDIINCIPFQMAPSVISR
FT                   KIYYQKINAHVKFVYHSQNILDLMPYFFIFKNVIKQKKMPSDQSLYICNVLLYALFEA"
FT   CDS_pept        complement(847679..850243)
FT                   /locus_tag="PKH_141890"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141890"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141890"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LIG2"
FT                   /protein_id="CAQ41971.1"
FT                   /translation="MERRKAQEIIDGIQASDPKTRLKHMKEIKTLCEILGMERTKNEVI
FT                   EFLYNIVEDDSDVLFELSNNLVTITNFLNDVNNCSSLCDLILHFIVTYEKEINVNAFFA
FT                   FNNYLQKCNCSTLLNIICPKIVNVASSDSDNYRIGVSKILPIIIERCIKEGQPKYMKTF
FT                   IQMFLELCQDQSILVRKSCCETFCSFIFILKKYKELSQNCTYLSAKGEEEKGKALPEDE
FT                   TVGRAQEYALQIGVNNEADWKGGTVNADRKGQIDGKRLNGEEVNNVVSTHRILESGTSG
FT                   NTPNGDEKKERKNVQEEIIALKTNEKRKIFVEKLWEGAKEIYRSFFSPINGMDEVQISA
FT                   VSILADILTCDPHFVKNLEETLRNICNDESWRVRAVLANNIHRILKVRKSDDISIVILL
FT                   LLKDVDSNVRSIVLNNLDNILVHSKISVNIMDEIFDDLKRDIDSNNVHLKISLCKLLCS
FT                   LPDILDKNGSIEYILPLFLLFIRIEESDLKSDLFTCLHKISKLISFFDMKQIIMPLCQE
FT                   IVKSKNWRLRCTLYHYLKFFDHFFFYQNKENFSSNYGDFWNFINIGAKDMVYSIRMEVV
FT                   NTLHFLIKAKSFSFFEKGITYLLSDLKESSRHICRITCLQYISRLVVYFPLHYIENKVL
FT                   SILEDLNNDKISNVRYNIVKTIYYVKNYVKYVLSVIMSDTYNTLMDKITKMVERRNREN
FT                   EESEKVSSGEGIQVPTSNAKLNINLHSTLGANVDVETDDNSEHDMQNFMSKKPSGNGTG
FT                   YFHLLENKQCLLKDQIKRKKYSFLINSCAVSSLTFYDNMKNTETNKLCCERILSFLSEK
FT                   INSLGADKDADVSTASKSLKNDDFFYYVSSVNTFSAVCKPIK"
FT   CDS_pept        854679..858560
FT                   /locus_tag="PKH_141900"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141900"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L3Y7"
FT                   /protein_id="CAQ41972.1"
FT                   /translation="MMLVKFLRGLTVFSLICWIQRIHALQNECDFNFNVMLLSNIYDKY
FT                   NGKHIEEVEGNRDYCSNLESLNSLKSFWQLKLKSLCTEETSILDKQVFNNICSKTYKVP
FT                   HVTVSGLQVGKDIVNIEFFCAHFLYSNNKEVIKCVRHNVLNNYLDSYHIAFDLSVSQEL
FT                   LKQSNHVDEVLNLKNIDGLALTKRIIDDSVCRIHSSVHTIMNKHDFDLFKALAGLCTKL
FT                   GFHHHFIITDNIHPLTTPLFNEIPYSLNSLNFNIQNSTMYYTNYEYFVYNVKLADIDHI
FT                   LGSYMSPSALAISKNNSYVTWLGINKENTLYKKKFDELYNLLDTNKYMERIVQCYSKYT
FT                   SKYYGSSIKYFLRYIPENKRDLMQNNPKIFIYIINGICKNIPSIHKCVEKIIFLDGIYD
FT                   LYFKNFMVNFIYYNAACIFNCNLPDLGKVINDEQVWDILVNYFSNAFLVNYKKTKTPSI
FT                   GGNNVNKSVDKTDENTSPETYKEMAKLYYTNFDYDYIHSGKWKKEINLEDEEAILKPSD
FT                   EVVEFEFYNYTFQTLDLSTYGFFILKSQMEEDNVCKISSFIEANGKKYVHVNRYIADFF
FT                   SKNNKRVLSHSGGKKGSSVGGHNHGHSNGGGEHNGGDEHDGGDEHGGGDEGDDHDDHDE
FT                   HDDHDEHDEHDEHDGHDEHDEHDEHDEHDEHGEEGNGGDDHVNTFNMFDDFLGEDKESN
FT                   SFMDLFQNNPLFNKNHNLFDNFYHGEDEEEEGELYDHKEREPLDIEKHKVSTPIGDVYP
FT                   LKTEYTLKELQNMYEIHPGFSELDEEIRYHFFRSQIFEKEVSFIVKDVPTKIENYYKYY
FT                   YEIKKSLKTFDKYDEEHYKMLMNKSKEDPDVFSKIDIEFSCTRMGKWPIRGANGRWLSD
FT                   VLCETKLVPQLVYNNEYAEKQGQNKKKKSGIDPNLYTLKENTRLIGIEFEDQEPYRCAI
FT                   SYLGDEGKRTHLPVSATLLVHLAIGFCTLHGFKIVWLADSAFDIHTNVYLRYTSILEQG
FT                   KTYYEQSNFEVYGQTRLIAQLEYIASGMSVENNLITSGSFKNRYNLISYPGTDLPFLLL
FT                   MSKKVKETIYNLKFDCHSWAYNGCSEYYPLMKKNKKVATDENYNTITLNGTYSKKELEQ
FT                   MYECSFMHDKTFQELNRMFPKECTFGSRIGDCHKKVRKHIPCYNEESCKYLIYIYENFY
FT                   KPQNHVNLLNEHFIKVSENLTKISRPYYLQSILALEHDIQIKKSKKRNTQYEDIVLFIL
FT                   KNSIFYVSWVTSSEYWKRAVYVQDVNTSFATINQVEDYKNKEMFCPVAYGHEFIGHMLV
FT                   QYMKYPNDL"
FT   CDS_pept        complement(join(859661..859746,859884..860029,
FT                   860311..860430,860561..860628,860778..861041))
FT                   /locus_tag="PKH_141910"
FT                   /product="ATP-dependent Clp protease adaptor
FT                   protein,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141910"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141910"
FT                   /db_xref="GOA:B3LC14"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC14"
FT                   /protein_id="CAQ41973.1"
FT                   /translation="MVDTSSLFFFFFFFFFILSAKSNDWCEGKMCGFQKALFFTLLCIF
FT                   LCKRSTFSCRKRYATRQWKFISASTTVGDHSGSISRCVFKAPKLKGRKKLIQAQDNSNL
FT                   EKIKKLRNVVKEIKKDNIKEFYSEEKQKREKETTAWKVILYNDDIHNFTYVTDVIVKVI
FT                   GQISKAKAHTITVEAHSTGQALILSTWRTQAEKYCEELQKNGLTVSIIHESQLKEKKKD
FT                   SNAGS"
FT   CDS_pept        862365..864116
FT                   /locus_tag="PKH_141920"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141920"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141920"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LAS5"
FT                   /protein_id="CAQ41974.1"
FT                   /translation="MEYKLEILSYLLIFKKKNERIAKFDEQIKTCINIFEKVLIDEEEL
FT                   AYLFEKNILDINPCVRSLCWKLALKHLSLNTSKWNEELCEKKKLYEDYIKCFILNPPRG
FT                   GQNGAEGVGAENEAIAAGAKLGGDDPNEDTPSTNLDDDSDANFINSELFSQINKDTFRT
FT                   RPELSFFNLNPQQTINNNVKILNSLISIEEFEEDVEEEIPSLVNINEMTKGPSDETEYQ
FT                   TKNVQHEKEETINGMRIEHQEENEEIRPLVDEISEKFTTKSKKDEKICQQKINYEHSFG
FT                   DHSADVCDIVNPKRHYDLLCRILFIYAKIHPYVKYVQGMNEILAPLYFIIFNDPLCNCS
FT                   IQGEADTFFCFVELMQKQKDIFCEGLDNTDDGINGKLKKFSLLLRIKEYELWKKLYTLK
FT                   IETQYYALKWILLLLTQEFDMADTIILYDHFIINNDENFILYICLVICAKLKSSLLCGN
FT                   FTVNLKLLQNIPPFDPYDIIYEAKSLMSQDFKNGFNITDVYNQYYGQRKRINSLGSLQN
FT                   CSSIAEEDISSFENLYGMDEGESGPRRGSILNSLRNKSIVQNIKNYISNKMDMAKREND
FT                   DLDFDEL"
FT   CDS_pept        complement(864863..867178)
FT                   /locus_tag="PKH_141930"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141930"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LAF5"
FT                   /protein_id="CAQ41975.1"
FT                   /translation="MEREGAQREEARHRGEKPKQIEHLGDYPYGLHSEEDSDPKDFRQI
FT                   SWIYKDIDNMLKEVNEKCSNLNERGASGVGMKLEALPGESYNWVKLSSQVNSSGSAKLS
FT                   NSKSSKHVTSSYSSGGTVSQNSSYTSDEMDNLSLSDELSVEEDSMGEDGNGSSSVVTLS
FT                   GDGNGSSSVVTLSEDGIEKSDRTTPNSSNSPDSSNDEGANRKSGTEGISSSTREEDNHP
FT                   NVYYNCITIFSLNSYLYNDMYRYNPHLYGIYETCRNNEKRCKKIGLLCSQYDLIFLRSV
FT                   FGKYQKNLYDVLKYTHSVLLDNVPSSYTILNEILYTLQNYVNGNGGLFICWRKKVFHLS
FT                   YYDYMFLSSDILFKRKVIKIVKLIFKGKYSLYILHCEFDLYSVQNKLSNLDDLVVLMKK
FT                   TLWKIYLFQIFYINRKLFKKREGSAHNMEKLSTHEYVDKMEAIAKMSKAEKELHTKDEV
FT                   VGSFSNLPDDEKGDSTHTHNGNTSNMLKEDQTDKSITTMTFRNSSMLVIGSFNIDVNED
FT                   RTLYDKLVNLNGQGKMKDLFFHKNINYKLQKTYDIVDRKNTLVSGLNYSFGLTDNIFLV
FT                   ESFFINSKDITELAYLFSPSDVISEKMSKLNKSLSRYNLEGFSQLINKNGVFIKFQDLF
FT                   NYGVDILTQKKGNEFSDHWALSARIHLKNPTKSVNLHIEKQLRNFLINVDKYFVLGKRS
FT                   YHELCAVVTSAFSGKQDPSRGGKGAEDKFKKKNHKEEAQMDKYNYTQRCIISSANINCI
FT                   HKVEKRLYNTLSRCFESD"
FT   CDS_pept        complement(868298..869248)
FT                   /locus_tag="PKH_141940"
FT                   /product="signal peptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141940"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141940"
FT                   /db_xref="GOA:A0A384LNH3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LNH3"
FT                   /protein_id="CAQ41976.1"
FT                   /translation="MNRSSHYVKRSYALIFLRKNILHTNSINNNSISYHGNCKGEHIFQ
FT                   KCYAKFLEERKRLQSVLCRSANACNFVLSPRSRGSSLKCYSERKKRGNNKYRTRRRNFF
FT                   FFNFVKINNPLNFIKKIILSFLLIFGINNYVIDMTLTSGSSMCPLINKNGVILFYVCDD
FT                   TVRFIHQARSIFLYSCINLLLRCYALIGSNIEQSYMVILNNKIFSLIEKLKRIMAENKH
FT                   VYRRGDVILLTSPVNEKKRVCKRIIAIGNDKLFVDNIKAFVHVPKDNVWVEGDNKMDSF
FT                   DSRNYGFVHMDLIIGRVIFLLDPFINFRFISNRTS"
FT   CDS_pept        join(870421..870456,870816..870930,871221..871490,
FT                   871654..871709,871858..871920,872135..872221)
FT                   /locus_tag="PKH_141950"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141950"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141950"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K978"
FT                   /protein_id="CAQ41977.1"
FT                   /translation="MSQRRSAYSQRNKISEIEKKCEESLNEILRSANEVTEISKKAEQE
FT                   LEHQTEQIKHINKETENIEENLNQSQYHLEGIKYWWKNINSFLGFETFNSSENKTVNNQ
FT                   PNNNTKKNTNHNYNNKYANNDDKFCRSPLNIQGTPKRKGTFDEKYESDLTTLSSMLDEL
FT                   HTRALVMGNTINEQNRMLGDVNEKMENNIEKIRDQQKMMKEIMKK"
FT   CDS_pept        join(873959..873998,874159..874207,874483..874907,
FT                   875182..875264,875390..875443)
FT                   /locus_tag="PKH_141960"
FT                   /product="small GTPase Rab11, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141960"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141960"
FT                   /db_xref="GOA:A0A384KY36"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KY36"
FT                   /protein_id="CAQ41978.1"
FT                   /translation="MSMKEDYYDYLFKIVLIGDSGVGKSNLLSRFTRDEFNLESKSTIG
FT                   VEFATKSIQLKNNKIIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKKNSFENIE
FT                   KWLKELRDNADSNIVILLVGNKSDLKHLRVINDNEATQFAKKEKLAFIETSALEATNVE
FT                   LAFHQLLNEIYNVRQKKQGTKNEDSMSIQPRGKKINVDDDNDENNSKKKSKCC"
FT   CDS_pept        876913..881127
FT                   /locus_tag="PKH_141970"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141970"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141970"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KSY9"
FT                   /protein_id="CAQ41979.1"
FT                   /translation="MEERNVLDYAEVIIDRQRDKINELEKKLVELRSSSEELQKNALKN
FT                   DEENKTLRLELNRKKENDMMLDMQLSKENEFLQKINILEKQLLKRDTLLEELNNLLKKR
FT                   KYEYELLLQEKENLTNTLNMMRSDMCKNWKKEKLKEEECLNNEKESENFLNLYKNNNEE
FT                   LHITKRCLIQIETELHLYKKQNEKQKNEIQRLYKIISCMNKEKALTPPVVLALQNDYVR
FT                   DRNSKALNEYMQVKTIQDCPPGLSTQMENKVTILKHISPEKNIQQRMIYDENLLKLNLM
FT                   QSQEQKNLFNKILETLNKIQYEKSGDNKIDFFFSSSVLHFLESNKEHKLLRTNNESLKH
FT                   FFSLTTESEEDSGQLSDVSSYNPLEEKTHLRKNKKDKRQMKKQKREKTKKKKKKNDRIL
FT                   HSPFSIKKSKWGKKKKEKGGVGPKHKLARSEDSSIEDDDGDAQRGHGDKTTTISDDTSH
FT                   GTSEEITSEEDTHSDDDDEDDNGEGGESESGVSASSDDKSSNSKSDDDTGIDSQGNSHT
FT                   PSAKRRHQKGGTSDESESNTDGDNINHIKNKGSYIGNKKALLNFERYKEKFIGITNKEI
FT                   FLYNKKGDEEPVYVLKNKNVKNVKTFYNRQVYMLEYISFDNIPEKHYFLIKDDDKSLRM
FT                   YYALQYAGIMKHEMDKFQGEEENKNDYVGKLNKNYYENKTQGVNDPQEKASYCNKLNSS
FT                   YQEITVNIFTPSGIDRNGNNIPYLCSNVLIKRSSQNNHLMLKNFNSKKTYINCQHYHMD
FT                   YKNNKFTLYFNEFKDQHIILPKSKGCMGILQDILNQMRWKNSHQIYESVKKGAYDDEDV
FT                   ESADVSSYGSEGVVAGKGKYDTREKMGEGGAHRGGAPDKESNGEWVRDRDNDGGRDIFR
FT                   EMDKSRSREMDAKREKEGDTKMEIPREGFIDKGVGRDSYRSKEREWEQEWEGQKERDLE
FT                   KDEEDRKDSILANSNMSDKMADTFYIKENVLYISKDGNPFKKDQMSFNDENAYKFPNEK
FT                   VQILRDDNAQELTFIKSEENKDEETYIFHYPKKEKYDHVISKLGNNNFNVIQKSDYDKM
FT                   KKQEKKEEREKKSFNADSDAKTEPGKEKMEKADKFIKNNQVVVIEKGLLSIYKDYGNEN
FT                   SVPIIKFTCDSCDVHANEQNGEISIKETSKGSNDKIVLDCLNKTEFHRWKNALRFGGFI
FT                   KGESVSISYMNLKKHIFSINLFDNLDIKSLVRVNNNFIYIYPNNEINKPLFSFDKEKIE
FT                   LVVIPNIRKIRIYMQRDTVYEQRYDITISLARDFLNIKEQIEKYNFHTLNKKKIQKIRK
FT                   PFVLCKKNIIAIHRDKYKLKPDLILEKKNCTVLYDKNKFTITFKIRNKLDTTQEDIKIV
FT                   TLSNAVNFSKWLVTLKVASFIPGFNDVEDDISFPTIVYGHTSPEATSLLGKRNSFMNFF
FT                   KK"
FT   CDS_pept        join(882689..882718,882927..883029,883246..884360)
FT                   /locus_tag="PKH_141980"
FT                   /product="dihydrolipoamide succinyltransferase, putative"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141980"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141980"
FT                   /db_xref="GOA:A0A384KDU1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KDU1"
FT                   /protein_id="CAQ41980.1"
FT                   /translation="MTQNLVLRLNKPLFYNAKGISRILNLECKQSVKCHSKFKRCFSIE
FT                   TIKVPRLGDSITEGTISEWKKKVGDYVKMDETITIIDTDKVSVDINSQFSGELSNIFAE
FT                   AGEIVLVDAPLCEIDTSVEAPAHITEVKKGITQSKSEKESEETGKEEESGEKEHNVAHK
FT                   ESERRVSEENNGKMIYEPVSERTETRVRMLPIRKRIAERLKESQNTCALLTTFNECDMS
FT                   KVIVLRSELKDIFQKKYGCKLGFVSLFMHASTLALKKMPQVNAYIDKDEIVYRNYIDIS
FT                   VAVATPNGLTVPIIRDCQNKKLSELELALSELATKARNNKLSLDDFTGGTFTISNGGVF
FT                   GSMLSTPIVNMPQSAILGMHTIKDRAVVVNNEIVIRPIMYLALTYDHRLLDGRDAVQFL
FT                   SAIKDYIENPNLMLID"
FT   CDS_pept        complement(join(885086..885124,885357..885418,
FT                   885529..885675,885849..885984))
FT                   /locus_tag="PKH_141990"
FT                   /product="cyclophilin, putative"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_141990"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_141990"
FT                   /db_xref="GOA:A0A384KTH7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034168"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KTH7"
FT                   /protein_id="CAQ41981.1"
FT                   /translation="MSDDNATEVLYVGGIDETIDEKSLYDIFSSFGDVRNIEVPINFVT
FT                   KKNRGFAFVEYVEKDDAKHALYNMNNFELNGKRIYVNYSRNKKMEQYKPVWIDDLYNQE
FT                   KMKQMEEGNSNQVENVEKDPPDE"
FT   CDS_pept        887761..889719
FT                   /locus_tag="PKH_142000"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142000"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L6X8"
FT                   /protein_id="CAQ41982.1"
FT                   /translation="MNASNTNGEKNLLIYDKSTKVGCIYFIGISSNLYRGKVILKKNSI
FT                   SDRIVRYTNLSENLLLIKNGNYNFKQTAILIKGITIFLHRQLEVLLTDFYAMYKKCLFS
FT                   SINEYRLQNGILKKCRANRRHRTKKNVLSLQDGETTYGNDYSGGHDDGTFRRKKAKYLN
FT                   KNRNIADINDLMLKENNELYENDYHFENEDIPNDENVIYQDMLTNTSSFDCSKFNNMYT
FT                   INNGMGNINTKESSGDGNVQSNLNNTAFMKYNMLDIRRHTSAERNNYSNDSLLMSKTLN
FT                   KKNFSFSILNSSLLFSGNIPHGKVSNNLGNGHLGGGNNFRKDNSKGRENHAREEEKKNK
FT                   RIFAQIDKDTILRDNIWEQNKMNKRQKSDNQFSTHLKRGSYVFFLLYNDVKNGPSDNSI
FT                   SSSFHSYEQAKNFINFDTRKHVYNLFGNEVIQNEKINMQPNNFKLLHTKSTVSSINERK
FT                   NEQKKNHLNFDQLRVNFNDEYFLKSELPQNQGGKRYSSGSFRNSYDQMDYNLDEMDYNF
FT                   DRMSGFPRKNYEHRKSEAKGEHKNKNGTKDCKDVYNFSDTLKDSLSVPSSKLVSRRSFT
FT                   CSEYKYNEELIKLKNYLHKISTKCSNVIEFDRIFPVKKISDKNISIIFYNLLVLASNAE
FT                   VDVTQNYPDSNILIQLC"
FT   CDS_pept        complement(join(890026..890097,890239..890715,
FT                   890903..897612,898041..899151))
FT                   /locus_tag="PKH_142010"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142010"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142010"
FT                   /db_xref="GOA:A0A384KNU2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KNU2"
FT                   /protein_id="CAQ41983.1"
FT                   /translation="MKSTSFMKKIFIFNVIISLLNKYVKREPRDISFFIYSLKIKGFHN
FT                   EDLNNGDEYTGDTGGGGREGGENVNGSVTNVAGDSRSRTSVSSSASSVESNIPMISSAS
FT                   KIMSISQLNATIANFFSNALAEAIRNKQDKGKNQDNQKKKDEEVENRRIPIIHTSIDDI
FT                   KKFSHVKGKLKLIYVRSFYDNGGRDDNMNLKELYEAKFQFYKDKVIYVTTFALVKNSLS
FT                   DNINQTEKWFNASMKLLQKNYYNISLRCNPIMETSYGTISFSADELKRFEALRKALKKK
FT                   VNITHDNLFYNLDIFQSAHRKYLQEINYNSLHPNFMNSLDAEVGHSGVMDSSNLEDDLL
FT                   STLSPFDRMKYVSHRRIKDSHKIMCSLEKDFKKVEDRFMVYNLIQDNIIVSEETTDIII
FT                   FETSNNGIFTYDAKYSNEINLISNNFEIEIMMDSNAFINEHDKYFYLNNYDSVQLELQN
FT                   KGIIKYDFIYSWLSTYFIDSHKYKFFYPSFYVSKQYDKFDNGLYGINFYTPPYDSFSEG
FT                   VGSSYTHLDRGKREADSDVPYEGVRQGEPDRSIRNDKRFSFFELKTTLHNENVGKGSSG
FT                   STLGNDSNNGIEGGSNQDNFNYGSELNPNHFGSEDPEREGREVENSHDPSHAPLYPSGN
FT                   KENDNNMDSNMNAQIDKRENNVPHKNVKVKDAKTKKSTKNESNTSDTGISYLDSVFGYV
FT                   RKVKNIIYGDEEDDSTSDSSKKTSDKHEKSKMLQQGKNTNWNSIFSSFTPDDEIVPSNE
FT                   TYDEDTQKTEATNISKEDLRPVEDQAIEEFSPMEEPNKDSEEPANDQPISPLPTENLEN
FT                   DQSKVKDASVEEVLNVTEGQSTMPEYASTPEEHPTTAYPFFLVQESLPAQPEESAPQSA
FT                   FDIRNDEDIEEQLERKSNEHFEQDPEESNEEKYEKNEEEYFEKKTEKNFEKEAEESFER
FT                   KVENQVQEIVPYKIYKHPSDKKIEDMSKLYEEHKYDSLIPFLYKIFHNKTLLSDSFLNS
FT                   DHNEKDGSDKSSVERNSSDDSNEDSNEDSSPSQHGFPNLSEGRKAFTRRYSDTDNIIVG
FT                   ENVDENLKDKIYEQDGNFTKYEDIIGRHPSRIIVGLLQEGKQNMFILDWLSGDNILCAL
FT                   KSTAYKELHYNMVRKNYFKILNKFKFGRDKELAILSSDTNGVTMSADFFPHFSAIKFFF
FT                   NDKSNNNIDNELKSYLLIIHYLLNSYNSPCKNYKNVKYFYSGDTFNVSHLNFISDKLLS
FT                   LLSECAMEIMNWDIPTGMIRKNENEINRTIFNRALKNVSRSIYHYALKYRMIRGKDAVQ
FT                   FVMSNYNMLEDNYNVKYNFFLNITSRLFYFHALGLVHGNIKADSFFIQENEEDDKHVNV
FT                   LLRTFKDTVEEGGYGNFKGSAIYAAPEKLESYFNTIRYNLKSDAFSLGLSLGTIFTKKK
FT                   FVLQKVERKLTYPVDKYILSLIRRNPMVLLWIKSLNPFLRKRLNIFKFRSYLKVSVQEM
FT                   KRRMSEKSVYKWFEDKFQFINYEEEDKLHALFTKAEGINLSGFSNNSSKMKTGEQYKGL
FT                   DSCFFRYTHASNTEKEDDTHSPKGSYSFHTFMGESSSSDNKEGVSFYQFPVGANRRGAS
FT                   KRGRKHNDGENDGENDGKNDSSSGGKSDSSSDGKNDSSSDGKSDSSSGGKSDSSSGGKS
FT                   DSSSDGSGKCNGDGKTVQRKKSYFSSISKHEYEESSGETNRKFRKWKKGDKENIYKIPF
FT                   GKYFEHQVDYSSLDAYNRKNYMNACYHFKNGVVGTAMKTLSIEHEPYRLNLFDMYLLNK
FT                   EKLTYLVDKDDNVKNLMSILQGFSTPDCKVILNDRIYGKWYSVRKMVLLKALLFYGYFS
FT                   LHERLSYEFKLYELQNFPLSEDNNDTFETVVTRCMQRAHFNEFGNLLLAQYIYDNYHEG
FT                   NQYTSIFINFYAVNDTVYYIDTNKVTNMMRRYIKQSLSKIDFKTADNFLHYMKRKELST
FT                   YMDMVELTPVKMDKSNYLDLHEHNVPLINSFVIKIDKFVIKDMNINLAVLLNNAFWGVK
FT                   NKCKCVNYTHLHVRNRKSDLPKGHISGEKMIDLHKPVGTLLREMIPNNINMERDNNPND
FT                   LLSWRTFKENKIHLDVVLRNSLHLIERRTLIACSKGLNKVAPVYSPNITNDHENEMMKI
FT                   KVGLGSSKYFYLSFNISLLRSEEITLKNVIYFIYKNYKSQLDRNVTYSHVGRKNKRRNF
FT                   NCLMVNEQNTFFYNNVTGNFIKEISLNKVISALYNVDLMEPSYVIKAALNYYNNRAKNS
FT                   ILFSLVTICNSVRERRNGRNARKSEFVLESAPGVYSGGEGQTGNGEEVQVEQTNVERTN
FT                   VERTNMERTNVERINEEHTQDEITIVKPPTDESTNNESINNESINNESTNNESTNVEPT
FT                   NDEPPTDEPPTGEPPTGEPPTDEPPTGEPPTGEPPTDDSPFMPSEKELSFLQRQKNVIK
FT                   TIDKNGAYHYGTAECLHFLHKKVINFFHDSNMTNAFDQITIPSEYKYINKKKRLKNGTF
FT                   QYSTRTINFNIISNVMNLQRYEKELYTLADFINLIIQWLVKQGPFDIKNKCNFLSCSTH
FT                   NSHFGMVLSITTEKGVKHILYKNDEGLMKFLFYNILKDRESRQYIPELIASAIKLYNLK
FT                   VTFFLRDEIGGIFPDLQSLLNLPEETPPLPPFTDCLKQLKGKNVTLYGDEESQAMYVSF
FT                   ILEFVNKNIMYRISKDMFNKIIYHFNNQEVNKNEGGNLRKDVLSSIPEIEDKFRHVFLS
FT                   ELSYYVNISTELKKRNKSFSVTMNPKFYEILSQKCNEYEGNCFYHVQEIISNVNGTFTE
FT                   PVFVVKNVMNLFLRRRILAVLSRIKNSIVS"
FT   CDS_pept        join(901927..901950,902123..902218,902430..902537)
FT                   /locus_tag="PKH_142020"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142020"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142020"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="InterPro:IPR026939"
FT                   /db_xref="InterPro:IPR039438"
FT                   /db_xref="InterPro:IPR039713"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LMV5"
FT                   /protein_id="CAQ41984.1"
FT                   /translation="MGKGSNACKRNQARERKNVEVKAAKSQLKANKDALSVICKVCYTV
FT                   FMQTQSIAQLAEHAQNKHNKDVKECFPDKF"
FT   CDS_pept        complement(join(902910..905550,905618..911754))
FT                   /locus_tag="PKH_142030"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142030"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142030"
FT                   /db_xref="GOA:B3LC26"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC26"
FT                   /protein_id="CAQ41985.1"
FT                   /translation="MTGLQFFGKVKKTEIQEIEKKLLHIHKCVTRSLTNTNLLNKGEII
FT                   LHWKKCHMYVTDVKTHVTEFFENYKNFEICNEINLLIGEYFMYLIIYLKNVKIKKNPLK
FT                   ILNLYIFVNNKWKDKLIYHFLKNLFLKNEDEEQDCTNCKTLIIEYFINNYGTFREEHIA
FT                   LFYTNILKYINNKLKINFLKKNQNYLNIFANFLITYNGNATLQITSHMLNAFLLIAKNL
FT                   KKILLQFPFDKDICTHVCLIYQQVKNVIEAYRTSVCLLLSDKVHLSPILPVGLETKRIN
FT                   QQEDPPSDADSDEEFDASEEEDVGLDVETGINSSVNDQNVIILHKYLGCIKKIQQLLQQ
FT                   CDNIIKEKKKENPFLLLCKYRSILIIKYKNVKRLNISDNLEYFILFFKIKNLLCEGSKN
FT                   PFFIFLCIDSINYWFQKNEKLQYIFEHAKGADLAKGEESEECFFTDGLPNSYADDRLGH
FT                   NAMKRNCPGKKVSWPNYNLANGNITNLDSTDLLHFPHEGEDKIWEEDSTLVRHEQRVKL
FT                   SQNYGFIDGKDDDSVYYGEGEEVREDAKMISEGNNPEGVRNAQANISRVQMDELIKTDG
FT                   YVKISSLRNHFELLSHTNRINFMSHLYSAIMKSLLAILKKYSWYNIKIIWKSCIGIYEF
FT                   LLSSKKNTFIKKEVCDHLRYIIFNQEKKKKYMCLSLLLKYFKESMCEKNVLEYLFYCFF
FT                   QNDDFFMFSLYELIKQCIKHIFIHAKDKNLLYYIFLKNILITDNFCMKTFYIKKFIELF
FT                   YKHDSNYVYFILNKEYSDLRKYFDATIQEEQEGRSIQADPMEPEQNNVDNFINMNNMNN
FT                   VKISMEMTDRHYFLFLMKQLLERKDTEEVTYNCVVDQMEDNIFLNYKIVNDGMNSLEKK
FT                   NPNMKETTMEGKFLIYNFHSLENIAFLELYTLCTLRKYESIEVVYYKGDYFYQLGKNVL
FT                   LNVKILNNFFYFSNDEFVLSILSFICENKYLNLCDLYLFRTFLITSITNISRTSRDAYR
FT                   KYILLFFEKFFIYYQRMVEVDKRRSYNTEGDVNAGATHMDKHSFEVQKVISFLYGNVEM
FT                   VRKNSVCDTPKEVYSTCIFPSTDEKHVDHREGIFLYNYYLMNILFVLYKNINKDMGIEA
FT                   TVYCSDILNAVVDYCAHFENLNFLFFLFNAKTTWKEFYLISKEIFFKTVNIILLKRESF
FT                   ACLNNAFIHLVRSHRQVDHSFYAFLLRLCFISLNQRREVNKREEGIVTHLLTSTSSDKH
FT                   EIYERVNNLRRNTNREYSPPCDFFNCLIRSRDIEHIKEDNKYLINYVNYLFSDRSEKCE
FT                   NRESDAMLNIPLYIFECFINKLKKENIVKLTKHEDIENCEMYKLAYYINEFILYLKDNM
FT                   DFSKHIEGAAFRKNFCEISLCSSSTYLNFEKHKLLSLSSEVLESSDGCQLILLKVYMCN
FT                   VLHYFISYLNTLFLNESKSFFFDCRGHLIFEDESEKEATSIIIWLSIKYICILFTSIID
FT                   FSFKFNITTCEGGDNLGKQNDSTVGNGNSKGQSTKDANYANGKKNITLFFFDSTEIHLI
FT                   IQNLLCLLLHSKHIACQQYLSDCLLDICRIIVMRSGESMQTIPLFYVYIILLIFKNEGG
FT                   VSKCRGEDGNQVDKTMDGRAHIPSDEPVLNGNPEDPEPNIEFLTGIISRLNKMLTTKEE
FT                   NNVNVSEILSAHFLTGSFTPPKWEAHEKPTVQNVTQRENKRESGETKSGTSPHVNHNFK
FT                   LNDKLNMLIWDDQRINTNFLRKSSNMCLALSSLAKSYRAKEQYIIYNFIIKIIINYLLN
FT                   GNNKYKKVICVNIIKHIYTIIDNKTLYEYMSDIYKIALTYYRSKFFCLKSASTSLYNIL
FT                   TKRLLAKLNYSYHVSSNMYYFCTGSKRRIFKNMNLTFFDLLNSVNLLKIFLNVFIRKGR
FT                   ILNGQNFRENEGKPFFDYSNFYAQFIPILIFLSNIIIFNNDDYFLLRNVKGDLVAAHSA
FT                   HQFSPHNASLVDTGGSAVEEVDNPSDMQEGGKNTELEEDRTDNQPSNDPDGENQTQISN
FT                   MNIYFLFVEHLKKLLTHGNYFVQVLICRIIVNVYMHIYLKLKKENLIFNFLTKLKESKT
FT                   LMEENKKKFRKIFFQFLFLFMRSERYIEVLLILQILNILYSKISISLDQNVVDFLFRRL
FT                   TLYQDDMFISVLVNELLMKITKRVENFVALLDIYTSSKNERHIESFLYNWFLHTKKRYK
FT                   KEFQIRERQLSDMSNYSSFKFFSQCDKKGVKIPLGEKWLDETKQSVTGDSEGEVLGGDG
FT                   KMDESVDERMYIYLYLLLFQIIHTYKDNIKIKKYCFSIILTIVKFISIENLFLFERMQH
FT                   YYIEHVDQNYLDKYIISYSYHICVKYFSITQKAEGKKNQKERYESENKFIEAIYNFIDT
FT                   EKERNISSLNCNWKESLFNYAYFYMLLFLNLVARLCNKNSLTYTKYFVKAFMNYGIVEY
FT                   NYGRLEQEEGEMKNVEAGGGADIENDVMVRKEETHSSLGYPTRNDAPSWNSRNGTKGNR
FT                   ENEIFDVTQFLKNNYSGEGTPPQVSTPNYALPKEQSKERDEGTSAYKKYKEWYRTDLNQ
FT                   WIMEVVKKKVRKQNITIDVVYVKNSLKHLRGHNLFTAFFVILYSCLIFMLNDENELIRY
FT                   KAKIAVFHMMRKRALNMYGTVKDIISVEFFIYYLSIWHQHVALHILTFCIFQTKSCITD
FT                   KFYYNPIKLFDQEKYNLYINNVLLNHLFVFYYLFNITTIYVEGNPIAEITDFYHFIDML
FT                   GGQKKDIFIRNVDIENATPFLSKDETSLDEQDLYVLKNGSVWKKIMERLIRKRAFCTGC
FT                   HILGGEEKPSLRTSYLVSHRKGLLTFYMGSFLLFLEMEYMADIKKSLDNYSHLLESYKN
FT                   VDLFDSNLVICWSNLFNKIIIFLINIFIFFQKSTSLYYNSYFYEEINMIKSKTASIYDT
FT                   FKLVRHEMNPFLLKTMELLLSIMDTDFLKNKNFFSDIYTLLYSLKGSL"
FT   CDS_pept        join(912814..912865,913053..913173,913523..913636,
FT                   913735..913781,913930..913983,914086..914173,
FT                   914361..914469,914585..914658,914854..914996,
FT                   915140..915188,915339..915381)
FT                   /locus_tag="PKH_142040"
FT                   /product="Zinc finger protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142040"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142040"
FT                   /db_xref="GOA:B3LC27"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC27"
FT                   /protein_id="CAQ41986.1"
FT                   /translation="MFQTKGARAPFLLPLYKVYESNNIFLCDGNVITGPNILHLIFTYT
FT                   IIIITVLPIYIIVYSHVETILLLSLAILSITVFFILVLFFLTTTAFCDPGIIPKKSYVD
FT                   LALPRGRTAFTTVKINGTIIKSFWCVYCNHFKEPRSKHCYVCNNCVTKFDHHCVWLGNC
FT                   IGTRNYRRFIFFILNLSILSTIICFTFIGIFICLCMKEYQNITLGSIFYITFEYPHIAL
FT                   YIIYTIPSSLLLINLFFYHLKMILSNRTTYEDIQGLYEDDNPFDEGKFINLKKFLLTPV
FT                   IKKQVEWTETVKITAV"
FT   CDS_pept        complement(join(916189..916378,916485..916888,
FT                   917066..917329,917507..917914,918171..918332,
FT                   918627..918737,919050..919149,919308..919412,
FT                   919589..921336))
FT                   /locus_tag="PKH_142050"
FT                   /product="cAMP-specific 3',5'-cyclic phosphodiesterase
FT                   4D,putative"
FT                   /EC_number="3.1.4.17"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142050"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142050"
FT                   /db_xref="GOA:B3LC28"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR036971"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC28"
FT                   /protein_id="CAQ41987.1"
FT                   /translation="MENPDKSEEEGKNITQRDKYTSEKDNTNTFTNDISTDEKKSDSPN
FT                   ISKNKVIITRKSFFTNALTPRRDGKNEVDVELFNSVQKKKSISKDLRTNDNLYKGRVRK
FT                   ENSNFKNLDHLQNLNNLDWPGIPDDIELNESSIDKKDTDRHGDSLSDVDNISETKNSIN
FT                   AYTDNRTENNNQNDVSNENNSIDWSISNLNTDSNSDFSNVEVKILSGKEEDDTKMVEEN
FT                   SGSTSCKKKKSGTNEYGKLMSNMQDRKLKEININENVRKEKKGNFFSKAVRSASLLKCV
FT                   VDDNLANVKLEKNQDNKTFMMHGIKRESTYDNSGKRFSIRKNYASMNRNTNTTPHSNGF
FT                   FYSSSKSCGHIKLSSGNIKTKNGKNNLSDNKNMWRTFENFFCEIWKRNMTIKKEFCNSN
FT                   SKNGLSPFKSNFTDNYLNQSNDNELMTQIPLKFKDETIETLYVLNLNNWISSRMIIIGM
FT                   IMLILCFFIWLLFSWSFKSSAWDKDSYIVMLFHLLMIFNTIILLLFIIVGLTELSKYAE
FT                   VISYVLFGIMVGMWGLWNIVTSLTLNDNITSKVIPSLSSAVETIYALTYIYGLLPLVIM
FT                   DVFFPSRTKYNWFMHLLFIVLNSTSIILVAARNPGFLPSVFVVFRVIAYTTLCLFLYIG
FT                   CYTSELQIRYVFYNLLITGYKLDKVESAMNKNNNRNNKKFSTAMEDLVLMIKECTKVIL
FT                   ELENETEINFNVHSKTSYCTNILEQCLSTLTKTDNLYNVDYDLFDKLENKKFIEAYVSK
FT                   SKSNFLGDQDDGADFKLNKSFSTNDFICIDKVDIDKKEIKKFLKEIDIPRVTNMIQLID
FT                   NKSLSEWDFNCLNYFENSKYPFFDINLSLMFTIDHDIPMNSIINFLSFVEKQYNNVPYH
FT                   NTIHATMVTQKFFCLSKKLGIYDHMEYKIRLVMFISGICHDVGHPGYNNLFFVNSLHPL
FT                   SIIYNDISVLENYHASITFKILQLNQCNLLKSFSEKDFRQIRSYIIELILSTDMKYHFE
FT                   IISKFRIRRENEDFDYVKNNDDLLVLIKMIIKSADISHGSVKWNEHYKWCQRVLCEFYS
FT                   QGDEELKNKMPLSPLCDRTKHNEVCQSQITFLKFVVMPLFEELTYIDDIKFVKNFCLKR
FT                   LHSNCLMWEKLMKEEKEIKVYDPASVKRKEKNKKKIDNRKKSYIDLTLFFIKNISE"
FT   CDS_pept        join(923793..924051,924241..924389,924591..924772,
FT                   924951..925055,925229..925430,925623..925760,
FT                   925971..926231,926395..926610,926835..927662)
FT                   /locus_tag="PKH_142060"
FT                   /product="cAMP-specific 3',5'-cyclic phosphodiesterase
FT                   4B,putative"
FT                   /EC_number="3.1.4.17"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142060"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142060"
FT                   /db_xref="GOA:A0A384LNY9"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR036971"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LNY9"
FT                   /protein_id="CAQ41988.1"
FT                   /translation="MIDYSKEKYNRNETIRKAFSLFSFPSNEEEKVINFWPLKFKNKEE
FT                   ELAYIAKLCDNIQKKKFVSLISHLSSLLLMYSICLVVGKINDLFSTLKWTFTFLHIFAA
FT                   VNVVLTLMLHHTHYVERFKTIRAKLFISYTISVLILWCSWLFILFNDVKDHLPTVVIVN
FT                   NFLYATYTHNKINIVLCFYAYLPVLYLITIIPCRICYSCVFDVLFFMMKVSIYSVYYII
FT                   TMKNYVLTDNIFMIASSLVGSIFIFVIRYIIEIQRRLAFNNWNKQTKQIIKLKINLKEE
FT                   KDRPSVTNIEEIYDIINDSIGNYYDSNAPSKEKDYAIMNNLKKILNILKEDNLFSPDLR
FT                   TINKKNYNHIYGYMMDIKKNKQRSGGKGEPKEQDNETHTEDGVNEGAEESETESLVESM
FT                   SDMGKKQELDLLSTRLSKKEEIKLDQGDFDINVRSGDVAARIYNTKFLNTDTPNDNIFT
FT                   QLGMNLLTKCYTANHNVPNETLHSLICEMKEGYNNVPYHNCIHAAMVAENCNMLVNNLD
FT                   TVNILRDNEMAAFLLAALGHDIGHFGRTNLFLKNSSNFLSVIYNDKSILENYHCSYLFH
FT                   ILFKDQNNIFKNESAKTMLNLRQEIIQVILATDMSKHIKILAQFRIKSIKIRSYIEKNI
FT                   ILCLKMIIKAADLSHNCVDWSEHYLWVKRLVNEFYHEGDEQLEKGYQINPLFDRNSHDN
FT                   FIKIQRTFLKELVFPLIISLKSLDRTSITQFMMDKVKRNYSKWKKIEKNPSKRKKYLNE
FT                   LISNIPDSWKKLYHPNLDIYQLQKCT"
FT   CDS_pept        join(929394..929496,929843..930813)
FT                   /locus_tag="PKH_142070"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142070"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142070"
FT                   /db_xref="GOA:A0A384KM80"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KM80"
FT                   /protein_id="CAQ41989.1"
FT                   /translation="MAKRHKLKITILPIFFFVIFTGIHTVFTAFDRNDWLMFYTSCSGS
FT                   GQVKWELLGVLTILNSLILLLNVNYKENINHLNNKKSETSDINDDLINVDMNEFSNNEK
FT                   DESSDESEKEKKYNKIKIRYLYSISNSRVCYYSMWILCYYLIYFLCFLSFLYGIRLFQN
FT                   NLINIYTIRTCRIDNLANYILSENTFISLYWAIINFNVFMSKYTDSFYISNYFKLNIQF
FT                   STGKKKLLFFLNYAYQILLVSYTIYKNVDLYNKGLYNLNQIVCALIFLCLILYTILEIT
FT                   YVLEINKPCYYGVTKLSFNYIWAIIYLFVIFISSVIFYFSVFPYSIKDQYVNFQIMLWF
FT                   FFISLTYIKRNQLFIKV"
FT   CDS_pept        931451..934504
FT                   /locus_tag="PKH_142080"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142080"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142080"
FT                   /db_xref="GOA:A0A384KW88"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KW88"
FT                   /protein_id="CAQ41990.1"
FT                   /translation="MDTLPDVESAFLIYNFENSPIRNAEKSNIIKQFNNKIKRHEKVLL
FT                   NSHYKHVNNFSYSTDIFHNFYKITEYYLLKYVNSIIIDSTLFFKCVHQVKNGSSYLAQN
FT                   DEEKLQERFCLNEQAEEGTKLLGNSETKNEDPADFTFDCVLLRNFVENFKRVNSSSVRV
FT                   SKTSGKENRRGSSHKKYVSKDANGGSTTNNAEANPRGGKEEPQNYPFRKSFLYELCEVY
FT                   SHSHNKKKRMICITKIFRKIVSRKQIRQFICENDKRKKKNYLRFFLNLSLGIFIYLYMH
FT                   KYIKKNYRNVEFFIFLNSPQNFQDIYVNMVPQMEKQQICSFIKFVKLLNIRMFRYLYIT
FT                   FFVNIYKYVNLIYNVTLLTLYSYFKYLNECINGGKELFSLERQEQIEEGNHLTEVPTHI
FT                   RASHTALEGTSSRREKREPSEIVTNEDSQGLSLGRTMQNYGSGLKESVDTKSTAPNIYQ
FT                   NYERVNSEIGEKNTNELNNKREAEDTSTWNGRQYDNPGPANYSEKHTHEIILSCYIYLF
FT                   IFYHYIRETRKKMKYEILRIQNDVKKMIALFLKIYGINKKGSDDENRTTGECKKDGTID
FT                   LRRSLTSSANTTQPTVDSVHSLYFNFIQMSKCYRRCVKTNYELIKSVHTFHLLLKHFYK
FT                   YFPILNVKKDKCMIYNYWNKHFIHYAKRVEKNGQVENVFCTEEKNRQKGNGNPPLDVFK
FT                   NVNDYEMDFFYFHERKKEEEEIIIDLVQKREEENLDHLFGAGKGDKVSSPQFSQIGEEA
FT                   QPLYESEGKNEQKDEQKVEQKDEQKDEQKGEQKGEQKDEQKNEEENDEADDMEPLKRLF
FT                   LNCVNNGLDALLLNAGTELGGTAGKMERDGYASMEHIPDSGNIFPPDDSHNGANFSSLR
FT                   KSPILQLLRSNIKIYRKIDTMMETFSSNKLEGTIKNCLHDLNKYNKSALDIYDDCIFDI
FT                   QYKIEKEPTLESEELRRNKKLLQVKIFLDYEKLYTKKTVETQTPVSFFRKEKVIQIPKD
FT                   EGVSTTSEQYIQAKRVANPIFYLKDIYD"
FT   CDS_pept        join(935183..937064,937256..937941)
FT                   /locus_tag="PKH_142090"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142090"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142090"
FT                   /db_xref="GOA:A0A384KUY0"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KUY0"
FT                   /protein_id="CAQ41991.1"
FT                   /translation="MLKNVFAKEKWCKRFLRLNERHIHNSHLNKSLKNRYNEKVRDKYL
FT                   DNIYNNEINVSTISKNIKNKKVDYLRQLIYDEAEGDEYLLDETILEEVKKKKGKGITHG
FT                   RNSNNSNSSRGGDEGAACALPEQDKAEMSESKYKQAIRMYNLLKLTDKANIFDEDVFMN
FT                   IDSKINHDVYQFSQKNILHDCENEVKSSENSKRSSYIDGRMVDNQNENLSSSLPMENQV
FT                   DTLRNSETSCHANLDDSNFMSITKMNLPIFNPSSFCLAIESLTNHICDDLIYLFGDFME
FT                   EKKLPTKDENDRLYKFMNYLCEFFSLEKRETDVDRWMDEVYNKIKPKLPSAFRSMKNEY
FT                   VKNWIKEHIKRVLENEKRNNQMLYKEKYYNLGNDFPYDNLPMNENKGEDPKAEFSTEKL
FT                   TNYFKTIIEFFLEKKVDSNLEEQLNMMFLNLKKIGLDNWLKMDVRDFEKYLLRNNNSNF
FT                   LQITENDKYVSYLMLKCASRNITDFFFYEEFSPFHLFNERPKFSIEEKINALQPNKHIP
FT                   DDELKKMIFSNESAVTIVSKNNSGHVHHDMDIDLFLEKEKTYNMNRSLITYTFDENTDS
FT                   YSYKYKQIPNTIYDHNTNKYIREKETIDPMLKLNEMRSSILEVKRMMSMTKDGRVYYIR
FT                   IIIVIGNGKGVYGYGVGFGKNIKEARNSALLNSISNLDFIDYNYKNCVLNFPVSGQEYS
FT                   SHVKIIPRPLGRGLKINRKYLPLGYILGLDNVKISFSGSNKWMSRIKALKRCLNKIVSI
FT                   KTLCKMTGKKYVCHFAPHYCTSHWPDYWFKNVLKEYKYKIQRIQKKRAMVCRKNFRSNI
FT                   SKIPEEVRPDFTPYTWKTPIQKHVESQKMRKYIDNNVYHVNVF"
FT   CDS_pept        complement(join(938656..938787,938942..939069,
FT                   939222..939267,939531..939568,939680..939755,
FT                   939925..939969,940064..940093,940237..940291,
FT                   940606..940685))
FT                   /locus_tag="PKH_142100"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142100"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142100"
FT                   /db_xref="GOA:A0A384KZ74"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZ74"
FT                   /protein_id="CAQ41992.1"
FT                   /translation="MRRLFSVLLSLLCFLLHYVQCDVIIVDSNEVIQGFDKETILNLSD
FT                   NVFNIFLDTKTKNVDILSTYANIYNKSQVIINENCAYVKDLIRGRNLKYLDELETLEYT
FT                   KSEDTNNFSIYVYTVNGKPDIIPLIYQKHPKYISYIVTCQETDIFDNPEDAKENKNVFH
FT                   TSPSILSQLIVIFLIFFFLYIGFYVLMNISTPKIFEDKQLIINKEH"
FT   CDS_pept        complement(942084..943082)
FT                   /locus_tag="PKH_142110"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142110"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142110"
FT                   /db_xref="GOA:B3LC34"
FT                   /db_xref="InterPro:IPR026305"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC34"
FT                   /protein_id="CAQ41993.1"
FT                   /translation="MRADFYTHIYIYVCQCKKEGHTYVHVYVDICVYICPARLYARVYW
FT                   YPHSTRLMGKNDTLTSMGEGKGTEGQRKKAEDEKDPAAEGCSDNGREVEKEGDGTQRMG
FT                   TKKEETNEQESNEISDKYIKYLECIKNNWSSSQASKLLNNKLIKYISERFLYMSSSLKV
FT                   RVLTSFFYLPDKLRVENERYLLLITANGEIDGNGWVKKFSRILKPFIKTGIMDIKDIDS
FT                   QTMHRILNYIDQENNSKKRRTRYIHNKKELEHIHMCDPVNELKNLENKSIIHLDEYKMF
FT                   TPAKNFDCLLSSVIMRAPKAQSPSLCCPNTGGGGGGDESVCVYLERLAFCT"
FT   CDS_pept        complement(944966..955306)
FT                   /locus_tag="PKH_142120"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142120"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142120"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LF72"
FT                   /protein_id="CAQ41994.1"
FT                   /translation="MDVEQKQHENAYCVYKKNFDETRVSSNSSSGSATESHTGSSNNSN
FT                   NNSGSNNGFAESKGENGDNRGESVENYMTSCEENEDAEEKYTNHELSEKNISASTSNLN
FT                   KSFDPLQFQNEYNGNGIVSMKWDYENGAELPDGTHSNMYLRGNKQRKGNENLTNYDMPN
FT                   EIEEERKYIYTRNENGEALNMYGIQGKGDFEIDMNCTQEMSTMFSCKESRNICASTKST
FT                   NSNGRSTVQDRRGTEPMENVLIGQTAQSCEQGEYKTNTEGSGDRGNNENSGSSGSGTEG
FT                   KNVELAGNEDVSMSLSNRQNQVNNGDPSTYNNDKPLNEETPTKFESMRYYDMKDVSGNK
FT                   LNDYISNMQVMRDSFTNNHLSNMGRSHFDISADVGSMSYEAVTGMSGMSCMSGTNSVEN
FT                   MGSPTRMNDFDHLKNMGECSDLQKIMEGNIVKEMNQFSDKANSDYINFMKMGAEDNNLN
FT                   SLNSVDVDYYDKGVLYNAASDESGLLKGQAAGTNQNNLFDASGMNMGNTMNDTQSVNST
FT                   STLSNINGGSGIGTIGARSTHNGISTLNSANSISNISNMSALSSMSALSTMSGLSNISG
FT                   MSSINALNGINALNDAISLSTMNSLNEDSMNIHTNLIERNVSKEDVYLMTQGEASKNTT
FT                   CIKEEINNEPIVYNDNFSSEGMTEKNFPYQAQTFHVAELSKEYNQMDKGNTMNLQGKDE
FT                   NVKNDENGKSMLLSTRYNNMISEKGQMNDASENVYRNNLYNGRTFEDVKNESAEKGFIY
FT                   PVHNNEGIKQANTNDYLHKHYKVCMDGKSSNYIVNTNVENGTCANNLLYQTSDYYHKNF
FT                   LHNEDTKNDVSAYGSVENINIRKSDGQTDKGTNCNVNNIEQRLANNGKGINKRCRKKRN
FT                   TPVESNAQLTNSIPCDNSNDINSENNVDINNVKMDDGTIKLAELNISEEELNKLTLSMN
FT                   SNFTGINEKDELYKTVLFFDKKNNKMIKMNKPLKRKRKLKKNTNEENDNPDQFQCQEGS
FT                   IDTSLVTQDQENNEQNENWKPISMDNAEPVGANNGAKGGSAKQNQSVHKHSHNKSINGI
FT                   FTSQNKELIFTPVSRDSQENNNLVIGHNATHEDGTHENIINESGVDYQRHGAGNYKIGR
FT                   SLSRENINNEGVISFLADGNSTGEYTAQGHATKGAKRAVDRKYKKLRMNEHAQMSSSNT
FT                   ASSSGSNNNESNLFRSDSCSSFPHRNPDVVKCMISGACNNNSYTDKPISASSFQVQCNK
FT                   MYDPRNGANGATYIDAVRIGTGEFLAKGDDIFKKATFAGDMVGTMKDKHGNSNLSGSGI
FT                   NNVELSSCGMKKGNENLSSTYYTSNNQVIAGMFSSHGEFLRDELSGSFEGNMKVKIEEN
FT                   QNAVNKGIVSINVMNNIGMNVGNDPLGSNIISGNGNDGTGENKYVKRRGKVKKDKGTPD
FT                   DYTIQNGEVVSGIPKKRRTYKLKNKIDISRRNTENDEAGDIYVGIPDAENMAPENESVR
FT                   LKRGGRRKGSIKKGFILVKQEGNNECVGDNKFHANDIRICKNEMTYGIVNSTMPFGEPF
FT                   GVINHSKDGLTPDRVMANGMNIKLEGSHVDVDGTLCSMGVINDSIVNVNAEMNIKTDFK
FT                   SKRKPKRSVNLFIAQKSKSETALEKKIKSRICLQDYYKKNKEIYQGIDPLASINGVNLP
FT                   SIEDESFSDNLTVLFKKKKKNLICSNCLYGFKIQISARNEFVQVPAMGKGEAPGDGPEE
FT                   GARNWSQDDPQDNAQCATQDGSVNSNESDKRNDDESVHTMMDPCSPGKHLSEDEGEADV
FT                   TRSASEENQMNPPKSDNLETDKTDRTDRTDRTDQPDQPDQPDQKVEAKSTGDVMKELEE
FT                   NSDIIEKIKSLKYLKISMYKELVEKNILVENYCTITFYCLCGYFTCIKEDNEWKQITNC
FT                   YFDEKDKRKPKAPHIFCTRCKELLVTNRFLDKDKTKIIMICECGSRNYDRTDFFWSRRG
FT                   NIKQRKAPQILCDECNSKMWVHTWLDDIGSKVKLLCKCGFKNFLKKNNNWVRSPRWKKP
FT                   VPLIICNSCHQKMYMSQWLNNDGTKVKMKCECGWKTLIKEGNTWVRSEWSKKLLCLKLV
FT                   KNPELLQKKYNIHPHKKSKSDEEEFSDRNSQNGLSNMRDGMIPTFPPSDITINHHDAVM
FT                   NELCNPNHLENCLDGENNVALNKMRSSDSFMISEATEGLLLADDNYIISNNNNNNSNGG
FT                   VEGGPNDSLFVWGVENGPSVGQAIPYEDVILRKKPGTRSPRGGRGRGNRGYRSVGRGNI
FT                   MSAKIDSGNHVGVNHASGNDVGINNVSGNHVSMNNVSGNHVEGSHVGVPPDGGDLCTRG
FT                   NAENNSRGRRKPRGSKSHLNSKKRGQNVNLAENKDYHIASLETADGASNSHNNLINLNG
FT                   TMNNGLLGDAYITNNYEQGKREADVDLNKGVPCTDGDAKKMNTNNGQKKKPGRPPIDRK
FT                   DKKVKKTTAREKFNNTENASMANIVTGVTSNASVATTAEAMRPGITTTSTTAACTMIYN
FT                   NENSPVSQIYQIHQTNDDILIDNMINKKGSVIIDSIIKHPDQNLKGNKEKLTESNMISS
FT                   GPTLNFYDEKYANGEEKPSSSIGKMYFENPYYYVNGYYDNSYDKGYSNHPVVSQFRGNS
FT                   NGRNGSNGGVRSTDLYNAYNMASGTYEHQNKEFPVNYDMNRSTSPMTNTKFVEDKESPD
FT                   VLPMDLNFQKKKFIVENMKKLNYNISENDMNILLENVDENVLVDTLLGKFVDKTNVVEN
FT                   GKMDDSDVNLNENYANHLNGGNSGFTNNNYNSNDFNQTEFRSNEMYSNNNMCSYDNYTG
FT                   EMFPNGVYQVGINEGGVHQNGLHQSGPSQSGFYQDMIEHPFSRNPSADGGARESHPISK
FT                   ENINYVVMENEDGKKEIDCKNMNMVNGQSGADNNFNLHIAERNGHDMDDSMNKGVGSQN
FT                   MTNKIMACKNMGRKNSMNNDPCRNDYLSSNFSYSNEMMGEKDKYNVDVNLDLGERINLK
FT                   NVTTDCELRSGMNNDMGGNITGNLDHPPGFENGVYDNNVNDNSGGSGNNNDEHVTIAQN
FT                   DGLLNMCNLNENLQYFSNEFKAALAHVLSDKASDAQKENFQNYLKNLASNFCNLANKEN
FT                   DLTSEKQQGYNSNALSCEDENRYLKDNKVEDNNVLKDILLPILANQEENGTPVKNNFCS
FT                   EYNIYENMLNMPKMDEKIKGEEMAATPSYKPEMNDMSQDKNNMNDMLCVYNFNSDSEEK
FT                   VCTHERKYKINDFITVCTNCNEYINSNMDCKIVSPSSLDSMNNNCSEQKMNAHHEDFLL
FT                   SNDEIKNYENFSSSGKEERKDFHGVSPNRSMNGSMSGSMNGAMNGSMNGPMNGSASDAR
FT                   NSERNSISHNSNHSSSIPIMENVDDMSHLYNQYCDYYVNNTAMDDMHMKNNYLNNLFFQ
FT                   DQNNYSATSDNCTNNQSPPIKSENFYFTEDNNYLSDSTTYIAGKNTANSVMQFKQGTCA
FT                   ENNLNNNNNSDGNYQEDDYENYINSECNNNSCYNIIHT"
FT   CDS_pept        complement(961452..961823)
FT                   /locus_tag="PKH_142130"
FT                   /product="histone h2b, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142130"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142130"
FT                   /db_xref="GOA:A0A384KB90"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KB90"
FT                   /protein_id="CAQ41995.1"
FT                   /translation="MSGKGPAQKSQAAKKTAGKTLGPRHKRKRRTESFSLYIFKVLKQV
FT                   HPETGVTKKSMNIMNSFINDIFDRLVTEATRLIRYNKKRTLSSREIQTAVRLLLPGELS
FT                   KHAVSEGTKAVTKYTTSGA"
FT   CDS_pept        complement(965094..967001)
FT                   /locus_tag="PKH_142140"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142140"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142140"
FT                   /db_xref="InterPro:IPR026720"
FT                   /db_xref="InterPro:IPR032840"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KKW1"
FT                   /protein_id="CAQ41996.1"
FT                   /translation="MSNYMKPRVRKKFGENEHNDENALIDENRKNISRRNREPTNIYYT
FT                   KKKLNEKLKGKSKVITDSGAKKQLSSKEGTTIKHISGPATQKEEHERAENENDGNSGTM
FT                   NDSAQADGATNEGDQIEQRKKEIKELANLCLEKNLSVNSENIQIVRKLKEKRMLEEQIN
FT                   KNENIKNLQEKRRILEQIEYHEWADREKRIKELQEKKMKLLKKVIIQRDTEKADRIFYE
FT                   VEKIVQNRDKNKDKIIENFEKEKARDMRNLFVETKNNLKTIFNEKTDIVHHMNDHTSNY
FT                   NLQLERNGTVPEKINEKTSNKIDNLLNLHDLNDLNMDFDKSSKYTQGEKKYDKFSKYEE
FT                   KKNKQIIDTFYRYLNKEESKYTSEEYVLGESIKTQKKGQCMKINFPSIEVKSSKQDIFE
FT                   KNILQLQNLLRGKAIKMLMNDGKQSYSDLIEELKAYEKIDQISANEKDLFEKENFEEIK
FT                   LDSYLENVQGKYISELLDSLSNELEKYEEERKIAVLVKYAERERRLKECKEKGKRQAEF
FT                   LLREKEDYIFNEIMGLNNQTVDSYLEDILSKAINDASKEEALIRTKKKAEQLNEIYNSL
FT                   DNNSDENNKLIVKDLVGNFIIPYVDKQRGLQFDLLEQKKNNCVSNFATQHVFSKINEAF
FT                   "
FT   CDS_pept        969000..972986
FT                   /locus_tag="PKH_142150"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142150"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHE0"
FT                   /protein_id="CAQ41997.1"
FT                   /translation="MNFFSSKPNIRSTKSEVIQKANNNNDSCSIDNGTHVGGNYTSSHH
FT                   IGSNNVGDDGKMQNDGGSGNFLLEDSSGFAYSNCDADKMSEIHYSNKAYDPQYSMYMNK
FT                   IANQVRSTRNHTSSHRIYSPRSQSINLFAPKVNRTSNISRNFDDRLSYISFYTNNKKKL
FT                   NKTSILEPHDNFKTQANSQIVEQSLDLLKHLVNQENREQYLSAQEKDKKNKLILKLIDQ
FT                   AKRNDERAHVSQTECASNNSIDNYQKRMDMLHLKFMKLKNEYSQLNNENVILKKQIRNI
FT                   KDNYHMINSKSATVSFPRGSIEEEPLRSNDSWHSSNVGKNNSGNTDKIGNVNNEQRIKQ
FT                   QQGERVTLNKTISINNVQAPVIPSFQKKKLVDCQVQTECNLMSPIADKPDDTKVGGPHS
FT                   NLKVSGNHLNSTFLNDSYISKLREQIRNEVTQEITNKVEQKYKEELHMLRQTIENYKTK
FT                   SSNVAEESSIDNLLKNTKHKLDEQVKETINKYKNNLFDHLKELINEASQGGKSTGQMNC
FT                   QGDEIATENVNIGVDNFSSLPFNDKINECIKLFETITQKQISARKIKEKRRDNNSSIIS
FT                   ALNDINTDINDIDNMIDNLHANISQDHFSDDAESRPGELDLLGKATSFNDDLDLEEEAS
FT                   PRTLGGALESGEEGELKEEITTSMDKAIKCSQRGEKNAYNIDDPMTVRNDGGIFNRKGI
FT                   SSTDGDLSHRNNFHVDSHPSDNKIDVMGNMTMEINPFLEETVEGGEKPLIDVRSKNANM
FT                   VMHHSEGDVPGGNHTGVHFDIHSDVQFEFRVDQNVGGETNVHFIETPEGVYKTGHIVEG
FT                   MEEENFNNEKMLHREESSHNFATNDNNAYDNPKGDFPKGEENEAIPTELADGKNKDSVD
FT                   TEKEKKKSKWKNIFTSKKTKKKNLSDNFGDDTELWSKNENDEKNIKGNINEETFYNSTN
FT                   GSKANNTLPNKVQIEEGEIDVIMNGVNNAKQIEIHSDLHKFASISYQSSQPFMNRSGDG
FT                   NGEKDPESACNVNKGGEEFKHHNANGMINNVMAVNCTSKNYGDYNPHVSNDNHFVGKEK
FT                   FNQSETTPYDSSNRRAQFNPFNHQNDENVETNNAYSMSSGNNQHMYQSNNETANGPNYN
FT                   TNGDYSSNYSVYSYNPATYNKTGFPSRNEERHEDKPMYKEECNSVQIMNNSEDMYRKDN
FT                   FLFIENNNKAFAKPGGNYQNNENANFVNFYNDHVDGNNVNNGPNCTDKVNKQYDFFYNL
FT                   NEPNGERKQYTTWGNQNSKTACINSYKWEEQFGETTERSPPNYYSKTANIKRVNSSAIN
FT                   TTKTFTSDLSQNGQVNLSTKSEVHYNSFQAQKNKTKKNLEDLFA"
FT   CDS_pept        join(975096..975208,975425..975503,975722..975838,
FT                   976047..976246,976451..979007)
FT                   /locus_tag="PKH_142160"
FT                   /product="Zinc finger protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142160"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142160"
FT                   /db_xref="GOA:B3LC39"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC39"
FT                   /protein_id="CAQ41998.1"
FT                   /translation="MNIFKRNKILERANFDKINNVQIYGENKIHCKGGFVSGPAFVTVI
FT                   SSFLMILIPVAIFHAFTSTWFFEKDIYYVSFLNLFFFTLTIYTFFKTSFMDPGIIPRQK
FT                   SVLNIYDVIIQQYRETQPPRQKEVLINGNFYKLKYCYTCNIYRGIRTVHCSICDNCVEK
FT                   FDHHCPWVGNCIGTRNYKYFVYFVFNLYILICITLGASIYKLTICINSLSDQGYNTEKI
FT                   FIHIWRMATDSIILIIYTILTLWFVIGLLCYHIYTIVTNQTTYEQIKTFYQNDNPFNIG
FT                   VLNNIKEILFTKTRPSYINFVNPKLQVVDEKCSHHVVELKDVAINVEEEQNDSDSLSSG
FT                   NKDEKKKKKKNSFESKVVDKKWAKKGRDYHSINIHDSKCRNKTYNVKKKIKKEKSLEEY
FT                   DITKLSSISYKAIEKNASHFKVDKNKNTKVNKMNKANKVKLSNVKKKDSYSEELSNDFE
FT                   QLSQYTQKRIINLDNTVGSLFIRNDLSSTGSSNNDICSDICNESRASYVGDEMNADELY
FT                   EYQDDDIIRLNRKKVNNNNNYIIVIKNWKRGSECYRSGISKGGLIRSGLSIDYPGRNST
FT                   ENNDAEKSGTGKNGLGKKDTHDGYSLAQRGHSKQIRRKPINYETKINCFSNLAHVKKKI
FT                   EYPIRHKKKFPFIHKFKNKMETYYIVRYANIDKKDFSTYCQQTSAGLQMNNAKRMSKMK
FT                   MIKKIKYLRKLFSRKRKHDNSGHNKRGKIKMFSISKSASRKDELRNLSDGVGDGRNPKK
FT                   GDDDLSANAQANENIVIKKRKKRMMALQKDVIISIYNYKPKDKREKPKQWVASPAMLGN
FT                   DEPHEEEPVRQVEQTGEDKHSIGKEDQDLFMQNHREMHGDALTKHAEEKQKKLDLDLPA
FT                   YYLSGIDNAELGNFSKICEMRYTKMYKWKYKKMHKRILRRERIKLLSRPHKNIHLYYNN
FT                   KNYCIDESTDLHQNNELLSEYMDANLYFAKIKKSNKFDNLKLLNYLIHKHKQDKNRSDN
FT                   KKKSKASKFFYFFTSFALIINCIHIPSSNDND"
FT   CDS_pept        complement(980049..980861)
FT                   /locus_tag="PKH_142170"
FT                   /product="calmodulin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142170"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142170"
FT                   /db_xref="GOA:B3LC40"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC40"
FT                   /protein_id="CAQ41999.1"
FT                   /translation="MVFLIMCTLLPFKCCMFYDSSCYVARSEEYVKDTDVTLLYALTHG
FT                   HTFTRFCSLLGSLLRCSGYNVSLKEIDKIKEKIIENKTLEKNAQVNEKRETEITTNEND
FT                   GNNNSSNRKQAKKTKEDNDGDDHDDDNNISKMLSDLKNYDNFIELEKQKEEKKKKEEEN
FT                   KNLFSIKEFFRIIQLPNITNETKPSNVLNSFEIFDEKGNGRISIKKLRFILQYLGEPLS
FT                   NADFDEFFDWIKTVSAPAEGCVEMNYSLGRYILYCVITTSPCYTLHAI"
FT   CDS_pept        983084..984307
FT                   /locus_tag="PKH_142180"
FT                   /product="transcription factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142180"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142180"
FT                   /db_xref="GOA:A0A384KBV8"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR003617"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="InterPro:IPR035100"
FT                   /db_xref="InterPro:IPR035441"
FT                   /db_xref="InterPro:IPR036575"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KBV8"
FT                   /protein_id="CAQ42000.1"
FT                   /translation="MNMTENITKITTIQERLKDKESKFLCANEEEEEADGGADAETEEQ
FT                   EKTIDESTVKEIIDDLILLNDVEINKDILKQTKIGVTVNKFTKIKNDEIQSIAKDLVDK
FT                   WKNIAIKEKHSSSSGSKSAESLKKRKSELVERSDSHTCSEDYELKKIKVKNSNEYKSEQ
FT                   ATIQSSNANHNEPNNKTHDILLHTKHDNSDNIQIKESIKNSYQFSELKHMNTDLKALSE
FT                   WNYNGKFHNDVLRDKAKQFLFKAFITGSDDNLLYLIDRKKLNDIIYNIENELHKIFIEK
FT                   KQSQKEYNMQLKSIKFNLCDKKNPSFNEKIYAEYISPKIIATMNSQEMASDEKKKERNK
FT                   CLQESLQACQSDWDVKNILLKKNRKGEFQCFKCKGYETVYHQLQTRSSDEPMTTFVTCL
FT                   KCNNRWKF"
FT   CDS_pept        985565..987268
FT                   /locus_tag="PKH_142190"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142190"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KQI4"
FT                   /protein_id="CAQ42001.1"
FT                   /translation="MSSSSFSRSVNDNDDDDAKYKNETSKRGRKNDKVECEKRLKNKSH
FT                   KNRTGDARKCNGGSDSSSSPNFKNQHRDKHKQEHMKISEAKNDSENRKSSKGKRMKHKA
FT                   RSSSSSYDKYSNKKRKKDKEKLHKLKDGKNEDTLRSNKGRRTSSTSRRKKHYSDSEECE
FT                   RENFSRGKIIRHRNSKRRKSISRSSCLDERRGMESHSRSESRSSGGSSYDDSSSGECDP
FT                   SGTSSDGSSESSSLSDGSSVSSSPSDGSSVSSTPSDGSSVNSSPSDGSSVSRGLSKKRR
FT                   VETEQGEETKAPMGDSPSGVKKKEEYEAHIYDSKEMIRLTISILQNYNFLNNLKILYQK
FT                   LDKKKKISLESMKDLKLKKKLRHLFRAWKLEKEGEFYRKPHTFKENIMDIFNSLMYYFL
FT                   SRLDVNKLRRNINKRKASSLKRDNPKEHDNQDGRVNSSRDDYDIDNTNYYDSNFIVNFQ
FT                   EEDYSHVMQNTKEKMKSLRELHEEGCFTNSKEQYKEFLEKHKKIDLWGKNEQEQKFLLN
FT                   SKNSVNERRTFDRETDLAINRFVKKDDYRKLINRTKQHVDDKFHKTGDRV"
FT   tRNA            988688..988759
FT                   /gene="tRNA-Asp (GTC)"
FT                   /product="transfer RNA-Asp"
FT   tRNA            989964..990043
FT                   /gene="tRNA-Leu (AAG)"
FT                   /product="transfer RNA-Leu"
FT   tRNA            complement(991172..991253)
FT                   /gene="tRNA-Ser (GTC)"
FT                   /product="transfer RNA-Ser"
FT   CDS_pept        join(992619..992735,992958..993992)
FT                   /locus_tag="PKH_142200"
FT                   /product="hypothetical protein, conserved in P. knowlesi"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142200"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142200"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHQ5"
FT                   /protein_id="CAQ42002.1"
FT                   /translation="MPVSSRQNKKGRKVSSTFLFCTKVSLYTLLIWIVNCSNSFQYDGN
FT                   SYNVMKNSLGKSFDSRALRSLAEALEEEAVQHDAPVVHEEDIEQVAQEDEQDVGETSGE
FT                   VTQEVAQEDEQESEQDVEEEVAEEVAEEVAQEDEQDVGETSGEVTQEVAHDVTQKSEQD
FT                   VAEEVAQGVGQEVAQGVGQEVAQKVTKPWEDALKTSRKAAKKSSGRKKIKYHDLGYILI
FT                   DPTDTYEQPGVVNLYKERKNNFYRKFDPTITGDFEYLKKNVNLFNARERAMEGDPSAIA
FT                   QYPEGYWDPYLALQKALKEEMQKNNEYREMLASKFYDVKLMDDFENNELNPPYLEREYG
FT                   CEDLNPVPPRSTTVRAEEEEILKHIKGKKSKKKKWKEKFLCCF"
FT   CDS_pept        995525..996469
FT                   /locus_tag="PKH_142210"
FT                   /product="4-nitrophenylphosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142210"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142210"
FT                   /db_xref="GOA:A0A384LPB2"
FT                   /db_xref="InterPro:IPR006349"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPB2"
FT                   /protein_id="CAQ42003.1"
FT                   /translation="MSLIRPEKRQSEYESFMKEWQIEKSVDAKEFVDNCQVFFFDCDGV
FT                   LWRGNEVIQGAVEVINKLIKEKKQIYFITNNSTKSRITLLEKFHKLGFGLIKKENIICT
FT                   SYAIAKYFMEKEEYTSGKKKIYVIGEKGICEELDCSNLLWLGSYKDNEKKVVIKDDLEI
FT                   TVDKNIGAVVVAIDFNINYYKIQYAHLCINELDAEFIVSNKDATANFTCKQKWAGTGSI
FT                   VASVEAVSLKKPTVLGKPNLFMIENVLKDLNVDPAKVVMVGDRLDTDISFAKNCNIKSV
FT                   LVSSGVTDANIYLNHNHSNIVPDFFMKSIAEFL"
FT   CDS_pept        complement(join(996929..997068,997250..997427))
FT                   /locus_tag="PKH_142220"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142220"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142220"
FT                   /db_xref="GOA:A0A384KMJ8"
FT                   /db_xref="InterPro:IPR026060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KMJ8"
FT                   /protein_id="CAQ42004.1"
FT                   /translation="MNVNMNVKMNAGEKEFITYLEEHGVIDQISRALLQLFQEKEKPKD
FT                   AIKFISDHLQNVDADVPLEDLKRENSFLREENQRLTRKFEELNDTLNKLLSSGGGEVSA
FT                   K"
FT   CDS_pept        complement(998343..1002764)
FT                   /locus_tag="PKH_142230"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142230"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142230"
FT                   /db_xref="GOA:B3LC46"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC46"
FT                   /protein_id="CAQ42005.1"
FT                   /translation="MSHNNTSVFLFTVQGILASLTCGLCCLIYAYCCNSRNEGNRNKRT
FT                   ISKVNGDTYAERATTAFKKSKVEKEAASKSIHQDEVTHVAKGVDRENNIKSDRKQPKSA
FT                   KASAECNREGTSPQKESIQENYCHRRESKMDSGLSNQKNGQMDKVNGMEARLSGSNCEG
FT                   MSLNMKNVNEYKDRHFVGIIPRNNSLSYDGRITEKNGKCENLHNVLAARSGMPLNWSNE
FT                   SKEMFQSNSEYMIKMVAPQNRCQLRSGGEQNEPLTMSNECRNDFNPQSVNSYISSNDCG
FT                   REDNNRILKTMQPGEKNLVRRNNHMGITINRVEAKNKDMCGFTQKDDSQVATERANRHA
FT                   YSKNFLDRQMVHYPKEEIFRVKSETLIRNYPGHGGASTSAQKSMNINGSKGNAEGSKYC
FT                   QERHAERRKYCPEEPSTRRRNCLETQNHFSHPTMNGCEDFEDKNKCRNPQYINNYTPSK
FT                   WMNFPHDEESTNRVFVKCEKDMLHTLDNYVPNRRKFPGVERNSNPVPVIQKEHTHTGSS
FT                   EYNTYKYKDFSMCDTLYRKRQPSHHMSHFNNGKEIKNIIENRREEEAGALSYGKDKATC
FT                   DMHSVSNNVGESTVWIPNVGHYHGGMNHHLSNGMSTNFINGERTVSAASSYGLAYNESR
FT                   HANGGEGEGTPPKGSFPRLGRFTNEKYFASKGRRTDREGETSQTNRKNQSGNNGRCNDI
FT                   CSNRIRNENNDEKDRITEGRYYTRGKSKDSSTNRRNVQSMVDAVEMTNRVPRNSYIHQN
FT                   KTKRDVMNCAHYSPLNEGKMENRKKKNYYQFPHDYHMGTTECLPCKEGTHICKNSKCSS
FT                   VGICEKQKNKEEKNIYLKRGFPEEHFCLPNCNSRSWYPHCTEKISGNNESFFHSNKFEK
FT                   NTQVSDINENFSQHISYNAHPFIGAKGLGQGGGAKVVRRSELSEDIYPLTDDNADYDGA
FT                   ESSRRGGNRSGNTSGVRSRNIRSLLLSDRINLGERYPNDEQKAILNKRGEEIPPVPVRN
FT                   DEVANGRKRRKKDTKKRGTNSKEERDNQSNTPLLTKENARKLRQTEPSEYRNSQEINQI
FT                   IHAYLQNSNQEYNCCRSDKLERENNYVSDKYTEDVMHSHGDVSPSIKRKKKNSNDNIRY
FT                   NSCRTKVLGNRKGKNGRDKDVSVTEGEIMNSKRSSEPGSIPKKNEQTDQEEKLVEEDTS
FT                   TCIDRIKIRNIRMKREKSDSKVLIKEEKDLRNENQTVRRSARMKSEKYKKKKKNIDSDI
FT                   FVDTQNEQEEMQSESSKKNSNIANNDNIKLMEKKKKKKMSKTKTMELKIFKNKRALKEK
FT                   ENLKRMNEKYEEIDEYRCASGLVNFIIENIQKKKDKENFDDLLKYILKLINIYKIKTID
FT                   FVEAFLLLETINVNIITEYPIEEWILVTFHFLKGNTTEQNFNLIIKSLNLNNLLIGNVT
FT                   ASFYMNKKTIKMTEKNMNRILTILSKVVRRRSSRIKTSNQPKLDKKTKEDHQNDALLGS
FT                   CWQPVEAGTEGK"
FT   CDS_pept        complement(join(1004318..1004449,1004750..1004851,
FT                   1005114..1006316))
FT                   /locus_tag="PKH_142240"
FT                   /product="calcium/calmodulin-dependent protein
FT                   kinase,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142240"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142240"
FT                   /db_xref="GOA:B3LC47"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC47"
FT                   /protein_id="CAQ42006.1"
FT                   /translation="MPLKRTPFSFISDIITNIKNGNNNDEVTIVNRQNSYEHIKEFIIS
FT                   ELGNFKIIKVLLRGLSSTVCLCEWIIDCRKTVALKNYVKYINHDILSWNIRIEESNETD
FT                   TGNSSSETEGTVNICPCCEREVHGLVYMEKEEQNGKDKLRKCKNHGIDDWEEEKEWEEE
FT                   FPLEFISRQRQNDNVDDHTKGEECNQKHYWQDIKDETSEHKKLHLVLKVKHKELYYKLR
FT                   DIEELREEIEIHKKLKHCNILQMILSAEDENDIWVLLEYSSIGDLYSYVGFKILDETEV
FT                   KIIVSQILFALYYLHIKGIIHCDIKPQNLLLFHLEESFLFESDFLSDPELSRTVKGKKL
FT                   NIKKLLNSINENIAKHPNDKTFRSIVKIGDFGLSVRCPFDEFYPYRGIRGSYGFIAPEL
FT                   FQESNFNNKVDMWALGIIIYILLGGYRPFYPCSRFEEKVTFHERYWFNISSEAKNFIQS
FT                   LLQINPSKRLNVIEAIDHPW"
FT   CDS_pept        complement(join(1007452..1007538,1007847..1007890,
FT                   1008039..1008582))
FT                   /locus_tag="PKH_142250"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142250"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L188"
FT                   /protein_id="CAQ42007.1"
FT                   /translation="MYKRTLFVLSFALVNFIGAESKNVVSSFLSYLNSKINSTSEISKV
FT                   VQMGDTMACLVSKENNSARNECSCSFKKVKEFEKKCSSNLKKNQEDAKNCSEEPCEICC
FT                   SLMNSNRVANSILDYEFFCKKKCARSSIISNLNEDDYKIVFKKLIEFIRIFYPSNVLNY
FT                   YPIRKRASANYTNKPLDAKNQAIMDDLSEEPRAINRGHVEDIATSLRGEESEEFFSPYD
FT                   ES"
FT   CDS_pept        complement(join(1009500..1009555,1009780..1009874,
FT                   1010128..1010192))
FT                   /locus_tag="PKH_142260"
FT                   /product="mitochondrial atp synthase f1, epsilon
FT                   subunit,putative"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142260"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142260"
FT                   /db_xref="GOA:A0A384KV44"
FT                   /db_xref="InterPro:IPR006721"
FT                   /db_xref="InterPro:IPR036742"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KV44"
FT                   /protein_id="CAQ42008.1"
FT                   /translation="MWKAANVSYTRYASEMADILRKCLKDPYSDIALERSRMHLRETIY
FT                   KDGKPISQELHEEFQKAFKSLGNSKE"
FT   CDS_pept        1010921..1013239
FT                   /locus_tag="PKH_142270"
FT                   /product="gtp-binding translation elongation factor tu
FT                   family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142270"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142270"
FT                   /db_xref="GOA:A0A384LNY7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LNY7"
FT                   /protein_id="CAQ42009.1"
FT                   /translation="MNNLLKKHNRCVAQRVVTQCIGTSAKGVINLQRNTAPLDGFPRGR
FT                   KMENCFSTMSFYDNSTLYKAKSKLRQKGSPEKIHTPILNRNGNSHFFSTNKKIKIINPQ
FT                   KIRNVAIIAHVDHGKTTLVDKLLKQGGEETKNERVMDHNDLEKERGITIMSKVTRIKYD
FT                   DYFFNIVDTPGHSDFGGEVERVLNLIDGVCLIIDVVEGPKNQTKFVLKKSLLNPKCKII
FT                   VIMNKFDKPSNIKSKEEIENEIFDLFADLNAPDELMNYPILYASAKNGWCTDNFEDAKQ
FT                   NKCEHNNVLAIFKKIIEYFDSPMMLPSGSEDVSSVDSKMGSQNSFITGDDANGITTAVG
FT                   ESVGKNNKKDDAMVEGKDVEAKITSEPFCMLVSLIDHQEGVGVTVTGKIYGGVIKKGDT
FT                   IIVKNEENKVKGTCVIKNIFYMKGRKIENANFASAGDIVNISFSKGVTPSVNDTLSSEE
FT                   SVSSLKVRPIDPPVLCLKISQNTSPLTGKDGKHITLSSIGNRLKKEAAINVAIEISESE
FT                   KKDSYEVKGRGELQLGILIEKLRREGYEMTISSPNVIYTKDEKGNLLEPVEEFHITIPS
FT                   TISSNVIEKLNGRKAEIVDIINDDNDNTFIKCICPSRNFFGMRSYLRDVSKGTSIINSE
FT                   LKEYKKKQASYKSDRNGVIISSSNGTTTAFSLDPIQLKGNLFVSENYPTYEGMIIGEHF
FT                   LSNDIEMNAVKVKPVQHLRNKGHEETIRINHKNVTIEYALSFIQDDEEIEVTPKRIVMR
FT                   KKILNTEQRKTANRKAKSG"
FT   CDS_pept        1014575..1014934
FT                   /locus_tag="PKH_142280"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142280"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142280"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KB54"
FT                   /protein_id="CAQ42010.1"
FT                   /translation="MIAKRYSFLLVQKNYAHKFASPDCPNLISIKKVIYEKLKPICFHI
FT                   KQDYTMGHHVHDMHFYGILCSPLFENKSYKDMNMMVEKLMSEINLAGRVKLHCQPPSRF
FT                   NKMKKHVRWRWNLEK"
FT   CDS_pept        complement(1015568..1016932)
FT                   /locus_tag="PKH_142290"
FT                   /product="integral membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142290"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142290"
FT                   /db_xref="GOA:A0A384KH57"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KH57"
FT                   /protein_id="CAQ42011.1"
FT                   /translation="MKFLKVENIFPKAKQDEGGKNVLLITVNLLLLFSMFLYGINYILM
FT                   KYFIMIKGSIYVFIILRTLLTIPLMIYMYTSKESEPNKKKLLHGANEKDGVGEQDGQID
FT                   LELSKIEEENENEKENESETKKKKNSRGDKNDGNNKKKKKKEKGSKDGKMDDNMDDNMD
FT                   NSMDHKMQISDGSNNDTGTDEYSNNKHGKWANIINKFSNYFSKLLKNDEKLIPKVAYMP
FT                   ILILSVTGALRQVIVIIALQYTDSHNVAIIQPTIPIFTALMSYYMKIEKMNYITCLSIF
FT                   LSFFGLAITAEVWNMGSFDFGFLLLLTVPVTKGLQVIYINIATRYVSNDIIQFSQMAVL
FT                   FLITLPFGILGEMFINENYNVIGEIYNVTTNQFLCILYSTLGIIFLCWKIQIIALNYLT
FT                   PVTVSLYQSFQPCFTFVLARLFLKETINYNKYIGTIFIVLSLLLYQYGCTKHPKV"
FT   CDS_pept        1018602..1020332
FT                   /locus_tag="PKH_142300"
FT                   /product="Zinc transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142300"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142300"
FT                   /db_xref="GOA:A0A384LP68"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LP68"
FT                   /protein_id="CAQ42012.1"
FT                   /translation="MESSLLGNGRSMNFLDRMSNLYDNSQKKATKKLIIASIICIIFMI
FT                   IEIVAAILANSLSLMTDASHLFCDLLSFALNLFSIYVSTFEGNVDMSFGYHRAEIIGAL
FT                   FSIFFIWALSAYILYSAVFRLFEVQTVDGYIMFVTAFVSTLANIFIAFVLKVHSHGFEF
FT                   IGQRRCSHSDDANDHSPPIKAWGDNSSKSTKNGKYKNINSDIVIGDDGDASAHGAICNK
FT                   NNISIGKINTSSCSYVAFDYYENVNQINMDSPHQGDSRAAGGTGGGEGTCAGKKDFQNT
FT                   QHALLDPTGNNFHHNNHIGNDEDVQKDDDTFKVGINEYVNKSNGTNDMNKKKKKKKNSH
FT                   NGIHKESNMTSNNSYMLSNEESEENVLCDKYDSHSHGHQHHHSHDHSHDHSHDHSHYHS
FT                   HDHSHHHDELNSISLKTAYLHAISDLLQNIGVMIASLIIWYNPKYSITDPICSIIFCFI
FT                   VFSTTISVIKEILNVLMEGTPVSINLMDIKNDLLKIPGVIDVHDLHVWSLSIGKPALAC
FT                   HIVAHKNFSHTVLNNATLLCQNKYKILHTTVQTDYPSNISNCETYAHLKCSSLKAETNK
FT                   "
FT   CDS_pept        complement(1021611..1024430)
FT                   /locus_tag="PKH_142310"
FT                   /product="FAD binding domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142310"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142310"
FT                   /db_xref="GOA:A0A384LKG7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LKG7"
FT                   /protein_id="CAQ42013.1"
FT                   /translation="MKTRKTFVLVIGGGPTGITTGMYLQKHRIPHILIEKDKYIENVPK
FT                   AHYYNNQTMEAWRSIFHLDKCFLNETEDVNLWKTFQYGLSLKKDRTICKYDNFMDKYMY
FT                   RNTYYEDISPSKVTHLSQYKLLGILYSYYISKIKCDPQQKRAFLKNIRLKLSTHRMLRS
FT                   ICGNSGFGEEADQTVGVDEEIDKRAAEGMGKDATGEALYKNYLSYDTSEFLIGYEFINF
FT                   RNIPEGVKSCNVGVNKQMGDNYHGVEWGNLQNGSFDYGFSPQGVVTRVRNLYSNEEELI
FT                   LSNYVFVCEGGKSGIKKSLKINDENRKDYMKFINIHFQSFLLSDIVKCNPSMLYFLFSK
FT                   YIGVLVAHNYKQGDFVLHIPYITEREAEIYNNGSKCLEIINNLTDFELPDLHIHNVYKW
FT                   TMHSSIASTFIDKRTKRIVLLGDAAHKLPPSGGFGLNLGIGDVINIVWKTIRIYNLKKK
FT                   KFLENIDKVSIFSNALQDASPQSDAESALILGRNKLAHLFRMLNELEKKKIENYIESYN
FT                   IERKLVANFTIYHAVRNYEKGNKVSSLLGYNHNSFVRYVSSSRVSCIQRSLLFYYLLAN
FT                   AKGLLKFINNLPYVFEFNRARVEYFVQNERMNILSLLYPGVDFGYSYVDTMCDVGWVEK
FT                   EPFSDLSIYGKKLQSDRGAKNESSPPEGVSGSVEQEADVGNGKKREDTHGATENPRERT
FT                   ELGERDDGQQDNGTHHSETCGESAKYNIFEKQNEKVPKLKICKNIYDHQMTNVVGAKIP
FT                   HFNLYTFDEKCIYKISTVDLPIFNNPSLSLLVILFNDTTLNDMIQFLDAHNMPRDKFSF
FT                   CLWDSNVVISKNAKDQSVRILKQNDPPMAHNDDSSDISIPLSDYILFPKCHNNFVGNIR
FT                   NVKHIHMDVKEYTVSYVFTVDIIRELFFDTLMLKSDNSFVILRPDRHIISVGEGNWADQ
FT                   LRDVNEMYI"
FT   CDS_pept        complement(1027100..1029736)
FT                   /locus_tag="PKH_142320"
FT                   /product="importin beta, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142320"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142320"
FT                   /db_xref="GOA:A0A384L3E4"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L3E4"
FT                   /protein_id="CAQ42014.1"
FT                   /translation="MEASNIAQVLYATVDPNISIRSEAESKLKHAKETDFVQYINQLSN
FT                   EFCKTQNDPYLRQIAGLLIKNAFASKDNYENEEKARTWVNFPENIKNELKNSMLHLLSQ
FT                   QGEKVVIGTACQIISLIAKIELSHNKSSELLHKLVNNIIEKNAYTKKSSTVCLAYLTED
FT                   IADICNESKSKYVFTQPDLDLILTAIINSLCEPGEEESVHCASMKVLYNLMSFIDQNFK
FT                   TQVERDIIMKTVIDGCKDSERSTVQVAAYECLINIVSYFYSYLDAYMYAIGPLTWTAIE
FT                   SDNERIAISAIEFWNTVCEEETFIDQYELQEGKKNHNIVKQAMVFLLPKIFNAMINQES
FT                   EDIDIDAWTISMASATFLALSAQLLKNDIVEPVISFVEENFTHEDWRRRDAAVLAYGSI
FT                   MEGPDTEKLKPLVEESVGQLSEVLRDPSVSVRDTAAWTIGKITTYHSEIIYNVLGNYND
FT                   SNSLYGILLERLNDYPRVAANVCWVFNQLASNKRSSYNKMTNSCTTELDDSFCVLCKKL
FT                   IDVTSREDADTRNLREAAFNALNVVIDNVSDNCLKYMIELLSHMMYLLTNTYLNPLTEE
FT                   VKSLQGYYCGTMQFIINRLGNQCKPFLKPIYLSIFRLFEIRTDICEDALLACSAIINVM
FT                   GEDFREHLKTFLNVIFKGLRNVSETSTCRICIEMISDICIPWTFEFEKEMELILECLWD
FT                   ALKTFGVHDSIKISILTVLGDIATALNRSFSRYLNFFANILAETSKITIASGSAESDDW
FT                   VNYVFELRDAILLTYSNIIYALIDGNEIAKLKIYITNILDLIELILIKEINHFNAQNFQ
FT                   NAVSLLGDLVHAYGYELIENSKLTDLIISVYGKIDILSSQGDEKCDSCVSKIKWLKRIC
FT                   NARLGQK"
FT   CDS_pept        complement(1033301..1036177)
FT                   /locus_tag="PKH_142330"
FT                   /product="RAP protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142330"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142330"
FT                   /db_xref="InterPro:IPR013584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L550"
FT                   /protein_id="CAQ42015.1"
FT                   /translation="MSVLQKGGLIASGARYIRTGKFKNPICYKQVVSEKKEEREKEVDK
FT                   LRRNQIKFLELLHLNNLKMPQPKKWTKKKVPSGDYVNGKRGGGKGSHTNGDTNISTTEG
FT                   SISSCAVEWGQSEKKCDRESGTYHRDTFTNRIKKKALLRRVMGNEGKLKKAQKEDSSNE
FT                   RNNVLINGNKTNCEGNEPSGILTQTHLHDSISNLLVDKKTTLKKKIHLINFSVTNSYVS
FT                   KKYYIQVKNDPCEDRFSISELKSIGLFDELEMSNGRRDTQDMATSSAPSPPYAGDQAKG
FT                   ATDAHDSQIPSQSKKNKQEIMRKIYKASINHVRDENLWKKYVQNTFIISGYLDASEIVI
FT                   LFWCFGKIGYRDNRLINLLCSILLKKINDLTPCALALLLNSFKKLEIKKYDTVELLTNQ
FT                   FCLHIQRWTSQDIALVANSLAFFYIYHKVFWKKCILKLQNGYYFSHPLHLCLIISALAR
FT                   LDIREGNVLLSLSKGAKKYAKQFSPNNLALVIHSFAKLKFSHPKFYNYLYQFVHTYLDR
FT                   QLFIGGSSDKNRPLKNGFQMRHNKRSEGEIRENMLQSEKNIASVNPYVHGINNFDEHPV
FT                   GEYPHVDATKNCDSVSTMWNSQDGEAVVPLGSVPPGEGNEEDRYYDSRSSSSGGGNTPL
FT                   RRKEKAHFDLQSLVLLLFSCTCLITCTENMILKLTYLILPLKDHLGSHKVEKLKYVSEY
FT                   IQFTYPQIFANFPKEIKMFYNYIDTYEIKKKKKNMKYGARWINELSKILARINVNHLKN
FT                   IYINHICADIMLPDSQVIIMCLGPYSYYVNSLVTTSTSDLKRFILEKKKYKVIPLSYHE
FT                   WNKLNDYEEKIRFLYAFGRDAANYLFVNAKKGVAEGEKSDEAHLGTHTLGSADCGRSCE
FT                   SGGENAGEGEKWGLCNEPMHGPLYDTERQSKNYASETNEPNYTSDEDDEVIDFIKKGIS
FT                   VDDGNEEDSDRDKIEIEEIKKFLEVEKL"
FT   CDS_pept        join(1037350..1037385,1037449..1038384)
FT                   /locus_tag="PKH_142340"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142340"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142340"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC57"
FT                   /protein_id="CAQ42016.1"
FT                   /translation="MVLNKVYLLTILLPNEDDDYLGKLINISSKITKYAQNNKFKIAKI
FT                   LSTSALSAYSLNWVYQTGVTLLKDPHYSLFVPSNNYMNNAIRRIRTNYPVKSYTFKVNK
FT                   ILERNFHHEYANTEMGQIYVVNNFVNFLNFLPYKWRKKCTYNFCKYKEFENIGNLFNCI
FT                   RISKHEGPILLFQGKLKKQYWIHLPLKYEIVKNGEEDSLCTLTFTPLHKYYSDYTIEIK
FT                   LVKEKENNNVTFITSVKCANKNNGNGNSFYINVIQNIAMFLAYDIFEGINNNIHVVHRR
FT                   NANYRKTTFNTSNVTLKRKKKTNFQFVLSPVINPWSFKIRRS"
FT   CDS_pept        complement(1039251..1039847)
FT                   /locus_tag="PKH_142350"
FT                   /product="fe-superoxide dismutase, putative"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142350"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142350"
FT                   /db_xref="GOA:A0A384LBX3"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LBX3"
FT                   /protein_id="CAQ42017.1"
FT                   /translation="MAIILPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNGLIKD
FT                   TPFATKSLVEIMKESTGAIFNNAAQIWNHSFYWDSMGPNCGGEPHGEIKEKIQEDFGSF
FT                   NNFKNEFSNVLCGHFGSGWGWLVLNNNNKLVILQTHDAGNPIKDNTGIPILTCDIWEHA
FT                   YYIDYRNDRPSYVKAWWNLVNWNFANENLKKALQK"
FT   CDS_pept        complement(1041790..1042833)
FT                   /locus_tag="PKH_142360"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142360"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142360"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KM01"
FT                   /protein_id="CAQ42018.1"
FT                   /translation="MSKSVRRGEIYFNGVFKYYKKKSLPVHGDAGYGDLSTERGYVCPI
FT                   REKNSTHRIGRKREKDNHADDNVDWEEDTGLEIDKIDEGEETEKEREDEQEEQRGRKPK
FT                   RLQQRGEKWREKPLDRSKEQNRVPPKLTAITGDAVEAPVRRTFPEGILKKRYLPKPRNV
FT                   YNSNAEYVGLNVPPEFNKMDISLNDKSGSAGREYSNTLNKKGKGKKPIKSKNSSPKKKC
FT                   TFKKSILLRKKKARLNEAYDNPIYFDMYHSCDAAQLRGNRSYIRKNKKKINGENCKYKY
FT                   ELPTIASLGKAKKLNYLNFTINEDEMTKQQRMLLDNLSNVCFGGNLLYNVAQPCKKLRR
FT                   KKVKPYL"
FT   CDS_pept        1045228..1046406
FT                   /locus_tag="PKH_142370"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142370"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KBJ4"
FT                   /protein_id="CAQ42019.1"
FT                   /translation="MTNVVECTFKTPPETAKAPENAVIWNAFQYCDEKGWYSLTNHDEI
FT                   MLRPTAFSDGRIKFLPQLEKIPDEFESVLCGKYDAKSWGKDDCNIVIEGDKDVHISLPG
FT                   LQEKINYNHRERFPTFLKNWKIIVGMLNEHITVIRINTETAIIISISEKKNVTVKCVDF
FT                   NNGFLCVNPHTNLAIAYGGFALSELKKCELVPSITHEGAEWGFFVHLFKWGHIIIPKDI
FT                   EIKLPSPGLKLIGKKIDTVAIISLPPNIYIHVKIDGPKCIRKLEYGQDYSITAIKSSES
FT                   DIDIYVLFDGQLIKYEFSFDTRLNKVGKGRSINCAKLKCTNKSKEVTSFIFQPTANSKL
FT                   LLDSNCPTDNMGHLLCNQTMSVFDAETGEYLSHPQGLKLTEVFNSLSYPPEE"
FT   CDS_pept        complement(1047769..1049526)
FT                   /locus_tag="PKH_142380"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142380"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KIN6"
FT                   /protein_id="CAQ42020.1"
FT                   /translation="MDISSLKEKRICIDDSSRAEREKYTTFFLLNPDGILDSVAGLENL
FT                   AFSFDSISYKDARCYKCLSVFSCETNAVYRTCPKCHVVNALVPHDVIGRKVIILICYQC
FT                   NSRNLTNIECSYVQCFLCKRVNLSQYNNSAHLAPSQSAHRSPEQKKKKNHRGILANMFK
FT                   CLRLKKNEKDANPSSGSSVKESCEGSPSVEEAQSEVENRSIQNNASFDEDRENDREEDP
FT                   NGERTNNKLFNEENTHGYIPDSKYSNEDYRKKFSKPNNNMYNSNMNYIPYSNDKFQNDY
FT                   MRNSANNNGQMNYIKKMNNDYGNSYMGSSHNNGRVGNPTGGYSRENNNFYNVNYSKNYQ
FT                   PSYSNTNTQANYWNKDNKAYGSSHYHDMNRSEKYNDKFGTVVEHGNVKRKTIMFNNMND
FT                   SNPPKINKTISHLEMDKKRDSDVKACIEYFSSLRKNKNDDIKVILEKQNFKEFNIPKEH
FT                   LENRDFYRYVEYYKKHNLKDLINKFNESSTNDKNRSKDSGAKGKDSSSSISNATNKDNA
FT                   KESGSSKGNEKYTNNKSTDNKTKKNKRPESDSRDDHSDGDGNAYHKKKKSKCNENIKPT
FT                   FYTLEDLFD"
FT   CDS_pept        join(1052386..1052759,1052988..1053147,1053358..1054722)
FT                   /locus_tag="PKH_142390"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142390"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142390"
FT                   /db_xref="GOA:A0A384LG65"
FT                   /db_xref="InterPro:IPR004177"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LG65"
FT                   /protein_id="CAQ42021.1"
FT                   /translation="MTAPTLKGEEGDDEDDLRKKKNNHFFFFSKSEKNVTTKRIPKGKN
FT                   EVDINFYEEEPYLDDKVNDVDYIILIIHGIGSNEEIITNQCEDLKNSFKIVKKMWFYDY
FT                   PFNIHFHIFNWKKYIIDAQIHVFNRININTMAETRKIINLSAGDIICFLHPRYGDYIMS
FT                   NLYNDINKALESLKSDPSGRFKNSKVCLLGYSLGSAMAYEILHNVKVRISDSKIKYHLK
FT                   SKIDYFFMLGSPLSALLSLYKPDYINEGLRLMEGIKFYNLFHGFDPVAFRIEPLIYPKI
FT                   KNIPEPVLINYWRNNGARYWFEWDKNMQNAKIAIVQNLNDFTSAITNGFYKFIGKSESN
FT                   EEEQGTLNKNLCYNKSDNKNINMFLSKVKENQRKMALQKRKVERRNSKYKSVKDKPPSY
FT                   SKITEEEHETKVYQSGNNTNEFQSDDYLSADNSSYVDSTKSICASQDSNSELSFFDQNF
FT                   SDNSSEDSQRGKAPKVEGTKKGSILSSYGDADESHMSNKQDRGNSNKIVNSSNKADELP
FT                   LRYDYQLQEFIMEHYIYPLAVAKSHFNYFIIKDISFFILKELLNRTVTLSYEDYLTQIE
FT                   QEYNKKSLNEQDHVKKERYLKISFKASKSLDEFRRYEKNVQAMSDPFNMKNFKNLI"
FT   CDS_pept        1055951..1058845
FT                   /locus_tag="PKH_142400"
FT                   /product="ATPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142400"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142400"
FT                   /db_xref="GOA:B3LC63"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC63"
FT                   /protein_id="CAQ42022.1"
FT                   /translation="MLSTTIRNRIHKIIAGNKLIVENEDNQTNLKNVVNNCTLIENALR
FT                   KEFLEYRRLPRNKLNALIVDVLKKTFEGDGVPKGGGISTKEFQRSCGEGEQHGQHSHYD
FT                   NDSHHSDKWEPDEVPLRTKEKKKKKKKKDEQLSQDGSKKGKSTLLKMGKDRTNEGMKEK
FT                   KNPAITSPKEKEEFLKDNVKEPSYLAHNLLKGVKKNIEGNINLRNYKGIKNIKSDIFYS
FT                   IIYPHKFREGNFSTIISISGISGSGKTTLSYAIAGECDCPFFYLKLPEYIKYISNDSKN
FT                   NKLKLIFEQIKNEYDGAILCIDDIDVILSSKDDSTDLYLFTYLLSLFENSKVIVLLLSV
FT                   SKPYDSVLYTRIKKFISIPIPTYEDRVEILEFMAEELSLTFDAKYTAALTYGFHRGHLY
FT                   DIANESMNLCIYDQVCEGKFAGIRSDMDVASTEGDSIEELQSEVLPPGGSVTQLAASTT
FT                   NDATHLNEENICEENNTEVLQNGGEDGQDDSNRDITTTFCSHTVHSKQRNEANLKRKEW
FT                   SGEVTTYKVKRPKMNCRKINDEIIQQSVRNIKKKMITQNICEVPNINLDNIGSLKKIKK
FT                   VLETKFILPVKYANIYKHLGINKSMGILLYGPPGCGKTMLAKAISNEMKANFIAIKGPE
FT                   ILNKYVGESEKKVREIFSYASIYKPCLIFFDEIDSICINRANNKAAAASDRIVNQLLTE
FT                   MDGLSQRESVYIIATTNRPDIIDKALLRSGRFDQLIYISLPKYQGRIDILKKLSKNMPL
FT                   HDDVDFAKISRLTKGYSGADLYGVLRESAFIALQECRDKIDLLNSGMSTNGDATQHCRE
FT                   ADAACGDTYNGSPFVKQENGNTAADARCGIRTTNSHDGDTNVLNQSGLATIDQRQVMEC
FT                   TREGDIHRDAHLCFQHGNDNLCMENNQTYQINNFKNKAICEKDKNNLIYDFIQRNKNIL
FT                   TISQRHIVLAVKIVPRSVTSKQMKYYKEISKKFK"
FT   CDS_pept        complement(join(1060651..1061067,1061574..1062419,
FT                   1062565..>1063401))
FT                   /locus_tag="PKH_142410"
FT                   /product="SICA antigen (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142410"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142410"
FT                   /db_xref="InterPro:IPR024285"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="InterPro:IPR024290"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC64"
FT                   /protein_id="CAQ42023.1"
FT                   /translation="PDVETKVKTMLRDLEPYVKWHYAAQGSVAAACKHLKDPRGKGNHK
FT                   TNQMKNVCKVFVQVVHWMGNLDKYGKKKNGMTKEDDWKQYLRCVIGYEFLLRVLLPKYK
FT                   VEDFMDVIFKTMKGGGTEGALSSMGGICSWVKINDVKEMEELIGDEVQKWLNEAKGDWR
FT                   GGRIMGFHNIIAWSRYTDEKEKQQAKAKQKTQTCNSDRIMDLFQAGESGKLENIVPPLP
FT                   PPPPPPPLPPHPPPPPENCIKDKNGLCERVSCVINKWVKNNTITSGKPNGQAGSPPWND
FT                   FWEKHINVKLQEMFTAMTNTNSSSNVSQYCNTVGEDNSAERKVCGHFAAGLEAIYKIAP
FT                   GSAKHKDDDQLLHRTMMCAALNAYADQLITKANGKKSNCKVKEGIDGAFEKSQNIKDKT
FT                   PPCSTDGDKCIKCERKSNFSCDITQKEVEAEWNKLLAGTKTEMSSALSSIDTLCQPPPV
FT                   PPPSAPSIPASSTSSSSSSNSSGSSSSSSGAGSTAPGGAAAPAAKAKSSTKAGRKGRIR
FT                   PTSPPRGRKGEGWMEGFPSDSIHPYLPLVPSILGIMTITYFLWKYFGPLGKGGPRFRRS
FT                   PAEIPGPSVQEQVLDHVQQEAGPHEYRLVKERKPRSSPTRTKRSGRVNRRTIIEIHFEV
FT                   LDECQKGNTQLAQKDFLELLVQEFMGSEFMEVEQFPMENVLMESLPMERVSIEEVPSLG
FT                   SGLMV"
FT   CDS_pept        complement(1070803..1071504)
FT                   /locus_tag="PKH_142420"
FT                   /product="ALBA domain containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142420"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142420"
FT                   /db_xref="GOA:A0A384KG98"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KG98"
FT                   /protein_id="CAQ42024.1"
FT                   /translation="MKKDREPIDEDEMRITSTGRMTNYVNYGAKILGEEDKKSLKIKAT
FT                   GNAIGKAVTLAEIIKRRFKGLHQITKCGSTVITDQYVSGQDNGEQVVQEKTVSFIDILL
FT                   SRDQLDVEDAGYQPPLDEKYVKEMSPEEIVNTRPYRGRGFRPRFFRGFRGGRGGFMRRG
FT                   GYRPFGDRMYEGRNSFRGGRGYGGSFGRGGYRSGGGMGMSGRGGFRGGFRGGRGGFRGG
FT                   RGGFRGSRALS"
FT   CDS_pept        join(1075179..1075319,1075523..1075592,1075733..1075782,
FT                   1075940..1076024,1076236..1076317,1076470..1076488)
FT                   /locus_tag="PKH_142430"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142430"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142430"
FT                   /db_xref="GOA:A0A384LI87"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LI87"
FT                   /protein_id="CAQ42025.1"
FT                   /translation="MARKDYVWVLCKFYCGKKRGVVSKKQEEEIFKILESSNLPLTVMI
FT                   KEEFDRKATMLYGKIYKSLIFSRFLVIFANLRLRLFIIRTSNKFKQDISQLAQFVTLCD
FT                   DYLDVQVLYIGVTLLKCKRFLKNLFIELKIEENMPIIMKELERS"
FT   CDS_pept        complement(join(1077334..1077741,1077959..1078198))
FT                   /locus_tag="PKH_142440"
FT                   /product="60S ribosomal protein L13, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142440"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142440"
FT                   /db_xref="GOA:A0A384LE88"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LE88"
FT                   /protein_id="CAQ42026.1"
FT                   /translation="MVSHNNVLPNVHLHKWWQRYVRVNFSKNIKKKKRRLLREKRRKAN
FT                   GGTPIEKLHPIVHCPTQRYNFRCRLGKGFTLEELKGAKLNPLAAQSIGICVDKRRKNRC
FT                   EETLKKNIERLEKYKKCLVMIPLKSTKTKKGIGGIPEDTSKDVVKELRKKKQLRSIFKK
FT                   ERNTKPFYESMDVSKIDKSYLAYKTLRRAKLTERRKNKQQQKKDLKRKSKDN"
FT   CDS_pept        join(1080181..1080222,1080829..1081221)
FT                   /locus_tag="PKH_142450"
FT                   /product="40S ribosomal protein S16, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142450"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142450"
FT                   /db_xref="GOA:A0A384KNN1"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KNN1"
FT                   /protein_id="CAQ42027.1"
FT                   /translation="MTTKVKRVQTFGKKKTSVAVATVTNGKGLIKLNGKNLDLVEPHIL
FT                   RTKVYEPLWLIGSAKLKNLDIRIRVKGGGQTAQIYAIRQAIGKGVISYYQKYVDESTKK
FT                   ELKDALLRYDRTLLVGDTRRCEPKKFGGKGARARYQKSYR"
FT   CDS_pept        complement(1081964..1083037)
FT                   /locus_tag="PKH_142460"
FT                   /product="GDP-mannose 4,6-dehydratase, putative"
FT                   /EC_number="4.2.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142460"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142460"
FT                   /db_xref="GOA:A0A384L9R1"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L9R1"
FT                   /protein_id="CAQ42028.1"
FT                   /translation="MKVALIFGITGQDGSYLSELLLEKGYIVHGVIRRCSSFNTKRIDH
FT                   IFEHLNLHYGDVLDSSNICKLINKIKPKEIYNLAAQSHVKVSFELPVYTAETTALGTLR
FT                   ILEAIKISNVPNVKFYNASTSELYGCCNDHVQNESTPFNPVSPYAIAKLYSHYITICYR
FT                   KSYQMFCVNGILFNHESPRRGETFVTRKITKGVANICKNKQDVIVLGDLSTYRDWGHAK
FT                   DYVRAMYLMLQQDEANDFVISSNEKHTVKEFCEISFSFVGIFLKWKGTGLQEIGVDEND
FT                   RVLIRKDSKYYRECDVFHLHGDSSKAREVLQWAPTYSFFELIYEMLRYDFEQCSLPIDN
FT                   FDTCVRRYELYRNAPKA"
FT   CDS_pept        1084293..1087910
FT                   /locus_tag="PKH_142470"
FT                   /product="ABC transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142470"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142470"
FT                   /db_xref="GOA:B3LC70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC70"
FT                   /protein_id="CAQ42029.1"
FT                   /translation="MRGQALLGVRRDDEDDDDEEEDELNDDDEEDEEDEEEDDEDEDDN
FT                   DDDDDDEADDITREERLAAYEKLLNAEGDEEDRMLSPKYNMNIYNILEKHYEQKEQSKV
FT                   ILTVHNLNYEIGSKRLMTNLNFQVNKSECVGLIGNNGCGKTSLLNLIFDHSDNSHKSIN
FT                   INNSVSKEGVTNFNLTEENMQAMVKKNKFDFLYKILHHMKMNSLDLSKLPSIIKNRDVS
FT                   YFEKINKKKSGNSNDLFFKNGIFYFKQNIHLLEKNNLTVFEKVLKFYQPVLEKYEVLNY
FT                   IEREISLYRNVQVVQKSNRCQTEEDSEKYPTSDSLNGNNIPPKRRSYTTKEHTNNMESV
FT                   ETKSSGEPTIEQAQSFAQSKLFQMVLKLYMHEKENVFKEINQVKMNFHKYLNILNLKNL
FT                   LHVKLSNLSNGYIIRVYLLLLLLSNAKLLLIDEINNNLDIFNIFFVMNIFHYSLKYKEI
FT                   GIVLASHDFFLVSKLCNRILDFNKIYGHDIDFNNMALLKRISRSGQQAMHSDVPQELQR
FT                   KNEHNSNITFFKGNYTQYLHSMKILFDNRRKKKEELKKIMDDLSAAINQVKKKKKNEFM
FT                   RQSLKKKEEEFKLFQNVYSTLFDSTLNYQYMYYNLIYSRKNEKGASKGIPTDGGIQEGR
FT                   ENISRVRSGSAEGNSNGQEIEEKAAQQTDGDVDEHTTEQEEGVESFVYNKMKDIEGNMN
FT                   KNILIDMSKKIKNNELIETGERYAKNNVSLYEFDNFSFYFWNKKKKKKKYIFKNMNLSI
FT                   NSGENVLLLGKNGIGKSTFFKILTNRYKFQMQTEGGRHRRSAYAYGDSEDEEEYQEGGV
FT                   YVHGGDGINSTPTENKIAHFEGSIKCNFDNVLLTYFEQNMIKKLHLEINEYFRYLIENV
FT                   NYEPVHFDDSSDVEGVDDITMENYDGYNFDNGMPITASKEHFFFYVLNKTKPFCNEQDI
FT                   SNIEEKIKALLKIFYIDSSTCMKDKSGGEKVRILFLSLFLKKSNLLLLDEINNNLDIYL
FT                   KNLLLNFLNYIYQGSYILTTHDFYMIKNLTNVHKVIYIFDYQNVFTFYNVQDFIENFYH
FT                   FILHSFDTLHMVNPRDGRAMNVVNHSVDLQQTQQPEVLHSPQRSSSVCGDSENNETAKN
FT                   PLHNGREEGHPYADAQEEDNIDNRENYNKILYDNYDYKILQFLKTQYAKDRNERKNIEQ
FT                   ITDHEEDVIFEKKKVNRKNFGGKGSSGKIKIKNWKRWKK"
FT   CDS_pept        complement(join(1088338..1088427,1088611..1088793,
FT                   1088981..1089126,1089322..1089712))
FT                   /locus_tag="PKH_142480"
FT                   /product="translation initiation factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142480"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142480"
FT                   /db_xref="GOA:A0A384L4Z4"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L4Z4"
FT                   /protein_id="CAQ42030.1"
FT                   /translation="MEELQNEFDKMKIKSDAEEEQEGEESGQEKISQRKLRYLKMKDKK
FT                   EEKKQKKRGTKGANNKNDVDGNSKIKSNDPKDEQKDGDNSRDDENANEVSNNLNENNED
FT                   DHNAASESPLRNKATKCEPVLVEYCKVCGMPYEYCEYGNSFNQCKEANKEKYNYDIVKA
FT                   DAEVNNKRQAKKTPQNATQKITIQKTTRARKKVVTVVVGLHTYVKLDKMAKIFSRFYAC
FT                   GASVIKGANGAPDQIDIQGDVEHNIVEVIMKNCPEIPEGVFVTLPPK"
FT   CDS_pept        1091531..1091812
FT                   /locus_tag="PKH_142490"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142490"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142490"
FT                   /db_xref="GOA:A0A384L4N9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L4N9"
FT                   /protein_id="CAQ42031.1"
FT                   /translation="MSYLVLLQAKNIFLTPYSIFSTLKLIKLYNPLVILLFKFVLLVYS
FT                   RKYNKKIIKLTFSLMYVCAYMSMYVFVRPDLSKLRTLNGYITKYIHIR"
FT   CDS_pept        1092067..1094001
FT                   /locus_tag="PKH_142500"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142500"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142500"
FT                   /db_xref="InterPro:IPR018997"
FT                   /db_xref="InterPro:IPR036339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LN70"
FT                   /protein_id="CAQ42032.1"
FT                   /translation="MKFEECVQLLREKFPHVDPKLIEDKTKLYLINKAEACLPQEEKDF
FT                   QIDDNSVEELCRIFYAEGGGKKKHVDSHPDKVHREDAAHSKEGDRRQEDNSSGYNKESS
FT                   ESLVQLGVGVKRDQPIDVVHERPHLSNEELTTKDKNTTKNLTRLNRACNPGILEADQFS
FT                   PTQKDLFGGGTSEGSSNELMKTGRDGKKGAREDSGGDTRWGGENTTNGHQAEGQNDIMN
FT                   RAANKEKNGEEDYTSKGALNSQTNKVEKREDALGNETEKENIAGMRTSQAIGKDISEKV
FT                   NTLETPNLADAPSATLFEVIFRKSLLENDNIKRNISSKNFYIIGEDMLVNITIILDRVI
FT                   SELINHYRIKKLAPSEQEQHFENYFKVVYKLLTNISYNSKEEKYKIIKFTNTQIRTSFL
FT                   TNCEIFNLTKLLFEILNFNTSSSYGLAISFPSQESIARPEEMGKDIASSSCYVDIVWKF
FT                   EEPFSDKESILFEFVLTCVNIIMVMINKKVPSIRMSNEKIFASDGKTEQRLSQESEISK
FT                   KYFEDPKKYLEKLSNNISPINNKLLIIHEKNKQEQQALSDIRKLHNEKYAVHKNYGKGS
FT                   FAGGKNSHGISNRNNTSAAGKICNVNEKKNNNSADNRYCNNKELGDKNSLQKGTKKIKH
FT                   FFKNLFKKG"
FT   CDS_pept        join(1097932..1097934,1098109..1099892,1100179..1100237,
FT                   1100673..1100765,1101091..1101209)
FT                   /locus_tag="PKH_142510"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142510"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142510"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC74"
FT                   /protein_id="CAQ42033.1"
FT                   /translation="MRILLFGDENFSFCNGFLADHDDDIVEVCSCLKENELKQESKNNI
FT                   EALNKNVIIHYGINPVQLKSKFPPNTFDALYYILPGLSFHGHPDFIHPQTEMFKLRLNL
FT                   FCFSFLKSSKNIVKPDGYVYMLFPDESTCKSSIPVPVSEGNAEGTNHNNDTENNNQNSE
FT                   GNDHVEGNSNLSNNANNAVGEGLGDASEGKKNILPFLPIEPKKLAKFCNVTREYSKDYN
FT                   LNLDLHENWLPVLFNMPIVNELPEWVKTCKYYCFKMTELPINKNKNSRGGGSTGNNNVG
FT                   SAGNMGNEQNQDNDNENKDGESGEGKEEGKNDEEKRQDGEENNDNNNSSMNNINAQNNE
FT                   NKGNNGENELNKEKEDNPDEYNVLKIPPQVFDYPIEKLGHVNECFLFKLYSVNSKSVLI
FT                   SRLTLKYDPRISGWKGDNKIKKDMLNMNMPINMSNMNMNNINNMNMMKNMNNIMNMNKF
FT                   KGGKYKNKQPKNDFQQQYKNNIMQNNMNYSLNKKGNMNLPPPPPNNLTMQPNSVNITNQ
FT                   NINYKQSNFPFVNNFKGIPNNLSQNVQNTMPNIPMNVNPNLSNNMMNPYLNGAFNNNFR
FT                   NNMYQQNIPIPPPMGNFNKKIYQGHNMNIKRKNDMYNCDTGLNFLCTYDCVCHLSVPTY
FT                   LCVYLHMSTLSYMNNVNACNDDYDLDQCDYNAGNVRNMQNKNAEDADYYL"
FT   CDS_pept        complement(1103117..1104157)
FT                   /locus_tag="PKH_142520"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142520"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142520"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC75"
FT                   /protein_id="CAQ42034.1"
FT                   /translation="MGSPILNPPERYLHVHFFLLSPSVFTLYAGKVIKADETVIPEIKD
FT                   GYSVIHLSRACLNNPEDEGKLYVQVEDANGCYNICCLQKNVCEDTALDIFLMLDNEVKL
FT                   KTSGSKNEVHIVGYYEVSFGQDHLDDDDEEDEELEDEDDEYENEEVRMLTRKNTLKNSL
FT                   ANGFGKKKKKNSLDEDDETNVGNNDDDDDEDDDDEEDDEDDEEGEDDDDEDDDEDDDDD
FT                   EEDDDDEEDDDEDNDEDEEEDDDDDEEAENKGEKKKNGQKKNKNKRGLDSKNDGPSKKS
FT                   KLFDENQYEKDLVAFLKKNGKCKLPELGKVKKPEGLKMKLGFFIKKHSNVFKLDADSQV
FT                   VSLKNN"
FT   CDS_pept        join(1107842..1108286,1108467..1108628,1108758..1108998,
FT                   1109288..1109381)
FT                   /locus_tag="PKH_142530"
FT                   /product="CS protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142530"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142530"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR025934"
FT                   /db_xref="InterPro:IPR037898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KH59"
FT                   /protein_id="CAQ42035.1"
FT                   /translation="MENEKHENMLLAIARDFQSIDNLIETFLSFLEHKTDYFHIMLNED
FT                   DIGTLAEKYDGAVGKDILNNNKCGFKAHSREENLMKLFRKHQLNYIIKKQPYLIENEDM
FT                   RNKYLPSCDELKKLNTSKFCEVKNKQNDMKKKVETGTTPITVTTSETHISTWNGGQTEK
FT                   YLWNQALNEINIEMPLHTEIKTSEINVQITNKSIKVYHKNEIKLEGTFYEEVNKQECMW
FT                   NIEDKKKLIIFLEKKRENWWPCVLMGDPEIDTSKIESKKNLTDFDEKTQGEIRKFLHQQ
FT                   KIKNEGAQSPEELKAQNIMKNAISSKGYPFMK"
FT   CDS_pept        1112206..1114203
FT                   /locus_tag="PKH_142540"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142540"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142540"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KTJ1"
FT                   /protein_id="CAQ42036.1"
FT                   /translation="MPNDTRYYYDVINSKWWYFDTLAGGWKECEEVATEEAEEEVTAES
FT                   SQVCEERKTHKYQGYKNVEKWNERNYRNNSQHVMNGKVETKKGKRLENRLHNYSYTYTP
FT                   RKTSKPSSESSNSASNTEHYSFKSNIKQHKRGNLIEQDETYEDSYEDNVQGKYPNCDAE
FT                   ENSYDESGGQYDESGGQYDESGGQYDESGGQYDESGGQYDESGGQYGEKGGEDEEKWGY
FT                   YDEYGGYYDEYGGYYDENGGYYDKNGLYYDGSGDHYDESGVYKGENEMYYGDSGICYDE
FT                   NGHLYDGSEEQYDTNGDYHNDKGCHHDDNDKHYYEDCSENEKVITHKEERGGWYEKGER
FT                   INVHNYDDKVSKDCAVSYLHHPGKTRKLKKSSESSNVDHGGGNRNDGHGRNKSDKKSEQ
FT                   RCNSSDKERSSYDHLMNDMEEEKKKKNSFHSMSSSDSENSDKLSERINSLLNQSSSNLS
FT                   ILCKKDSSTILGNLLSRSFTRSDHLNSINTIERASEDGKDENKIANKLIRRKTKVNFDE
FT                   MLRAENNGSKEQMGKGGELGHELVNNTGHTVDRNDKDTDAETKYVPFVRRATRKLTFKS
FT                   QGGLAGCLKVFQEKKKELMSSTASDVSDMEIKIANLKRRARELAQRYKTKNQTTEDQIK
FT                   SDQIKTKFEELVFLVQQQKKQSHEKGKDLK"
FT   CDS_pept        1118771..1120618
FT                   /locus_tag="PKH_142550"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142550"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142550"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KAW8"
FT                   /protein_id="CAQ42037.1"
FT                   /translation="MSSATQLGISEREYEEALAVEKLFFLSSKERCNYCSSGKPTFVDT
FT                   YNYEFVCDRCSFRSKHKKRIGEDPISYYDVQKLEKKFGVASSSYHNSSNKHRRKSSSGH
FT                   HHHHHHHNNNNEKKSKSKSRHTSGKKHIEVVSEDNSSSYDYDDKMRKEKKKKKDKEKDR
FT                   SGGGDRDRDRRKDKHNKDRYKKKKKYDESYDDFDDDFCLNDYDHTTPGMIGIMNSNNMN
FT                   NSDYRSNNMDSSFQDFDGSLINYNQLAEGNFNDFGAPNGMNQGAMNQGGINQGGMNHTN
FT                   HPFDSPHFAKDNYNTKYMNSPNAEMVNSANNQLCLDDYNSHPFNNKMGYSNNFNMKLNE
FT                   EGELAKMKYGNSGQANGAFANNRAGNNHPANNKSNNSNKMNMHLYDPFDSNMNSGADKN
FT                   RYNNGAVDNLNYFNGSNFPNNQQGSMNNRLFLMNKRNSLNHNYNQHNSNPNSMYSHFGT
FT                   TQNPYMMNNQNIINTKMLYDNNVNSSKNKNFHSSNPNSPFMLNGGINGGTVGNANNGNS
FT                   VQGPHNNMNNSMAYCNQGNLNDRTKWHDNSNSNNAINNANGGGNLSSNNNGGSHSEDFS
FT                   PVIVSDKNPFSLQNIISNNKTSPSYVNTMTDEMNKYAYK"
FT   CDS_pept        1123248..1123463
FT                   /locus_tag="PKH_142560"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142560"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142560"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="InterPro:IPR026939"
FT                   /db_xref="InterPro:IPR039438"
FT                   /db_xref="InterPro:IPR039713"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KQ02"
FT                   /protein_id="CAQ42038.1"
FT                   /translation="MTRGNQREVDRIRSSKRNDKAKQNSTVKDASKNLNVICKLCRHTF
FT                   MCTVNPSILKEHHEKKHAKHAYEDCF"
FT   gap             1126251..1132250
FT                   /estimated_length=6000
FT   CDS_pept        complement(join(1134656..1135135,1135584..1136228,
FT                   1136367..1137011,1137742..1138347,1138634..1139341,
FT                   1140054..1140698,1140881..1141522,1141769..1141878,
FT                   1142185..1143067,1145332..1145448))
FT                   /locus_tag="PKH_142570"
FT                   /product="SICA antigen (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142570"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142570"
FT                   /db_xref="InterPro:IPR024285"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="InterPro:IPR024290"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KU29"
FT                   /protein_id="CAQ42039.1"
FT                   /translation="MADPSAATTQGDGGLLGEWMKTILNNSGKTSLTTPQEITEVMRKD
FT                   FEDAWEKLQESLMLPEVNEMADLCKGVVDYGSVKERSWEEQYLKELCKAVVELRYFTSG
FT                   GGTQKRRRLNFDRNIKPHEWYPRCVVGAVALTEIYGDHCYLREVLHHISDKVEQKLRDT
FT                   HQSKGAKLDVCSRITDIDLMVGRAVLGNRMKQWAQEEREKGGASRGTRGSGRVGIQWWR
FT                   WKKVCPEGRENATTDQIDKAKKNAKEANKNILTSFVKVGPQSTTPGTTTTSTTPTPGQT
FT                   STLGDVLVNEDLTIAKEVIEEALSEIVSSGKVDTNRINDVVKKLGEASQQVKAQECIKG
FT                   HKDQKDKLCDRLKCMKYLWQNIPTGEQGTIEDFWTGEDGVVKKLWNELAQKMKATNGTG
FT                   NTDCDKMPNATNSEKAACNYLHAGFKQLYEPEASSSPPSGGGDDILSKKYPSFRQTMGC
FT                   LLLHSYAKYMKEKAICNIEKGITQAFELGDKLRKSGTNCNGSATGKGPCVPCQWNDASI
FT                   DNCTVQIGTDGTGTTEDGMKKIIEQNNSNTKSIIDGINKMETLCNRLQCIASHLNSTDG
FT                   QKPSITSAKNFWTKTGDVGKLWTELSNAMKNNGNNAGDCGQMEDGTTGSTGTRDATNPE
FT                   RKACQHLTAGFDKLKSIATSSGNDYPILSKDPSLKQAMGCFLLKEYAKHMQGQSKCVIE
FT                   SGIKKAFNSWGSITKGNCTGDSPCIECKWDDDKLGSCGVKIGTNGTEMKDKVNTFLQQN
FT                   NNEMDATMKDINDMSTLCDYIKCAAPKWFQNQNNQAGSGTTPTKNWCDFWNDGVKPKLE
FT                   EMFKQIEKNGMDKSMQTNGPCDQFGDDNPDSVERKACNHITAGLDYIKDITGDTNSGAQ
FT                   AQTSSSQKDDKFFKQSIMCAALNLYATKIKEMSQDKCPIDENTIQRMFEAGNGSNTSSS
FT                   TSCLTSGGNKNDCFVCERKPNFNSCELSVPNTLINTQPNGTCTDKDNDKHKVQPEMTKL
FT                   LEDKTTIKMEDKLSQITNINTSFCTQLQCTAKKWNFIKKKNGKPTWTKFWESGGEVAKL
FT                   WEELAGAMMERSGNGQCDKVDGTRQATEPERKACEHLTAVFDKLKSIATSDGNKYTILK
FT                   DNPSLKQAIGCLLLKEYAKQMEKKTTCLIESGIKKAFEVGGKCTSSNGSCIKCKWDDKV
FT                   DNCNVTIDKISVTVKTKVEPILKVDEQNIEIVTENMNEMTTLCQQLQCAAPNWFKKHNN
FT                   NQSGSGSPTKTWCEFWDMAVKEELQKMFADIEDKGKNTNPACNEFGDDNPDSVERKACN
FT                   HIAAGLQHLKTVSGNDQLFERTVGCIALNMYATKIREASEDKCPIDEDKIKQMFSDSNK
FT                   NINSSCSIFGGTNKDCFLCTRKNEDFKKCELSVSNTLINTPSNGSCTLNTDKDKVHTQM
FT                   NNLLEKDTTIKMKPTLDKINEMNHFCTKLQCAAKQYYAKKHGGKSSGVNWDALEKDIGR
FT                   ELNELLEYMTKGQSQPNLLTYCNDDAKWDALGHKKSKTNKAACLLFAAGLQHIYSPKKV
FT                   HVKGPSFEQTMGCLFLKEYAKQLKDLANKKKKGYSWVHPLCEIDKGIDHAFNQSKDIME
FT                   KETPLCKGTNVPNSCFVCTQEEDYNKCKIGDDKIEDEVKPLLQSKETHMEKTLENTVCP
FT                   ILLTDLLTPFLPLAPVSIGLSAMAYYLWKYFGPLGKGGARFRRSPAQASRPSVQEQLLD
FT                   HADEGASHEYRLVKERKPRSAPTRTKRSGRDPAGGGRVNRRTIIEIHFEVLDECQKGDT
FT                   QLNQKDFLELLVREFMGSELMEEEQVPKEDVLMEGVPMEGVPMEGVPMEGVPIELVLIE
FT                   EIPSLGSGLLV"
FT   CDS_pept        complement(1150731..1151741)
FT                   /locus_tag="PKH_142580"
FT                   /product="pf47, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142580"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142580"
FT                   /db_xref="InterPro:IPR010884"
FT                   /db_xref="InterPro:IPR038160"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KWZ8"
FT                   /protein_id="CAQ42040.1"
FT                   /translation="MLIIRGHYKHNKTIYCKCDNTKTEKKRSDGQGVHDHQEVDYVGKV
FT                   GIVKIVLNEGKKKNNKRPPKGIDFTETNEFEETDDFVPNGNDRILDAKENDIIHFKFKP
FT                   NQEPTIEGCENIINMKYGFLQKYVLSLRFPTVFLSTEQCSITIKTVTGTPPTGQTMKIV
FT                   MKFQKTESIDGCDFTKPTGEGDYQHGFPLVDIQSKEKICSIHIKSRSNSSSSHSGDKGE
FT                   GSKIAAGIKCPYKLTPTYCFRHVLHEKNMKGVKDYQPFLMTDVLGTTDVEFYSNVKEGS
FT                   YIIGLPTGIQKYSMVRCLCEYNGKTGIMELKIDSSSRWTFLSRTLMLLSLLMVLL"
FT   CDS_pept        complement(1152100..1152786)
FT                   /locus_tag="PKH_142590"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142590"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142590"
FT                   /db_xref="GOA:B3LC82"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013085"
FT                   /db_xref="InterPro:IPR017340"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3LC82"
FT                   /protein_id="CAQ42041.1"
FT                   /translation="MPKYYCEYCDIYLTHSSPVGRRQHVQGRKHISAKIEYFQNLLREE
FT                   GITPQNFLGFLGPRALNNILGNPMMNNMMPGNFPMHMKHNNMKHHSHYSRRSHRHHMPH
FT                   GRYGRERHGHYSYSSKYHSHPMHMNSSSMSSMSGFPYNEHSGNFFSLSNSMHGNGKMGN
FT                   MVIRDLVSNVNIENDLVKDNPNEERNGDSAIANQPSTMHHEEDQDDPANATGGTANNND
FT                   NVSINA"
FT   CDS_pept        join(1154504..1154654,1154946..1155289)
FT                   /locus_tag="PKH_142600"
FT                   /product="Ubiquitin-conjugating enzyme, putative"
FT                   /EC_number="6.3.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142600"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142600"
FT                   /db_xref="GOA:A0A384L461"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L461"
FT                   /protein_id="CAQ42042.1"
FT                   /translation="MSNLAKKRLIRDFRKLQADSPYGVSGSPIGNDIMKWRAVIFGPAD
FT                   TPWEGGTFQLELLFGNEYPNKPPKVKFLTKMFHPNIYMDGNICIDILQKQWSPIYDISA
FT                   ILTSIQSLLSDPNPNSPANQEAALLFVENRIEYNRRIKNCVKDSISFIDHKVQEEEDGK
FT                   A"
FT   CDS_pept        1158269..1161172
FT                   /locus_tag="PKH_142610"
FT                   /product="RNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142610"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142610"
FT                   /db_xref="GOA:A0A384L4W8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR035542"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L4W8"
FT                   /protein_id="CAQ42043.1"
FT                   /translation="MFSFGLKKKKKEEEQSVEEKPNEENKSPVEEKNDNKEPTDDDKAK
FT                   EEAENEEKQVESKGRNRRTRKTVRKTKKGQKEEEEVKEEVKEEVKEEVKEEVKEEEEEE
FT                   KEEEDKKGKKGKKEPKGKRGSARKGKKVAADEKEEEDKKDEANEVNEANEVNEANEEAE
FT                   NEERKKELKAEEELKDKDAKASALTLEILGDIPDADLKPPENVLFVCKLNPVTEEEDLK
FT                   TIFARFGPITSCNIVKDKVTNNSLQYAFVEFEKKEDCLNAYFEMDNVIIDDRRIHVDFC
FT                   QSLAKYKGEIKNWKIENEAVLENIKKRKLDQEDTRRKRGGKGTANRITNGELNEEEEEE
FT                   NVRVFKYESDNSKKEHENNSDNEEKKDDPNDSAENNAEESAKYKYTNDKRYNPSKYYKD
FT                   NYNNYSSQYPYRRYSYKYRYNNNYNAPYGKNFFYRKNYNNNFYDKYNYYDKVRKNGMFN
FT                   KRNYSPRDGVGHRNDDYSSRYRRQRSYSSDHSQKRRSDKEYARKSENRKYASKSMEKSP
FT                   KRGEHDKYRYPRDGHRERGYSNDKNADDSLLRSGKKMKDRGAATSGYGDYGHYKNGDDE
FT                   GHSNYNYKVQRKTNRSRSYSVGMNGKEESKGYLKRDGYNNDYYYDKKRKYGQQYERAPG
FT                   DDGYTYNNGHSNGSYSKRLKGYPDGGDEERYKKVYPKYSDTYDKNFYSKDQRKDFYDAD
FT                   KKSSKYKNDEYGKYDRDASYDYKADRKKYGDKNEDLYNKPKYSKYDSYERDDGKKYNND
FT                   GKAYGKSYKDEKSYGKYKDRAYDREEDGDPQKSSKYYSKEDKKWYKKRDEKENKSRQKD
FT                   DYKYDDLDKGKRDKSYDRKNKGDDSRDRANDKKSYNYKSKKGKYGDGKKDDDYNTSLNT
FT                   RRDRKNKDSKKRRSKSYSGVSHNSSAKYASKGKKQKKEKYSSKDKKKDNRNKNYEDDDY
FT                   EKYDNSISNSKGSYSNKKDNKNNSYAGKSESANSDYS"
FT   CDS_pept        1164871..1166508
FT                   /locus_tag="PKH_142620"
FT                   /product="karyopherin alpha, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142620"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142620"
FT                   /db_xref="GOA:A0A384KG23"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024931"
FT                   /db_xref="InterPro:IPR032413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KG23"
FT                   /protein_id="CAQ42044.1"
FT                   /translation="MDRRIEARRKEFKKNCDDTRRKREDLVVQIRKQQRECQLESKRAL
FT                   IMANIGLEENSSYNVNYLKSNQNDSTNDSLYNAASNSSSSTVEMLKKIPSLAIGVRSTE
FT                   YVTQLNSTRELRKLLSIEKGPPIQEVINSGVVPYIVEFLKYDDKTDLQFEAAWVLTNIA
FT                   SGSQEQTKVVIENNAVPHLVRLLNSEKEDVCEQAVWALGNIAGDSAECREFVLNQNSLP
FT                   LLLKILRTSHKRTLIRNAAWTLSNLCRGKPAPKFEIVSKALPTLAALIYNDDEEILTDA
FT                   CWTLSYLSDGSNENINAVLDAGVAERVVELLSHCSFLVQTPALRTVGNIVTGDDLQTDV
FT                   VVKLGAVQKLSCLLNSSKKSIKKEACWALSNITAGNISQIQAVIDNNVIPQLINILMKE
FT                   DFEVRKEAAWAISNASSGGSESQIEYLVECGAIHSLSNLLDVEDANIISVTLEGLENIL
FT                   EMGENKKLRDNLPANPYVHFFEECDSVHKIDALQDRKVDNICNKAWKILYKYFPFIINN
FT                   EINNTQITLNNVFANNDDAVLNKDFTFD"
FT   CDS_pept        1168901..1170232
FT                   /locus_tag="PKH_142630"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142630"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142630"
FT                   /db_xref="GOA:A0A384LBF5"
FT                   /db_xref="InterPro:IPR010884"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LBF5"
FT                   /protein_id="CAQ42045.1"
FT                   /translation="MSNIARYFCLLVLLLSPPVRSRGYVCDFSSSKYNLDFDDYYADVT
FT                   CYHEIGQGDTIGVIIPKYRDGRENTHILTQCFEEISLNKSGNNPVSIYNVFNHDEIQVS
FT                   VSNSLYDTEYLSSILKIKNVQKNNYIHCVFQNKNEKNKEIHKGVAKIAVKNYPVQNKNL
FT                   SNKHVVDLYNQLNLSEDNSKNKYRVTAEPGHILYILGSKLANGKNVYFDKKCPIHFEHI
FT                   GDIYKHVFPIINEEEVLYDCPMYYDEKEKKISVGNLIVTFEARPPSIKSISKDILKKHI
FT                   KYDIDRKLHDILNGTDYTMGHMGNVDGDNDNQYMEQSIEINETQTSNLQSVSLGKEHCN
FT                   NDKCIDLFENSNCSSLCGNGYRLRDGYDVRYDIQSIIPCNHGDCTPEDFIEPLVIFAWT
FT                   SIVFFCIMITLLIITIYSLLHASKQKVADPFFNYDSNIRSSGAL"
FT   CDS_pept        join(1171228..1171891,1172169..1172200,1172347..1172419,
FT                   1172610..1172669,1172811..1172869,1173017..1173152,
FT                   1173271..1173346,1173490..1173569,1173718..1173777,
FT                   1173994..1174103,1174334..1174375,1175231..1175354,
FT                   1175766..1176165,1176281..1176424,1176646..1176697)
FT                   /locus_tag="PKH_142640"
FT                   /product="GTPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142640"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142640"
FT                   /db_xref="GOA:B3LC87"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B3LC87"
FT                   /protein_id="CAQ42046.1"
FT                   /translation="MRGTYMWILYCRTKHLRIRDSFPFSKLRAEQFADKFVRNYGDIIN
FT                   GVKNELNIMCSFCNMSMGMVHVSLCESAIGSPITPVDGCDCTFEHKPEHRLSHGAHDAP
FT                   SENDQLEQNTQPEKKGTSKLATYLIIYYVKEYVKYVAHSLLHFCFNLCDTIFRTLFVLP
FT                   KSYLEFPKQLDYYSSISDNLLTSFVTIYKIYKQNDSSEFRFKLDQLAFLGSGFIYDKRG
FT                   YVLTAAHNITNTEGTFVIKNEDNFYVATVAGLHRESDICVMKIISEEQFNHIPLNPSRE
FT                   LLKPGETVITYGQIQNFDKGTCSIGVVNQPRQTFTKFENFSEKEKTCLYPFIQISNPIN
FT                   KGMSGSPLIDKHGNLVGMIQKKIDNYGLALPVNILKNITTHLQEEGTYKEPFLGIVLRE
FT                   KEQSISAVYKNCKNELKIQDVLVNSPADVAGITKGDIMLRINNTKIKNICDVHEILNST
FT                   SDGYVTEDLEYKPFKNISFNKLKSNLKNFLVVNKKFSISDVKQVSFLGKFYNYEKIENY
FT                   GVNEICILGRSNVGKSTFLRNFIKYLINVNEHANVKVSKNSGCTRSINLYSFENGKKKK
FT                   LFILTDMPGFGYAAGIGKKKMEFLRKNLEDYIFLRNQICLFFVLIDMSVDIQKIDVSIV
FT                   DAIKKTNIPFRVICTKSDKFSTKADERLEAIKNFYQLEKIPIHISKFSTHNYINIFKEI
FT                   QHHCNLDIP"
FT   CDS_pept        complement(1177014..1184318)
FT                   /locus_tag="PKH_142650"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142650"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142650"
FT                   /db_xref="GOA:A0A384KLM3"
FT                   /db_xref="InterPro:IPR021843"
FT                   /db_xref="InterPro:IPR035309"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KLM3"
FT                   /protein_id="CAQ42047.1"
FT                   /translation="MMLNTLRELNDYSNFLPKKIKENVNKEKYEILCEIKKIVSLKKNN
FT                   SYNVTLVIKLYNLYETINTTKHKSFHFYIFMIKYLWYSLHNKNISPNLKSYICQTISGI
FT                   LENIKNHILDDYFFEYDKELIFKDEESSTFVQPEDVSGTWHDEGNGSDVTNNSYEGISD
FT                   HYYDEYKYINENPSDVDSTTINENKPHMPADRYYLSINGIFERGDENSSSFFNEEVLIN
FT                   GKDEGFRLYIQKCIFSIIDYKYLFSLFYNYLSNNSKKQDGYSHNAYKNFITSVINLLAM
FT                   LRPFCYYNIDVHNLLFNFSLNNIFSSKYEEYVDMRGDFLLECANRVGECAQEMNQSDAT
FT                   DGNHDDNNCVNEGKDKHGGGRDDCSIFAINFEMNKRTNTGVVLDDNYMKHKLGEGGNAF
FT                   IGMIDESVLRNVDLATYPIEKLEICPRYNTVFLNFVILSQLGSDDLCFKLIKYEKALHL
FT                   YRKLRRYNWHSINYAFVRIVYKGLKYAYMYNISLEKQMKEIVRLLFFLFLYYIKLPCNV
FT                   QLSSAKKYIPDDYNLLINDDDSVVKTISKTFVFLLNKMYRKVKVTGGNSAEEVKQKQLE
FT                   AKMREKELLQAFLSLLNDENFNLSVFDEVTNDGEGQEGDGGKGNKRKISSLFHDLDTHE
FT                   FFNIITCLFMPHIHPSSVGKHLGNINLFINTFLFSFIRKLKRESLYLKRMKVRRKTPKN
FT                   DNLMGGGNVYSEVSINLHDEADDYVSKYFISEEEKKFVMEKFTQLAVQGMFPKGNKGVS
FT                   LFENILKHICVVDINCLDIFVKKMLECLINVNTSTQICNCLLSLCLILPLLIRYKAGHL
FT                   KELLSVMIMGIDICDVYKSFTIFSFLSILFSYICIVKIENVGGGKGVDLKIAIREYTKF
FT                   MQMEGSQAYTLHLLNDEQIEEVMKERKELVDYLCYWIHEFFDKILYFIKFTKNEKSKDS
FT                   KKMNGEKKENKVGNDIYTGLKTTLISLFIHLDHDILYELCEKFLNNIDQENAKSLSIIP
FT                   LAFGMVNNKKIYDMLFNAFYKKLITKRKKKRLVHAVTSSDGAVSTQEEEEYFTYSKNEY
FT                   ANDDTVKCYLHFLSNLIRRARNEYINLEDIYNLIEIYIIEDNNVAFKYICKIMYRFLEI
FT                   NFSLSVKEYACFKIEENISAQEKIRTLAGWGIPWYILNNAKNDGNVLPNKTCEQEQVMH
FT                   TTQNYEEGLTKGDCINGRFSDGAQFNADEMIKWKMPSRENVKVGKRFMYILLDYLLDLI
FT                   IQCGVPVSTPNLIKYVEKRKLREKKIQWKFPLNHSNVISRIYKIIKCIVKPLSCLYPDE
FT                   RYNYNNLLVKCHVVNTKLSFYLYVYLCEIVVTLSLHVLKIPKQILSMSLYAKYNPNDDR
FT                   LEHRSSFSSVNSENSVNDVSVKQILVDKNELKKLKEDFFTNIINNREESIKADAKMQRK
FT                   IIKSIHFLLLKCNDSPNTTMYNEYINSVLSFTYNIYPYSYNYDIIKSQYVNNILSLYNE
FT                   RLKQRKKNYCFKGYREQLCNILFFTNLSIYSQVRSYAQSTTKLVLPTFKIIKIPFLKIC
FT                   SFYLKNYIKLYILMKSEQNKEPYTESTADIGISNATHAAINNSTNGPMNEPISDPTNSG
FT                   SLTKLSTLKSLGELNNHDYFENKCISCFNGILINISSNSGLIKKISTDLNLLRKYIKII
FT                   LNILRLEIQKDEVTLKCMKLVYAIINSRFIKNQEASTVGEEKKKKKSLNGLFLFLKEES
FT                   EKKNNVYAQIVILSFLICYENFVILNHSEFYFSYLLENLMIKKNVNVYNLAYYGFIKFL
FT                   KYFNRNVDKGIVPAHIMDVFKSPDVYNNFVEVCIYKNLKSKKKSNSINAIIVNLSKIQK
FT                   SFKGFAHISETHIKDFFYYYEFFKFLVNLQNEYDEQSRGDATSGVVHTDELYIPVKKQD
FT                   DGEGEAIPGDVHQLGEEQSTIKKEGVCPHFNFFQRIIHNLKELQQDVHADNEYKSTFIS
FT                   LVCPLLFSLRKLKRREMADTILESIISLLEKEIAVVNMDVYTIWMYYFHLLFINIKKKD
FT                   LDKYEKLFKFCLCFNFQDTSNLIFKKKTQLLSIMLMYSMHKNIHLIDNHLMEFLKLIDN
FT                   DNITVRQVVGDLLAYLLYVLHDNRYYSHLKCMYLRILMYLYKRSCEVIEYLQGKETLSK
FT                   QSKFIYTLETLAYITITIFSIRSMYVLNNISIPFLKMFILSFQLVDNFINEIVNKAINC
FT                   FMCPSLYLFQFEKITYAQSAAQLAVQSDDACVTCGTNDICEIATPELISSFDILLKDNL
FT                   GNIFIKELSHLLRKSNWKIRNCVLQFCFYFHAYYCIFFYSRTENTFLLNVFISLLVDNY
FT                   IEIQNLSRHILSSVLCFYDSQTVQSISQYFLTVANEKTILPSPQRENLETSNSNKLMEK
FT                   KKTVAIYALISVINSFPNHIPHWLPNILISVAKMSNNKVHIIKKEIEKCIQNFLRTHKD
FT                   EWEYKYKLVFTEDQLNILDMYKGGLNYFT"
FT   CDS_pept        join(1187169..1188626,1188814..1188900)
FT                   /locus_tag="PKH_142660"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142660"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L0Z0"
FT                   /protein_id="CAQ42048.1"
FT                   /translation="MILHRIRKAQFSMDVNVSNLLRKKAILFENVKRENCKKELIMDYF
FT                   HIKGVKLKKNDIHIMTNILCRPTGRIMILTDNMKKQNFNFDFGSLSEAREDLSLDEKRM
FT                   SGKSAEHSGNSPNSNNSNTANAVEDSSRCDIHGGDKSNVELRGHNQENTEGAKGETQEE
FT                   LKKAKDEVVEEEEEEYACSNMWNKNLKNLFKECKIHLCDDFEIEKFVEECERFLRFTED
FT                   IKRIARFENLDKIITIINIPNCYGRKELAQIIYDCARIHVKLNNIIFRFKKNGIQSDCA
FT                   YVLCNSVNDGNILINKMQEYPVAKKYHLREFFGTSFLYASKSNLFLSSEKLDYVTIFSK
FT                   YKIFTCGWHKDISIKEFESFLITLKIFPKKIIKIDYRTGGTARRAQQEHSAGESAHQSD
FT                   DQPEDHADCKYQLSPVDPHHILISIDEVESAATNADRTNDPHDANTSSFILFFENMRMT
FT                   KKVFTKLERLKKKWKISASKNFYAYPKTPDIHFNDDEDYEDENEYEDSDLDEEIEY"
FT   CDS_pept        complement(join(1189064..1189151,1189300..1189423,
FT                   1189572..1189639,1189795..1192658,1192896..1193039,
FT                   1193258..1193347))
FT                   /locus_tag="PKH_142670"
FT                   /product="RNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142670"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142670"
FT                   /db_xref="GOA:A0A384KJE8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004170"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR037197"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KJE8"
FT                   /protein_id="CAQ42049.1"
FT                   /translation="MIFTKVFFIPAFLMCSVSTFVKHNLPTSNYIYTKTDRFRRKRKKI
FT                   NYRLHKSKDEDIESCIPHIYKDIAPSLKGLTDEEYSYKQLLNAYFPETVEREIEKKKEK
FT                   ELKQKNEEKGICKNSAKKEGVMDGEKDMEEKLRENDITNFEDINKISDHKKKNKILDIA
FT                   YDSMEDSLRDIYLRMKSGVGNEEEDKKDYLEIAKKEKDMLYEKLICGYSPLNNSSTFDL
FT                   FGVFYDSKDYEDGKKLLAEMNKMLNLEPLKSNRGNILQTVDTLLKKNNLPPHIRNFLIK
FT                   YRHIAEEVCGTREDRKDAVGDEKTEDTQIEQDVTQTPGGERKNEEYLELDDPKTAAEVG
FT                   KGIKKEEYLKDVNKVIMTLHNNLNNEKLMRRDQYFVDELYDAYKKHLRTIHVKRNKLEP
FT                   QKNNYDFLTFFHEHYEEYFFFKYGNFAYDFEETVEKVKEKMENEKGLTKTEDAAQFSQH
FT                   GGTGPPVENQHMEGDKKPSSLDMWVRSVGDPTESRYNEDKGTRAGRGKNPNEKCSILKG
FT                   IKQDKKLRKHILMDIIHNYQKRMYDIYKPNNIITNAYGFNNYIDNEQYEKEINASFNKY
FT                   SILNYDSKEDLNKVEKLYVGKLIFGKIFKIEKTYAYVDINYAFYAELHEDQMPYNIKNM
FT                   KDVFKVNDKLVFEIYKMYPEKILLTLKNIQKVNDLNKILHYKTQDMPFDVKVVTILKNG
FT                   ISVSYNDIYAFIHISALSSKYKVKVEENEKIQESLLNQKIKVICTDISKLNFSNLIYEQ
FT                   NEQLKKLNIYDIVQVEIIHISKYGLMVKCDDIVGLIHISEISKKKIDDLNDVFKIGDQL
FT                   KGVLINIDYDNKRFSLSTKILETEGRNFIDDRAQIYDNMEFILEDIKKRNTSLRINDSN
FT                   IKNQLLSLIDIYKTEDGDSKSDGQADIAPAAGADTHQGKIDRGEADQGENDRNDTPRSV
FT                   ELTKRTNNPGDGTDRHTTCKGDQDQSTELAPTDLRIENDQIKRTEGDNRETETERFSDD
FT                   LDETEEEEKELTIDINNQLVPYLMLKQDEIAKEEEEESVLEKPREIIWNLEDEEFLNSN
FT                   SPTQSTQFFEYQWSYLKDKKWVNFAYYVNRIMNYYFNINDDFFTYKEKNVVYEIDFVKG
FT                   VRIDLATGLQNRIRKITK"
FT   CDS_pept        1194055..1195680
FT                   /locus_tag="PKH_142680"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142680"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KA97"
FT                   /protein_id="CAQ42050.1"
FT                   /translation="MHYPTVGHIRLLRRPLYGAAKYECSNMMRTNSNMDIGRRYFQHTH
FT                   MNTASSSTKEKRYYKGKELNLCTPLNHTVNLCHERMDGNFYAYDISATVFRLLKCVHKL
FT                   EQREVPKIIPQTSTENTFINYQVDKLFYCYVSIYNNISKNLFLKLTLEFLKSPALHRRI
FT                   VENGRFYEQVLCEIVKCADGHETMDKSFYYEYVIKILSVILKNKNAFNDIQERIFFQDI
FT                   INMIREEKNINYFIKNFTFLISCISLYKRRLKKEIHFNRPKDDDVRMEYLAQDNQILLM
FT                   QRKKQLLQKCLPIILDIFNKLHQYNHLNDVDICNIVDFLNEFKESHKIKLAICKDIHKY
FT                   FKPSSDMKHLCLILYLLTQSKNEEMQLTQVAYKHIYNIIFCRKSELTDPKNVNLFLLGV
FT                   TRWRRKVDVQQNVRNTPLGRGTQSDSHPDGDTERVLRRRKTYSGRSKGRLQFSYGTKSR
FT                   STNLQLCQLLRHKIIKKQKMKKEKKMYFWIKYCLLQFIKKGQLKAKYVKTFYEYFCPYH
FT                   ISRKCTRKKNYISPLSIVQRVGKV"
FT   CDS_pept        complement(1196499..1199807)
FT                   /locus_tag="PKH_142690"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142690"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHK5"
FT                   /protein_id="CAQ42051.1"
FT                   /translation="MKKKQFFQIVESNDLSAQPENSPLDLSTLSENSSVHLSARPEKSS
FT                   LNLSANSIVDFNKLEKKKKNNLSETQLSHNSHDIFNNVSKRNALNFLGLCNKKKNVDNF
FT                   QGENESEKGTHHAHVKSVNHEVLHTPGINTQGVKCENGDFIIPNGVSPCTVEFPPKDES
FT                   DNSRNSARDEHGPSTPFSRGEDARENQRNNHFYCLRQIIHNNLNNNYDKSEVKIFNIYH
FT                   DSRAECLFNDASVIKFYGHENVCIYENKSYICEEINANLFHQNEEKEKEKENSFDAHTD
FT                   IYEYLYKEKIKLSSTNGKDKGNCDQNGIMNECGHHHEQVKQCFQFYMHKYPSFLKGKIK
FT                   IFIHLYNIFSIYPYINHKFIEQEIYSKNLKISSSFEKIVHIKWRFYAEHELREMLNRAL
FT                   LNKKREHSLQESCLHVDDYIDVNFLTQQVKVRDVGFPHDGDHGNNNSNYILLNGNGLCF
FT                   SAYYHLIVPYHRHINQSAKEIDKRNSDYNLSYEYVYLSQLFNIYDNFHVCFLYPLFVSY
FT                   FFYYHLFFKGDRCASEVDPPPSLPPEATLAPSEKKGTQEGAYKSTCEEVYTNQIDDIYA
FT                   KLTNCVKESISNTQCGSFKIKDGVIEFLVPQSCYKNCEEPEFLADKSHHLPLLYVVCIS
FT                   KHGVSNRVGDVNYGLHHSVWNSNMARTSVERNMITFPANSTSVSSCHVHGHTHPVHTRE
FT                   SYSTEEGLHKTNPDKEQWTWELHDNNICRNEVKEFNNLRTIFPEGMKHYFNTCNKIDNI
FT                   IKVSVRNDGVCFMYVRNILGEYIFFSYFILFNAFENLVHLMNKGKNGRTHREGHWEGLH
FT                   QNGETAGDNTTSVDILHMEPIQQCGEFYSNVLDSTRGWYRPNLGRHESEEVSFANIENT
FT                   FEMSNISNIYNDFYICENKRMNTFKLFNIMNREKKKILTAYYFENSKLTPIFFLRLSNI
FT                   HIYDINRQLNSVFEYINYNNKTFTPFLEKYAKYEMNVQLDLLENMYNINNELYLLYTKK
FT                   INYSHDIYKYNYLYVQDYLLKNYILYYNIYFRVSEEMKKNAYFKLKYTNRNKQTISVHF
FT                   TVSFNYAYDRVNSHFGLTPSHYITHLESDSPHEQVDSANYIVFISKYVHNKYVK"
FT   CDS_pept        join(1203386..1203481,1203678..1207826)
FT                   /locus_tag="PKH_142700"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142700"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L9N3"
FT                   /protein_id="CAQ42052.1"
FT                   /translation="MNNVIICFLLLINYGKSVLGAEAQGKNPNNDNNPYEESEIDEKWR
FT                   LHELETNPFIDLKHPNFNGDFIRCIDEYYVYETKEYNAYKKERYKNIKNYKTFKKKQFN
FT                   CAINLLVHGRPNSRNSNDYKIWSAAANINKHQAMLQKKYSKYIIYTPFVSLSNVTSPEG
FT                   LYTHLNYAYLLSNRMAITFKNMLEDDTCYNYDIFIHSHCYGANIVRLMFTLDNEIWKTL
FT                   DKSLLNVTYEREVLAILEDNFKLTLKDINIITDKNAIQIRKDPYFKIHKYYLYKTFQSK
FT                   FNKNKIIEDFDDVFDDHSLKYNFHPQGESNAIHGGGGKGSMENLVAQSGTSGARNAGAE
FT                   ESESEQGEREEPEESEESEDSEDSDSDDEFIFFIKPKKVRKKGSHAPNRSLKRLHTYLL
FT                   NKKFTLLSIVSTAPPLIGIVSNMEDIRVGHQKLMKYKFMFQNVPSFLRAKMLKTRDAQE
FT                   LLHVVNPGLLCLLALHEKLNYNYENNTGSLISYFKNVNYYADLDNDEIMSLHTSLGLHS
FT                   TLHMRNLSYYLLNIRNEYHHRTYSLPAHLSDINVSNNYAFFEYIKENDVCSQIKHSELE
FT                   RFVSYLSEIINFNQEPQPYIPHRQVYKNPFMSHYVIPYMQENNIYTPHSILGTGRTALL
FT                   LFSYDIYKHIAMNGFSERNVIKNDIDFLYDADPFVYYNWMTYIGNQNELDEDNFVKNFH
FT                   IYSDNINMNMVQNLFNLFVSTHYVKFFIFSKNNTADVYRSLHRTLKNFSLPINKVVLRR
FT                   QREKKINFPLLNNAQFDHEENVVYDYMCRYTNFLKTFSYLNSFQYITNEEFILNHKNFK
FT                   KYQSERMAELKNEIKKAHNFIQQNSTFSDMKNKLTDMYNIENTANSSERELEVNEEVGN
FT                   LNTFESANYPLEESKKNSASNDSLQDIDKSYVTYHGIYVNIRRTMTLKEAFKSISMHND
FT                   IYDAMQYVEFVIKGSAYNDVEDHLNNMEDVNSCLFNKNENIPLNFISKFCNYDQQAYFH
FT                   IKKLYTSRNLFVLKSLKQCNYPKYRNLKLCENRNLLKTFFQSDLSVTLSKLHEREKKRM
FT                   ATMRDGIERGMNEADILSISNDSLAAIFHNKNEDISTFKMNACFIIPEKPLIQNLFSND
FT                   ENMQSTKEDTEMGTVKKVGHGHITADTSDVITMTESSTNWDSSLSNMEEVDSSRTSLHS
FT                   LESLGGYEDVGSDVIEAAYELEREFGPVAKMAMSVVSANEKEQEKEKEKEKETETEEEE
FT                   EEEEMERQKQKEKEREKKEKEKNYNIYAQSSASRSGRDSGSGEKVFCTEVTLPVLLRKD
FT                   ILKSANDIYMRAIRSVMQDPHFRSAFNLRNGDEPYESFIYFFDKFAYVYNQKNKYAHTG
FT                   DINTFNTPQNIKWNYFYYLLKYGSQTNYNSESFLKNFFYGKKSNLVKPQKDNILKDFLA
FT                   HFTVFFYLFKLD"
FT   CDS_pept        complement(1208772..1211228)
FT                   /locus_tag="PKH_142710"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142710"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142710"
FT                   /db_xref="GOA:A0A384KM05"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR025799"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KM05"
FT                   /protein_id="CAQ42053.1"
FT                   /translation="MDKESPKAVDQNVLAEMKKIIELFAQETTCTGKEVFADDKYAYSL
FT                   IDNYKSRRTKNVVIHMLKNDINILYYNEEYKNIIFINFLRLCQLNNLNVKKYHDMFLKY
FT                   DIFSYILNSEKYLHAFLKSIINNDKLLWDVNADHFEFIAFPMGASAQNENDRTGNLGDH
FT                   SQDNCYVLDEKQKLKLDDLVENSSDCSDSSAFSEDEISVSSEFSEKSPYIINGKQEVNG
FT                   YLSHPYMGTNVEECHKKENVTVAKKEQIFQKLQIGKDEVPVEGINDSTITLQEEKSRND
FT                   LEENTLSTLNNINLNHLVDAIVDTGKWGDEDTLKGGRCKKSTNGMEKKSSLNESIIEKF
FT                   VTKSEDDQEEVLNLHKKVNSMEKIIKHLIGEIMKRDMVRKAPLGRVSLGVVPIDETEKA
FT                   EQNDTEKKNQEESPPSDITSPTSKDCGECSEDTDSKYFESYNNTGIHRTMILDKSRTNS
FT                   YYEFVKKNKKIFENKVVLDIGCGSSIISLFCADHAKVVVGIDNAHRILTKAKKITEKNG
FT                   ASNIYLFEGKIEQNNIYIDEKEEIHYINKKEDLEKYKKIYNIKNLQILKFDIIISEWMG
FT                   YFLFYECMIDTILYARDFYLKENGLLLPNKVYLYLAGYNDTEYINENILIWDSPLYGKD
FT                   LSELKPNSKNFMENAKIINLDKNKVSTQVVNYAIIDMYTYRKNENVYISSDFKIAVNNG
FT                   KVVTSLGFYFDCHFEAYRCYADESSHSGKDLTPTADECTNIILTTSMFKEETHWRQTLL
FT                   HLHCPNFTIANISAPAEGTHPNELSGRIFISSAGEHSRNVTALLQIKKNESMNVDDDWT
FT                   CWYSLD"
FT   CDS_pept        complement(join(1212702..1212891,1213126..1213244,
FT                   1213540..1214820,1215045..1215299))
FT                   /locus_tag="PKH_142720"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142720"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142720"
FT                   /db_xref="InterPro:IPR018553"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KP34"
FT                   /protein_id="CAQ42054.1"
FT                   /translation="MNENERLKNILDEKEEVLEAKEEEDSLVENKPKEFQNISKKNLEV
FT                   LKFLNKQELMLLIDKLDHEDKLSGIIEKEIKQDTLEILKNYENEQYDTINLEEKDLKED
FT                   KEEKEKEEEQEENEYLRLSKFIPLRLTYEERLYLRLLESTLEVSEYTDKIDVFHSGNKS
FT                   KKIIKEIKTLCSILSGLVIANNYENGQRLIRDRDFLRNSNFFSIVFEIGRRYKILNPDR
FT                   MRSSYGKLMYFLMDTRREEIYDLLSFNCVAPIKTVYDLLKGKKNGLDILNDNLIKIATM
FT                   HIDAKGSRSEIQKQIKQKEEAIKYLSRKYASNSSKNCKKNIFRINIPIFNNQNNEDDDS
FT                   NNTEELECLSSEEIERCLYSLSDYNTHIKMFCEPCEIMIDYLKTFYDPYEKNSSYSLSI
FT                   ESGKQGSRLTHSHNRQYMYVLQTLYLWKEIGEHMFFLWACAENDMLDFKNPYRLVDTGQ
FT                   GLNRMQSGHKVLSVMKKILHNVQKKLGGWVGSSMIHMGDTNIPNTFMFIDKYTQVPRIL
FT                   TPIVLCLQKIDELYNSTASMKNYIKTEFNGAQNLKMMITCDFFRHGFDGSGGDNFNEAG
FT                   SCIDGRLTSAWNWCSKIEKKKYFPIFLLTGFVGFDGSF"
FT   CDS_pept        complement(1219857..1225772)
FT                   /locus_tag="PKH_142730"
FT                   /product="CAF1-family ribonuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142730"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142730"
FT                   /db_xref="GOA:A0A384KUL3"
FT                   /db_xref="InterPro:IPR006941"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR039637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KUL3"
FT                   /protein_id="CAQ42055.1"
FT                   /translation="MDERTKIVDVWANNLEEEFERIRDVVENHPYVAIDTEFPGIVARP
FT                   TGNVVDYNYQTIKCNVDLLKVIQLGVTFSNGKGELPNVSTWQFNFKFDLESDMYAQNSI
FT                   DFLKHSGINFEKHQSLGIELLHFGEIIMSSGLVMNEDVKWISFHGCYDFAYLLKILTCC
FT                   ALPHNEIAFFDLLNDFFPSLYDIKYFLLNLNIKQLSRTYSLQKISEILSVKRIGRQHQA
FT                   GSDSLVTCKTFFKLLELYFDNQIDDKKYSGIIYGLGSTIKNYNPKLEDSPHKINNSNHY
FT                   GNGYVKGNNNAHGSSGHYGCGYSSNYDCNYSGSHSVNHSGNHSCNHSCNHSGNHSCNHS
FT                   CNHSGNHSDNNDSEERSRECNHMYMDGNNCMMHTQNHMLTSYQGNKEYQISFSKDAVKG
FT                   NFKSDMLYNLYADMNQNNYNTIANVGNMIQNNINGFASYENDATNNRDFIKYSSQPQLL
FT                   NMSTANAKSLRVLANSDVHTNSLSGGDSGSNSANGNGSGNGSGNGSRNGSGNGSGNGSR
FT                   NGSGNGSRNGSGNGSRNGSGNGRGNGSRNGSGNGSGNGRGNGRASGKNSGKGGGKGDNK
FT                   GEGKGNAKNSNKNNNKNNGKNNSNGDGNSKNGSNSRGNNGGNNGGNNEGNNGGSSGGNT
FT                   GGNGTGHSGGHGGGQNSGHNGGNGNSHTNGHSGGNGNNHGNNKGNGKNKYNNNTSNNTN
FT                   INNNGRDFISLAGNSNKSSLDNSTKPLKNVFNDLPKRPSNDNLNNDNWRNDNLSSDNWR
FT                   SDNFRNDNLSDHFSTANVNSSSEPLRNMNGVGGTTNRNFTNPSGNIISLNSANMSVSSM
FT                   KNSILLNNLSSLSGTNSNVSISGKSGLSSKGSMQSKKGAIGKNGSVGKNNVVGLSMSSL
FT                   NNPVVLPNGLSVGTTGINLANINNGMVVNNMDVNNMRMNNLSSNVSVNRVPAANVGNIN
FT                   LKQSSISVSMNNRNANNSCSVSTVSEVNGRQSGSMKSVNISEESIIDAVKGDYEVDNSN
FT                   PMPQNGIALSSMYVPNMNYANGGGNGNHKNSASANGSGKNSSKKNNSSNGSDIGPFLNS
FT                   VNLGAANMASNPPLQMNSNVSNFKQYPMPNKYNSFSNYPTSVSNPNDKGTTEDSEIDEA
FT                   LFDGAGGMGIVGNGINSGSGNGHGNGHGNGNGNVGNSGANANGKNALNKNGMNKVNMAH
FT                   ISYGKNIIPSGVNGNSNFKGSHKSNTLMNSEMPGGLMQNGNLISKNNELSSGNFDAMSD
FT                   LPPNMTMLRDDNSKDEKMNNLNKGAMGSFPVKHPPPPPPPPPPPSSCNLTNVMSNGNQN
FT                   NSGEKAKNNSIMKNLSSSSSNNTGNANLSNGAHPISGNEAKICNLGMGSASYTSNHLLK
FT                   HNMSLSNLGNVSGSNKLNLANMANPNSSGVIKNNSPGPVGPAGANGGVRALGTNIVPVY
FT                   NATNKGPLDNGEANMNPSFNMNGSNKNNKNCNQLSSTTNERNSKNNAKEGNGKNTVLLV
FT                   NSSVSEEAYNVDEGIIANGGTLSSANSLYNGSPKNSGDQAKGRTNTNTTSDSANNGKNG
FT                   KGGKNGNKNHKHSKNKNKGANGGINIGGVTNATTANGGSTVIKKRSNEKNAADKMNISN
FT                   LEQNNNYDSVSQKKNGNKIFANIVREEEEGKFSSGNVVSNDEKKNAPIDRNEHKSLLNN
FT                   MNYFKGDNVKMYNRGGIGAGSGAAPVAGPYGKNGAHHLGVKNNFLNSPTCDSESMLHNI
FT                   SSVNIINDMNTSDIMNPSNVQNYANSGSASDVNADIHYLGSMNNSKGGNNYAEVLHGKM
FT                   NNLNIMNISKMHSGTYSVNNNVGPLSGGLGGRHNGKHNSSSIAENTSTNGGAFNFVNKK
FT                   TSKDNLSMINHAMMNNLNLNNIYANSDTKAFNKMNVNHKGGGSVSNSNFCFNGEGATGV
FT                   VARNQPYYNSYAESFPDKITNKSFIEKSGNIIPSSIYNGKREEPSISMYNYVDSNNFLE
FT                   KNAILADKYEPMESPQGNMFNYASYEYKNKERKFFYDA"
FT   CDS_pept        complement(join(1230988..1234052,1234300..1234492))
FT                   /locus_tag="PKH_142740"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142740"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142740"
FT                   /db_xref="GOA:A0A384LK49"
FT                   /db_xref="InterPro:IPR011678"
FT                   /db_xref="InterPro:IPR026895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LK49"
FT                   /protein_id="CAQ42056.1"
FT                   /translation="MWFHFFLCFVALLTKLTFEKHIPYSNIASVIGHINYIVPTSNLLN
FT                   SSVLLSSFNGNVGFLNYKTGTLDYVQNHRENEKIKKLHGDDGYAAVLIYRDPSEENEVE
FT                   GNYTNDGEPYSYINVYSTMDTHLLSSFEYKNEIIEDFLINEEKIFILLHNRIDIGNIGE
FT                   RKVNSLIFQELNLNSIYARIIAVSNVSISLFYVDAELGGHIVRINIVNKNLENDVKINK
FT                   LQMNDKMVNYVNVVNNGNVIVVYNKELLQWVELAEGGNNYDYGSVSIGGHDKKAENEET
FT                   NERANYANTKETIPKHKLLRDDFMAQWNTENCFVIKLGEKQLVYTYNDKKMRLIKGKNK
FT                   NEVIGYYINQYKEKDIIFAEDKENQIIIKKAEEQGIVTLNVLNKSSNVYYNAEMIIGLH
FT                   NKEDNANYFFSVYSDSTLTVYKNEHVHYSREESLAYVEQLHFYNFQHLKKKKSAKHSYD
FT                   TTQFHLMKELESYIKDKINSFNKPFLEEVMKRKAEKSLLPFNFFYLSHEDKMNLLNICM
FT                   EKKKKADSLANYGMERKPSYSMNSRGDTYDMHSGDHTSNLMNEMIENSFKKYEQNQSGK
FT                   YAGSSVIIVATRNNFIFAIHLYTGLILYKIDGNQFKDTKEIFSPKWNFDMVFSLNKDNW
FT                   SELDNGKKIIFLNNQKECDTLESNLTSKRQPSKTPPMTKGVLNYSNGVHLFKSFTKDTV
FT                   ITIFKGENFAHIIIFDILSGLIIFEEKLNSFEIKNIFIDRKGSSIVLVDNSLNVKVVAV
FT                   PGGGVTDATEDDLFFYRINGSRNFIEGFKLMSYPRKKGPGKEMGLIQTYSINLHNEKLE
FT                   VFSKSITKKDTFYPIKINKDASICYKYVNDNIISYITSTKQKEGIIYTLYIIDGITGDL
FT                   IISKMLDKHTNPPFHLMISENFVILNYFNTNLKKYIIQVIEILLDKKDPGFFNLITSKK
FT                   EKIVDLFDQKKKIVVNEKNYIIDHNVKSFNFTETKRGITNKHILLLLDSNKITSLNLGP
FT                   EKEQNVYKNLNSFITQTDILYNSRGFISNESLLESTTLVFSWGNYLYFTCYQPNGSFDT
FT                   IENFNLLLLLFLIILVFIGTYISYIRRINKTVYSKWA"
FT   CDS_pept        1235710..1237536
FT                   /locus_tag="PKH_142750"
FT                   /product="mitochondrial carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142750"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142750"
FT                   /db_xref="GOA:A0A384KYE4"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KYE4"
FT                   /protein_id="CAQ42057.1"
FT                   /translation="MDVRYEDNYLWKRVTKYFSKDYQNRDKTGTVITSDTRNSNDESKT
FT                   VKARTLNFMASSALVLCVLHPLDTIRTRKQIYKVYKNSYPYYYNNKYNLFYILKKEKIE
FT                   SIYRGLLATLLTTGVSHGIFRFIYDTLNNYAFRQFNDVNGGKNQKNDTAISRRKEEFSG
FT                   GEAKQVCHSGSGDSLEGGKVIENSGGGREISSWSPNFVKSAIERRHGDNLMMSNLSYKK
FT                   EINNEDNVEGSTRKDGAISGHKNMKYYIITSSVSSIISVCIQHPIWLIKTKIECTINLN
FT                   YKFLNYKNRITSKHYNIFVARNKMCTSKIVPQMAKVFLFFGYNLRRKNGTGKKIKSLLN
FT                   DRMLKSYKNNFVCNKNVKRIKKFNHLTYVNDNKAFLHKSVKRKIAHNYLLYKYYTLSIL
FT                   ERKQMTKMFISNHRKKFSRRYLTYLKTSFTGNQILRIFKREESKNAISTIYNYKNYFQF
FT                   VYNVYKKEKLFSFYKGFFTSILLTPHVAIQFYVYEYLTYHFSSEYFTNELIGKDAYISS
FT                   NTLAKALPFLYGVLSKFIAVIFTYPLYTIKVRQQVQMKNYGFLNVVVNIFRLEGIRSFY
FT                   TGLNMHLLRNCLQNGMLFFIFEYLNTGSVGVK"
FT   CDS_pept        complement(join(1238615..1238701,1238899..1241220))
FT                   /locus_tag="PKH_142760"
FT                   /product="cullin-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142760"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142760"
FT                   /db_xref="GOA:A0A384L5A2"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L5A2"
FT                   /protein_id="CAQ42058.1"
FT                   /translation="MDIANVNFESGWKIIKEEAIEKIENYLENEHIEDNKHLFSATEYT
FT                   RLYTVVYNMCARKNPFCYSKEVYRKYGESLSVYTVEKIKPLLRNKEELMKTKILIDAWF
FT                   KYSFYTNWMNKFLRYLDRYYVEYNSSLCLSAYTKNIFKITLFNDLREVIRNIVYQIYDN
FT                   LRKDEKEEDKKLFCDLVHLYKELDEDSNEKMYEHDIEKKILENVENYYKIEGDNWLLNL
FT                   TFDEYIISIESSIQKEFEKNKMLNLIEETCERVTNIVVRILIFEKLEQLLSNKNNIFHM
FT                   LKSNNIRCLRRTYILFSYFPEAIEGLKKIIGDYVKTEGNSLKEKYIQMSRSINSNEKEA
FT                   DYMLCASNVNSNIIHHKDEYALCGYIDELIKLHNHYDNVFKLAFFAISNKSIDHNFKEC
FT                   LKDYFESFVEHEDEYFSTVKLLVLYADNILKKGDEQERLTSQNGKEGESFNDPIDGEEH
FT                   TEDAQRKDTIELKRQMTEIVEIFNYTSNKETFFEYYRIYLANRLINNIYISLNVEKKFI
FT                   ENLYFLCGSQYTSKLVGMIQDMINNNTTNNKFLDFVNSKYAHCKNDLNLKKIENFFSVK
FT                   ILNKGFWPTFEKTPIKLSDSFSKYIELFEEYYKVDNKNKKLEWIYELSEVILTCTFQNC
FT                   VYYLYCNIINAQIILLFNKHKFINYEIIKRELNLDLKTFTNNMYSCLHHFKIICSNDKP
FT                   VDWNSSTFFINTKFSYPNNKVYIKKATTLLSKEHEKIKEDRTMAIEAAIVRVMKAHKKL
FT                   FYDQIFDYVKKSLSSFSPTNQIIEKKIDLLVEREYLQKEENSQVYIYIP"
FT   CDS_pept        join(1243857..1244189,1244474..1245208)
FT                   /locus_tag="PKH_142770"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142770"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KXK7"
FT                   /protein_id="CAQ42059.1"
FT                   /translation="MSDMSTCPLNDFFDIDEENNLDELKKEDTEIYDGSFLSYIYNQFA
FT                   FCCTNFFDELEKKNKKKNITLKKTFLDDYNKNQKDASQFQVFHKILKRSADLAKEVPLD
FT                   SKYFNPHADWFECAHEVDIELTKEEVEFCIFNFFLKMYRSELRDKDLLLSIILECLYSR
FT                   KNFKKEFYSQKAKLKFLKEIKSIEINSFKESLNELINTIENTNFIQINTDQMKNDKFYF
FT                   KLYVTIQIKYTYGVYIFNCDEVYDIVVIDCNTLNNNIPKIMSFCSLRKFISFLNSIYST
FT                   HFTDENVHNSFPIVMYESKECYALSHNHLPLKETVFNNRGRGIFQKRGILNDQGGDEQE
FT                   QDGQQSQGESHDIAT"
FT   CDS_pept        complement(join(1245878..1245993,1246144..1248165,
FT                   1248447..1248573))
FT                   /locus_tag="PKH_142780"
FT                   /product="dihydropteroate synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142780"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142780"
FT                   /db_xref="GOA:A0A384KVV1"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KVV1"
FT                   /protein_id="CAQ42060.1"
FT                   /translation="MEDSNRWNSTPRNIAVLNFGTNDKQNCVTILETALYLTEKYLGKI
FT                   INSSYIYETVPEYIVLDEAKKIGKVREEQAPNKISWIKDLIENVEKSRYEESEDLIYEC
FT                   KELEMFLKNEKINESIIKEVNVKDYENETRKIIKQNDEIMKTNLEKCKDKYYTSYFFNL
FT                   AVVIRTFVEDPLTMLVILKYIEQIMKRRESKKCQGEIFENRIIDIDILFFNNYTIFEKS
FT                   IELKKNDIHNIIKKYIHIDHTSDQNRLEIIQNLSDKIEFLCIPHVYTKYRYSILLCLND
FT                   IIPEYKHNTFDETIRSTYKNYINKFEYKYQINIRENNRKLYVLKDKVSYLKEKTHIVGI
FT                   LNVNYDSFSDGGLFVDPVKAVDRIFEMTNDGATVIDIGGESSAPYVVPNPNVTERDLVI
FT                   PVLKLFKEKWHAFEHEVVNNAEGCAIMDDNKKNAQRDTEGATILQKVRDAKPTISIDTV
FT                   NYDLFKECVEDDLVDILNDISACTHNPDIIKLLKRKNKFYTVVLMHKRGNPHTMDKLTN
FT                   YDNLINDIKKYLEDRLNFLVLNGIPRYRILFDVGLGFAKKHDQSIKLLQNIHVYDEYPL
FT                   FLGYSRKRFIVHCMGKNSASNGGLELTKGKSDVPNGKSELANGKSELANGKSELANGKS
FT                   ELANGKSELANGKSELANGKSELANGKSELANGKSELANGKFELANGHSKLANGNASQL
FT                   WNFKMNHMRQDKDQLLYQKNICGGLAIASYSYYKKVDLIRVHDVLETKAVLDVLASIHE
FT                   S"
FT   CDS_pept        join(1249390..1249475,1249638..1249723,1249875..1249926,
FT                   1250018..1250049,1250190..1250310,1250452..1250506)
FT                   /locus_tag="PKH_142790"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142790"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142790"
FT                   /db_xref="GOA:B3LCA2"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCA2"
FT                   /protein_id="CAQ42061.1"
FT                   /translation="MDYNIFYDWYRTFTSIKTIRKINTFVSHNKEKANVEELKVINENN
FT                   YVSHSIAILTAVGILTTFRTLRRVKFFMFRPLLPDVLGLTTSCTFLYLHAMYLSRNTIS
FT                   KLMQLDLKENDNEGISKNVAEMYKKDKPEDYLFLVRKGS"
FT   CDS_pept        complement(1252326..1255052)
FT                   /locus_tag="PKH_142800"
FT                   /product="rna helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142800"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142800"
FT                   /db_xref="GOA:A0A384LMP1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LMP1"
FT                   /protein_id="CAQ42062.1"
FT                   /translation="MNYGNNNMNAVGFNEGDDDRSTYVRNQYMSNINESASYNNQGKNM
FT                   QMEDNTNPHMFNQMRNKREVSNNVMTAGGNANPGNRTFYEGNVNNDGYMMGEGAVRSSE
FT                   NGITGAGYVNYSDNGNNNNSSSNNNNQNNNNVGGGNQESYKKKFGNNNYHENTNNEKNP
FT                   AGMSPHHQHKKGGVGGGGGNFMDRGNMNKNKIESGMISSNMRTNTANDPSNDNNNNNNN
FT                   QNNNSNYNYEKPRYKPPMLRNQPNTNRSNFGRMNYNRGSGGGGNPAFGRNYNIPKTAWA
FT                   NRDNRRYYPEKEEEVYSNVKNEKGVNFDLYDSIPVEIKGYNSENIIPIDNFDDVGLNLH
FT                   EILLANIKRVNYDKTTPIQKYSLSIIMNKNDLIGVAQTGSGKTAGYLLPIINHMLLNDP
FT                   PKHTFYEENQRSSSYYYNRVCLPVCLILAPTRELAVQIFYDSKKFCFETGIKPVVLYGG
FT                   SNIKMQLSNLDKGADIIVATPGRLNDILEKGKIKLFLTSFLVLDEADRMLDMGFSPQIR
FT                   SIMYDYDMPGNDNESRMNPNKMEYKRYTNEIVKRQTIMFSATFRKEIQVLAKEYLYNYT
FT                   FLLIGKVGSTNEYIKQNLIYIEEENKCNYLLKLLSENNNGLTIIFVETKRKADILERFL
FT                   NNQKLNAVCIHGDKSQDERERALKLFKRGIKNMLVATDVAARGLDISNIKHVINFDLPS
FT                   NIDDYIHRIGRTGRAGNIGIATSFVNDDNRNIFKDLLATLEECNQAIPPWFLNLVMRYT
FT                   ASAKSNRTFRYNKPMKGGRGNFSRFNNNSNFGFGHSNNGMNSNHGGSGNNPFNNNSYNQ
FT                   HSPFSNNNPYNNNNQHAIGNNGGFSSSPFNNNNTGMYGNSGFNNNGGGSPYGNNSGGMN
FT                   PFNNNGKFNNNYGHKKFDDERFQRSNFQGADDNVDGW"
FT   gap             1257081..1260080
FT                   /estimated_length=3000
FT   CDS_pept        join(1262630..1262666,1262975..1263101,1263306..1263453,
FT                   1263681..1263744,1263953..1264060,1264237..1264369,
FT                   1264494..1264644,1264843..1264944,1265223..1265264)
FT                   /locus_tag="PKH_142810"
FT                   /product="Protein phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142810"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142810"
FT                   /db_xref="GOA:A0A384L6C4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L6C4"
FT                   /protein_id="CAQ42063.1"
FT                   /translation="MPVVGGAHVIPMKNYTIVSDGYGEKGVKKTYEDEFFICENLKTFN
FT                   KSLHPNFNFSCFCLIDGHNGKNTATFLKKNLAQELSNSFVANQETYDETLPIPDHFIRI
FT                   GVNNACRKIDEQLSVQFPGCRDGATCVIILIKDDYAYIINIGDSSAYLCRFLNNTNQAI
FT                   DLVDIHKPWVLSEKERIIKHGGRIENGRVNDIIDVTRSFGDLMLKKYGLLCTGTFKKFK
FT                   ITSEDNFIIMGTDGFFSFVDVNHITNEIVALSRKEERMVNVEKKKTVFDAQNVCRIMVE
FT                   HALVDKKSQDNVTVILIKFLHK"
FT   CDS_pept        complement(1265709..1267679)
FT                   /locus_tag="PKH_142820"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142820"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142820"
FT                   /db_xref="GOA:A0A384LE39"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LE39"
FT                   /protein_id="CAQ42064.1"
FT                   /translation="MKTQKGLFRRYAKQVIQKFIKYTKNYLKDITDEINVKSFKKYKYN
FT                   FFFEFIGSFIFVFFISVYMLNSNQNEEYVIKHTKQINPYDSNDIFIPGDNLFDNEINNV
FT                   HYGNDLNGPTSVASILLEQKNKEDDATFKTKEEHSKVYPMVSKAEGNNGTNRLIGSENI
FT                   EHVSEETKGSLVKKHEMGKRTSQEYSTNGRQTTVNGVSGNNDLLKSVEKDETKKTDSPN
FT                   GYVEKSGNKDDILRQSAGPSEGGIEKGTTGDVQGESNENIDNNQREEKTQEERSAKELS
FT                   KEGLTKNVGTVIFKDHVNEFSKIKLNDINNIDLGDIDKYQVMKNSGNKQNSNHAVYSFF
FT                   GCLIYVLFVILGAHINPAYTYALWLVEPKKYGFVITTCYVTFQYFGGILASILCAHMYG
FT                   SIFIYALLPKKEIMKTFFCEFISTFLLTLLLLSLYNYKKKFMEENKNENSLIFNTAKGI
FT                   NMTSLYTFSNYEDIYGSDVFNSSNWGGRNERFLLHVDNKYIKYIMNHIFYLLFIFFSLL
FT                   FFVFVTNTTLNPMFSTSTLYTYLYFKFFQANGSFHISSVVLSFLSVSKIFQMVKLYITS
FT                   LPLWIGPYVGSAFATAFMKLFKEGEEEIVNVIDTNVYSTNRRNETMPLIGKHNVKRNAY
FT                   LVEYDDNIHHNSSNYLIPNVF"
FT   CDS_pept        join(1272249..1272315,1273656..1274952,1275278..1275452,
FT                   1275621..1275758)
FT                   /locus_tag="PKH_142830"
FT                   /product="protein phosphatase 2C, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142830"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142830"
FT                   /db_xref="GOA:A0A384KSJ1"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KSJ1"
FT                   /protein_id="CAQ42065.1"
FT                   /translation="MGTCTSSLIKKFRKTHPPSSRTFKGKKNTRRRLSISTKGELPNDT
FT                   DEIKRSIQELKDNEDRFKESSENDSHTKVEITPVKEEEEKKCGEKKNKIKNRSSVAGVR
FT                   ASHFQEDFEKKCVKIKGEVDKLNENGIGYVCRKGLKPESPNQDDFTIITTENLALYAIF
FT                   DGHGPYGHDVSNYVQKELPYMIIKNENFLKNPKEVFTKAFLNIHANIEKTTNEYLEDFA
FT                   NKYKGNNKGGNSRRLHMDKQSSSSVVSTHFDLNIPHLDDEEEDDDDDHDSDDDNNFSED
FT                   SGTGNTDGYAHTDSDSDSDSDHHHGESDDNENQKKSKAKMKKSESNKHANEKNTTKSEK
FT                   GQALNKKKKKKKKKKEAYFDSTMSGTTATIIVHLFQEKKLYVAYVGDSRAVLGRRKKGF
FT                   PDVLEAFDLTKDHKPNSAAEKKRIINSGGQVLKLEGDIPYRVFLKNKFYPGLAMSRAIG
FT                   DTIGHQIGIISEPDFMEIKINEDEDILVLICSDGVWEFISSEEAINLIYEFGYDNVQDA
FT                   VENLAKESWDRWLNEEENIVDDITIQAIYLSEKCKKIKNEK"
FT   CDS_pept        complement(1276946..1279783)
FT                   /locus_tag="PKH_142840"
FT                   /product="abc transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142840"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142840"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L8H2"
FT                   /protein_id="CAQ42066.1"
FT                   /translation="MKSSLKWERRFFAPWVCRRCYMSNNEISKFKIRKSNREHGPEELK
FT                   EPSKMRKAVGGKQMCSDLTTPFEIYKWSHILNTKNESLIDDVIRQVEGKKKKNRTEKNS
FT                   PHRNTMISTRKDATPNIQYSDSIGSSLDLHRAAHRYHIVINDKENDIYVEKEISTFFSN
FT                   MINNLEDRLHNNPSAMKLLEMAKENESHIFYYLYNNFKIVRVLPYKCFWHYEYPEDIFP
FT                   ADLRQNEEGHDNEYLFKNIDLNKLDLLLRGEEDMLCGTEKNRSRKMAKAYDQGKLNDDE
FT                   RENVNLNEEQVGVNHKFKFCSREEGVLPKSETNHGVGTNYTSFGQMKEEKSNGRKAVTK
FT                   EVHTQSDYHFLTTPFENKPPHNSPWMDTKRFFSTIGTSNNANTSHRVKSQIFHNAKKFE
FT                   DIDIANQGDNIKRDNWGCTVKSDLLKGGADNINTCTGAEEKKNTHVDIEEEEGNSAENL
FT                   SHGKMVDEHDFNYDINVLNNKIICTDKSERTNFRISKVPVSPLSRATVFGKVLLDIAKN
FT                   SSVEYLKSRLARGFGGGDAADSGMHNTIVSEKNAEILANGLSKMRGVVLKLGQMISLQD
FT                   EHLSPILGKALKMVCNSADVMPTIQLKSVLKNEFGKDYEKKFDSFDYIPFASASIGQVH
FT                   KAIINNKKVAVKIQYPGVYESIDSDIKNVLLINQYTNLILKNLYIENVCREIKKELKCE
FT                   CDYINEAKYYVLFKNIFKNSKYFYVPSVYTEYVTKHVLVTSYVEGISLDEVAEKFPQAI
FT                   RDSIGQRILYLCLHELFVFKIMNTDPNLGNFLYDQERDKLCLIDFGATRSYKNEFVDNY
FT                   LRLVKASVEEDEAKIYHYSYELNFFVGKEIEEMKNSHIKSVILVGEPFKYPEYDFANND
FT                   IAKQIYKLLPKIIYNRLVPPRSEIYTLHRKLSGSFLICMKLKAKVKAAHIFNSIYDNYK
FT                   FTTEDTYLRDRLRTY"
FT   CDS_pept        join(1280909..1281089,1281304..1281494)
FT                   /locus_tag="PKH_142850"
FT                   /product="Plastid 50S ribosomal protein L33, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142850"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142850"
FT                   /db_xref="GOA:B3LCA8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCA8"
FT                   /protein_id="CAQ42067.1"
FT                   /translation="MKKCDIFFLYLIFFVLITIKCCQPFIIPNNTKMVNGPLLKNCCRS
FT                   KRIGNKKKTRNGLKRLTIFGKKKKNRKVVVIECTEARKYGKQPSRYVTEKNKVNTPKKL
FT                   QLYKYNKYLKRRTLHVEIK"
FT   CDS_pept        1283286..1283564
FT                   /locus_tag="PKH_142860"
FT                   /product="Acyl CoA binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142860"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142860"
FT                   /db_xref="GOA:A0A384KLK5"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KLK5"
FT                   /protein_id="CAQ42068.1"
FT                   /translation="MSMADLFEKCVSFINALPKTEMISLEDKLLLYKYFKQGTIGNCNI
FT                   GAPSIFRLQERKKYEAWKSIENLSKEEAKKKYVETVQGLYPEWEKEI"
FT   CDS_pept        join(1287985..1291102,1291871..1291949,1292155..1292230,
FT                   1293640..1294011)
FT                   /locus_tag="PKH_142870"
FT                   /product="JmjC domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142870"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142870"
FT                   /db_xref="GOA:A0A384L7P4"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR004198"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L7P4"
FT                   /protein_id="CAQ42069.1"
FT                   /translation="MDLYDKNTKKRKRNFELIISPGNEEDDVDLTEKDKKNKLIISDVD
FT                   CKSVPCQQKDSQIKKESDEKNRFALKGQKADEEDDQVKEIINLDGDYDNYKLEAKKKKQ
FT                   MGKNERAPNFPFTTAEIKLEHAQELIKKCYDACNSNNMPRKNKMMILQSGKLTKVENKC
FT                   NRLMKGKKKKKKKSADHLSNNSIYKNIEEIPVIQTTMEELSNPILFFEKYNSIGLKYGA
FT                   MKVKPPNFFEPQFNSYYLNMKFNIRKQKINELKHGKEFEHPEEYWSLYDVYKYNKMLEK
FT                   RYLPEEKASLEYIEKKYWEIINKGNEEVISIYGADLPVSRDHPTCLFHRNLKRHKDSGR
FT                   NGHGSDISAANGTRCSSTKSGTTESSCESSIDYLKRGEEGNDVLFYKGECKYAMCKNPK
FT                   SANVSSSVHKLNNDMSLSHPLGNRGKKSTSNCFNSHSSNGDSANDQCNSECANADYNND
FT                   SANKEEIVSGHKEDIIDVINISDPENVMKDENYVDNREHGIKNSEDDILFGSDRKKDHC
FT                   DHLRHSINGVAIDRTPPICASGINKIASTEGGVHQGTSGKNDWSEGTSYAGAKNCHNCS
FT                   ETYARDVKRDEVFMKQREKYYSEINNVIKNINENMNIKSLPFIKGSMLRNVDVSIEGVN
FT                   IPWLYVGTLFSSFCWHTEDNYFASINYQHWGEPKIWYVIPPLYSDKVEDVIYEYLKGSS
FT                   NQDDVLMEGAKGKMKKKKRRNLFNNSNLKKKLKEESSIVQIIRSEQRLKNLRISKNNPK
FT                   LTSTNRITAGSTSTSNAVMASTSATSTTMARNSHSSSSSTSSSTTTSASHKRMEDNLLL
FT                   IDVDINNAHLIYRKSYLNYKIVDRNEINFKKGNHKNKIYKLTIQVPIEVFLKNNIPVYK
FT                   NIQRKNEFIFLWPKTFHGGFNSGYNCNEACNIAPTFWLFYGLQSYYNYKYFRNTCISIH
FT                   LILFSNLLHYQEYTFSQLKHIIYSLRYILTDEYKFFKESKTLFIEFTLNRDALLNNKLI
FT                   NYSKHLGLDLNKMYANFECHKNKPFFFQNIKSKLEFFYKDCDACNAPTFNSSIICPHSN
FT                   DILCIHCSEEHSCKCKLKVALKRYTLLEMMKILTLLVHYANKIKAHGEKDVQIDDIPDY
FT                   NSLKIFEDKNSIKIYNLIRETRRIDLERRSKTTNYRDLENYCLEKLNNNSKEKNKREKA
FT                   KNEKNIVLDDYYTSSNHFKTKLTLKYFLLTYEEEMEDNPLKILPKLLV"
FT   CDS_pept        join(1295631..1298419,1298923..1299186,1299415..1299541)
FT                   /locus_tag="PKH_142880"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142880"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142880"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCB1"
FT                   /protein_id="CAQ42070.1"
FT                   /translation="MNREKKTEANTSLNKKNSEVQFFTPKSNLANECVSRNVAFHNLHK
FT                   YVNRNVIEDQLKKRKGTSKSSAPAVKRKNIPSKGKHRECSILNYITGFKNTNNIFLKNA
FT                   NTDGEKRKGSIPPEDGTLKKIKEKISDVKKNKSSKKRIFSESSTNILRYFKNVNVNNKE
FT                   ITKLTTQCDTDKNAQNSLGDKTVTDAKSKFYAQGNSEKHADVHKNIYYGENNVHSEEWE
FT                   NRKRVRSVNYENKISDEGKMQYEYVKNNANVECNYEEDLQIAYLYCRKYFLYRKMEFLS
FT                   KHLFYRKKSIKNFVFLIEALFLRKKYIDLLDMLKRYRRLWIFSYKGVKTKGTAEKKKNA
FT                   RNKIQMKDISTKGNNCKCGKKYTKLICHKYRKSTISKVSVRKVPTPPTGEISNVEHSNL
FT                   CNIEHSQVHKFKRKKKAHTNKMYTMEMLCKHKNNYEVNNTTGNIRNGGKEYKRKNCNKI
FT                   YCICYVAFVKIMSLIKMQNQNCLNKCVNFIKKISKKCLLNKNGHYLTHGVIHVYELAGL
FT                   YNYSLKYSILLFLKFPVYPQIILKLFSFSILSLKDGIYLILLAKYCKCISWMKYFLLFI
FT                   LYSVNYQFRNKKTVSNFLFLLGRVTKGKKKIARRWKANNVAIKSVHNEMGEKIKNKKCM
FT                   PSRKNSMEGIGQLTYDSERNDRDKCTEWIEYGESEKRKYVNISQYLEKHSIKKNMHKHN
FT                   RNNNAHICTKITLYNSLYSKVTLYDTYVYIAKNKFSDYFPKFFLYSKLHIIINIKRSFH
FT                   EQNFPMCYSLCKILLMDHMYDPSVVAFFVNSAYLLKKVSAIKRLAQELKTRNRRIYFLF
FT                   CNAALLLHFKQIERAIQIYKYIVDSYQNIFSDLYFYSLFNLIYALQLTQKAHQIVIFCK
FT                   NLNKLFFNNIHSYILLSYYYLVNDIPTKCYASLRKAHHIYRYHPDTFYLLSMLALQAKR
FT                   YEEYCAFSELALFFSLRNRNLRNYVFSNIYEKQHEHVPSYLLSYHLEIIDSSKSTTLRI
FT                   INLISLLNYVYFEGLMKSYIILHFCSAKRSDVNYLMLSKNLGIMAAQFFPNNLSLLYSK
FT                   GKKVNSEKWKR"
FT   CDS_pept        join(1300879..1302015,1302289..1302397,1302541..1302638,
FT                   1302797..1302869,1303042..1303220)
FT                   /locus_tag="PKH_142890"
FT                   /product="ruvb-like dna helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142890"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142890"
FT                   /db_xref="GOA:A0A384L770"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L770"
FT                   /protein_id="CAQ42071.1"
FT                   /translation="MNIIESNREKERISLHSHISGLGLDADGFVQDLILEQKKGKSGKM
FT                   GVNGMMNGQPKGSVIKHANPDEALCNEFTGNAMEEEQGMKATSELNGYSHTNGECAHPQ
FT                   EESDDEVYRNFYNCKGMIGQKKAREAAGIFINLIKEKNICKCLLLAGPSGSGKTAIAIA
FT                   ISKEISEDSIPFCIFNASQVYSCEVKKTEILTQYIRKSIGVKIKEIKEVFEGEVIKIEP
FT                   FYDDTYEEKKISYVHITLKTLKEQKKIKIHSSIYENIVKEKIQEKDIIYIESHSGLVKR
FT                   VGKCSLYQDMFDIETDTFVDLPKGNVHKKKNIIQNVTLYDLDISNVQPKDNILNFLQNS
FT                   KSKKTEITDKLRNEINKIVYKYVDQGIAQIIPGVLFIDEVHMLDIECFTYLNRTLESNL
FT                   APIVILATNRGICNIKGTNIISAHGIPVDLLDRIIIVKTMLYNKEEILQVLKLRCKFEK
FT                   IKIENEALNYLADIGIQCSLRYAIQLLTPAKILSKRKGKKRINKSIIEIVSSIFFDTKR
FT                   STQLLLDDKNKYLY"
FT   CDS_pept        1305445..1321122
FT                   /locus_tag="PKH_142900"
FT                   /product="C50 peptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142900"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142900"
FT                   /db_xref="GOA:A0A384KMJ9"
FT                   /db_xref="InterPro:IPR005314"
FT                   /db_xref="InterPro:IPR030397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KMJ9"
FT                   /protein_id="CAQ42072.1"
FT                   /translation="MIRKESNIYEKLDRIVCDVLRNIDEETKGVGEEAHDKGGTNYADE
FT                   KSTNERVYKKFFELFNRESYIEKLTHDELVATYRDKNAHKYLFYMFEYLHNKITQTRNV
FT                   RHVDFLFLILRYITYLWFLLSNDDKLVLIFYYYFKLVDLLFNLKFVRCSFFVNIYNLLI
FT                   YFYMKDKRKKKKIIFPVKKLREKEAGFHIKNVISELNKIIANENAHFMETVGKRNNFVN
FT                   LHSHSLSCGNAERKEFPSNTEEDAFTCAGIQNVYDYLWVGYHQGENDPHETKHKNKHTE
FT                   KIESDSTEEDKSFVLITKCQNWNNENPIFPIFSIFSVTSSYNFFLNITKHLFKISVYDF
FT                   STFFPLLSMLNVEFLLSHFHLFEILHYVQMEEMNSDIGDSKKETKIVSISSSQFTPYKS
FT                   NEQVTTEGKEKTLSKNQGIFSNNNKSNKKILWNILFEELKKVYIVDTKNVNYTLKMLKY
FT                   SFSFFLFEEKIVLKNNEWGIRVIKKGEHTFAQISQVYLKELLKFSLSFVNNLMSSITLN
FT                   EEVVFKAISYVFYLLSKLICNTINNLRKYILLNNDNNLALVALITYIYKYFKRVYLEKN
FT                   AAGDVHKGNAGAVGCIEDQNKLKYTFVTLEKVYQKIQECLYVVLTVDESVESNIKKKLV
FT                   QCSDGGMPYSDGPQGSRQNADNCDLYFYIIIKINKMNMFYSNLEIIKILSQKDKNVFRK
FT                   YIYTINKNNENFCSFFSCLLNIDYKENQHELLLKKYMSNLKEKKNYKNKKLIKLMKPYH
FT                   SPLKYIILKNEIDQDGAKKSSARKSTLGVNFPHRDYDIHTFEGDKRKVIDLRVRRKSMY
FT                   DFGRGEKGGNPSSSLQRDHVMNGHTVDGDTVDDITTDETSSHETLSDENTTDGEEDKPS
FT                   NNPANCPDRGCKDYFSEGLKRARASSSHAKVKKKEMPIFENSILRIRKKQLDKTNIDFK
FT                   NVCHSMTMAIKRCILISDSMITYFKTYHGFEANFNIYICKNIYINFLRVCLLCASLFSY
FT                   LCVKLNYDEILKQMYDSNLIIMSYNIFDKYISFVLDQDVKRLRKYKNVLQVPTRQLNRG
FT                   KTGAGRSSEATSSVNASTAVKEQKESFSTVTAYTQLHRDEIYDVLGARGNQGGRGFFLS
FT                   DQDEFIETIYLNTFMIVINVISVWELYLEIPVEVLNKMKYTFFELFYNTTIKIIKFIKK
FT                   DKGFFFLLNILKFIYLKFVSLPFNPINIHTSIKLHDFYDFLINDGEEDVKKEEEQKFNS
FT                   EDMYMNSISPLKFLINPDNEAQRNNLINSVQKLNIHPDDHVLSNEHDYNTFSVNKKKRV
FT                   SMGGLVPVFLNNNRRKRRRTSVGPYTSYDSLENNDNGSYCTVRNGVSTEHARMDDQTST
FT                   RVKYDLGGGEYESENIHVKDSNINDSINVTPKRNYDYAQPEERKESENFRNTYLSNYYI
FT                   PHIDLLFIIVDLEVFHYFEKKEYKKIIFSVENTFKSIISKCDYNTKEYLRSSISYIYNF
FT                   YQQVHLSDSKINIQSCTVIRHIFNLYIKSKVFYLSKKIKKKLAHYRSSYSNDGELKMGY
FT                   NKIYDSLFSSEKWKNFFYIFYESDNLRQNKRMEIINNLLIVHINTLLFLIFYEYLSKYV
FT                   TKKFIFFFRFFLFFFNKLCVAILSLVNSSNHLEIFNLFDWQNIARENYAQDEEQLANKI
FT                   RNAIRLVQNCSVYPQDEEIFPQKIYSKRGRHTNVNGRSNPIVMVDIDELLVTYIQLNFT
FT                   FCRSCCFFIFFKNVCSQKYENILKENFTSTYFERFKNNRDLFDPIDAVKDEKTSRNDNN
FT                   WGVSHTAEEFAPNEEPNVNDSFDDESDDNCRSDSSSSGLSQSSFTLIEYTDYSKNEDYI
FT                   FLEFILEKIEEMDVDYYYSNVLNNCYYVIKIETLYNYIYKNEQLLRRFSFLNNVYYLYK
FT                   LYYHMFVWSSNKSHVMDKKDVATEGINGEKKLSKLYNDIFYLFDVNRILGETFCSKYVH
FT                   LIDQAGVSDFTPSGGTPDKIAKMSPPHGYANDYGATERRSVEESPYFLCDIYNFKLKLF
FT                   HPLNFEKRHLAKGKKKNTFDNFLMVNKNYLLDLKHKYGKIKKYINNYMVYLYHIILHFY
FT                   YNEYGIDREKLSFHYIVYSFQSAFDTLNSNILCSRHDTVCSSSVQGVGNEKGTPPYVPP
FT                   FNIISKCELKKNILLIFDILNNIYDVYHGNIFENSKWADSIVTQIDTKLIGYLSEIYKI
FT                   AYLYKMYHCCMCILVLCLLFTSKFWLIYVFNEKHPCGQQVGSCHTVGGHSEYYQPATRG
FT                   KRKVGSKPKEKSVDKGTLLQNGANLGRGASRRGKPKEGSYESNEEMTGSPKGRRAYILT
FT                   GIYDKILSKRNEVNTKEIYNDLHNYMQMLIVCTSIFYLSFLCIEKIQKNLQNIYLLNCA
FT                   NSLYNCYVQFYEYIEKFCKEHCEDKLYASSLFFDTFHLDLINLKLQAHVKAGRYKAEMR
FT                   KMKKILCESSSRVSADSEGGVTTMPRSEHSRERNRSTWDKAQVDLFSNFPYLLYYNENA
FT                   SMECISDLRRTEKKYQNDGKNFFKNNICLYFNMVRYLYKKRSKYTGLLPFVNSYIISIV
FT                   TLMKFTIGKYFSSFNVSFDFFSLKFEYPIKQFDMDMLTKVKKTDDEKENIKLTNKAILM
FT                   NLENLYCNMFLNKDMCYQIKFVYTYYKKISSIMYKMNNFVLSYYYLKRNILFVCDLIYL
FT                   PDVVHNYLLLMNIILKSGRERIELLTQEEIFFENLNNQLSIYYKKNLDQDTDTETDANY
FT                   AKDKTVKDVNDFKIYEDSDFCNIDYVKTPLNTYLTKRHIYEYRNMLNQFLAYLTFLMKN
FT                   PDHSLILSTKRRREILHMLCLILFTKRRMNYFCCSKARPKKSKDVATNGKGTSCNHDNA
FT                   KLSGKKCTNEKNENRSDQDRVMSQNVTKENPDNHKIKHFEKNFLICFNNCNEKKEETFF
FT                   NFFLEKLFIISNIDTDVFDVELEDEEQVESLIKSQVLRDVSNLNFVHPGVVHSNDSFLN
FT                   VGNEISSEQENAAQNIERKTNQTNCIEEEIHLECHRSANSYYSFKINDISVLNYLYLNY
FT                   NFEQNLTYTENYITNRFFIFNCRKMNIYFVKILLYYINLIFLKIKNIFCDDCVYTIKKQ
FT                   QFLNSSANDCSRNIFFFLFINLFRFFNFSNRTLSELCANYFPGNKNYASCLDELYRSKK
FT                   YGDLLMEVYANDGKRIIEDTKTHNEEDKENNSDYNLANGLDKMLMINFFEIFLYPHKNC
FT                   SLLEVLTVCYEFLINMKDDKWRKLRKRNKHKMYALLKTAVTEWQDRNNPSVFYFQIILV
FT                   LLSLLLHYTCKGALVHEMRKVAQFFLDFVFFFIENIKNNLIILQIIEAYGEGHTDGCAD
FT                   NQTNDHTDGPVDGHTDRHTDRHTLGYPCARRTQVNLLKFYFRKLLSLLYLYTDELILYT
FT                   IKNNIDQEISQKNYYRKHAHENLNIETICNYEYICQSNLSELCFYWDYAIVSMSHDKSD
FT                   LYISRCFKNFLFVLIRIIREETHNAGQFSGENEAATKGRRNYGDKNDKRRDSHIEEDKE
FT                   CFNFYSKINNLFSILNDEDLCERLFIQWGKVSLSDSTIMGCLNKNANISTDDAHEVYAV
FT                   KKGNLNHHSDGYNGAPPSNIIKSENGHSRGETIIRENATHGKGKHSKVRNPTGKHFEND
FT                   KMGFEQLHNPPTVNIFFTSMGKGGMEITNELGESNKITRDKSSYSSAPYLSNEKDQVTK
FT                   DIQLVKFFSRLYKNADRCIENKTSEYFHVEKIHLNIERFPIREKWNYIKKLEKILKQYQ
FT                   HMIKIMCEILHESKNVDRNKSNLKMFIDLWWNNRYTLEQHLKILNLDISNTLGFSIHKL
FT                   MSIPLISLNIRTNIVLNNSANWRDDDQKEVCTRTDKDSTQVNSAYNTLSIVNNQKYYLS
FT                   TNFDLFLVLYYYSHMLNIIAWINKWGRYFVPSRYWDTVHFVNVLLNLTVFSIVLKNCNV
FT                   QITHAKRKYLRWGGILDGHPSRMDKGESTLIGSNMPGDTANGVDSFSSRSVTKGRNDNR
FT                   RASKSLIPFDKNVVTSYLPFINKDIETILFLEERKKKNKRTSTEVGQPYLLDINPPNEG
FT                   KKRTIVSSTHRWSVNLQEGINQNDDCHSTYKSMHREGVEHVESISTVDNKYRIVIPKRE
FT                   SESAYPHNSHHHNNHNSHSHEKKGRRRTINVISEQTSNRVDSYCVDRCSIYKSEKQSRD
FT                   EKKVNSTIYGYVSPLKTNIFEHIKNEDQSEILTKEGKRKRTTVAGTLNLDYVKKQENKD
FT                   EKNKENIYLKYLDLKKKCDRGVLKCSFLKLRMYLYNILIDIFENNNIHPKNIFNLFNII
FT                   THSFIMDVIKCTMVDDELDHERLTYVKNVEHRRIRKTPVVVYIHNNLNRLPFENLEPLK
FT                   DSYIVRGVHKAVTAYLYGRVMAKIKVEESKVKRLSLSSTPQAEMDAAAAEEEEEGEMEV
FT                   GKGTRQNDDESNNSDHQSDDSHMDEYIKQEYSKKWKIDNAKNVYQMNSSTHLTSVDLRC
FT                   SHPTEWKRKNSDMPKSIIEHCNTTQLYNKNEENKNVSKKKGRNSLSYILTHHIEVSKNY
FT                   EKNNDKYQHEFNTYQVKASNRHDDQGKVSSQENRQNALKSQRRNTLTPYGHETLNITGH
FT                   LDDNYDTRIVQAKGKGRYSLVVSSEEAKDHLKKEHIHDKDNPGEGAQDTDTKEVRGKRQ
FT                   GKKSSRKSICIEHSFLNPFNNNNTKKGQVGMSFSGDHFNGKDSCRKKKGEKKLSNRSPE
FT                   EKHQLRLSHSAKRRGSIKRINPNSSCPSYHSRSSCASSHPLSSESESESASSVELIQNE
FT                   EELRKIFMSARKSMNMHNMMGSYKNEEYSFFRFKKKRKKSVSESEAYFDEEKKFSSSCV
FT                   DDAKRDNKRRSYSADPDHHSKASKMKYVKYVPYYIKSSRLVDPKRSNIFFVINPNGDLK
FT                   RTEDATYPFIYFKNKDKYKYKNWNGYFGKVPCEKTLLKHLCCDDLYVYCGHQGGEQYIK
FT                   KDIIQNAILRYEDPLGEGEKVEEAKEGNPKKEQNRHGRIAKSNTRKTENKDPLFTQNKD
FT                   KKRRNSCNWKAEKRILDKGMKRKSVGDIFNIHSTSESSDALCTQTEMEDNESNRVGDPY
FT                   FSTNPNDGINSCVFLIGCSSGLLSSHGFDLDVWGTPYDYIVGGCVFVFGNLWNVTDGEV
FT                   DGFTQNFFWKWTQPNSSSLFCSNYNYNSVQMEKVSTFCFRFFAKILRGVSEIHMREEDA
FT                   EWDRNCWKDDDNDHKGSSDDLLIEVGDNFVTINFHTYTYLKKNYFFYKYFQKCYNCNIV
FT                   LNQNLFSINQNRKYSWLSMTEALAEAKQFCRLPNTTGSAVVIYGLPL"
FT   CDS_pept        1322353..1322667
FT                   /locus_tag="PKH_142910"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142910"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142910"
FT                   /db_xref="GOA:A0A384LPA2"
FT                   /db_xref="InterPro:IPR015418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPA2"
FT                   /protein_id="CAQ42073.1"
FT                   /translation="MKHKVKRDIIKCKKKLENSIKALEEKILRLEIEYHQNCNVNGGNI
FT                   MKGWDNYIKRASLEPLCFKTFRDDYNDAYIERMLSLTSCTSPAAAFFQTENTENVKYKH
FT                   "
FT   CDS_pept        complement(1323491..1326169)
FT                   /locus_tag="PKH_142920"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142920"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LLQ9"
FT                   /protein_id="CAQ42074.1"
FT                   /translation="MLLKNTLLLKRFLQCVHFNVTFPFKHGKGNSRISKRHYSIDGVSE
FT                   KKGAHGGAPSFRGEIGGGKGRDDAGTLNTLQYHQHVEYRSGASGRTFDQTFDRTFDRTF
FT                   DDTFEDGYSCIYEGEAGGDAENLGTDEPYVNLNQVNREDDGDEFPPGEDESLRGEEDGE
FT                   EFEDDIDTLLFTNNLNSSLIGNLWHASANSVYRESWKNAHVNKEGSPIIEGPLHSYPNE
FT                   RENQNCVNEKAIPLEGKKYDMSYTNAQDATEGKEKKISNAHEHSEEEVKNGKINDAHME
FT                   GINLSEVIKANGKIAEWSGKNKVDSFINEIYKEEQKEVEKMKEFFEKNEKNLMKFRNSI
FT                   LCKLKISQELPKKFKHLSKDTNIFNNENAKEKYYKKLIDSLNKQSTQEPPRRKHKFARN
FT                   VNYDQMETIKILDIDSVPLDVLNNLFAYKIVKNCSAELCLKIISRIGMYRDKYSQVSYE
FT                   NMINYLGQTINHNSNAEIIALFSRCYETVSIPFLVNFVRKYATFSRSFIVNMYDKYFRK
FT                   RLFDFVRYENNFGIRKLPNILTHPYHLSSYIKLLGECSAKKDMYIQLKMRGHVPHWANL
FT                   NQQGTGSEMDCLPGGMNSLPGGMNYLPGGMNYLPGEENHPKAKKITITDDKKKFVKKKN
FT                   YVERPKMYDVILSAEYTGLPIEHFIEKEENFLHVDTGKEKQLQQNSPNLLSHPGEASLN
FT                   GRLLKEGGNENDIDNLSIYTEDPTNGAKAEVISAIKSIGQHEGNPTHHIKCETQTEERP
FT                   SENINFTMEEECDVYVYKGFSKLNESSLKLQTMLVKTEDECSNELALCPSQGEHYEEVD
FT                   KEQNDQALWELPWKTRRKNSFFFKGRFFKVLPNEGWSEIKDISNQYIRPKRKRTKHSIR
FT                   RRRFLQKKIKINLFKKKILQK"
FT   CDS_pept        1330687..1334358
FT                   /locus_tag="PKH_142930"
FT                   /product="asparagine-rich antigen, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142930"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142930"
FT                   /db_xref="GOA:A0A384KEE8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KEE8"
FT                   /protein_id="CAQ42075.1"
FT                   /translation="MDSYNANEEKNLNFITHKNSYDENMNSRSRKSSFIEFQYDRVVNN
FT                   VLGLFKKQNKQRFLSTSSALRNDMHEQILCSRLFLDLCEDREILLHKILKKINILNLIY
FT                   FRFLKESDIDDVFDLHNELFPVKYQSDFYFSICNFADDKVIDDEVTRIVEKISRSLRSN
FT                   AGAKRHSGNANQSSGALPEEKNEEAVKVRGVSPSSDDDHKVKRKQVGEKVDTDKNSNCK
FT                   DEDIDNISNKKIVNSEDYNSSNRSVDTNNDEKRRINKKWKEEEIFSIGAFLPFSFIDYI
FT                   NSDHITKLLKSKSIEKVSEKEILLDYIKFIDDANRLRSGAGDENSAHISQSVDNAQSVD
FT                   TTHSDDPFQSDGHSHVQYARGSASESRTNNRRRSSSNLDTKSSNSTNPSAKCLPTICFS
FT                   QSTQNDSPWRKTEQKIYSHNKHKDSKHVASKNAKNVTPHNLATHENGQNICRYNGTHLE
FT                   EYIKKNEILKEEDCRVEHKKDNHSNDKVDDKNTDRSNILKKEEYIKKYPPSADETEKDT
FT                   NCNEAHNRNNSNIWVSSLQKDKGVESGEKGKKHGNSQLNSYLDNLQNNMYDDNNTNIQN
FT                   IYKQLKEKNIEYEERRNPFFGTENVISRLRDKICLSKETLNLYNRNKKRVKSNYLIGCV
FT                   SNLINYQDARNEKDFINIYNHFKKKSNNSKKGKNYLKYVYDSSLNFLENYIPLDKNGNF
FT                   SGREKTASIFPSNNLKKTDQSEQPKGNTLHTNGRNDKMKTESSYMLNENDEEVPKCSSH
FT                   MLDQEKKKLIHLHNVLNDLSVLRTQYVNKDTKFEKKLYEEIYMNENIKTISKKYIKKKI
FT                   NSIYILTVGISEYFRGLNLASYLIEYTVFYFYFIIYRIFLYKSKFYCYIDNDMFYSISS
FT                   SHLGDQQQNDFFDEGLLTDNSSDDFYSIVSDEKSFSDREYKMKGINGKEDMFLGETRNC
FT                   LDEERKQSDGVLSGPTRIFHEQLEEQKNENIWANLNDSLRKENFVNDKMDDENNEMVSN
FT                   LKNKSTPFGNYPIQFNACQTDEHGNTRRESNEMGERDPFNFKTYKINNLNSHAHHGNKR
FT                   KNKWSTEKSKNYSISNGVLRECYKQIILNDYLHHLYVIIQNKNAEMLPEKETQKGEAQK
FT                   TDPFPAFLKFPLFKNPLYSSGLNNKMLDFFLNNFCAFNLKDRPFFHLKNANARKPCLDY
FT                   NDDDVSLPLYIYLHVIDYNKAAINLYNKLNFDYICTYDNFYDINKMTFSSFLYSYFF"
FT   CDS_pept        complement(1335317..1337632)
FT                   /locus_tag="PKH_142940"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142940"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142940"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KYH3"
FT                   /protein_id="CAQ42076.1"
FT                   /translation="MLCAPLTHVRRILGEGITTVGDEMFVLKIGFLKLEKRRSIRKGIF
FT                   FFNSANQSNAKFPNKSGDTNEKCGNEFHFQGNFSPNFENLNLQNLNNRQVLYYLGYCSK
FT                   NKLLKLHLLNSTMKDLHSLVLNSVNCISTDFQQNKKNILNPECYQEGVKNIPKKPFFDI
FT                   HDLVKVYLNICYINSYFFLKTKRENYGDSGCSSFPQSCGYNDGDKNGHMLIKKYTSLNE
FT                   KKNVKKCEGNGKNDIDNSLRRDNIFIYTNVQNRNMEASNEFVCNEHVKNIFHLLSIFFL
FT                   QNVNILNDHYLCRIFYGYNKSKFVNERYLNNLSFEIIKRIKKIRTYHLYLILMNSYYLS
FT                   YVDKTFVKILLIHIVNKLSQLPCEAMCQVLPVVPLFIHSEKFTYKINVIYAKKIASFNQ
FT                   VGHVVSLFKKMVQWKMISQRNILITFSHLNKFMKVRKGPLKGNVHRATSLHQGKSGKGG
FT                   VTPKPTSQTPHDEQMINNVLENFNSFDGRVTRGNDIKFPVRDTSRGRSKLPHDYTNVKG
FT                   SPEKGTDNVAPPGHFHSTAEKMFSFEQELMRCSKTSPGEKNPSVIFGRENGEGEKCDRE
FT                   TPHSESTCKDKAKTHKGDNLLFNLKLIEMHLLHDFKNIYCLLPSDYKNFLQKIRTLPCS
FT                   VNKNMQGEKEIYILKKYMKMLNYEFITFIHGPYVLHICDPFYKIYLEWENGWKLYPLYQ
FT                   QNAERHFRENKITHLRKEGFSEILICHDAFANCPSDEEKMNYLSSVLQRTKFSKCSSII
FT                   CGPAAIAPPPVVSPDIYL"
FT   CDS_pept        join(1338474..1338576,1338734..1338835,1339003..1339215,
FT                   1339352..1339631,1339847..1340172,1340452..1342560,
FT                   1342845..1343079,1343231..1343371,1343515..1343674)
FT                   /locus_tag="PKH_142950"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142950"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142950"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KXD5"
FT                   /protein_id="CAQ42077.1"
FT                   /translation="MATTEEGFSTMKKIKSNMSKICFNRSNKLNGDFKDDQIEIILDNK
FT                   NITPKPIYFNFQEAETKKSFDQIDYLLKQFDDKNEFIDEKGNTTKETDEANHTGDIIDG
FT                   EPKRDVGGNDSVVGDDQEAGPKVIQYEEDFAKSYNEIRLSESETIILLNIPNMINDTEE
FT                   EKAATEEKNQRYEKLIKNDESNYINKTMQTLNVFRKNKDVFVSTINKQNKSSQTNLHEL
FT                   HKLTIRNPSDISELLHKKFLKYRNKKLKKIMDEYGDSLNINERVILKKNMWVQVVDKNV
FT                   VDNKQTTIIPKSFYKSKKNNTSLFNTLFSTKNMSRTLSNKSRTFRTRSKFKNMKTMKFL
FT                   TSSFSEDEYLIKSIIKKKREQAEASPERPEDNEGSANFIPWKINNQKKNLNKGSFVDIL
FT                   KNMEKYVVQNVYYYEQLLYKNIHLSYLNDMRKNNKVKMFDGENYDALTNPNINYKKKKT
FT                   IIRMKIKINLKKAINFYKINKCADIASEEEMHEERSAPPLKGDPQWVTHLDLLKRVAVL
FT                   SKRKKKNIRRQISAGKLRTQIRRKAARRRTGKGVRSKVSNQAEDQTERTAEMQVVEKNA
FT                   PEPVYNANETNKCEDDKTGGDHQIFDIIANEESNEDKIKKISTLILDDVLKNDCNDEKK
FT                   KQILEKENIEKRKISYVLRKKEKFTSIRGNRIKFVSEVRQDEGMFLYNDDDHFMYKDHI
FT                   QNDYNAYMEEYTEQGETERKANNNNRLYKMKGKKYIKNISIDKLFQFHYSKLEKIVTSI
FT                   DTNKFYEDYITASYSSTLDIGSFQNSKGNVAIFSYINPTYPLRLYDVNSSVLKIMYSNN
FT                   NPNLLVATLSNGHINIYDTRNSDQLPVLKSTSIKSYHDNCFEPIYDICFKSNYIASNTQ
FT                   ESIFYSAHENGHVYQWTIEKELKNKEILYLKNKKNDLYQGLSSVFENKNLSNKPFNSSL
FT                   TCIDIDNYMNHDEDFIISTMEKGDAKELDQEHIRYENSGDNIPKGDIQELRKDAPKNTT
FT                   SHEAGANKTAAMADPGEEQYGKRISREEELLNHYKNITENIIDRKIKPTHSYYYLGSKN
FT                   GIIYRCNSCYQKSYLNYYVAHFGAVNKIKINEFDHDIFLSAGEDCTVKLWHKFSNKQIT
FT                   TFKSKNSFSSINDILWMPNNSTSFFCCSDDGRVELWDFNFLSKDPLIIFYPNVVEASKI
FT                   ICLKMFNKKDILLCGDNLGNVSMIKIKNLVDMGLGDYEQKMKLTDCLKCLDTYDYF"
FT   gap             1345842..1362841
FT                   /estimated_length=17000
FT   CDS_pept        join(<1362849..1363469,1363559..1364224,1364447..1364935)
FT                   /locus_tag="PKH_142960"
FT                   /product="SICA antigen (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142960"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142960"
FT                   /db_xref="InterPro:IPR024285"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCB9"
FT                   /protein_id="CAQ42078.1"
FT                   /translation="KNITNDGNWKQEEFNQYCMEDIGSSWSTDTDGEKTAKQKACKLFA
FT                   SGLKHISDIKKNNQKDDHAVPLRKTMMCAALNLYADQLIEKSTNQCPLDNEKLGQAIKY
FT                   AFDKNNATKNGANSCTTQGNNYCFECKRQSPFPNCQIGSKTTDKVKERMNELLEQNKSE
FT                   TKMDETLDKINSKDTFCTQVQCAIKQHYNKKRKEKTGAMVTPNWSDIHNDATTELADLL
FT                   KDMNDPTKQKNVEQYCNDDSKWNTKGHKEKKTNKAACLHFAAGLKHIYGRGKGSAKVNV
FT                   KDPSFGQTMGCLFLKEYTKQLKEMAKVKKQGNSWVHPLCDIDEGINHAFEQSEDIMKNV
FT                   LSECNKGPNGISCFECKIDQDYDDCPIGNSQNDKIEEKVEPLLQEKSDLMEKTLENTVC
FT                   PILLTDLLTPFLPLAPVSIGLSAMAYYLWKYFGPLGKGGARFRRSPGEIPGPSVQEQVL
FT                   DHVQQDSSHEYQLVKERKPRSVPTRTKRSGRVNRRTIIEIHFEVLDECQKGDTQLNQKD
FT                   FLELLVQEFMGSELMEEEQFSKEEVLMEGVPMESIPLEQVPMESIPLEQVPMESIPLEQ
FT                   VPMERVPSLGSGFMV"
FT   CDS_pept        1367549..1368496
FT                   /locus_tag="PKH_142970"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142970"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142970"
FT                   /db_xref="GOA:B3LCC0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCC0"
FT                   /protein_id="CAQ42079.1"
FT                   /translation="MDSLYSSTQNSLSNLNQGNDKYNHAKSAENNDNENVDTDVCDESE
FT                   NNELSKSSPSENDTTKENQDNNGNTKEEKDKEKKVVINECPPDGEDNQKKLSSDSMDDK
FT                   YLEEQNEKETRDDANAKYKYGDYEGAIKIWLRGLRSINYVLSKKEELTSERLESFQKLH
FT                   ATYCSNIAQGFMKLSKFSECVKYSLMALESDKKNVKIYFRLAKGYFMLGEYDKSIQVIN
FT                   EGIEIDNDIALVNLLSLVKKKKETFLKKEKHMMKYIFDNLKDKSIIQEEKCYNSIFRTV
FT                   YSLVTLLLMFVYAFFVRSSSVLARTLRKWKIKSS"
FT   CDS_pept        complement(1369847..1371598)
FT                   /locus_tag="PKH_142980"
FT                   /product="glycerol-3-phosphate acyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142980"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142980"
FT                   /db_xref="GOA:A0A384KLJ5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KLJ5"
FT                   /protein_id="CAQ42080.1"
FT                   /translation="MPDLYFLIRWLCKAIVSSLFGDVNVINPENVPLYGSVIFVGNHNN
FT                   QFIDACVLVANIPRQVKFIVAEKSMRRAVIGKLASIIGCISVKRPEDLKFKGIGHVCWV
FT                   KGDNKIKGINTRFKLDVQIGDKLLTQNKVFSVTKIESETELIIQDAINIECEDKKNGVP
FT                   FKIIPKINQTEVYNLVTSSLKNGDTIGIFPEGGSHDRTNLLPLKPGVAIMTLCALADGV
FT                   EDVSIIPVGLSYSKLYQLQGCVTLFYGNAIIVSQDHCKDYNNNHRETISKVLSKIEEGM
FT                   RSCMLTSKDHETSRCIELCVSLYTPERMTISKNKIYNNLQLFCKMFWKFGNSKEIENLS
FT                   YELKCYEKFLQANKIKDDEVWMLKQSTSAATLKFIEHICSLIFCVIFGMTFSLLWLPLV
FT                   AISIYLAEKHRESALKNSTVKIQGCDVVASYKVLVLLVLLPTFNIMYGLVFSLYLYQSW
FT                   LKRIAFVILSMCILPICYYINLNYSAQIPSLLRQMKILLKVICGKINVWRDNERELIST
FT                   RHELQLKVRALVSNLGPKVSDDFLEQLYRNIPKFVVDADTKRLIRGKDEWVPILQRSQL
FT                   EYKEEIL"
FT   CDS_pept        complement(join(1373421..1373501,1373630..1373777,
FT                   1374027..1374169,1374358..1374441))
FT                   /locus_tag="PKH_142990"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_142990"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_142990"
FT                   /db_xref="GOA:B3LCC2"
FT                   /db_xref="InterPro:IPR008506"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCC2"
FT                   /protein_id="CAQ42081.1"
FT                   /translation="MAGQSEKKRLKKASAFIVYASPFFTIFSLIYIIFAYYFRYNLITR
FT                   NIFLLHCLLFFCYYYSIKNIHYGLTNGLNFTYYTDVLILSFVINLGLFYSFKFFYIYIV
FT                   IPIYAIFKTLNFIFTNFLSSPLGAVDSTGKEDKAEKKKNKVVYKKVY"
FT   CDS_pept        complement(1376127..1379978)
FT                   /locus_tag="PKH_143000"
FT                   /product="eukaryotic translation initiation factor 3
FT                   subunit 10, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143000"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143000"
FT                   /db_xref="GOA:A0A384KX72"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR027512"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KX72"
FT                   /protein_id="CAQ42082.1"
FT                   /translation="MQTFQKPENALKRAEELQFIGQNEDALQILHAAIGHRTFRLQGWH
FT                   ILQEQIMLRYIEFCLYLEKLSLVKDGLHQYRIICQHGNIASLGKVITDFRDKAEEKVRL
FT                   AKENVNLNKEKIEQDESNVDFTEKILISSLDIEIAGKYERKLQNAFRICMETYKMILEI
FT                   LRATPKLEKAYHETAKKALIFCKENKRLTEFKKLSDLLRNHYNLILRGKHKPEYQSLLK
FT                   IEYHLETKIIQLETACELGMWKEASNIAEDIYNLNMHDYFYRTLRANLVESEASGAGES
FT                   STRKADKEKGQLKSDGKESSKKGKDESKQGEDVEEDSSKVEKKDGTMEETEKDGANETK
FT                   DNKVEGAHTVIHVNESSGNVNYALAKSRDNLKNWVGTFYQRMAEILFVYESELFHGLAW
FT                   LKYCFHILNYSKNIPEKEKTFICTKAVLAVISIPLVGNKKKNEDYAKIFEAHKKMSQLL
FT                   GHTSVPIKESLKNGLKVRNILNYADENAQKLYSLMENQFTPLSLCLECDVLLKELEATE
FT                   HSVYISKIKEVIFHKLILQLSKVYSHISIDYFIENICPESFISWNEAETMLVDLVYQKE
FT                   LEMRIDLIKRAIYFGDKENTNSSKLIKESLTNLYYELQTGLKIMNETISIENEVEHLHM
FT                   KKLTYEKEFDMLDRAHHKIMNYETANIEDVIENEVFEDKPIEDEKMLKKIYDKIDEEHH
FT                   KFQLLSEENSRKRKELLRKQKELEQAQLKLKMEKKLLEEKLEKEKREELAKKGEKLRIK
FT                   EEKTKKKSEAAEQMLKEIKKLCTNNTGKILMKGKYLDEITIEDILNGYVDFEDIEEAQE
FT                   KLRLNERNEIIKVRKMEYKKVDHYFRALRQVELSHMNKWIALVFQEDTEILLQEQKAAE
FT                   EEQKADFEAALKEKEEYVKFSNDIEEFTKSEMKDRIVEFEKNLKDQKDRLHQLLKDEKI
FT                   QRAKERREQHLRKLKAEEERKRREEEEERLMKEEMERKKKEEAHRKKLDEISRIQRERD
FT                   LEIEQQLLKRKEESRIGDKYYRKPSYEDDFSWKRGDKAGSQHDEDSNYKRLDDAQDSSY
FT                   IDRSDRRERRDWPGRDRERERDRERDRDRERERERDRDRIFRKDRDYRRDRSKDRERER
FT                   SRDRDREYRKERDYRGDRDREYRSYRDKERDRDRDYRRDRDRDYRRDDDYRRDRDYKND
FT                   RDDKLDRDYRKVERSGKGEHERRRDRDEEEYERNDLDVKKNHNIHDEDDSVRVEKGKEG
FT                   HSGNDSDGANHHHLKEKEKMTNGKDITKNEQAKHEEASDGGGDFTVFKKKKRGFMKFF"
FT   CDS_pept        1384009..1384959
FT                   /locus_tag="PKH_143010"
FT                   /product="Iron-sulfur subunit of succinate
FT                   dehydrogenase,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143010"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143010"
FT                   /db_xref="GOA:B3LCC4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCC4"
FT                   /protein_id="CAQ42083.1"
FT                   /translation="MGRSAAKVATDDQHNYKEWTILNNRRFLSTAQNTGMNQTTGKDES
FT                   VKEKFDHAKNSMQQNELKKFSIFRYNPQNSKRPKMETFEVDIDNCGPMVLDVLIKIKDE
FT                   IDSTLSFRRSCREGICGSCAMNINGKNGLACLTEVNKDKKEITEIHPLPNLYIIKDLVP
FT                   DLTNFYNQYKSIDPWLKRKTKKEKGQKEFYQSIEDRKKLDGLYECIMCASCSTSCPSYW
FT                   WNPEYYLGPATLMQAYRWIVDSRDEYTKERLMEVNDTMKLYRCHGIMNCTLCCPKGLDP
FT                   AKAIRNMKELVQENFSKESIKSHANYVKEKMEKTK"
FT   CDS_pept        complement(1387435..1390686)
FT                   /locus_tag="PKH_143020"
FT                   /product="Bromodomain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143020"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143020"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LD08"
FT                   /protein_id="CAQ42084.1"
FT                   /translation="MNTNNDEMSNVSNDSNIGISNNIDDINNISKNHLGHVGSVDSIKN
FT                   AIISANHFNSTNNIVDSENENSNDHIELKNVHMNNKNMNNYRSLSNENTIDDNGNDMNF
FT                   LNDDDNDNCNESNENNLSGNMAITIEGSNDSGNYDKAQSSDIPNNVGDEHNGGNDIASS
FT                   GMNNTGTTLSAEDAQLNNDKTIVPNGNYKNAFFKNVDDVRSFERGILYLTDEEFNYISN
FT                   TVNLLGFRFFEIPSEKSKSDKRNTYSAISKRHLNEIKNLRCSLSNNIYDAGKRKSKKSF
FT                   DPYYSKDETSSTTTKDNNDTQREITRKRGGTYNNYEDDNRSSLNDDDNKYANMSNNHVG
FT                   SNGTAALGSSVYRGGGAYNNKVGSSSGSGVNTKMSESDKMAQGRNSSMVKKGSITKGEM
FT                   DSSSVSKNAYGAFPNVGKGKSSKSVGSSSSKNNAAMHHTNYKHGGAGSTGTVASGKETL
FT                   KKRQRSSNNSIPEDDTVDEYEQHKRTYKKRIYKGGNPWKNWCFKILHKLKKKEICCWFL
FT                   KPVNPELDGIPNYFNVIKNPMDFETIENKLLTNKYNNPFEWQQDVRQIFFNAFTYHKVK
FT                   NCVWNDAYKLAKEFDKLVKQHTEMKNILNECTKGSNSVYLDMNKYNKILEEKYEYDENF
FT                   HHSSSSSYAGSSSEEVSSDEYRSNKRYNRNNSASNAYTVRKKNMMMHGGGGAGGNHATY
FT                   HNMDASTHMYGVPNRKGSGAAGDNRFNKMNKQMSGMPSKNARDKFINNKKDNCYGVGNN
FT                   NSSSGNMHMNSNNNSIEFEPPSMGTIPEPPGIQKIGANDKGLNNYQVNLLFKNLRRLAP
FT                   NQRRAALEIIQDDLGILAENHMFDRFFTFDTDLLSIEKQKRIFLYINHMGRINLEQYKA
FT                   SLIPSDQRGPCTIPKGKMPMKNMNNKNYLKSTNSLGNNSNNSNNLHFDKRRTNRYLSSS
FT                   SNSSDSSSSNSSDSSTYSTSSEESESEEDSDSDMDSDSYGKKKVKRQLSSNERKKEVMT
FT                   NKYLDNKRKSLPQYKPIDENKKNLQLRDDVMGRHADFLVSMDGPKNGKKDPKSSGSAWP
FT                   EWKGQVIQQAILTQHQSSVPLNKKELIAEGYDAKI"
FT   CDS_pept        1396614..1397486
FT                   /locus_tag="PKH_143030"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143030"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143030"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCC6"
FT                   /protein_id="CAQ42085.1"
FT                   /translation="MNRDFAQILEDFLSGGKNIRKGYRDDNDQANEENIPHILGQSGSN
FT                   LFHDDIGKKLGKELEEKKNFFKYTEYSLSSLYMSDNQIPLEEDPQYETFINIITKASDA
FT                   NNEYKWVDDYFKCEVKEEVNILTPQSQDKDFVFRKYIQPNQLKNICLLRKYEQAAISKT
FT                   PEKNKVDAKIVSEYIVHDSYRQIMKALDFKLSHRIFTQAHIFHSKYGNSDHIIILVMRH
FT                   YRDENFLHPLFPDRAFVQIKSYVNDNKYSDMIQKNLLNYAEIFKPYIKLRKVDSHFVEQ
FT                   IKDRYYGAF"
FT   CDS_pept        <1399812..>1400634
FT                   /locus_tag="PKH_143040"
FT                   /product="SICA antigen (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143040"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143040"
FT                   /db_xref="InterPro:IPR024290"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCC7"
FT                   /protein_id="CAQ42086.1"
FT                   /translation="NDLRKDLEKTWENLKKWLMRWESKEIADLCGGVTWPWTGYTGAAI
FT                   GVKEMCKGVVEIGYFINGVEIERVGQGFPLDHAARITENMAAEEIFRRCIVGSVALTEI
FT                   YGDHCGLKVVIEKIENGMNDKLTGTHRVGSMFDKCKGVDLPALMVGKSLLHGRIKEWAA
FT                   VNRGGKGPARVRSPWTYWKQVCPPVKKEEELAKKEAREKNKEKLTQFMGLNNGNTQNNI
FT                   GSVSIADVLTGDQFLLKQDKLDAVLQSALKEGDKFDVNSLTQKLTKSTEEKT"
FT   CDS_pept        join(1402863..1402877,1403162..1403914,1404115..1404933,
FT                   1405199..1405507)
FT                   /locus_tag="PKH_143050"
FT                   /product="KIR protein"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143050"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143050"
FT                   /db_xref="InterPro:IPR008780"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCC8"
FT                   /protein_id="CAQ42087.1"
FT                   /translation="MSGGKETDECSGKLPAGGEYALLGARVNCSKTYEDQTKNGNIVED
FT                   VGGPLELWLTNNDKSDAKRIVEAYCHANTQTRAVLTNYYDLCHFFYYWLGDLIKGKLPE
FT                   RRELHQVMEVVYAKLGGFKFRGGFSHKCENLYPGISKSVFVLYKKIFDYAYNYKSLESK
FT                   SEVKNKFLCSSECATYVKEVEQAYSSAIGACGSATSDRFCRELTSEYNKYFDNNKPKWT
FT                   CTTTTSEVDEDPDDDDDDDFDDELFPKEFQDLDQVDGPLSTLPSRKDYYKFFDEGMSKC
FT                   DREDWSWPNQIKAALEGDENIGEHAEEIAKALCHAYEKKGKDTPSNKLPEEYCDFYYFW
FT                   VGDIFWNNSRKRTFKGIMDQIKDAVGNSTSDHGCSFRFKTKGLNSFLSSKLLFDYYKDK
FT                   DDMKSHLNFDSEEEIGCNDAYYEYFVAARKAYEIMHKKCPKEDTKGTNEWCKKFHEMYK
FT                   DCSNGGGVDGKSQCWVARESTKSCTEDSKPDTLDTTSSSTANDTNSVTPGAVAGGTIAT
FT                   IGIPTIGFFLYKYTDVFDGIKKSLFGELNNRSSNRNRGRRSTIGRQHFEDTFTGNDSST
FT                   LGGDGSTTLGGESSTLGGSSTDISTIYDDGRRRPTGRTRTGINNRRPGNIRYYAT"
FT   gap             1405993..1408992
FT                   /estimated_length=3000
FT   CDS_pept        complement(join(1410540..1410738,1410892..1411049))
FT                   /locus_tag="PKH_143060"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143060"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LLR3"
FT                   /protein_id="CAQ42088.1"
FT                   /translation="MHLRKREFPKNDAFVKSSEMGETSMCVEDEIFSNSTLSDAESCYK
FT                   FWKNADRGDIFEICEEFESSEDESVVKDMAQNLGALKLYSSVETNTVPVNMDTTVEDDT
FT                   CVKDEVENPPSRGN"
FT   CDS_pept        complement(1411901..1413655)
FT                   /locus_tag="PKH_143070"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143070"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143070"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KCX8"
FT                   /protein_id="CAQ42089.1"
FT                   /translation="MSDISDFSETEEFSENEKQKKLFQKDKSRNSTLSQNYTTDKSQMF
FT                   SKNSSMRSVDSNLEVNGKLSIQKSGTFASTQNAVTKKGSQDDHMLVGNESKSFKNLYST
FT                   SKLNEEGKPSPTPSPNSRVTDCVMSPPKFFLSHIYHDNKVFTKKYGHSIVEYENEFFIY
FT                   GGINSKNEYLDEFLTFTYGLNTFTSKKLSVNPGKRAYSSMTLTYNINNNPSLLLFGGLC
FT                   GPNVLAKDCYMYDFMEDTWSKYTYKLESIPGTRYGHSYTFCSRTYTTVIWGGLNRNNEL
FT                   LNTGHKFINGEWSEIKHKGICPSGRVFSSMVWLDRVTKENVNYSFLYLFGGDTTNKGTP
FT                   TDELWVYNFNHENWTMVKNSSGETPCPRWKHGAVIIDKNMWISGGLCSGWFSNYSIPDL
FT                   YVYDIPSNCWFNCQIASKQIHNCYDYGTLNLHSETRAFFLFGGKNANNDPTSNVCRFAP
FT                   LCTNVSIVTMRNEIKRFSNYVLEVRKESEETANNVSEMQKIIHTFSLDIKDFKILFEAL
FT                   TRSIQMLKENIENVDREVALLKQQIPVVEKKEENTKKEPAVGAEASAKEPVADAEVKAN
FT                   EVVKAEGQ"
FT   CDS_pept        join(1416292..1417812,1418281..1418715)
FT                   /locus_tag="PKH_143080"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143080"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143080"
FT                   /db_xref="GOA:A0A384LCZ3"
FT                   /db_xref="InterPro:IPR019336"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCZ3"
FT                   /protein_id="CAQ42090.1"
FT                   /translation="MAKKNLYVLLFWILTLLTTLLQVQGKVFHGSFNIRKNEKIHYLTK
FT                   FSCSIGTCQFNIKMKLKDNIIAKLLYYYYKMSSKSSTDGGDHMEKLFHMDYDNAYHVLT
FT                   NNDLHGISQRVTLMLDIEQNYVNQGEKCLALGNLRSVHRLKIPFHFKYSDLVNSKTYNI
FT                   NNFMSNKYSISFNTVHSELKNNKVLQSELSSHASATNEKDFNYDYVNISAKTTHRVHVW
FT                   FLMFDDCYHSFIRNLKLNIKAKIAYWEYFLNAAKKKNISSLASAAWDEDIINNDNSDDD
FT                   DDNSDNSKFYKSYNFDKNTLLKNPKRLLFFENNFTKGEIEDISFFLKYYNFKNMKNFTN
FT                   MYNNLYKNGLYEKVIDYIYENDGFKIEYEVNIFQTNNSHFSYELLYSPLLTFILTILYI
FT                   FLILQYGSKIMQNIMSKEHKHTMVVCVASVILVQLVSNSLLLIHLLVYSKNGIGIELFK
FT                   ISFNLLNFLAQIIMCTMLLSLSYGLTIFEASFDIFARIKVIFAVITFFHVVLVILDNTY
FT                   IMESSSKFFDNDNITGYIILALRVLLAIVYHVNINNLFLVAKVPTIRNFLKKMYICGLF
FT                   YIFSFPIIFMVCYIFDTYWRQRFMLFGTAFLQYVSTYFITKMFLTNSEYFKVSDMSASD
FT                   LPGATSSWFNQKIHTY"
FT   CDS_pept        1420500..1420781
FT                   /locus_tag="PKH_143090"
FT                   /product="Dynein light chain 1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143090"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143090"
FT                   /db_xref="GOA:A0A384K9L0"
FT                   /db_xref="InterPro:IPR001372"
FT                   /db_xref="InterPro:IPR019763"
FT                   /db_xref="InterPro:IPR037177"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K9L0"
FT                   /protein_id="CAQ42091.1"
FT                   /translation="MADRKSNKNAVVKNVDMTEEMQIDAIDCANQALQKYNVEKDIAAH
FT                   IKKEFDRKYDPTWHCVVGRNFGSYVTHETKNFIYFYIGQVAILLFKSG"
FT   CDS_pept        complement(join(1422085..1422211,1422325..1422470,
FT                   1422651..1422809))
FT                   /locus_tag="PKH_143100"
FT                   /product="rna polymerase subunit 8c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143100"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143100"
FT                   /db_xref="GOA:A0A384L5A1"
FT                   /db_xref="InterPro:IPR005570"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L5A1"
FT                   /protein_id="CAQ42092.1"
FT                   /translation="MASNVLFEDRFVISSVDNSKFEKVSRIKAKSTGYDAELILDVHSE
FT                   LFKVEEKKAIYLALQDKILNKNDDKIWEQSENIALNNIEYIMSGRIFKFEELSSERRTV
FT                   YASFGGLMMALTTDKQFIGDLEIDMKIYLLTKNVDIERT"
FT   CDS_pept        complement(1424262..1426409)
FT                   /locus_tag="PKH_143110"
FT                   /product="bi-functional aminoacyl-trna synthetase,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143110"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143110"
FT                   /db_xref="GOA:A0A384KY82"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KY82"
FT                   /protein_id="CAQ42093.1"
FT                   /translation="MSSPNCEEKVPEEELKKAEILCRELDELKIQYKEVKHAKANSIKD
FT                   LLDMNLENSKNIIKNLFLKDKKKNYFFLCTVNWKTVDLKYLSTIFKTSNLRFVDEGNLK
FT                   SMLNLLPGCLTPLALKCDQENLVKLYFDEELKNMENIIVHPMHNYSSLYMKQEDVVKFC
FT                   ELHNHAPEYIHIEEGQNKMKKEDMHLEEQKMEKQKGTNAGGSGGNAGKDDNAKDANILG
FT                   IVAKKTVNFSEWYTQVIVKSELIEYYDISGCYILRPASYYIWECLQTFFNKEIKKLDVE
FT                   NSYFPLFVTKNKLEKEKNHIEGFSPEVAWVTKYGDSTLPEEIAIRPTSETIMYSVFSKW
FT                   IRSHRDLPLKLNQWNTVVRWEFKQPTPFIRTREFLWQEGHTAHKNEEEAVKMVFDILDL
FT                   YRRWYEECLAVPIIKGIKSEGEKFGGANFTSTAEAFISENGRAIQAATSHYLGTNFAKM
FT                   FKIEFEDENEKKQYVHQTSWGCTTRSIGIMIMTHGDDKGLVLPPKVAKFKVVIVPILYK
FT                   NTDENVIFNYCKDIEKVLKNAQINCILDDRELYSPGYKFNHWELRGVPIRIEVGPKDIQ
FT                   NNSCLFVRRDTNEKFNVKKESVLLETQQMLVDIHKKLFLKAKKKLDESIVQVTSFSEVM
FT                   DALNRKKMVLAPWCEDISTEDEIKKETQRLSQNQANTETSLSGAMKPLCIPLDQPPLPP
FT                   NTKCFWSGKPAKRWCLFGRSY"
FT   CDS_pept        complement(join(1429010..1429094,1429336..1430306,
FT                   1434310..1438212))
FT                   /locus_tag="PKH_143120"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143120"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143120"
FT                   /db_xref="GOA:B3LCD5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCD5"
FT                   /protein_id="CAQ42094.1"
FT                   /translation="MKKGTDFNLLYDEEKKNLVGLLIENNFDEIYEPITTESLRFFVPL
FT                   NGVCLIDYQLHFFKQNNIKKIYVVVTHHEKELQHYIEKFQKSKRRYNDLDIEIIKLSKK
FT                   VKTLGDALRDFKKCVEIYQDTLLLLSDTIPIANIKEIIKAHFVNKEKCKNQIMTLILSH
FT                   CIDENKSHDDDFVIAYDNFSFKLLLYEPLKNKNYLILTSEIFDNVKPRDGKKGGSGANA
FT                   GGVNTHGKKEQKYSLSNVGGNKEYHTPTINFSTSTNSIIISYDLVMPNIFIITPQVFKL
FT                   FEENFDYQCMKKDFIYNILKQEIKIEEIYVHALNNDYNYTECNQIITTLTDFRIYFKFF
FT                   KTLIERNVHPFLANSSHLLPDLPKFTFCEPGLYKAKNAIIDDSCKFLKIVLVENYTEIS
FT                   ENTVIENSVICKNCKIGKNVKIVNSIIGKNSIVKDNVTIISSFISENNSINQGVYIDEC
FT                   CVVGKNMNIPAGTKIAKYTRLSAFKHLKGQLKVHRRSKEQDHHFAEETEKKDSIPDGNG
FT                   EEAPPNLQFEQEVVTKENEENTFNGNAPKEFEEEPHREKQANVVTEEVNIVNEEVNIVN
FT                   EEVNIVDEEVNIVDEEVNIVDEEVVEEEEVKEDLMNDVKEEVMNDVKEEVKEEVNEEVK
FT                   EDIMNDVKEEVKEEVNEEVKEDIMNDVKEEVKEDIMNDVKEEVKEEVKEDVKEDVKEEV
FT                   KEDVKEEVKEDVKEEVKEDVKEYVKEEVKEYVKEDVMDDVKEEVKEEVNEEVKEEVKED
FT                   VKEEVKEEVKEEVKEEVNEEVKEEVNEEVKEEVKEEVKDEVKEEVKEEVNKEVKEEVKE
FT                   EVKDEVKEEVKEEVNKEVKEEVKEDVKDEVNEEVKDEVKEEVKDEVKEEVKEEVNEEVK
FT                   EEVKEDVKDEVKDEVKEEVKEEVKDEVKEEVKDEVKEEVKEEVNEKVKEEVKEDVKDEV
FT                   KEEVKEEVKEDVKDEVKEEVKEEVKEEVKDEVKEEVKEEVNEEVKEEVNEEVKEEVKEE
FT                   VKEEVKEDVKEEVNEEVKDDVKDDVMDDVKEEVKDEVKEEAEKEIKGEVNEKMNEEEIK
FT                   EEVKDEVKQEVKDEVKQEVKDEIKKVVNDEIKKVMNDEIKQEGKDEVMQEVKEVKDEAK
FT                   KEVKKGIRGIWSMWKKYRKQTKEQVKDEVKNEVKEEVKEGIKKEVKEDFKEDVKGGAKE
FT                   DVKEEVKDNVMNDAKEEMKEEVKGDAKEDEKENVVDDVKEEMKEEIKDDILDDVKEEVQ
FT                   NDVMVDVKEEIKEDILHDVKEEVKEEVKEEVKDDILCDVKEEVMNDVKEEVKEEVNEEV
FT                   KEDIMNDVKEEVKEEVNNEEVKDEVNEEVKEEVKEEVKDEVKEEVKEEVKEDVKDEVNE
FT                   EVKEEVKEDVMEELNDDVNDEKEEMENGNMEVAAEESSEQNMLQEEAFDLNNYIVKTKY
FT                   SEDQLRFFSLIGDAENYGKPKMTIFSEYDSEEESDEDSVYSTSKNYSTLSDTNVSDKDD
FT                   ESVCNRSENMSDINNHFDKINLENEKNSFVKEISLLCKEAIEKPQHMSYKILEMKSFRL
FT                   SLNFTDLDVIISFFPIFWDFINSMEFDKDTWVENFDNAKLDLLFSSFLLDDQLYYETIY
FT                   GLILDFSKKEFLTNDVKNNVYGSDKLCAAFEYIYHSDIFEFNYFNEWISKNKEDEYLAN
FT                   NKRLKAFAEWLAQE"
FT   gap             1430308..1434307
FT                   /estimated_length=4000
FT   CDS_pept        complement(join(1439952..1440141,1440476..1440720))
FT                   /locus_tag="PKH_143130"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143130"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143130"
FT                   /db_xref="GOA:A0A384KML6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KML6"
FT                   /protein_id="CAQ42095.1"
FT                   /translation="MFRFQQLRTGWNELGRTAKVVYGCFFFNIILLMGITTRRHMANKR
FT                   AVDFYTNKIIDSNSENNDWNCYNSAKQYRYECAYLSEEEMEHLGICQKLHLELEHCRND
FT                   LYKHIREDTPAMKKTPYILNKPTWIRDPVWFQNMQSGKSE"
FT   CDS_pept        join(1442077..1444604,1444751..1445839,1446011..1446083,
FT                   1446318..1446428)
FT                   /locus_tag="PKH_143140"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143140"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143140"
FT                   /db_xref="GOA:B3LCD7"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR039524"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCD7"
FT                   /protein_id="CAQ42096.1"
FT                   /translation="MKDKVKYNRFGNFLSNHVLIFFLIFLLNLLIFISFINGFLFPREG
FT                   ITNKSEDLETFSRKVFGDEYIESQKNKKDVHSIVNPPYDRIVVLLIDALRFDFTLYDPN
FT                   YKKELENDESVDEEEKTSKEVRFFQNNMMNLHHMLKTEKDKTMLFLFQADAPTVTTSRL
FT                   KSMVIGSIPNYLDLNENFSPSDDIQDNFIEQLYYNRKTVTAIGDDTLVKLTKNVSRKLV
FT                   YESFNIFDLYELDNKSKNHFYEEYPLDYWDLLYVHVLGVDHVGHVGKPNSRKMKSVLKD
FT                   FDIFVNDIIQKVKSEEKKKTLFVLFGDHGQTRTGDHSGFSADETDSSLFIYSPLKFMPL
FT                   DKNINNKSFILYDKDNLDRTNSDSLYEFSTCGSDKDQCFVESYKNYHSYLNDLNKDRTY
FT                   FYDVRFTKQINLVSTLSFLIGSTIPFCNVGNVIMDFIPKAYKDDAPSAPASFRTSNYGE
FT                   EGNESESNSSSGDPLGEDKSSEKSKPNVPRNGDDENYSKLYHEVLNLHYIAELNYANLW
FT                   QINRYLKEYETHYRVIKNEDYFFIKNNWKHIEEEMVRFFQPNKKFLDIEEILTSEKEDY
FT                   IKYINKMRNLMDVTQKYFYVIFAAKKPSFIVLCFIVNIFFLMIFNIFYLNSKLNCYYKS
FT                   ISTGTFILLLTIFFIVLLPLDMYNKCLHLLVLPFLFILIVVGIFFSRNKYTDFFRFISY
FT                   VKVSLVCSNLPDANLKKYTAIQPGDKHSTYQEKTQYSKLGDHTKNNFLRKSFLFFKCLY
FT                   IIIRRSIALSINIVLPYIFNITKCIFTVKKKIFKYLMNNNYFFFVFIWSSCELSFYYIF
FT                   KERHCIHFLLIVYVVLSLFKCESFFSLHLLRGLALLTVLVVNTAFSFTPGYFEHDMEKL
FT                   YLKKSMLQMALPISLYFFSTLFINCGSNKLLKREIKIITLLGWTVQFALVLLYFLKINE
FT                   QVIFWNPLGVYLTTFLLYLFIIFRKSSLIQEEKVQEPLQKVQEVCITLFLILFSSLQLS
FT                   LIAYSNTNLSVLVFFYTTLFCFYFFFLSTNNLEENKDMNNIKIKWIEENKQVHMFSNLD
FT                   DEKKTVEIRNVNTWVKEKFDLKLVHQKCTLLDKCKCLEETDATQIQIYKLIKNLPFFSL
FT                   SDTDFYLLAAILIKYTFFLTGQKFVVNSLPLTSAYIGFNKYVWPISQVYIFIHIFFPML
FT                   FSLLFILYVFNMRKIKMLMYFKGVDIYNFYFYPLINFFFKSIFLFCCKCLTALWVAFYL
FT                   ELHLMLYDYFLPNFLFLTSINLVFIVSSILMLSLTKYIFLR"
FT   CDS_pept        complement(join(1447001..1447171,1447406..1447891))
FT                   /locus_tag="PKH_143150"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143150"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143150"
FT                   /db_xref="GOA:A0A384L3Z1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L3Z1"
FT                   /protein_id="CAQ42097.1"
FT                   /translation="MTYIRHPAAEKMVKLVMTRRRFHNYFAKDTLRQILKNEQINFNEL
FT                   HNRVYVGSSPLNGVGMFSFNEIKKNEIIEICPTIKMKNEDIPEKLVNYLFESKKENMNT
FT                   QVVRIVTKRRDTINYKLLPLGYGILYNHSDSPNAFVHIVSLREEKEKKLDDLNKDEKNE
FT                   TITSDQIMIFRAQRDIQKNEEVFISYGLSWWKVIYGRNGSLVEKTQKGLKNDILK"
FT   CDS_pept        complement(join(1448667..1449171,1449349..1450397,
FT                   1450812..1451138))
FT                   /locus_tag="PKH_143160"
FT                   /product="Geranylgeranyl transferase type2 beta
FT                   subunit,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143160"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143160"
FT                   /db_xref="GOA:B3LCD9"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR029008"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCD9"
FT                   /protein_id="CAQ42098.1"
FT                   /translation="METKPTPPKQNVAIQKNILDVKLYKDSQNNERKIKHNKNSLILSK
FT                   QFYGIIGGITVGILGIQGTYGFLFFSLFTVIGTLMTFSHIRNDFKSYFMKPSDIFCRDF
FT                   FSGLIKYFLNTIKEKLAKNTPDTSVSSKYESIFISGIFWVLSGLTIVRKNRKSLDEVLD
FT                   RKVIDTLYSLVMECLEKKKIKKKYIYKLKKEKYFLSNEDIDQIIGESQSGPSGLYAVTC
FT                   SRGEDRGLPTRCKNVPTGHKKMCDEKAILTEERNAEFIASPECSNRVEGEESNKMVKMT
FT                   SVGKRKKKRFHLCGFSPCKKSNLYEANVISTLSAIQVLFLLNKISEEDISTKMILEMYN
FT                   FVYFLFDEKKGFYHFSLNNAKFQFDGDIRFMFCALSVLHFLSLLLKKRNVHISLYNNDE
FT                   RCAHWILTCLNLDGGFSNVPGSESHAGTTFCAINSLKLLRLRGGENYLSNNGLLRGKLI
FT                   RWLCDRYDNFGINGRIGKDHDVCYAWWVLGSLVALKTNLTELFNVKILITFILMCQDKE
FT                   KGGFSRTAIKNNVSGNKPFNFYDRENLSHQEADLFHTFFALCAISLIYHNFCHYKKKNR
FT                   KRFQLFGGDVIPQQLESTLAQMVNVHVSFAMPLRMTYSAPFPVADCVCDR"
FT   CDS_pept        join(1452640..1452865,1453019..1453174,1453343..1453365,
FT                   1453572..1453661,1453790..1453827,1454025..1454055)
FT                   /locus_tag="PKH_143170"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143170"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KNJ2"
FT                   /protein_id="CAQ42099.1"
FT                   /translation="MSRIIPACVIAISFLLSNIKCFTTGVYGGSGLHNCSTVFCSYDKL
FT                   SNIYDNSKFILAELESILYDVRDEKNAHQSEQEHDKSLNLEIKFPNSKDQEDLSYLYPD
FT                   EEYENESNFGEPVPYIIISRMDDDDFEKSILNKSPRRIEDSENRELTNEEQIDMALSRI
FT                   SDLEEQQKRFSEEKRKFNLKKYLR"
FT   CDS_pept        complement(join(1454419..1454533,1454686..1454815,
FT                   1454949..1455052,1455207..1455317,1455502..1455530))
FT                   /locus_tag="PKH_143180"
FT                   /product="adrenodoxin-type ferredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143180"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143180"
FT                   /db_xref="GOA:B3LCE1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCE1"
FT                   /protein_id="CAQ42100.1"
FT                   /translation="MTEDGENDYNFFSRNNTFKRALLNKIKNKCIYFNYIRAFTTQSQE
FT                   EIDVTFVNQDNYEKTVKAKVGDSILKVAHENSINIEGACDGFCACSTCHVIIDEKYYNL
FT                   LPEALDNEIDMLELAPCITETSRLGCQVKLRKDLDGMKIKLPPMTRNFYVDGYVPTPH"
FT   CDS_pept        1456765..1457229
FT                   /locus_tag="PKH_143190"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143190"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KCE5"
FT                   /protein_id="CAQ42101.1"
FT                   /translation="MIGKIFDNAFRIRTYNRLVCFVIGGAFSYSFANPDMDTVYEFFPI
FT                   FKQNKYAYLTFLEVNEKHGNVFEEKLKDLCRFYQKQPGYLYTKIIKRKNNINNLSRYIV
FT                   LSTWLKSENYLLACNRMYGQILINNIQNYTNYNSFLYRIVVDDSDYLPPF"
FT   CDS_pept        join(1458391..1458525,1458668..1458718,1458884..1459033)
FT                   /locus_tag="PKH_143200"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143200"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143200"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCE3"
FT                   /protein_id="CAQ42102.1"
FT                   /translation="MRIRCGIYVLAAMLFINSIFAYRRLKDINNLQILSQGFKDIKPVG
FT                   TNFHQIRSRAKSAAPDQMNIDISDWTIYITHKTPYYNTEKIKSILIYSMTYPFKELEEF
FT                   KEYLFEE"
FT   CDS_pept        join(1460807..1460983,1461276..1461389,1461557..1461760,
FT                   1461868..1462026,1462182..1462265)
FT                   /locus_tag="PKH_143210"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143210"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143210"
FT                   /db_xref="GOA:A0A384LLM2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LLM2"
FT                   /protein_id="CAQ42103.1"
FT                   /translation="MDMEIKDFDKFSGFRINCTKDLVVKGSISAVVGMILGIMCSLIVN
FT                   CTLVEVSLSKFFSMYFGILFIVVGLIIFWRLHANVTDEAENRRNQLMILAGLIVLSGIL
FT                   CLFFDRSWLFSLSPLSKVPIYCILGISISFALTFSLIDLINYLIGFIQGSITRPLIESV
FT                   AQVYLILSFTITMGAIFGFIFGLLDVEDESSHHIRLALMKAENCCFPLGAVLGGIAGFG
FT                   NEVFRQQSEAYKIENVTEFDDEV"
FT   CDS_pept        1463552..1464202
FT                   /locus_tag="PKH_143220"
FT                   /product="thioredoxin peroxidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143220"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143220"
FT                   /db_xref="GOA:A0A384K945"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K945"
FT                   /protein_id="CAQ42104.1"
FT                   /translation="MRILHKLGKNVFQTARRSFSLVTKQAHDFTAQGLNKNNEIINVQL
FT                   SSYIGKKYCCLLFYPLNYTFVCPTEIIEFNKHVKSFEEKNVELLGISVDSVYSHLAWKN
FT                   MPIEKGGIGNVNFTLVSDLNKEISKMYNVLYENSFALRGLFIIDLQGKVRHQTVNDLPL
FT                   GRSVDEVLRTIDSIIHVDKTGDVCPINWKKGAKSFQPTNDSLLNYLNTEVKKE"
FT   CDS_pept        join(1465698..1468222,1468473..1468569)
FT                   /locus_tag="PKH_143230"
FT                   /product="nuclear protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143230"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143230"
FT                   /db_xref="GOA:A0A384L702"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L702"
FT                   /protein_id="CAQ42105.1"
FT                   /translation="MSAGASNTSGNPRGRGGRGSKLSKNNHIAQNASSVANSGNSANNG
FT                   NAQNTLHGLNPPSHKGLVESEISEVGLPATDRSDDNNSTIDNDERNTLIHVLHSYEDFQ
FT                   KKNMNYGKVNPYRKRESQLSKMRKSIVKLFTISDIRLDESEPNGNADNNAYSISASKRK
FT                   DKAHSSNFLTSRAAMWNEIENNDDPEYDLKLESSKNKSIIDIVTHYLNVLINDIINDKK
FT                   GITYIAILMIILSVLITCISGVMTLFNNKTGEKNNFNLHTTKNNYDDINKFMNYIKLGN
FT                   EENNRSEFLRLYQLLEEFKTSMNQNMNENMNTILINKKENHALYELNANMENKLKELEK
FT                   KLLLNTKDIDYFKIHSKKEVENFKKILQENYQSFQNKLKDYVKTVDTIKKDIHKKNSLL
FT                   NDVEKKMNKSQMDIKKDVSDRVENEKRGLLNTISELQKKIKWIESKLAFHASNSHDPLQ
FT                   LDNPAQGGLMHENDQAEARERQIEQRIATWNEEHVDLIQDIQKELNLLKESAKKSTNFL
FT                   DDVLPSFEHKILKNVESKIKYYLEMYKKDIINEITESKVIYNEEKYKTITLKQEKMQSE
FT                   LLKTISSQIKAQTKIIKDDLNKSLHTMVDQKQIKMDNEYPVKSAKVNYDILDMLQKKVD
FT                   ELYNEFILDYNEIDWALESLGARIVYKMTSSPLNRNDFIEKFLNQIASYLPSEEIYGMI
FT                   KPMGKDPSIILKPSNFPGDCFSFNGSKGKITIHLPATIDVSSISIQHVHENISNNSNAT
FT                   PKYFSVYGVVDSNWPEHFESQDINYDDFKNSSLYSCLHSVYGNLQPKEILDKWLKGNKN
FT                   PGLLHLGDFYFDRKKRISTYPTKHCFPMKRIIFEFTENYGAPYTCVYRLKVHGKRCIRK
FT                   FK"
FT   CDS_pept        1469503..1470333
FT                   /locus_tag="PKH_143240"
FT                   /product="cyclophilin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143240"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143240"
FT                   /db_xref="GOA:A0A384K9U6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K9U6"
FT                   /protein_id="CAQ42106.1"
FT                   /translation="MLKKGFTATKIIGKRCFQWWDNLNTSWKFAIGFSVLFPPLWNYNE
FT                   RRKAREKQVYYNKSIKDYVFFDIAIENKYVGRVLIGLYSDQVPLSVENFIQLAEGYKVK
FT                   DKYIGYRNTFIHKIYPGIGLVGGNVLNDKEGLSIYGKKFPDENFDMEFVQDGDVALFNE
FT                   GPHSNSSQFIITFSPMPILHKHNVVIGTVLKGMDIIRMIENVGTKLGNPMYNVKIINCG
FT                   LYRSLEQDGPPFFNMLHISDKGNKNIISKKEFENLSEQQRQSLMEEIGKSEKQR"
FT   CDS_pept        complement(join(1470942..1471118,1471249..1471380,
FT                   1471623..1471625))
FT                   /locus_tag="PKH_143250"
FT                   /product="10 kd chaperonin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143250"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143250"
FT                   /db_xref="GOA:A0A384LL45"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LL45"
FT                   /protein_id="CAQ42107.1"
FT                   /translation="MSSTIAKKFIPLMDRILISKIVPKTTTKSGLFLPESATEPSFTGK
FT                   VLAVGPGRITSNGSKVPPSVKEGDVVVLPEYGGSSLKIDGEEFFVYRDDDIVGIIKDQ"
FT   CDS_pept        complement(1473188..1475110)
FT                   /locus_tag="PKH_143260"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143260"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143260"
FT                   /db_xref="GOA:A0A384L1B3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1B3"
FT                   /protein_id="CAQ42108.1"
FT                   /translation="MEGESKVKDHESKEEQTRIYKILLLTYARRLSKYQDQIKNIYFHH
FT                   NIISAIKDETGDYYLNENVTSQHHFIDTLIKSNENQEFLKSIQLIESKGDKGEHTVNGD
FT                   LNGDPPSGNRESSNNGSNNNRESNNDGVNNEANGTNQTNQRSHFNNYIMDIMERFHLFL
FT                   LLKILFVLFLFEASLKMYFIVSGLFILYNRGFFDLLISNFSFMSSNESIEQVLRRMRES
FT                   RNMNNILVNEHTEQMSNLNGGAHHINQQEGDIMEHNNSQDLACDLQFMQDGREAEEELD
FT                   NGTVGQGEENTHNNKTNKREEVSSTALHPMNSMNDETDPVHATGNEGDPVDGEDNQFVS
FT                   ELCDEFNYQLNDDNSKEIHGIGHSASATCGEKNKKRSLFFFKKKKIDQKTHGTELSVKN
FT                   SSHEEFNSSIKLNENLNQNLDENLNENLNENLDKNLNENLNENLNENLDKNLNEKLNEN
FT                   LNENLNEKGDSSYLDDATDEFFREMGTANSGDAENLLCAGVRRRKYITSGDQKSGNNDD
FT                   LNGDSSNARNDSASNTRNNNKMYFHDSSTTFNNLLNNSTSEFVNSDCDDSENNIDSGQS
FT                   YCSNSSALKKKNPPHNMPEEGDNNTTINVRRKPTKFEKYIYQSVVMFFMTLLPWWVPDV
FT                   AYLED"
FT   CDS_pept        1478048..1478503
FT                   /locus_tag="PKH_143270"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143270"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143270"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LIM5"
FT                   /protein_id="CAQ42109.1"
FT                   /translation="MTKLHALTYLKGNNFFLQNRKQYYNYGTTKGAMSLQSLCHHFIRR
FT                   TCAETIHPFYYENFSTLERNNNPAEGASRNQEDNRNMRHSLTTSGKKQGEINEADNRDE
FT                   VNNGTMEENHKEIISTDDSLQEFGYKYEKHEPTMFGDWAHNCRVTDF"
FT   CDS_pept        complement(1479037..1482789)
FT                   /locus_tag="PKH_143280"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143280"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KD01"
FT                   /protein_id="CAQ42110.1"
FT                   /translation="MHYFRKKKNEPVNKREAFIANSKYTKQNRTLKSDDVFNGVDAFEE
FT                   KPKQNGKKISHMNDTHNLETSRNSFLDGSFKEEVGITSNKGALSNQNEKFNSGSSFEEK
FT                   KNLDNSSSEYGMESYNEDLAKEYSQKGDIPNSGLKHSAKNKEENNVSNSSEPSNSNVYN
FT                   HTEGTNFKNPSPYNSVRDKIIPKNVDRDIQHLRNSKMDGEFKQFVGSPKNNKQNSSLLS
FT                   NQGKTNDFPQSDRPVNENIPPNSSYISSKSFNKTTGTGQSGTGHMKGDHTDHFYDNTKA
FT                   VSIPPQLSANNSVSVTSGDIRNMETNLNSTERNWTLQKNERAQQGMHHRSPDNYGENAE
FT                   ESTNGGQIIYKGQHYHNSNLLEQSDRVDSSAHDRSGNFYAGIDGNDPTGDSLNSLQHSQ
FT                   RYIDIGESGDRQNVQNEENVRTRNRDNFDESFLKNNNSSTKNEEFYKMLNSNMREGKEK
FT                   ISGEKFKESVDAELEQKTRGNRRHVHSSRSFTQPIHVQEELGGHLIESTGHQNEQFLKY
FT                   NTAINSIQSQPSRLSTRKDLSKSINAKDISAENVSGRQSGQIEKVYKRDESNSRHIESR
FT                   RSYMHVENVQIESRRYSISSKNSYNNRSRENFEEHKNNMILSEKRTMRMPESLIELNFN
FT                   LNSSVCSISESTNEMNMENGSLKCESGQEHLMNTSEESADNRMKVASQMEYRNSVSKHS
FT                   RKMESKRQHEDPSNMMIESQYGEDTDHLMDSQFEQSSNHLIESQYDIEKCNDNMSDINS
FT                   SSTSLNKSQHQMSNDISDERSNFIKPGNYTHKSQYGNVNSGIVHTESRRSPINLSHSEM
FT                   QLRSISPCPNNNLINQNKVYKESNGTLTESRNGLMNSQSQHNEMWKTLTETNDTFGNSK
FT                   YSHSVSGSRRSHTESASSGSMNNGHHDPDNLKKYADHPKGYADHPKGYADHPNDNLEER
FT                   PPEPSHSFQQNRKYINEMNHYYDNRSNRPHLNRSEYVPRKNIPHNYKKFNTCVRDDDQK
FT                   ADLLQAFQKGIKTKWGMNNSQIQGVNEMGKSRNALENRQTNHTIHTSENYNLKKQQSRN
FT                   YFSTGDSKGNVPQFSRRSRISHAPLVHNEDDEQKPGGKMHYNDLENTFENFEKEGHKDG
FT                   SDLEFSFDQENEICKNMSKDFSTSITNSQLLMSGSHNIMHHSGINSSNHFELEMSNKSN
FT                   KTSDMDKFAMENNFDLNVNSNYIKRLTMNDNFVNTNLQISYMENEIQNKIKDLDNFWGE
FT                   NFENKCNSVLNRIEKLLSSDFFSES"
FT   CDS_pept        1483619..1484722
FT                   /locus_tag="PKH_143290"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143290"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143290"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LKU9"
FT                   /protein_id="CAQ42111.1"
FT                   /translation="MIELKNLDFHLENLGESNRCFNDEEKLGLLYGMTNLEEKLNKQIY
FT                   LWGKIEGIQNDYYIVYYLNQDKFFPKKKFYYCNDDYEFKEVTKGNDKLIEKVEKKTPFT
FT                   LFTGVPGSLYSEGRKSKGGQDGSHSDGIQGQCAGSDSSEASLSDSEKSSTVQSSSEQSS
FT                   SAQSNSENSDNSKSEHQNSEDTQGRHQKEGAQSSESEIEGGTPKKEKKKIVEKNKQKER
FT                   QSDITELERLSYVIRKIDEEAFIVPYNSVKITNNLEMKFANFTGFNMIEALKLTSWVHF
FT                   RYPKNLTYDKIKSYNTFFLNNFLDSIKSDIPTSMWNVKVNNQLSKISIMNCFYPGYVFY
FT                   HLLNTPFYASVYIGNGIPNYDLPFLLP"
FT   CDS_pept        1486673..1488460
FT                   /locus_tag="PKH_143300"
FT                   /product="receptor putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143300"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143300"
FT                   /db_xref="GOA:A0A384LN65"
FT                   /db_xref="InterPro:IPR009637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LN65"
FT                   /protein_id="CAQ42112.1"
FT                   /translation="MIWKSTQKVKCKTEFLIVVFLVLFASITNSQLIKLDGQKISTNYI
FT                   LYVLKGLYIFGKNDTPYVLLGEKKDMATKGPHAIFENIGISTTDNKNTKYFSFDIEESR
FT                   TNGQENNESDEENKSDEHPTSEMNHSSDGDDDDDDEKDKKDKFKINLYKDNPYLRKKKE
FT                   YMHKHEDDEVLDAGNLFLEVIIMKESDFNKFYLPKDTNVCCHMEENGMDGNDSYTCPGR
FT                   GYLKRYVEESSMYSLKLPVYFLNDRISNDDEISPLENEVNHENFLKKIQNKHIYNIDDT
FT                   DVYALFLSNCSDSKKYELELHGNIHILNKYGYLPGDKIPKLNLYVVCMLIYAIYLFTWI
FT                   YLLIRNKQFVIKIQIWILVCTFLYLMENVFLFLYFLVYNLRARVNSNLLFLSVCSSILK
FT                   NVCSYLLILLGSLGWGLVIPTLDKKTFIKIKVLFFFFIIFDFIKQFLDMHLTDAEVNAV
FT                   YFLFCIIPVTIIYSIIYLWVFTSASKIIIQLNEDKQYEKLNMFKKFFNVLIFSLIFSVI
FT                   SFVIDIVVMLFVDNTIWSLKCYISEGIISCLFLIIITAMFMLFRPSDRLKRISHFTEIG
FT                   DMDEMEDFSQFKGSIEDIS"
FT   CDS_pept        1489844..1491508
FT                   /locus_tag="PKH_143310"
FT                   /product="seryl-trna synthetase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143310"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143310"
FT                   /db_xref="GOA:A0A384L1E0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1E0"
FT                   /protein_id="CAQ42113.1"
FT                   /translation="MHMRNLSLLCILLCVHWALGRRNRHGIKYYINPCYGDPQWRDLRA
FT                   VKKRTPLVCKNKCTGDQWREDEQTECGMSLNILKENENKVIENLKKRGMDKNIDNVKIL
FT                   KDLIEEKNKLEVLRNNLRNMRKVLSDRVRNLMFAENATDESATQGRMSDETPLYIDRSK
FT                   VETEGHNPLEDTPFEEYNVERVKEQINQINEQININETKITHLRYKIEDHFSRLPNLLL
FT                   NKVPEGKKNNKNKIIKMYKRKNIQTDKDNTSIEPHEEILKRFDRNQHIFANITNKIGFG
FT                   YNILVNNIAKLERALINFMINTHVNKFHYTYVKTPVIVARSALTNTGQLPKFENDLFKI
FT                   NDNYKILNEEAFLIPTSEVSLLNLFRNAHLNFENLPIRLVSHSSCFRIEKNFTYGKTSK
FT                   GLLREHIFEKVELVNITDRRSSHVFYKDLIKHSEYILKKLKIPYRVVLLNSFETPFSAS
FT                   ICYDLEAWLPSQQRFIEVSSCSNCLDFQARKLNLKYKKKDSNFFCHTINGSGLAVGRVL
FT                   AIILEQYQIGGNSPNEKKELIIPKPLRKFMNASIISL"
FT   CDS_pept        1492306..1493199
FT                   /locus_tag="PKH_143320"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143320"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143320"
FT                   /db_xref="GOA:A0A384K984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K984"
FT                   /protein_id="CAQ42114.1"
FT                   /translation="MISLFRKKSTNLINARYRKRELHIKKCYNLRREFTSGKASGGKIG
FT                   RRDVKIENWGEKVNPRVNTERKGRPTFPASVEPDTATSEEDPRDIYFKNKIIEKKVADI
FT                   MIKNSHNESLFEFLPMEGRTNKVPKGFKICQCLFLLALSSGVLLIHILPEVGKENYIRD
FT                   IYSFEIYCCSSILVFHGGFNSLLQLIQYGVPPKRKYKGLYNSLRLISSIIPLFFGLITS
FT                   SLCESFPKDSILLLMLSYTSLLLNYYLLHNKCLVPAWLFRQCKLLVCFVLFNLVLLLIS
FT                   EAQIYRGRKVSIQVDD"
FT   CDS_pept        join(1494136..1494180,1494419..1494877,1495046..1495177,
FT                   1495329..1495631,1495757..1495921)
FT                   /locus_tag="PKH_143330"
FT                   /product="glycerol-3-phosphate dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143330"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143330"
FT                   /db_xref="GOA:A0A384LPK9"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR017751"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPK9"
FT                   /protein_id="CAQ42115.1"
FT                   /translation="MYKSLFDKLKEGPLKISILGSGNWASAISKVVGTNAKNNYLFENE
FT                   VKMWVRDERVNGESIVDIINKKHENVKYLKGVSLPHNIVAYSDLSKVINSADLLIFIIP
FT                   SQYLENALKLIKENQSINIGKHTRAISLTKGFIIKNNEMYLCSKYISNLLGIPCSALSG
FT                   ANIAMDVAMEEFSEATIGGNENETLLIWQRVFDLPYFKINCVNETVGVEIFGALKNIIT
FT                   LAAGFCDGLNASTNSKSAIIRIGVKESFLFGKTFFNYSDVSIFFESCGLADIITSFLSG
FT                   RNAKCSAEFVKCKPKKTWEQLESEILKGQKLQGIVTLKYVYQMIKKNDLTHEFPLFTIL
FT                   HKISFENGDPRELLNIFMNNTVSGIAT"
FT   CDS_pept        join(1497760..1497951,1498807..1500090)
FT                   /locus_tag="PKH_143340"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143340"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143340"
FT                   /db_xref="InterPro:IPR019111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KLT3"
FT                   /protein_id="CAQ42116.1"
FT                   /translation="MAHTNEIIINGASSRSMQSQCGNYQIVTARQERKMDERKSTQRSS
FT                   FFTKRTAMLFFVVACIFLKHQDDARRQGVNASLQVHNKVGRNLSSKEEATPSGPNDHRL
FT                   GQTEDHSEGGRQASPAVGEMEYPNVRQDVQKPAEQEAPLFGERTNYITDGDSGNYAIFE
FT                   SLCKNSFNDNKKKKKGKKEIEEEKKKEEALLKEKEKSQNKLSIGNTKVYSGPLAALEKY
FT                   EDELEEERKRSLRYDKEERRKNKEREEYEKIEKWGMDKKVVVENDDNYLEQISEKRKRS
FT                   LRYDEEEHIDDEEEMNELLFGEFKKWENYGTHTIPSSHYEVLCFEDRLNDYEINKELNE
FT                   MEEMPKKCELVSLYWQSFMNEKRKYINANKRLFKKFLELKKKQNFDTMGKCNNKWKKCS
FT                   KIVGTNFKEQREYVNDVFYSHMTKENLSKDEFKEILGHVRDSWKELTLKVTQECAALLE
FT                   EPIVPDVKILDYDPYYGHGYFKVTRMSSPEVSS"
FT   CDS_pept        complement(1502024..1502437)
FT                   /locus_tag="PKH_143350"
FT                   /product="signal recognition particle 19 kd
FT                   protein,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143350"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143350"
FT                   /db_xref="GOA:A0A384KHL5"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHL5"
FT                   /protein_id="CAQ42117.1"
FT                   /translation="MMNPHVINANDDSKDYSRWKIIYPNYLNRKKKVKEGRKINLDYCV
FT                   ADPSVDEIALACKELQVQYVVEKNKYYPRDWLVEGRIRIKMPDSGSSNIYSKFALMKQI
FT                   GLKLQTIKANVGPTTTVNANSATKKKKKKKNKD"
FT   CDS_pept        1504663..1506849
FT                   /locus_tag="PKH_143360"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143360"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143360"
FT                   /db_xref="GOA:A0A384KWT6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KWT6"
FT                   /protein_id="CAQ42118.1"
FT                   /translation="MFKRSLIFLVISIFSIALVVYKRVKHESVNGEYYNVGGNIGGAGG
FT                   RSPWGGAHECSLSGEICTMDYSDIGTEQDEYKIVHYKGTRINKVKKGFKQIFQPFFKEM
FT                   KCKKNSKHIISLFLEFFENSKVFLTVFLRSSYHMLYAYGILLISFLKILFLWYIILEPY
FT                   MQWLLLKLKIMYVNLDQKTKKYVVTMLCTFLSVLYLIHSGVIKYILNKISKFYIYLLRK
FT                   VFRINKFLFNILPYLLSSLLYVTLVKTLPMSFISFFIYSIFFPLPSIYSVIIILKYVYP
FT                   SKISEYLADSVTEKLNSSKYVNAMSQYVILRDGELVEEDQVEKAGEGGETNEVEKANGG
FT                   EKAIEAEKANGEEKVIEEEKANGEEKVNGVEKADEVEKENDHTETELKTDELKDNHPSG
FT                   SKKKKFSLISLENFVFKSRKKDRSGKVTENENQDEGEMADPPASKRKQSSICESVGEPK
FT                   GEGENRDSHYDVPILLEYWLFINILKFLNFFFFFRNYSKTSFMFEYFTLFVICLNVSEK
FT                   LHEFVFLKDYKSSILVRILKSVLVSTVDFVLYTLFNVRLENEGKKGNKSVEQDMQNNER
FT                   SNLLINLSKIVKDKLKLNETVKFSLTCLKSVIMENVVESVQVPFYIKIFINLLLYMPQL
FT                   ILLIFPSFILKIYFAYFFFIFPIFGSLKCLEEKNSIHNKIYFICYFFFYNIASATVNHA
FT                   FFKCLPFYNLYKIIITISVQTILKYIFNVIQVKS"
FT   CDS_pept        complement(1508164..1508910)
FT                   /locus_tag="PKH_143370"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143370"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KQW4"
FT                   /protein_id="CAQ42119.1"
FT                   /translation="MKNVAFSILHISSLFILYLSSQSGLYSCKNTGKTASKGNHSNPNS
FT                   AVNSNSLSTEWSEKGYNFMDLVKNGYLKNKGDLDEVKDYLADELAGKIKDKLNGILKDE
FT                   NIFYDLENMDEEDISDFKNYLKDMSEYIGLKAADILNSNLEDSLKSFLPKGSFANLKEA
FT                   MGSSSPVNLNFDDEDGETKKGKSKKGKYKKGYSNDENANDENANDEDVDETTEDFINEL
FT                   VDAYEEKHHKDLENYAQEIKNHNNLD"
FT   CDS_pept        complement(1510620..1511177)
FT                   /locus_tag="PKH_143380"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143380"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KT14"
FT                   /protein_id="CAQ42120.1"
FT                   /translation="MNKVNRVSIICAFLALFCFVNVLSLRGKSGLTASSSLEGGSEFSE
FT                   RIGNTLSSFLSESASLEVIGNELADNIANEIVGSLQNDSASFLQSEFDVKAQLKATAKK
FT                   VLTEALKAALEPTEKIVASTIKPPRIKEDIYFLLSPVVRSLFNKVEDVLHKPVSDDIWN
FT                   YESRGSSSEEEDEVDSDEDFLD"
FT   CDS_pept        1513737..1517045
FT                   /locus_tag="PKH_143390"
FT                   /product="MAC/Perforin domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143390"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143390"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KBW7"
FT                   /protein_id="CAQ42121.1"
FT                   /translation="MRTTVERVLAHLLLVYLSAHNVKCEISRYFLMHEKYDDFNLEKFN
FT                   SSDFLNEEKSYIADVNSVGKRKRLQNDNGIFAGNPLYGCFNKYALRRNGQYGQNVVNKD
FT                   RSAKLNVKNEPAKCNGDTCSSFMLIKAHLPARHTVKKNEKNHTLCNLQREGRNCKKIPI
FT                   GEEKMEQAVTINKHNYNSNLVDLTRELNKQHMPHGFPEGYSKEKKKNVHTEPSDIQSFT
FT                   HSERDTASPSNMKKNPKREEKQIRIHGNSKQNELPPNERSKNGRDNMVMLPPYNDSIGY
FT                   SGGNYFEKEKFINIKFPIKISREVAEQNQEMDNEKQIMKKLHKHQAPRNNSDANFAEFT
FT                   NKEGEADNTENRNKNIVNSKLGEGNLIGIFKTPYILGRDSFFIKNEMEDLKQINSERGN
FT                   KQYKDFDLRDTLMGETGSITNTQPLGGGTQIMKNKNNVLTHNHNPNYGENHATYDKVHN
FT                   PDIDLSLKYLGLGYDIIMGNPEGDPTINVDPGFRGPVLQINIEEMRVNKDISGDLNGTT
FT                   SLYGSDIRGGGLPYRESTLMGDYTIEEHKTKLTPWVIPEHSCSQSKNVEEIQNLEQYKM
FT                   ELLSDVKVSTPSIFPYSFSASAEYKNAIKKLKVQNNVIFMMKIYCLRYYTGIPTTTSWR
FT                   FTDNFRNALKKLPRTFDGLKEDSQCSYEYYINKIHTPECEENVNKWMMFFRLHGTHVAH
FT                   EIYLGGKIIIKMNMEKDEYNKLKDNNISIKTFFNLYFHKMGLSGGYSKHTQKLVKKFRT
FT                   SEDISILGGNPGLNIENSTFFEKWVNSINKNSMPIRTKLLPFSFFMDDPYMIQAYKDAL
FT                   TFYGLTYGVQIFDHEKYSHVVLSIGEYLEKCTQKLYAGPPPGLLTCPLGSSLLMGFSLN
FT                   LDFYKNKDLSSTNGMASCEQMKESCSGNGFGKKYSDIRIWGLCSEKPLDFITQVVQQGE
FT                   SPKITASCPGNLVILFGFALMKGKGSSSANKVDIYPCRTGQSSCSAVLQNNKIKQSMIY
FT                   IACVDKSTNGLGNIQTYSKVKNMGYVNSDKDENDTSLSFACPKNSSLIFGFSLEFHTNF
FT                   SKTRNNFTGCSKASNTCHISGTRINTKLGFFKPDKYSLAIVAVCSTRRELSLRA"
FT   tRNA            1518100..1518171
FT                   /gene="tRNA-Pro (CGG)"
FT                   /locus_tag="PKH_143392"
FT                   /product="transfer RNA-Pro"
FT   CDS_pept        1521801..1525025
FT                   /locus_tag="PKH_143400"
FT                   /product="dna-binding chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143400"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143400"
FT                   /db_xref="GOA:A0A384LHX8"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHX8"
FT                   /protein_id="CAQ42122.1"
FT                   /translation="MKDIILPKNACTQSEEQFCLQDIKAKNEEDYASQLSSLPYISTHH
FT                   GVSIRKKKVEPAGFMFYVKYEIALLKGKKKKTKEGKQIPIEEIFLYKEKIDYLNELKGK
FT                   NQGEEEPHSEGDHGGDYNKEKSTKNNKDKNYEDDYDDTNNMDSSNKKKQEKANNKKSSN
FT                   LVKKCINNNINVYEVLSVEEADDLETIKASYKKLILLFHPDKNKGTTFLNQKEKERKRK
FT                   KEREKGKDGNRNDDNAKAKGQHGSQETQKDFMYYMEKYNIEKLTPEEKKIMFLKIQDSY
FT                   AVLSDKTLRKQYDSSIPFDEYIPTLTELEEAPNFYEFLRPVFKRNAKWSAKKPVPDIGD
FT                   EHTDIKNVKYFYDFWYNFINWRDFSYQNEYNYEEAECREERRWMERENKKIQKKASKAE
FT                   NLRIIKLVDLAYNNDPRIIAENKRVKLEKQRKKELSILEKQKKIDGATNEMEKESTTNQ
FT                   QSNDKKNKDNKAAVKIWRHHIKSLCVTKLAKYVDSDLVQERLSLMPFETLCEFIDDIYV
FT                   FLNFNLQKGNSLSVEKTNVSNDNQVIKQSQGGKDVTHIAHGKSDSSALINTNSVYENGS
FT                   SSLVGMNGIAKQDSNNIVKKDPREHANSGSSKHSAGYTNDKNYKTKKEENNTLNGHIAK
FT                   ISNDDHKDNFSVDKDKQNQVMNSKTSFERPPSENNHLHHSKIETGENDPQVEVYTTGNK
FT                   REDEQNEKKLVNAEKVTNGVNSGEPKVSDGDDSKRSPSENMDMRNNTMSSTTCSTASST
FT                   TRNQVVNQTVKQVVGQMASQTQNIKDSGGNRTTGFIGHLKNIELAEKEIELLILIFKKY
FT                   INQFTLVVEKEQTKNLEETANTKNKNEKGAQITEEETINRSPSPVQEQVSDNVKLMNEL
FT                   GSGHVSENDKKKNEESSNTCGKWTAQEVSLLAKALKSYPGGTRNRWEQISNFIKTKSVK
FT                   EVIKKTKEMFENETLKNLSRNFEETAFDNFKNQNKGVMKKIDDNLDKRDVKMTTDGEEN
FT                   LTNNSADNLTNNLTNNLNGHAEVKRPWTHQEQHLLEQALMKHPASLPKKERLQLVASEI
FT                   KTRTLEEVILRMKTLRAQILAKKAAK"
FT   CDS_pept        complement(1526245..1526664)
FT                   /locus_tag="PKH_143410"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143410"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143410"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJP9"
FT                   /protein_id="CAQ42123.1"
FT                   /translation="MLKNCFEKLVRFSHQCVRHYCKNKNEVLLIKRFSFATNTICMRTH
FT                   RNSILSGFYLPFLKSHFNFVLKKQISTKRRRYFKIRKHQKKKYKKKRMGLSTIPWIPTK
FT                   EKVRTYKLPRQSRLINKRFMRDKKGGRRYRLKKQR"
FT   CDS_pept        complement(join(1527580..1527682,1527805..1527864,
FT                   1528007..1528139,1528278..1528328,1528465..1528551,
FT                   1528681..1528861,1529151..1529182,1529328..1529682))
FT                   /locus_tag="PKH_143420"
FT                   /product="type IIB DNA topoisomerase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143420"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143420"
FT                   /db_xref="GOA:B3LCG5"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="InterPro:IPR034136"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCG5"
FT                   /protein_id="CAQ42124.1"
FT                   /translation="MRGNVDVTSLLEKCTLNFLTSLLDKKKKKKVLSKGKILEMARLFC
FT                   IIEIVSKNLKTNTHSTLRQIFYTNPHLFMSQNVSNVAIGKLTKIIKIPRELLNIYNSPK
FT                   GIIRGNIFLREKKSSPWVDCMSIFETRGHLICPFGISDIKISPDVKYVLIVEKETIFFR
FT                   LLQSDFISNYGPCILITARGFPGWHSHINTRQLLYEIRRYNKGLKVFCITDYDAYGLSI
FT                   AFTYTSKMESKVYYVEDVSIDNLFWLNLFSPEEGLQKHVLKDIDISKLTLRDIRMLDNI
FT                   CETVKSSRKFCSSEIIAWTEHANHMKTSGMKYEVDAIQDIEKYLSIRIEELL"
FT   CDS_pept        1531267..1534416
FT                   /locus_tag="PKH_143430"
FT                   /product="RNA binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143430"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143430"
FT                   /db_xref="GOA:A0A384KFN9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034423"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KFN9"
FT                   /protein_id="CAQ42125.1"
FT                   /translation="MMDNAAASLSNMDTADSNCNSRPFQNESNFDKTRLIIKNIPKYMN
FT                   EMDLKKHFFKMKGNYEFKITDIKIMKRKKIVKNKEIFESRKICFIGFINNTDCENFKKS
FT                   FNNTYINTSKIVIEDAFSPLISKNAQQSRNATSYALKRIGDIQKMKKDKSVKIVKSNNF
FT                   VNKTIPIKKTKAGMSTTRSHMIFLDDQPVQGEVKEEEKKKKKKKKKKKEKKKIKMEGDN
FT                   PSERLDPAEKTRTNGAKEEVDEEGNRDDAAHADTGDDAKSNAENEEAEEEGALDWLKKI
FT                   SKREESEINNHSDKNDQNDKGAQRNRLFEDEMSTASNLSSDEKEVKKKEDNGMDDENCE
FT                   NMNTGKIIIFNLPPVSEQDVKNLCERFGPVVDVKVFRNVKKGAVVLNLNEKKNNKSSDD
FT                   FFIKLLKENHDSFANEKVKEKKKKKKKVDEDDSGVEKMNDRVIGDGEAEDWKNKNRSNK
FT                   NESILNSDLTNVKVYAFVNFMFPSACERAKQFLNHAIFRGKVLSVKYAKEKIGDYEYTE
FT                   KEKNNVFIKLSHDSKTSYKKILEIQKKRNCQNENIWNILYTDINSSIHSFCKENKCSPN
FT                   SILNIKDRNIAVNVSLTETYIINKMKEWIKKEGIYLEAFEQIYRKRDEGGEPSGETDGK
FT                   TDGDNPPGEEPSHTNHVVKYKRSDDTIIVKNLSIQTNQKEVISLFKKYGVLSKVSFSPY
FT                   NNIAILQFEKAENAKKAFISNSYIRYKKLPLYLEWAPMNLFQKKENQDGDGSSNKGETK
FT                   SGEIPAKEAVKKSEQEGAPKEEQHYSESESSDEEITHASIYVKNLNFNTKEEDLKKLFE
FT                   KLEGFITCNIVKSKKAISKKNDEKGKEPEQKLLSQGYGFVEFKSKELALEAIKKLTATT
FT                   LDGHVLELSLSRNRVKKKKNKNNEEKEVVKEKKKITKKLLVKNLAFQVTKEELRKLFSA
FT                   FGNIKSVRIPKNAYNRSRGYAFVEFMSKNECLTAIESLQHTHLYGRHLIIDFADDFIFD
FT                   KNVNEFDKMKEEGVNNNNGGKKEKCITSEQAKRKATYEKEKKNQVTESKRRKVMNNMQD
FT                   I"
FT   CDS_pept        1535820..1538315
FT                   /locus_tag="PKH_143440"
FT                   /product="gtp binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143440"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143440"
FT                   /db_xref="GOA:A0A384LLX8"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LLX8"
FT                   /protein_id="CAQ42126.1"
FT                   /translation="MKLKVSFLLTIFTFPLVQFCNSYMIKFFHHPGVNNLFPHNKVQKK
FT                   KNLGPLGYSSHIPPFLNENNELRKKVYRFELFVKNGNLRNNSGCKNGRPTHEGTKIDGQ
FT                   TDKELEGGEEKYYDKETTLEEVDNQHGSADRREDEEREKGYQKGVHFLSDMTHEGGTLS
FT                   NGDSPGCASVPPDGYEGWTQNCERHMGEISSEEEGKGDFCEKGENYEGQMGSEEKALQG
FT                   EESTQAYGGKKKNFHDESLRERKGKKKDVDLKIIRNLPLISIIGRPNVGKSTIFNRLTR
FT                   KFQEGSIVLGESSTRDKIYGEVDWDGYKFEVVDTGGLIFEDEKFCKQIRDQIMLALKES
FT                   SVVLFVVDGIKGVHPVDLEICRFLRKYIKNEYISKMAIRKKRTGQVNHDEVAEHSAEDA
FT                   SKSSNTSSGTSERFAVDNTQTDITSRKSDNDADMRNSTEKETSSPEEKEENDDQKRAML
FT                   KVIVCVNKCESYKDGNVKAQNFWELGFGTPYPCSGIHGNGLTEILDECIKYIEKVEINE
FT                   LEEERNEENTINISFIGKPNTGKSSILNKILNCNRFIVSPIAGTTVDSIDVLVKIKDSD
FT                   RIYRLIDTAGIQKRKKNIPFSEKTKYEYLLFNRTEKAIKRSDVCILVIDSFNGISSHDI
FT                   NIARKIVQENKSCIICCNKWDLIYNKNDIFNDTKNYVLNLLKPVDFANILFISAKTSQR
FT                   LLNIFDNAEETYKQYTRKINTNSLNDVIKEALLLRPPIPIRNKSLNIYYAFQAHIKPPG
FT                   FVFFCNSRKCAYENYTKYLESRIRESFNIRGTPIRIYYKQKKKRYLIKKVKNPDKYNLD
FT                   IEAIQRDFLKTQSGQKSQG"
FT   CDS_pept        complement(1538877..1541648)
FT                   /locus_tag="PKH_143450"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143450"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143450"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LQ30"
FT                   /protein_id="CAQ42127.1"
FT                   /translation="MKKKKHEFSYINSDEEKREEINDMLKNLKNEERDLCFPLLDFYFL
FT                   NKKFKYHNLRESLEINNNVNEYINLRLLRKEIVPKDVSFKTEQKNREMVVHNKLKNQME
FT                   EACLKDRDGDLRRDSQSGNRVSNHYSIGGDIKAEAAIVENMNLPHDIPTMWKKNDIIGT
FT                   FNPVYNARDQVLNDNSIDSIPTIDIFYNSSKLLTIQTVFEPISNYIYLLRLLPKFCLPL
FT                   YDSGILQYACEDPILNPKLRGLEISYRLLVHDILFYAFFSYLSDLPFWAKPPIELLRIY
FT                   NYESLYSFNDYESEHTERLVFHNIKNILYNFSDTLNKIELLYPKNYYITIFPNIYFKNI
FT                   IEFLKSEKFKLKKIVVVLKGKNFIDEKMIHHIKSNLENFRGMTTENVKKEINHKYCPTN
FT                   NGRNKSEAVKYDTKSVIDAIKRCHNCDEDFFSLAEGKSVSTTKDRTRRKSNWKEKMDMS
FT                   SRIDQMGEGKNHQSDKPNSLPEPIQRDGQLCSTSPEDTYPSENNNHVDKERATCSNNIP
FT                   QEEGKPINISGEGIPSGFEKSWDISNNGESSIRSSWRDFPFEDVDKKDERDQQRSHSDE
FT                   SDGKKNGEQGDQLSTIEQYSEEDNSLRKKNPIDMSDNYNIDKSVYNMYYQQENNDREEE
FT                   ASMMESKKFQNSRRSSNSSESSCSEDDETDDENIDGFFKTKKLKSTVYDKDNFSFSKFM
FT                   NKIINYEKIIDYLNNDPQRQENEDSKIKFYIKLLLFEKANSPYDLNGWTNVDGRENVSD
FT                   EDQVRSTTFASDNGQIDGASPQGGEDSSIRADGTVSPTDDDDNLSGVYQRTRREGGTSS
FT                   SATISVSVPNDTMMGRNNSNAADSSQTSLFVNNQNENETRTDEEETVLNVTEDDHVVIS
FT                   SDYISNMIRNLRETYGVSNFLSFSSNEGEMHEGTFNLDDVQDSQTRLTFNFN"
FT   CDS_pept        1546115..1546771
FT                   /locus_tag="PKH_143460"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143460"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143460"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KQ18"
FT                   /protein_id="CAQ42128.1"
FT                   /translation="MTITLDNLNEQKVHNQKNKRKYNCRLNFKRFTRRRNNYGEDNRDS
FT                   KINIKTALIKNEVISDDSDEFIDSNLMRTCHRFRLYKHSNNKIDIYYPYDKKKLDKYDY
FT                   ERDQTFCSLTDIEDLVNNGDERSNKFFYYKNKSLNDYKSCFEKKNKKTKWFRLRKKKKK
FT                   DYAMDESLKYLNESVCSNYKEANKNNKLDSSSKNNKNCVINTTVNGIRGFSAWIF"
FT   CDS_pept        1548872..1549870
FT                   /locus_tag="PKH_143470"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143470"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143470"
FT                   /db_xref="GOA:A0A384LA20"
FT                   /db_xref="InterPro:IPR004939"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR016901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LA20"
FT                   /protein_id="CAQ42129.1"
FT                   /translation="MAFFRTNKIDKNRNFKCILEWEKHILGGGLEGGQSHESEEDEGDE
FT                   SYEVGRKDKWDPSADSRREETNERRGKANDEEGYKESHSSCTTTNSMENEDNMENMTNV
FT                   KCESNTQVVEGDFLWSVISALNGGEKSRAVRLRGGDKHAEQVVHNIPQIRLSKKYVDVG
FT                   CLGTWKLSSSKSISDTKKLKDNNVNTYWQSSGLGPHTITIQFFKLTKISKIYLLFNYLL
FT                   DESYTPYEISIKVGNDENRLDVLCTTFCDVNKHPVDHPFWFIIDLANFQLHSYLYNYNM
FT                   NPFKRMNFIYCRCIQICVMSSQHYGRDTRMRQVKIFGPTYPFYKHDKALIL"
FT   CDS_pept        complement(1550349..1551806)
FT                   /locus_tag="PKH_143480"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143480"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZ15"
FT                   /protein_id="CAQ42130.1"
FT                   /translation="MYKDIEKEDTEKTGEGKNEKVIIRVKRKVDEMIIPSIYVKRSNKR
FT                   VCNGIFYKHFDTAIPEVDIEKENIECVNLLRKHEQCHNSSSDLSSLIEKKRKFNSLKGY
FT                   EKDLKEAINNLKRYRIVNENIQYVNLDAQKKEIYKIIDVNLLQECGYANVGADAGANTG
FT                   GAQKDETKWECARRQTEKDAHNKAEQEYEYDLYIVDDQKIEVNDYMDYMYHIKNNNVDS
FT                   AEVIVLEDVYGNNTNEYDSKSFSSSSSDHDTVKEMSDYPDESSSNGDGSSGVCSVDGSS
FT                   DSPVRSGSYDRSVANDHHHGNNIHNDCYGGSLASDYHLENNLHVASSQENSFPSDFYDE
FT                   NYVDQLSNCSEDNLFGEDLKNIGHEDNLFGSRRCAMNNWESSIKVESPQGGYNNHSGYL
FT                   DQRGVSHHNAISSSALSRFFPQKSTPKKNERKIHTHNKKMNSLMFEEEIKDELEKRLKK
FT                   KNENMLNVTLSEKLKILEQMENEYYDK"
FT   CDS_pept        complement(1552737..1552991)
FT                   /locus_tag="PKH_143490"
FT                   /product="zinc finger containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143490"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143490"
FT                   /db_xref="GOA:A0A384LB94"
FT                   /db_xref="InterPro:IPR007872"
FT                   /db_xref="InterPro:IPR036671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LB94"
FT                   /protein_id="CAQ42131.1"
FT                   /translation="MIVENNHQEINEAYDVIYEEVKLEDFEFDETIKTFFYPCPCGDIF
FT                   EVTLEGILKGEDVLRCPSCSLTIKIIYSPNDLKKYASDA"
FT   CDS_pept        join(1554858..1554907,1555116..1555207,1555375..1556486)
FT                   /locus_tag="PKH_143500"
FT                   /product="Permuted Papain fold Peptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143500"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143500"
FT                   /db_xref="InterPro:IPR008580"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1D6"
FT                   /protein_id="CAQ42132.1"
FT                   /translation="MSSFNVKLKIYDLSRGMVKLWSPFLIGKQINGVWHTAVWVYDMEY
FT                   FYGGGIMCLAPSEFESYYDIQPVNVVDMGITELQQSHFHEYLNGIQPNFTEDKYNLVNW
FT                   NCNNFTNEICNFLVGKNIPQYILDTPKEVMSTTKGKLILDMMQSYQTNIAPGFETNSSL
FT                   LNNGSNEESKGANNRATCSKEPEVNELPKVPSVSLDNFFNENKIENLLDEYIKNEKYDV
FT                   NEKKDFLSFLKNLLDNVSTNPDILKNRYVHVTNFPKFQNEDGSSEYNKILSSLNFFQGY
FT                   IENDEINNLQKFTIFVDPKYNKMHAFTEHLDLFLNKNVFLKNPDKAIFKMETLNFKDMC
FT                   EYAAYRDKKKSNSNDVLIFISEAFLTNHFDVTNEKNDLSHFNKVKAGICADPKVEREFL
FT                   SSTSDLLEGRINELHSSE"
FT   CDS_pept        1558639..1559661
FT                   /locus_tag="PKH_143510"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143510"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143510"
FT                   /db_xref="GOA:A0A384KP58"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR036383"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KP58"
FT                   /protein_id="CAQ42133.1"
FT                   /translation="MRSFTFIAVLLCTICYQVISDNFKRQNTNYFLELLQKNGNYKIVT
FT                   LEPECTVGVGNQLGQAPQQSDVNRKEFLLHNYMVIKNSQFTNDQLLEIYSSKEENAKSH
FT                   LVLIFYIGDFNFSVGSNSPYEVNLILSLMAGNKKSTCKINNYNMFLLKSADVRNPSELE
FT                   ILSEPIKFSISKTTGSFRININNFFLDGTWRAFVKDRLTFLLKSEDNCYTVLENKLNKP
FT                   SLIIEKKNMFYTEWGEWSKCSMECDHPDNVQIRERKCANTSGDCFKGDLKETRPCQVPL
FT                   PPCNSLFELKESSTFKIAIILLPIILIICVMGILYHIFYKKKGAEKELYENVAGRFMYD
FT                   "
FT   CDS_pept        join(1561606..1562494,1562619..1562801,1562948..1563229,
FT                   1563436..1563506,1563626..1563646)
FT                   /locus_tag="PKH_143520"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143520"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143520"
FT                   /db_xref="GOA:B3LCH5"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCH5"
FT                   /protein_id="CAQ42134.1"
FT                   /translation="MKGHRDTKHISFAVVKFVVSFLLINICAISVRKNVEKIRFIMHQN
FT                   DDNDIPIGKVVPYFSEETNIFENYMVKKVSHEDNICINAIRNNKNLNAPMEKMLELENE
FT                   TQVIQVGNKRNIYGYTNNLLRDGNYQLSNIALTFKVPINQEICEFNSFNNYILHINYLK
FT                   KVSFEEIKTKLEKGVFIFVTLPDGYDLNKSIASFMGDKYSISKGTLENDYIKIDITHVI
FT                   QYSICQKENHSKANNSAEGNPSDNVDNYLIGKSVEFVLLTSHELSDIILFSPQMKDPQF
FT                   LHNYKNMRNIVKLKKALKERHSQWEDWSPCYSVCSDDFSYSCRRNKCMEEDADFCDRYY
FT                   NLKFRKCESAACQVLLKEKINEVPKEDVQEREKEDGKAEEVKDQKVEASVDVGVDAVSA
FT                   IGTAAADVAANEAENKEVEVEMHAAADEDYLDALKFRRRKEKKVNFFMWIMNNKKMALG
FT                   LVLFLLGAIIFGCIYCYLQSRLS"
FT   CDS_pept        complement(join(1564433..1564480,1564645..1564732,
FT                   1564883..1571205))
FT                   /locus_tag="PKH_143530"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143530"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143530"
FT                   /db_xref="InterPro:IPR022075"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCH6"
FT                   /protein_id="CAQ42135.1"
FT                   /translation="MVQNGKKKKKCRIQKIIQLLENNEEDEQSLIPHIIEIEQIFFECF
FT                   NNENKKNRRIINTYVIPYVNLLLDRVDKGDAKINFPFKEKLLTRTLTFLSSVLRINRNY
FT                   AHLVVSYFVNLIEQKYYVVKIVEHLKKIIIPLLKGLIFWKGYLHDCADTSIYDNDEERE
FT                   EEKKNELNNIKQGFHNYAILKSKIFNILTNFHFDKGITENPYKYELIKNLMLILTKEIL
FT                   FFFHILKNKKNIFKEILCEQKKVHHVINQVFDIAYLDVVTDKVNMNSYDEIIMIWLEQD
FT                   IQLLNDLILFNLSKSGNNINDISKNELSLQKVKEELGGKSSRDGSIQAVAKKRGRKKKL
FT                   KSEQNVKTECIIKREDDGEETAIKEEHNSWDEEVPKLEIFNKLIAQFNGGYTPHGGKNE
FT                   NADDGKYVTCENAHESVFENMYEWAYQYGVEGAQGTCPSDTLPEEEAIEDFHQLAKKYI
FT                   ISTDCLICTIDEITTDNIVFLTHLMRNVFYLIREVPFVFNFFLKNIFIMVSELMQIQGS
FT                   AAKGEKRIDGCEEDAFTEDDQIAASHDETGLSSYKKKLFNCMIQYIKNELYLLICTSSV
FT                   NFPFFYAYVTSLLNLLGEKGSTEELVRKKKASIKSTLLEDEKEKKRKMHENNLNYNCEY
FT                   LKTNVLRKDFYGYKKLKNEQVDIMSYLKVKMDESENEQENVSENKRDDFIKKEEKENIF
FT                   INQIVKKLYLTNFKLDKEYYERFDCSRRSNVKDLFCQRRKGPNKSTTDLCDFYAYDPDV
FT                   SQKDEMYIDNNVLRNTETVCEAKPSIDENSVGQNVSNDAGAGAGAGADADAYAGEISNG
FT                   GNANHIMPHSADTNIVSNGNEKNTQAHILGRNYKGMYANFLKDDLKYYNNVKSNDSILG
FT                   TLELYYFLIFSQILNNNLENNVPVLGENIFIKRINNLKVINNVIKRIILNDMMKEKLKF
FT                   YFLILYLVKINTVCIFKGKDPSDIFLNYSAIFKIFNNLLFFSYIQDEKKKKKKKQIKEA
FT                   DQHKRRADSAYQTHDHRHCDHTLGYTTFCYNYLDKLKNKIKTKGYAYRQELQKSKFKSK
FT                   CKYDEILNIMIFFLHNDKLLANHRDQYIKTFIEQILETPKLTFSFFIYLIIWLNNIDVH
FT                   IDYTGYINNSNSGHISLTEGGVNKGEIMNQVVGEAHGKMGEIPCEGENANMSQTKQFRS
FT                   NKNEDEHNTVANEGGGYHTSNGCDPHSVISYDGKKVKQDKNYPFDEHTCSVSSDGSVSH
FT                   FDVELSESDDTENYENEENKMDTFNAEEKNKTMDNSQSDDSHKSFISHESESLQNGDTI
FT                   VGVLPRGNLANVSICTKEMNQENNTGEANIYNDIISSGEEMQKQSGAYKIATTKNSHKK
FT                   KEKNDDACVITNKENEVNEHIFNINYYIKYSPKVQSASNYYIFCFSLISNLLKKNQNIR
FT                   AKKTILAIYINTLFKSSNEIRNLLKKLITAAKGIYNNALSFFVYTKRVYRFYHQVFILF
FT                   LLYICNMYMPHLKNDIHFFSHFAFYLWPMELINFVHNFLLTNFSFFYNDILCIFVNYQN
FT                   IPSYEKRMRSLKNYEFVKQKLSEYVKGLDRPDIFQSVESFLKQTNFFNTGKANDQGDTA
FT                   PSAGYSEGAQLPMEDENNSDDSKNEGDYKHGEDTDEEAQECLQKNEISQKILLEEIFVR
FT                   LFMQAVDLLEDNKMVTKMKKGNVFLNFVSIHYVNSLCNFVITKVEKVYQKNREQFWANF
FT                   STLLNESPEEEKKKMTDQEETTVELRYILHFFLNAIDNFLSICIRSSIFFHLYLNTYAN
FT                   CVKKEVRTILLTKFVASLPLLKSLFHEEFFRILKYNNNKWNNQNVQKGKEDEEKKQEDG
FT                   ADSETNVMRNSVEEAEQGKDMEKEKKNEQKNDGTKGEERDDNIENSSFQVNIEIIKYIS
FT                   RNLSEYTSASSVPSWENRTNFFNFCYNLYLENNNIYFIIELVAFLKKEQTVHIFNEIIK
FT                   SDLEENTKVDLLKFCINKIVKLPYFYIAEKQNENENESYYITNIEIFYFYYNLNKNKNI
FT                   QKIMLDYFVTKVNLHTVDDQENKMFNDITIKDLANIIQQIAENSNAIFPIYGRFLCQIS
FT                   KNINILREFISSIIIPLLIQKKIWNNKVIWKGCLMCISMLWPDFKHSLFYVFFMLPADE
FT                   CATLFNALQQKYPLASDLIELISPNDQAKRMCPEHLKNLLNS"
FT   CDS_pept        1574215..1576035
FT                   /locus_tag="PKH_143540"
FT                   /product="adapter complex, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143540"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143540"
FT                   /db_xref="GOA:A0A384LHC7"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHC7"
FT                   /protein_id="CAQ42136.1"
FT                   /translation="MIDALYIFFINGQLLIQRNYRNVTRKNDLSHYINKYIKTKRFFEH
FT                   PIVEINNVFFLNVSINEIVITVLTRSNSNICLIFNFIYKFIEILNFFLNKEISGINIVN
FT                   NFVLIYEICDEIIDYGYPQTLEVNILKNSLLNKVKYYSRTSKYFQKLSNELRNPNCVIE
FT                   DIVHDTNIQNQNEGLHMKYYNGNSKDSYKKKNSLKNSNSYELNEKNKLKYIGKETLNRI
FT                   KNKIINNNKPSNNFNYITGNCTWRNNNIYYKKNEIYIDILEILNVTINSNNLIYAHING
FT                   KVTLKCFLSGMPICELSTNNMFNLLNNASNGSSGNNQVNNAGCANSNSKNALKGKSNQS
FT                   NSKRKNTSEEKETEDIIIDNCIFHHCVTLSKYENSKLITFTPPDGTFELMKYTITKNIQ
FT                   IPFHIIAIYNPILQYSKSLEKRFSLKKLTNNSKSTYGDYKNTNRYEYAVTIKSNYKGSM
FT                   YATDVVIKIPIYKFSENVEVKYKSIGKTEFNNIEGIVTWRIKKFSSSSEHSIRIYLTLE
FT                   NQNQIYSNMNNTQKVDDLSKVVLQVHKVKNMNTVKFLNTYKMPITLSFKIPMFTSSGVY
FT                   IKYLKVFEKSNYKIIKWIKYLTESGIYQYK"
FT   CDS_pept        complement(join(1577337..1577429,1577554..1577624,
FT                   1577762..1577872,1578028..1578069,1578192..1578325,
FT                   1578460..1578521,1578677..1578706,1578835..1578977,
FT                   1579144..1579216,1579388..1580077))
FT                   /locus_tag="PKH_143550"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143550"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143550"
FT                   /db_xref="GOA:B3LCH8"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCH8"
FT                   /protein_id="CAQ42137.1"
FT                   /translation="MKALNPYSKKEEEVQNHDDMNTQNSTVNGININDININDIEENIS
FT                   DHENERKVKKKGKAIEYHLFDVEAYNTTNNSTIESFVDLSSIRSSYLSENKKKKAKKKR
FT                   ISYLKKQLKIYKKKYKILPEHTIDQDTSYEESVKNENKDYRVYDLREVKTDKGTNDFLP
FT                   QIRKDTIGVKKDVFVNVIKFIILISSIFSFGTLSTAITKYIIFVKKFTYTQIITLLEFF
FT                   IMYLILKLVTFCGKMKSSTNLTRKEYIKYIISISALLGLSVVTGNSAYSYLEIPVISVI
FT                   KSSSLILIYFLSIKFGNLPFFEFKCSLFCSILTILMGVIMSVITLKIDSLFGIFLLVIS
FT                   VIASSLKWVFTNVLLRSTSMKPHIILLHIYQMAMLIIFIPTLLIDLTCVIKDYSNNVLT
FT                   VDQIFSALILVSIGALSSIFLILAEFSLISYTSSVTLSIVFIGREAILLIIGSLFFGEN
FT                   IDFSSSIGIAISMIGTILYGYASK"
FT   CDS_pept        complement(join(1583045..1583131,1583317..1583468,
FT                   1583695..1585950,1586093..1586738))
FT                   /locus_tag="PKH_143560"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143560"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143560"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCH9"
FT                   /protein_id="CAQ42138.1"
FT                   /translation="MEYGNGGDKIFDLNSISREKLELVEVFYDKMKDTTNANALYLYAL
FT                   QIFKICNIHNELPRLVVFGQQSMGKTTLLDFIMGGPMGYTSSDTGTKQPIVIILKPSDT
FT                   NKIECYLNKKKVSIDDLHEKMKAIMVNLNESIIPKELEVEISIPGGIYATFVDLPGIKD
FT                   DSKAGSELTRKIVRNYVQNFPNDIYILVKKASDDPANWPYHLREFFMKPKPMGLGLQNK
FT                   QCIVVGTRALEFLNNELSTIKTLTELYDRVKKRGIMDHNDNILSLYLLELFSIPIEQKE
FT                   KNDFLTNRISMYSKILNGRKNVLDLLLNKFENDCNDSIKKELLDCFDVEKFKQEVNSKF
FT                   MNILIQQLRKVEVKLEKKKSKMEFYNKKLEELYNKGNILSIREQVKLYIRELVNIVSNL
FT                   LTGNYPILNLPNNGEDFLKKYGGTLMENLKDGNELAVELFEKQGLYDENFLNYLNEYLC
FT                   KYASENDINQSISSESNYDINNILNNKDLHNNNGNNNNSSNKRADAYDTLNDMEKKKLN
FT                   SVPALVEGQPVRFILAKEESSMFGVVQNTPTDAKSKNILVSFYFRNSNTEEQVQIKSVE
FT                   KDRLTVIKAVETLNGDPSFLNGLQVWYKMIRDDGWVGFDKAEIIKVFNNNSKIKDVLIR
FT                   NLSKNDEVISIKINDLYMDYVIDENKENEENEENEEMKENDDDILKRIAGAHTDLKILN
FT                   QLAITYICKWLKYNIAKIEPEKDFSDEVLLQMMRSIHNIVDQSDWKPLVVDLLQANISG
FT                   NILHLTKLASCSAAVALNRVFKAGLGEINRKIKNNYMDENIYLLSTNPKFLDELNQALH
FT                   NFCKERAITCASEMKDIVFEQTYAVHFEIIEEIFDGCKLFEDNFLTPSGVKPTMSIITK
FT                   NVKQNLAYRNHQLSLTDIKINKKSKSKELIQEEVKLQFWAIKMLISVPFATKIYAHFLN
FT                   NILPKNKHLANVLDYSIDCESTLEKYIQSKLLNREVNGVMVPIDDKELMSHYNIIDNRD
FT                   NLLRKLENQKRLNQYFTIVSNSIKLLKNNLSKESTLDFVTKLDFGQENKKNWHRLGT"
FT   CDS_pept        complement(join(1589399..1589443,1589720..1589846,
FT                   1590057..1590159,1590272..1590361,1590461..1590580,
FT                   1590861..1592021,1592224..1592344))
FT                   /locus_tag="PKH_143570"
FT                   /product="arginyl-trna synthetase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143570"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143570"
FT                   /db_xref="GOA:A0A384LKS0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LKS0"
FT                   /protein_id="CAQ42139.1"
FT                   /translation="MDCLIKKIKEVFQHSIQKCFPSISEEVVVTYANAKFGHFQCNNAF
FT                   NIFKKYGKELNVENAQKLSQLIIENISENFFEEIKSSPQGFITVKLSKQYIEKSLLKLY
FT                   KNNKIEISVNIDEVKSGNDGDYKRVLVDFSSPNIAKEMHVGHLRSTILGDSICNIFEFL
FT                   NVQTIRVNHIGDWGTQFGMIINYIVTNYPNFKENMPELTNLTSLYQEAKKIYDVDKEFE
FT                   KNSKNYAIKLQNNDEDSLFIWKKICESSKKEFNKIYKILDIKLDYVGESHYINMIPSTL
FT                   KILKDQELLTNVGDAICYHSENFKVPLFLQKSNGGYGYDSTDVAALHYRLKELNADCVI
FT                   YVTDNGQLSHFETIFEVARRAQWANEKTKLIHVGFGLVLNADNKKFKTRSGTTIKLINL
FT                   INEGTERAKKDLLERIQLKSEEEISYFEGVDIDKLSEELCVSAIKYFDIKQNRNTDYKF
FT                   SYDNMLNVKGNTGLYIIYAYSRMCSIFRKCNIDMDQLSKDELNLVSPYEVNLGLHILKF
FT                   PDVFYFILKNMLIHKLAEYTYDLTTIFTAFYENCKVINSENEKSRLILCAISKSLLQIC
FT                   LKLLGLKAIEKL"
FT   CDS_pept        complement(1593914..1595509)
FT                   /locus_tag="PKH_143580"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143580"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143580"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHR5"
FT                   /protein_id="CAQ42140.1"
FT                   /translation="MNINKKKNTYATIRKKLQERSQEGRRNDSKIHNQVHKLINKEIII
FT                   DYDTNEKVNAKIILNKYLNIITHLTKENINLKKIIEKIKLQNDKNESILTKYEHELKTK
FT                   NDIIAKITNKHGIHILGENLNGCNIPDEEEQGRHPIIQEDMSMLKEDDSNLPNRGRTNC
FT                   FPHDGEHIQTINSPTSCNVIGAGANTQWEDKLGRTTTGIPPSCRKMNLQSDHEEGVNRN
FT                   RKMTVSNMCQEKTIPHEDENRIPVREKGGLTNWINYRHKFTWHEKTIKNEIPLFNAKNS
FT                   NLYLHGQSKLQENDKCLDELNCLINNSPSAADLSDVKIVPHGGRRLEEIERYHKKCEEE
FT                   YKNIHTPNNFVDKTNSLITVRTERNISQCATQGKKVIENTSSFLYDDLSKMRNFPRLRN
FT                   DDNEGESSEDKYNKRDELFWSGKEKQATYTDRPVDVHAGRMSVDSPDNNTSIVNKMATV
FT                   VMQKDSGGEANYHTTQTHIDAEVAEGGRENYEAENSSPSDKKNVQDDLEDDNYEDLENI
FT                   MFTILKLRQKGVSK"
FT   CDS_pept        complement(join(1596071..1596444,1596680..1596748,
FT                   1597215..1597263,1597590..1597646,1597747..1597789,
FT                   1597933..1598158,1598324..1598498))
FT                   /locus_tag="PKH_143590"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143590"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143590"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCI2"
FT                   /protein_id="CAQ42141.1"
FT                   /translation="MSFHFFKAWCLIFLYSYFKIQIECHVDDPKLPECDVSIDTAICIN
FT                   NGQKILLPEAKPYGISAHINFDNISAVDASGNRNHAVGNFFASTGFGGIGNSSLFRKNY
FT                   IYIPHSDEYFKTVDFSYTFFIYLLEDEQSIKNNVEEMFCPVIHKGIVKDKIQESSPAIL
FT                   INAKIGRIKIVLSTSSSTNSVVRHINHVRLFVNGILDSSFLTEGITKTNDFPIYIGGAP
FT                   YSVESCDFPFLLDELKVYNLSIGVDHIQSEAATTLNGIEPSFIYFGCFHCDINSAILSC
FT                   PNNYHLCNKVELYIGVYNVMRKFSLNINNLILPFSPENHMGIGVCCADI"
FT   CDS_pept        complement(1599783..1602104)
FT                   /locus_tag="PKH_143600"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143600"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143600"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L8A1"
FT                   /protein_id="CAQ42142.1"
FT                   /translation="MKKEFKEYNEKNFRNIQFIYDFLDKTGMKNSVEALKNESKINYVR
FT                   DYDKYFLENGSKYEADEYTNNPDEKVADNSSNVPSDNRSDSLSDNLSDDFEIDRDFFIH
FT                   TIEKMKNTALCKAIDIFECALKSSNSSCKDAKEKEKKKMDSAEKGNCFQNGETFPDYKN
FT                   FFTESSGDNFVGMKKEHNAYSQDNVQNDCTNIGEYIGISDKIENQTKGDMDNHSRKAKD
FT                   GCILKKLAENLKDISSLSKNHLKFPSSIDGKLRAGVSSKHDLTPTGKPNDEVDENTSKY
FT                   EAMLDQEKSSIGNFPYMFESVEGAYSSCEKGKNYYLSGKKSKSMNGEGGRTVPNNAGTD
FT                   SHNARDVQNWDSFFTYEREICRELKVKYSGGAKGKNENNNGDDNYIGSTSNILVVKYVD
FT                   IYNLDTCQNMRFENIIFFKHFFPILLLVGYADGNVKLLLILYEKSDNENNAEECIHIIK
FT                   ELDHLSLSSPIMFIDINYKDNIFIVSTMNGDIFICKINMSNLSILTENVELNHSIDDIK
FT                   KNVRTDERYISIIRNLTYHNKYSIKCVFNQDYSLFCSIANDKNLIIYEKITSENDMSVI
FT                   YEKKKVIGLPQVPTSVLWVKENNNKEMIITSMLSSNHVLCINSKTYNVVDKIYLFEETD
FT                   KYNILNLEYNKNKNILVICTDTSIIFVYSFISKSIIRKIYGCVLNSLSFPTIEVDINGN
FT                   NIYITSDDKANGTHILIFDIKSGNIIDAINNGYKIRCFQLLKSYICPFSSETNSNNIEE
FT                   NKKSLLILGSFDKKIHFYSN"
FT   CDS_pept        1606837..1615107
FT                   /locus_tag="PKH_143610"
FT                   /product="formin 2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143610"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143610"
FT                   /db_xref="InterPro:IPR014020"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LL92"
FT                   /protein_id="CAQ42143.1"
FT                   /translation="MRNHLEGNVKGTTEKKDHKRRANEKEKEEEETGYGMNTVYHQPFG
FT                   KMDTRRIKSFSRKKKVEKETLWNIENSEENDENVICFRNFVQKDLSDDNVNESGDIVFD
FT                   HFGNGKREENRWEMRSYSGSWDGSENKSDSRHQKMVSLNNTGRIRNPPRNKEHNPIRGL
FT                   NLTNYMLVPDEIRHKYTKTYLFQISKRLLVMKKPWRLPKNVELQINNVYHLSNYIKVLE
FT                   RISSEYLNEPPINYYYKGLELYNKNVFANIDYLLKKVDIKKNPKNFEYKNLIKINECYY
FT                   DLSTFGKSPSAMLYQSYVIWDIHGSSLTLEQEYENFFDSQIMDYNFGEKEYPNLKYILS
FT                   ICSSVLFWLNFNKKDNFAIINYHKISSFILLIFSCVMLVVDNTLTFSQIQEILYKSSKI
FT                   SNSDKEDEEDNINANISSNYFGNKYETYSNEEKSDDTCNMLERAKVQMGGHPPILPNNR
FT                   TTNLQRDKYERRFGSTYDNEEDTSLRNNSYNDKFLEKDTCRNKRETSDFVHIYNFRNGD
FT                   KEDYRTYDNHFNGGNMTLATDEYKSRNAISDFNKMQYHTLNLGEKSVEYDNDVANSQDR
FT                   KKTKCSNSWGFDLTNRENYKSNNKVKDHHFWIPFDYWKSSHKRYFFYVYELMKNKNKKV
FT                   ENVPFKLKSIIFSDYVMCSVSVEVYEIIYKDNHEFHLEVLSDCCCDSDGGEGSTGEGTS
FT                   EDESVSGKSGSERSDKEVRRRSENQRDDQWRNPNECSEVDESNEDYTESEESKGGGLHQ
FT                   DETFYKDPSLKGKLKRGTPNERDSNDILKGRGTSDYSNEVIYSAGSVKNRNGNICEVCK
FT                   PVGRKSSKNKIPYGESEGPRRLSIQKDDLGANNIFINRTYEPTTCVTNKLRKKSSDYKL
FT                   RKGSNGCSDSCERASFDTDNRSDRSNSANSSSAPINERSVEVKQSEGEGEVEQRPFDLR
FT                   SGKGPVTHRIRQHGGKYYSARSLSSVSPEPTSVDDMYRYKNEGIPDSDNIQRGMSKGKI
FT                   ITNGRIITNGKIIANGEVKTNAKMKTKSCTSLSQKKNTSSIKSNESLSPLMKKPIYDAS
FT                   KMEEAEHKKGSKWKEKKIYDFLRRNRKKKQKKGEDQNKGASCAKSGYEYFLKCNNLSYN
FT                   VVSSYEKNKKKYVTIDFTHDSEGNPKEHIICGDILILIGHKNIEKFHKGFSSSYSFHTG
FT                   FLKKASSEILHIRKEDMDINSNYQSYIPDGMKLSIILESASKRDCMKAYKRNLKSHNKM
FT                   EDLRSLKNFEKNKSFESNDSELAVYGLRGRRTAISASDVVNHNGGEAGVRGKGRRSEPQ
FT                   GGREEDSDEEEEEGKAKWWKGRSGHNVMKCRREEEKDNDEEEAEENDETDEKEECIEQG
FT                   SEEHSDKMDKTNEPTYHRRKTKRKLQQRRENERYPSPEQREFRNKLNNNNIKQMDLHSR
FT                   INYTGYSIFTEKEPKIKYNATNITQLLTSLFGFKNREDKYSLTNKQNVCSLLSSKRSFS
FT                   NLISLKDYIQRQYEVITNPTESMYNFVKNHVLKVNIPLVQYLKKITHLSNLKIYFSLKL
FT                   CNNDLSKSLTFIVSIWGIHILKKKSSIRYSSTLNELPEFREEFKKIVPHEVGIKIPTEL
FT                   ARHVDYGDSTNVSCTNEEVYEKLEDGGNLLMGHEQVEAYEEVKEVILSGETCRRVSSLH
FT                   RLEVASEWTKEPEKLVHLKELHPYRESEMVKTSSEEKREEPSEVKIGTQNEVTRGERND
FT                   APCKAKSKDPTTNNVKIEDSSEVITNINGIKIAKLEINKTYYQMREEINLAESKEQADI
FT                   RKNEKEEVQTDKEKIIEDNESFLKSMVEKDGPSKVIEKTNKKSDVLKKIEESSFFYAKL
FT                   PSGELVKLKVKDTNEVGTYESMPLLLVEPVDDSVHLTRAVSGLNVKEESHKNENAAVDK
FT                   AASKDCLINDLEKMYDQVIMKKSSLESTLSVESDRSTVSRYSTSVAGPPLVSTSKVEVP
FT                   AGEKLEVKVGENAEVKLGQKMEIKMAEKMDQKIDQKIDQKIDQKIDQKIDQKIDQKIDQ
FT                   KIEAKIDQGVVVKPPQLGVKGTPKQLSKQLPEQPAGEVQTKAKAVEAILKKAKEKRPPP
FT                   PLPSALQKRPSPKATTEGKEPGGDTKKESSAKPGMPKKMGKKMAGPPPPLPAFLLSKGK
FT                   MGEKAKMGMKKCPMNFAPKKFAKIEEKRPLGIKLHWQLLPTHKIEGTVFNEIKSQESKY
FT                   NLIDTKAVHKLFARVKGEKKIVKKVTEEKKKSNEEKLITVLDRTRAQNIGILLRFPMST
FT                   QEIVEKINVFDLENMNTEFLQKILHILPTKEESDGILQKLKNENVKEENFRDVERKLIP
FT                   FVHMDKCQCKIEICLFSLKYEKMINEISRDLDIYEKAVNEVRSSIRLRSLLNAVLKWGN
FT                   YVNYGVNENEDLVALGFTLSSVLKLTEFKSSIDSTITSLHYITVSLCTYLRNLNMNLLE
FT                   NDLNSVSAASKMSSETVDILLSSLDKEINYIREQLKCTYEEVFKEKMKTILQDSEMKYA
FT                   NAQKRYEETKKSVQQLGTYLGEDMSKGANLESIFIILSSIVDNFTKCYKDILANPKKFS
FT                   IMLNDENLLDEYYTFFGKKKNKNLPISKKYTPTSKETVAKEQGATKESDKEIGKMRINR
FT                   LKSCIGIVRKNDNAKSSMFQLRNKLMQDIQNRAFIKRTNSDGGKLQCEPTIPLCNDNNT
FT                   LIPNIGLGGNDGVIKNAEGLNENENGVDAKGGNVPHGCALGGDLKKRESPIENANREMS
FT                   LKEGVNCDEKPNGDIIPEVNLTGGQKIESKPNVNNKIEDKINDEIGGLGGKDPMVE"
FT   CDS_pept        1617957..1623713
FT                   /locus_tag="PKH_143620"
FT                   /product="clathrin heavy chain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143620"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143620"
FT                   /db_xref="GOA:A0A384L1Q4"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012331"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016025"
FT                   /db_xref="InterPro:IPR016341"
FT                   /db_xref="InterPro:IPR022365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1Q4"
FT                   /protein_id="CAQ42144.1"
FT                   /translation="MNPNNPLSVAVADSLSAYDIQNESFRLGNVSIEGDKYICVKENVN
FT                   ENTQVVVINLQNKISTRKYMKAESVIIHPNDPILALRGTIKNVNTIFLQVFNIETKEKI
FT                   CSLNLNEYMNYWKWINNDTIAIVCEKNVYHWNIDIHNSKKHKENYTLTKVFEKAQVFID
FT                   NNSQILYYGTDKDMKWCILCGISTQDQGKSIDGYMQLYSCDKKLHQTIEGFIGCFGSFI
FT                   FDNWEMKPLFCFVEKKKNSSISRIHLMDIYTNKTETGTMPYKIVKEINLINEHISDFPI
FT                   YMSLNTLQGVIYIVTKCSYVYIFDEGTLTQLVKEKISEDNIFICCDRKNGEGIYAVNKK
FT                   GKIYYITINYVNLINHIKLSNFESKDKIIQNLCVKYGYPGCDYISSYKKCINEMDFKKA
FT                   SKLICLLKNTKMYEEYSSSIAEAVLIMTRKNVDIRIIPPLRTQQVLNSFKSMKNASGQL
FT                   SPLLLYFSVLLEYDKLNTYESVELVKPVVLQKKKEYLEKWIKDDKLTCSEELGDLVKVL
FT                   DLRLALNIYLRCGAHNKIISTYCLLNMFNNVLSYLNNFKNFSFDFVSIFIVIVNYESQY
FT                   SNEKDGSSTMTDISGSSKNEAMDFFNDSSNSTNDSRQGKGSNNEVAVQYVKFLCENNIP
FT                   FDINNIIDYLLSKKKLQEATSILLDFLKDNKPEHKNLQTKLFEFNLYNNVQVAETLFQM
FT                   DIFTYYDKNRIAYLCEEKGLYQRALENYTNLNDIKRVITKSSCFQKNTNMNHNMEDSLP
FT                   NRAISIDWIKKYFSTLSDSVCQDILFDFMKGNKINMEVVISICVQYYNKIGIKKIINKF
FT                   EENKNYEGIFYFVSSILTHLPNLTSKSTDHLSYGNMNDDASSILLASDIGSQYSNAENS
FT                   SNLKIEDVHFIMFKYIEACVKINNIQELDRICKDKNAMYNPEQIKNFLKDCKLSDPRPL
FT                   IYVCDIHNYIEELAEYLYKNSLLKYIEVYVIKVNPNNAHKVIGVLLDLDASEDFLLNLL
FT                   NNIKNISNIGNLIEIAEKRNRLKLLLPWLESRSNEGYENIELHNALAKIYIDLNKDPEN
FT                   FLKNNNFYDKKLIGKYCEDLDPHLAYTVYEKSNGECDEELIHITSKNGLFKLQAKYLVS
FT                   RQSMELWIKVLDESNKYRKNVIDQVIGSTLIESNNAEEITVTVKAFIEKKLSSELIELL
FT                   EKIVLHNSEFSDNKNLQNLLILTAIKSDSKKVMEYINRLDNFSAPQIASVAYQYKLREE
FT                   AFVIYKKFNYYKLAISVLLDKILHVNHKSAYPCEFSGASSSVYNDSDDYVKQLGEGGSY
FT                   GYQDRADNLFSGSNDVSGSLGESDSHDAQEFLLDAKLYEDDLNRAIEYAQKCNNNDVWF
FT                   ILGKAQLKINKIIDAIDSFVKSNNPEAYKEVITKCKENNFYEHLITYLNTLRDQNLLKD
FT                   VLVDSELLYAYAKLKKTTEMTKFIGCTNSANLQLIGDRLFKEQEYEVAKILYSNIPNNQ
FT                   KLTFCYLKLKEYSLAIEAAKKAKSLKTWKEVNFICVKYKQLKHAHTAGLQLIMHADHLD
FT                   EIIKIYEKKKYINELMSLLENGLNNERAHVGIYTELGILYAKYKPEKLMEYIRNYSNKM
FT                   NTRKLIDVCQNEYLLKEAVYLYISYDEYNLAVDTIIKHSPTAYTPDTFMQVIHKVTNSD
FT                   IIHKVIDFYIEEHPLNLYNLLKILENKIDNNRLVQTLKKSNNLPLIQKYLEDIQGQNIT
FT                   AVNETLNEIYLQNDDYISLRNSIDEYDNFNQTNLINKLENHKLPEMRRIAALLYKKNKK
FT                   YKEAINLSKKEEQYKDAIEIARVSKNNSYVEDLINFFIEIKNKEALCACLIVCYDILKP
FT                   DYILEIVWMSGYKDQAMLYFIQVISDYTNQIDVMKKQIEDMQKEKKMNKSAPNDFAANS
FT                   MPGQFNYSLNNHLSIMPPQNTYMSSSSQYDKYDKYDMFNNNSHF"
FT   CDS_pept        complement(join(1624838..1624930,1625187..1625261,
FT                   1625431..1629778,1630785..1630834))
FT                   /locus_tag="PKH_143630"
FT                   /product="p-type atpase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143630"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143630"
FT                   /db_xref="GOA:A0A384LGZ3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LGZ3"
FT                   /protein_id="CAQ42145.1"
FT                   /translation="MSLLYKKTLDLLKGNNNDANGIRININSQNKRGHNNSVITSKYTI
FT                   WNFIFLNAYEQFHKISNIYFLIIGILQLVPEFTATNRLPTILFPLTIVLVANAIKDAYE
FT                   DWNRHKTDKIENNRMCYVVADTEINEEEESTSFFKSIFRKIRKFLIRKKKICSMDNSFD
FT                   EEIYVDEITDVDTFMSSFEGNLGHVEGTVKKRWKDVNAGDIILCRRSEFFCADILLLST
FT                   SDKNGIAFVETSSLDGETNLKVKEANGFVFNILTSDRSEAIDKVKNLKGFIISEKPNKD
FT                   LTTMYGTIYFEKDETTDLKFNDDLSEILKGTTELVEYRRRRVSSADFSRNSSSIGNTQE
FT                   EWIGELNDYNEDKHVRIPFDEKHFVLRGCKLKNTDWVIGIVIYIGKETKIQMNSTKPII
FT                   KTSKLEILTNKLTIIVWLIQMIICFISAYYNAVIVSMSKKSKFKYLPFNLEESKKPFIV
FT                   GVISFFSWVVITANFIPISLIVTMSFVKVVQAYFISCDKNMIHKVVADIPTFGMQKETA
FT                   SLRDENSVELDIKEWGGKLQADSTHTDKSKINLAPQENTESSEATNGKFHTGGKKNNNA
FT                   SQTNGNSSSNDNATVNATSDEPKKTLTRVITFKDVKEKNYIYFNAVPRTSSLIEELGQI
FT                   EYIFSDKTGTLTCNVMEFRKCAINGISYGNGLTEIKKHILKKRNMAIPEEPVLKSTERT
FT                   PNVNIVDEDLVKHLHDVTHFNHAAVIGFFVHLAINHSVICDYGKEPTTTYSSSSPDEEA
FT                   LVYAAKHFGITFLYRRDGKYGISIFGTVYEIETLAIVEFTSKRKMSSVICRIPVRATHT
FT                   DGAGSNGAYGEVGRGKGGTGTTRGTNDQASGKDPKVEEHSALVRNEMITSSPLKNNPLD
FT                   ENIAHGGKKLKKGNKQNQKDEIITCKNCKESKIMLFCKGAGSVILNKLANKTEIDDITI
FT                   EHMETYADEGLRTLCIAQRELTEEEFAEWYRLYKEATVSLKDREENLENVAEFIENNLT
FT                   LQGVTGIEDKLQEGVSSTIEDLRLAGIHIWMLTGDKIETAMNIGIAANLIDNYSEQFIY
FT                   TADLISCEEALMNKIDEDIINIEKTLNLPHYDFNAKFNDKNPGFLRRCFTVKEESNLSL
FT                   SPDNYKKIISSFNHVLVVDGGLLDTLLSKKFERKFFYLADKCSSVICGRVSPYQKGAIV
FT                   SSANRLLKKITLAIGDGANDRNMINTANIGVGIRGQEGVQAFNSSDYGISQFRFLKNLL
FT                   LVHGRLSYARISKLVVYMFYKNIVLIFPLFMFGSISLYSGQKIYYEFLLHLYNIVFTSI
FT                   PVVAHAILDKDVSLKTALVTPSLYKLGIYHYYFNISTFVSWVINSLFHGLVVFLLPLYF
FT                   LSYYNIPSADGTPFDMWTVGSVTYFLTVLVVNFKVLLETYCLNVLPLTAVFMSILSFVI
FT                   LVSSCSFMCFGTNNFLGTAVILAKSLRFWLVVLLGLFTTLSRDFIFKVFKRNFNPEVYH
FT                   FLLDQEDKPKGKNNVINPLSSDTHKKDEEIKIEKCKSLGYAFSEVDPACVKLIRKQDKM
FT                   I"
FT   CDS_pept        complement(1632808..1633383)
FT                   /locus_tag="PKH_143640"
FT                   /product="phosphatidylethanolamine-binding
FT                   protein,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143640"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143640"
FT                   /db_xref="GOA:A0A384KED6"
FT                   /db_xref="InterPro:IPR001858"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR035810"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KED6"
FT                   /protein_id="CAQ42146.1"
FT                   /translation="MGMPPTIEELKREKIIPHVFPDENVNLTVDMYISFKSGKEVNHGN
FT                   ILDLAGTGSVPRNIKFSEAPPDDYCYILFMIDPDFPSRRRPDGRDYVHWAVSGIKSKEL
FT                   IKGTDKNCITLLPYVGPSIKKGTGLHRISFILSLMKEENKGNINGVPLYRGENYITRVK
FT                   FNNFQTAYNVIQMNEMKIVGFNWCQIEA"
FT   CDS_pept        1637439..1638122
FT                   /locus_tag="PKH_143650"
FT                   /product="d-ribulose-5-phosphate 3-epimerase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143650"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143650"
FT                   /db_xref="GOA:A0A384L6B3"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L6B3"
FT                   /protein_id="CAQ42147.1"
FT                   /translation="MSSLKAIIAPSVLASNISKLAEETQRMEELGAEWIHLDVMDMHFV
FT                   PNLSFGPPVINDLKKYTKDIFFDVHLMVENPEKYVDLLKTSDQLTFHFEALNEDTDKCV
FT                   KLAQQIRNNNQWCGVSIKPKTNVEKIVPLLDTNLINTVLVMTVEPGFGGQSFMHDMMSK
FT                   VAFLRKKYTDLNIQVDGGLNIETTEISASHGANVIVAGTSIFKADNPKFVIDTMRESVR
FT                   KHLQK"
FT   CDS_pept        complement(1639604..1641100)
FT                   /locus_tag="PKH_143660"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143660"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143660"
FT                   /db_xref="GOA:A0A384KG30"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KG30"
FT                   /protein_id="CAQ42148.1"
FT                   /translation="MSEEKYNNALDIFLNQKDTIYDSMLHLKQENEEKMDSAMNSDIYR
FT                   TLSNYADYSTKKVKYVVNKRFSELENIEENVQDMDYSVFKYFRTLPPKYSDENDIRNNI
FT                   IFNNNNIYIYAENKNGTLNEQACISISPDNNIIYCSTKGRRYTIGGHAGIQKHINKEYN
FT                   FFEDTNMISPHDSIKTCAFDAIDSSDISSSFTKMNLIKTNDVLDDFNGNKNNAGNIFNE
FT                   HIIMNSCDSSNLNTTKCLSKNESVQKLFKYYKKCSQDLDHEQRVCKPCAHVYNGNKCLN
FT                   GDECAFCHHPDHVLISAKKWKKLVKNNMEKLNILLHVLRNPDDVNAQLMNEMLKLNTKN
FT                   FKKSRKMSNSNKGMGNANGVTPGTSSYGFSNYSATNYGNNGNLASSGLNGVGGISTVNN
FT                   LNNLGGISTVSGLISLNNVNAQSNISTANSGNGNNRRNKFGKNKPFYLPPQNAEQMPRF
FT                   THSHFEPNEETDMYNSKFNVRNYQGNIEKNFIFLPHHSDM"
FT   CDS_pept        1643927..1645768
FT                   /locus_tag="PKH_143670"
FT                   /product="Pre-mRNA splicing factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143670"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143670"
FT                   /db_xref="GOA:A0A384L495"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR032847"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L495"
FT                   /protein_id="CAQ42149.1"
FT                   /translation="MDLLKEYEDSEDVEGDDLEVAAGMQKDQGEEKKGQIVSVTPVSLM
FT                   NCAPDIDTYDLEIKNYKEKFKNMEKKIMFNDPTFLSVLNKPQQGPSINGNYNFLKNASK
FT                   NHYNGCIESTNVNKNMFDYQYNQFNLTGVTENPALKSYYKKNYQNYIVARSRDYELLND
FT                   GQSSYDQRCKKKKVKNEKQDDGALERYKGPWEDKTTSNSKHGEKTEKGETLENDAETKA
FT                   DPQINNEQANNEKTDSKRSVKKNAIMKLESCNLEDAIKKNVINEKSTLYNDKVVSTLHI
FT                   NEESNEYYHKSWFELPAEYKERDFMIEENFPPKKEIHTYKGHKLGVQKIRFFPKYGNYI
FT                   LSASLDHTLKLWGVYKSKNCVRTYKGHFKGIKDVLFDNDGSNFLSCSYDNNVIYWDTEY
FT                   GKIKGVYNQKKTPYCLCLNHDDPNTFLVGGANNKICHIDFRTGNIELEYNEHLQAINTI
FT                   TLCENNKKLISTSDDKKIFIWEYGLPVVVKYISDASMFSITAVSVHPSNNFFLCQSMNN
FT                   VITVYEATGKFRLFSKKTFKGHHNIGYAINVSCSNDGKYVISGDSNGGLFIWNWKKMSN
FT                   FKNMKAHKNVCIDCAWHPFNTSMLATASWDSTIKLWE"
FT   CDS_pept        complement(join(1646360..1651164,1651264..1653130))
FT                   /locus_tag="PKH_143680"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143680"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LKZ6"
FT                   /protein_id="CAQ42150.1"
FT                   /translation="MGVLKKKQKLDEELLEIIIYNILSLIIVNGELSKTSAKNRIIDSI
FT                   IVKNVDYIMNKCFFLSLGNIQKLLFVIDLILNDEVVYYEFGKVRQRENAGTAKNVEILK
FT                   IEEAPICKSSTVGAHGVGTMGSRISRVPVNDGGKDKADLGRMQKCARKELRLNRTDARR
FT                   FTDRYSLNNYIKDIFLYIEEKNIYLSLFHFNYIFKNSADYQQFFLRRYQSYTFETFSRD
FT                   IMKLADGGNRSRRRGGKLTLKRTHKSCDSTNKRMNMGIGRSVRGNEKGIANLLYIKKKK
FT                   YTNLYDAVIKYHKENFNLMGKGDNGGAASSSSSSSFSSSSFTSFSASSVRDHTSSVPIT
FT                   SNGTTAMRGVKWTKGGTVIPGMPKKENNANAQNSNNYKSGNEEEGENKEYVLYDIISRE
FT                   KIKRLYKYKKHKCKLIENNNFVTKSSYIPINLFPNNNLHVNNIKFQTLSSSIRVKMHLV
FT                   ILFTNLILIFDLLNSSLYPWVYKFISFLLNVLNNFNCKFYDYLDNSSLLSHFNKEKLFI
FT                   LNKTTWDHNFVTKVRDDVNRVSISSSANSLPAKGSSILKKLVQKNAKKDNRINLNFPYT
FT                   NCGYIEIYDSDKNENAKKLYFHHFVSVQILKYYSILSLYEIENLYKGILSCLLGDIYNR
FT                   TITTICMFEREGSHYSVSPPSRNNMHFKNNYLKNNNIDLYTLIGEFIKLRCNNKSEEVV
FT                   INALRYLYLFVLFNYITIWGDFSIAYNFFAGRDQADPCAQGEEDNVNNYSNRKNVNADN
FT                   SCDGKDTHNMYDFRETVFDRKKLEDPQRSDVADLINQINLFARENQVRLELQEFCKSIQ
FT                   VSEGVRTNSHFCGSLITLPFYVNVGVCQMIGHVRKMEKLNGVSSDEKGFADRFASCNEE
FT                   NPQDEYPPKGEKRRQKRIIAIRHKCKKIIQKRITKLLSRYSPLVFHFTRYAPLFASTLA
FT                   DILKKNNYFLYQNDSYRFSVCVNYLYMLYEEVNESIIVDFYEKIILVIKNGFYTHISKI
FT                   IIIYIFSFFLKKELILNLCERDINQFFPSFSDSKDLAIIKYYFVLKFVQYRPIPIKLEE
FT                   VHKKLYTYHHYAVVGDTTNNGNPCCSEFPPWKDHSLGMIPSQKYPFCKYTHEVITDSAT
FT                   CGGEQSSSHRRNLHPIVQSPYCKEEIRQNSLLEERSSLVYTNEWKRDCNTCGKKLQKTR
FT                   LRLMFDSRESISQLGVVSRKEEEEEKNANGRSVQSHINALYRKRANVEHAKGAKSIDKL
FT                   SEVCVKHSMCSENTLEEDHSGYPFPEKNNLIYEKKIYFLIFAYHLLKCNSQSRQLAQRL
FT                   KVELLHMLVSNMNSIHIIYFMLHYLHEKKDLQLFCAIQNGVLKCLMKMKPSYKLINFLA
FT                   FFFYLVKIKYTNVKAIMKMLSQVFKKYEFNLKVYMVMFKIIKVLLQRHEISDSYPFILS
FT                   ILRHIKESDYVYLHTTCMYYINIIQNKISFLECTKFGKKRPHYRSDLTEADANSLGDDP
FT                   ERTQRISSINVKYEKKNDTSNFIKLKIHKLDRRKLLSLKDNGSTIFYAQRGATSPDMVP
FT                   DGTLSFPSDHYYNSNDFSSDSFYSIYRDDSYSLKNYCTYIATTEQCIYFPFILRYSLGV
FT                   ETTGGRDTHPGKRSHIGPKNVIRVAPSNILHKTERGRKQKKNSKRDTPRGDPLWNPNET
FT                   LFCLNVCFVHKGDFVNIHNVYIPYIQLSHECPISKYRCSGKEKDNEGVEMDNRYEYTWE
FT                   EDALFRRLPRRRKILSLKKKNFSIVRYSCALYKGKVRYAIRVLIRGLKRGRGSMHEEPS
FT                   MCKSKGHYPNDAITKPESRKKKHIADNQTHGTHFADLKRDVIKKEAYKINCMIKGNPFL
FT                   KREKCHVGGIDGKVNQSRNETVEKTTSSYKLLIKIGVKLLIKSKFYAYIVYINREKKTF
FT                   KRFLGKYNLNFADFFQPFRANIQFWKNIFEDVWNGKIGKMYKSSKYLNMTSDKVLQIIK
FT                   KKLHPFVVQGNVNVKNWNVYNFRHYKMHVGRNYCLNEKYYYAYGSKNRKINNPIFDEFY
FT                   IDNYPLGSSETDGTTSTTTSRMKAYNLRANGKTKKKETHYLRYKPNFMNTLLNDILRHS
FT                   LHDNHVDVANLNKCDKGSAKVNRAKNRTILKRNNNERTTFSTLRVRRIFHLNINRMIRG
FT                   KGKCTKRINQTDGDSAVRKIIKKGNPQHDGHSKYKINPYFSGEEQGKKCRTRPRTRTNH
FT                   DLIKKFVGIFLPPKHHLLMVFHIHEWSTAVQIRTDNLNALNYLNSFFDECTAAF"
FT   CDS_pept        join(1654244..1654512,1654769..1662260,1662407..1662758,
FT                   1662869..1662972,1663111..1663155)
FT                   /locus_tag="PKH_143690"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143690"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143690"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCJ2"
FT                   /protein_id="CAQ42151.1"
FT                   /translation="MSRVSRKVATFNQENERKDEIPDRHRNDVNITNFSNVKWNESVYS
FT                   KSKGRDKLCNLKDLNFNGDYLIKRKTKMRKPYFAIKNDELILPNNYNMENLQDIYYVYR
FT                   VNSDICDLIIKRYKENIYLSIFNNMLIIINPHECVDAFYKLVFKRKNRNNYIFSWFINY
FT                   ALQKKLVKGESEFESHENSHDSSDSNYREDDKNVFSYLWQKRMDLGRKNIFQFDKFKRR
FT                   KKNLTELKQELYIKSNDEMAQVHKDILGNFRMNFNEVFNIRTDPRGSSIDSSASDSLRS
FT                   SVGRSISYSLGGSVRGKPRATVKGTTNYIVNDTVSGTGKGFIGGTKSDGLDRDSAVPSN
FT                   SGQSYLNNRSAYKRRNVFNRSTHLRRYKNLVDSKDAHLSSSKYGNKLIFICGEKNSNQN
FT                   VVSTYVFKHIIKKGKNKELYHAYKNVMNVLNLFFNYKCYNFVIHFSNKNRLLYFNVLPC
FT                   FLNDQSNVTNICTKIGSFLQRLNLGDKPGKKGGDKSSHADIQNDRHKIDHRKSSGDEGS
FT                   KAGRGEQETSKKYEHRKKKKKKKKKTQSGGELPASLNNESDSNVVDMEDGTDSAEQQEE
FT                   RRSKGRGNQNEIFNIPYIFFFLLETTLLDSSNKYYKHLKLHPLDIRKIYKNYVEAPADI
FT                   EVKETDISRTFDYFLELGFTETEILSMIKLNFALIFINIYITIRKCLHKNEEKTLNFLQ
FT                   LQLINVQDYKKLVKSKAMYKGGTKASSDYSNQSSSSFLNFTNEKYMSSDFSSFTNEDVS
FT                   ISCIREILQNERDEGKATRVRRLKSGNIYDPFDRNVHMNLSNKNHLRILKDDSGERSEG
FT                   EKGDESNRHEKHMYKYTRRRNGERNGERNGERNDERNEFNYFIVFEGHIMEEYIAFLLG
FT                   VDLEVMMKILSNQIRLKNLCSTIFFRLKIRIIKQINEYLRSYFFNGTVVHSLYVYSNTG
FT                   LRANIHGQNIKECEKKKYNNLAHLINNIYNEILHHYYLKISMFNMDSYLVHTIKELNES
FT                   REKNDNYESAIGNTVDMYKGLSDHICRGSMMSCYISQFGKDPILKLLEKYTYKFLHTME
FT                   NCQEVKGIRPSVFIKAEHYKMMYLYCAEISRVMRRLTEGVHSRRMFNQGYSANSNDNLE
FT                   CSGRNSRDDHSVGIIHYKKDERRKSEIELADEEYAERMLLKLMEGIAKGDKKDWHAGGG
FT                   NVAERRRKRKFCIVHYNDETVTYRCNNMILDNIEDFCALNDTIQIIEKSKMEFLRKLFF
FT                   ENSFPLKNSRSNFLYDEICFFSNIIKNTYEKFFVLLLNEKEKTRQDTFLVPKYMTKYAR
FT                   GNDRGLDVYYGGRKSRSSSSRSSNSRHGSNIFREDVLFSPSSNKAFFSGITRSRRKYFL
FT                   TSATMSREEITDFSELKKKINKEHIKSVIDMLNLKRIFNYQFKYLYHSLTCLDFIKKYL
FT                   LFCIHVSRDGDLIKLVNYYELRCKKKREKSSLTGAAIADLGKKDEHMEAHTNVRDIVQE
FT                   DASDDGSIEEGSNGNDESNTDRHTTHSSNLNVVTNPRRNVATNASGSASSKPSGYDAHS
FT                   SSTSTKGNLISGGRSSDEGNSQQSHVSKKKKNPRKNAENFYYLNCLNLQEKKDLCKIIL
FT                   YNFNISKNTLYFRNFILLSKYVYFILENLRAKYVKSIVPYVRKIENCYLSYKNRKIKFF
FT                   LRDKIIVIQNYMRRFLFLERVKTMERRKNLFVSFIIFYSYIVKNKNFDETKETLELCKE
FT                   NFMKNEKKLIRHAASVYIQSWYRKIMQQRKYRELKRERFQKKAIENINSAIRTYLVQVK
FT                   IVKNLNEIIIPNKSALLIQSYFRRYMCLTNFQKKLFLKICFLSIKRKYLSYSNVLTKVN
FT                   YHYLIKNIYSRNIIQSQFKIPEAVIKIQSNYKAYVVKKQFTMLMEAIYFTQAYVHTCIE
FT                   RMRYTKMKKSIILIQRWWKNFYKLKTIFSQVQFNIYSSEYDKNKYYFLQKNNFPFYKYY
FT                   ILKEKKALKLLTYHILLKQWYFFYFKKFQKKNHQFNIVFNLKMYKNVSYHYTLPWAYKI
FT                   NSILKIIHMKQMFQKCTNNSENTIFNIPVFGSIQIFVGGSHTILLISQSVISEPIGDSQ
FT                   DGFTTTMRKSNTYGNRKNYYAKFVYSLGSNDYGQLGYYNLFEKNFIYHTGDHTRESPRA
FT                   VENMHNSVAGSMASSTVDNLANCHVNGQTKPFSTTCSNPIQPEGKHRERKSLLLPLARR
FT                   KDMMDPSDYSRRKYSSTWDTTKRESTFSSVEPPPEENQNASSHLNGNCRPIQGGKNSAS
FT                   PSEKKKKNEKKYTEHSLCNKYNKNIQHLIFEHKRKFTIDKNLFSNTHGGESMQDIVDYQ
FT                   IIDKKNSKGENEKIVEFTKVVSETNKIANICCGSEHTLALSENGNVYSWGCNLFGQCGQ
FT                   KYERSIVRYPKVIKHFLNNKIKIKNISCASYHSAYICRKGDLYMSGNFFFINLKYFHEN
FT                   VYEPAFLISQCHSILCNDSYNVCLRSDRSSLYIWGNNYKCILGLNKNKLRNLDEISIYP
FT                   LRFLSPNISVIKIACSDNFVCLIAKPGNTKHSVYMWGQFALIQKREETSTPVVSHTFNV
FT                   FNKFRIKPKMNNLPSPHPGSENNGVDAAFTRGKIIFIANPSPVHDPLWDSVEAMDVCCD
FT                   LDEILVLMNNLCLYGFSAVEIISSDDKKEKKKETNLPYSYYGRREMEQKKEKKIIYEEP
FT                   EIYDNIKLLNPSLYMFKYFKPSYFNIKKITCSYNRNSLSIMNAAMGEYEIPPVVKKMDF
FT                   VTPSGDVMQFPEKIREAILANAKRESNKWIKSTDDPYINHFLIKNSSDSDSVN"
FT   CDS_pept        1663750..1665297
FT                   /locus_tag="PKH_143700"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143700"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143700"
FT                   /db_xref="InterPro:IPR006767"
FT                   /db_xref="InterPro:IPR006768"
FT                   /db_xref="InterPro:IPR040194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L773"
FT                   /protein_id="CAQ42152.1"
FT                   /translation="MSNVDEFYEYAKNNFLNLLKKNNVHSGNEEKANEKKRGKEIRVKG
FT                   MHDRHLSDMRKLKRDELNDKESYDKKCKDFLLKRKSKGLKRSWKGVSASASSDASATSA
FT                   SAVTSVSSSSVASSTSTSSHTSSPSSHEKTKRRKREKHRRGYRDRDKNGRKRTTEKRDE
FT                   RKKRRKEEKIEEKRKNRKTTKCVERERTGKKQKQKEKNIAEKSYLMGGQTSDSQRSSSP
FT                   SGDETKRKSRREKTEIHFSSQNEDKMKTHCTEKITQLNAKLEIIIAEKKEKMLLKNALN
FT                   KNLVDCKFCIDSNSFSKINKLNIISISEKSYICYYNYKNVFLKDQLFISPIEHTTSVTN
FT                   TNFDIVQDMRNHMKSLIAMLEESNKTCIFVEFNNCFNASIELISLRKTKHTYVNCYIIP
FT                   MELLEKAKIYFKKNMEDINSLYRENKQLIITKNKYAPYNVLPKQIPYVSVNFSLVETYI
FT                   QVIENNYDYINMCKCIFTDLFKKDKFYKCFQNFQQYVNAVEAFKSAYSKYDWTTYVN"
FT   CDS_pept        complement(1665684..1666613)
FT                   /locus_tag="PKH_143710"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143710"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143710"
FT                   /db_xref="GOA:A0A384KHR8"
FT                   /db_xref="InterPro:IPR007177"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR022968"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHR8"
FT                   /protein_id="CAQ42153.1"
FT                   /translation="MKNSQIERKKYSVHNLVKLINERNKQNVSNKQLAVGADGTTSFKE
FT                   GNGLDGETHNDFFQFENNGQMGRKDKASVPAENGKDGKDCGECNDDDDDDKDVPDDEHA
FT                   GCTYGEEGASAPPGGSEIKLFMFDYNECQNQKCSCKKLYRFKKIKKAPMNKKFKGIVLT
FT                   PFCDKFFSTNDKGTMEKFGLSVIDCSWKSLDLLKKSKFANQRKLPYIIAVNSINYGKPY
FT                   KLSCLESLAFCLYVCGYNKQCTDILNIYKWSSSFVSLNGELLDMYKLCNTHEEVKNAED
FT                   EFINNSLKEKEKRKEIDHYKVIYEDGYL"
FT   CDS_pept        join(1667672..1667939,1668307..1668658,1668799..1669048,
FT                   1669340..1669522)
FT                   /locus_tag="PKH_143720"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143720"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143720"
FT                   /db_xref="GOA:A0A384LHA1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHA1"
FT                   /protein_id="CAQ42154.1"
FT                   /translation="MIAKFLLFVILTIKTYSCFHVNYKILSSPNDKQNYVRTISSVNYL
FT                   YSKCPLNERFPYKCLQNSQPKKYKNKLLSFFSNYFTNEQDRYTLNKEEKEYLRKLGKTE
FT                   RDNYNDLVKAHDEFIKTCSDIKSKLKYKDTFFFITQKIIQRNLYDFKRKQKFHLFGNDE
FT                   YTSELSVDYIKSANIEERVKEQVLKNLGEELGSSGYFLFRVFKWKSFLEIVNISTLMLP
FT                   ITALGLFLSKMGFFSVAVNMLLTAHFLTFSKEEKRKMKIRTLLLTLLPILVHSSLGVLC
FT                   SNIFLKHYMAQMPSFIKSENVLSFFINVQLYLASLLYFVNTEKEDDLEEGDIKNDYPDF
FT                   NYDEPMEKNT"
FT   CDS_pept        complement(join(1671145..1671424,1671948..1672043,
FT                   1672315..1672430,1672692..1672748))
FT                   /locus_tag="PKH_143730"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143730"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143730"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCJ6"
FT                   /protein_id="CAQ42155.1"
FT                   /translation="MPEDYAHKNQNENDCMCICEDYRSTIGNFYEYIKKDIKIVIERDG
FT                   NINIDLFSNYFKNIIKEIHDEKNNVKKKKIDKITRKYLRKIDSYRLRERDFFEDEGIVE
FT                   TKSCKYYNRNLNKYDSFDLRKILKNNYEQCEFSSDHEEEGPFSFYENRNIRIIDRLKDL
FT                   KNNISFFKFYDLIDFPSKS"
FT   CDS_pept        complement(1674318..1675679)
FT                   /locus_tag="PKH_143740"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143740"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143740"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCJ7"
FT                   /protein_id="CAQ42156.1"
FT                   /translation="MSTPICSSYLHNIYLEFSLFNNFLRDLNREIKNGNNERYTPIYDS
FT                   CIENAYSIQNKFYAWNSEEEDIDEKFIEYFSQNFIINIKTFLRTNFCSIDENLDNLKNR
FT                   NKKLIEKLKVDLENAENQENYIYELEKSLKCEKEKNRNAHNLQEKINNLVNQNEKLKNK
FT                   NEQLEMSSWKQKEENSKIKVELNKFLSLKEKGRNIDNDKRCYNRLNKTMSTLFKRINNN
FT                   IRRRTENKLLLGKCRSYSASFLHTFNSIMLDEGNHIREENQYTGENGHKAESYGQRNDI
FT                   EKNDAGKNGILHSCARKNDGLQSAAVQNDITTNDHFYHEPSANIKRRKKQIHLDHHMHP
FT                   RTHEIVSNMINSSNFFFRGDKRGICRNELNWYNFEEKDNFKIKGQGEKIYTNIEPINDK
FT                   NMEGKCHKGKKLFKNSCMLKRIFTHNDYCTEGENTLSCCSNTLLIDIRKAISNK"
FT   CDS_pept        complement(1678695..1679522)
FT                   /locus_tag="PKH_143750"
FT                   /product="chromodomain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143750"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143750"
FT                   /db_xref="GOA:A0A384L1T5"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1T5"
FT                   /protein_id="CAQ42157.1"
FT                   /translation="MTGSDEEFEIGDILDIKKKKNGFIYLVNWKGYSDDENTWEPESNL
FT                   LHLTTFKKKMELLKSAYLNKVDTTQNDGNLLKNHLTSPSSLQEETGTTNITKTKGRNPL
FT                   ISKKKGNKKGVTNKLEAKKLLSTNSDNSQKMSDDEYNESIKQETIENPHDSSLLNVEDV
FT                   YSVRIKNRKMEFLASLKNASPQWVEESNIRRTGHLNIKVNDFKKYIRRKKTSKGNRIVI
FT                   KNLHNVGDELYISVIHNINNKEIHSLYPSKVIEYIYPQELLNFLLSRLRYRTA"
FT   CDS_pept        complement(1686848..1692559)
FT                   /locus_tag="PKH_143760"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143760"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143760"
FT                   /db_xref="GOA:A0A384LJW1"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJW1"
FT                   /protein_id="CAQ42158.1"
FT                   /translation="MNISPIKYESKILNNLASMLKLSEKSDNEIWNEIKEDRNHIKFEI
FT                   DEDIKRVIDVNKINCTCDESKKKIEEYKGKKFEYYYNVETYGVDFFLDICNALGRSNYK
FT                   PFLSEEGKKEVMNGLRIRRNSNLYRYVSFFLSKERLNKDRLNDGKTPEQIFHCFKCLRS
FT                   VLHIYVDDKNNRKRKMYLQDNIYITEEMEEKMENDILRENQKNNNEDPPDLRDGIITVS
FT                   RYKAELASITRKSNEKIIKTILDHTKNMQNGKNGNESPSHSNTPNICKDTSISGDNQSS
FT                   SHYQELNGSNTFEENNNYKASDSFEHNELKHYSDSANGFSNDGETGSTDNNAHSKKRTT
FT                   LKNNPVANNLIQMNGSAGNIVLRKKRERQRRSVQTITKNKLSTNSSRKSSSVKKKEAGD
FT                   MVMSVDGGVSGDALPGGHPKGGNKSDVDSAPCDEAQCDEAQCDEAQCDEAPTDAPTLEL
FT                   ILQGNETPRALIQSGVVQQAEWDKKLNGDGSNVTEKHEISPVQTKISTGEEELNSKGGG
FT                   SDEGGKDSYQYDVYQKTSLVKNASNREESYDLEGSDDASYSTDDSNYKRYMTRKKTKLL
FT                   QEGKIVIDLNILNGNAKNASEKKEKEEEIEEKYKERCYGKNQEKIRMDNIRKKLEEKKM
FT                   FFCKIEEVAKRRNKRHVKTQVLSKDCKIERAYFSHKMKKFYNSKSGYFGCGWSNNKTQW
FT                   TPFIHAPFFDNNYNNTIYKNRNKKMYEEIYDTLLHGRIHPAVRIVELKDHKHPVRLCTP
FT                   YSEDCYSVVYTGEKILASDDRVIFGEYTGYVANNSELSQDKHQYMFALSFSKKVFNDRK
FT                   NVVFINEIESDEEGVFKGDNHHGEEANDIITHRDSSNHSEYATKSSTEGIYLSDEKICK
FT                   EASVKKGDINTNGRGNSTVPNVDTIQCEKSTQNFIREKKKYKGMYNKIILPDNYTYAVD
FT                   SSYMFNEMSLVNHYKTCSIFNNYDFRINAEWQLVYLDGWPHIILTSIPGVEINTGEEIF
FT                   ADFGFEWFERVNDICLNDFIKNSYACRLSNLNLGIEKTFSGIDDIVEKYNLIKNHTTCN
FT                   ICMHSVNTDGSNGFIACSGCNHIYHLTCVQKLNAEVNENYDWFCASCVKFCINMLNQEE
FT                   FVANLEMENHKLLIQLFSDDMCVEKLNRLPTLLALEANDTPLCIPDGKDAKEVTNNSNC
FT                   IEQYDRIRKLLRCRKNIIDLVKNKEIINSYLENTEKEMNSLDNIQEVGNLSFKKDKMKS
FT                   LLQNSFELHLLIEYKKKIDDLLLSREKVDTFFNDEKAQRTMHLRKQTINYLLENRKCIE
FT                   KLVDSMEKGTSIVFAHKEVNRSDRDTTLMGLKEEFPQEHNLAIEKWDPSFNRGESPGSV
FT                   IKEHTNGSISNSYEKILYRKSNDIMNNLREIKNGTPRGRIKSDIVNCPTSSNGNSNMNT
FT                   GSNRNLCFNNMMKLSKKILGFPLLTDFERGMSTNQPCLPLSDHLKRLSVCTVCYSKHGD
FT                   LAKAIICRVTKMHFEPNYNDGLSDEDMFKTSSECVQSIIRELANTIKEYRKRELSGAYL
FT                   QEVELSASSNYRSRSIGSCSSRGEINANSAGAPLAGHHNHMGAEAHSSSSVPSRTEIVQ
FT                   PVRSILRHQPRQPFYEMMSNPACIGGHQRGRNTPVENNTPPLLLENRMSYTDDYTFKRE
FT                   QMNSTKNKSSYEENDGGSSKKKSKLRTKSSNKVIDEENDDSLKRRTNKAGSHGGRCRVH
FT                   GEIGQHVRIDPCFQGHAEEHVHPRKEGNQEGEKNHMYFTREKLKNTKEAQSEQKGKDVT
FT                   LENISKTSNFVPLMGVQLGKTKIQREFTNGTYVGTVMEQIKNENGIPFFVVTYDDGDTE
FT                   WMTPYFLFQELLKQSTNSVEYPLATTFKEVFNPEFKKDLKLNNCSLELKIERRKRKSNC
FT                   ESASNSNSVSKRQKYAQEENSTKKKKQQF"
FT   CDS_pept        join(1696215..1696320,1696657..1696742,1696872..1696911,
FT                   1697052..1697089,1697244..1697422,1697594..1697691,
FT                   1697954..1698021,1698289..1698360,1698578..1698706)
FT                   /locus_tag="PKH_143770"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143770"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143770"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCK0"
FT                   /protein_id="CAQ42159.1"
FT                   /translation="MNRASLLLLFLFFFFETLLGQIGEHSAKGMHPRDGVFPRKVFVTV
FT                   NKPRTVNDTSPRGDGADFVGAKQNEYHNVVATAEELLHIIAENKHMLLGQENPNERGLK
FT                   AESEIINANDENVLNLLLSREEKETKRERKYSPPVILVLPQPLTRQELFYYEKYKHLKG
FT                   GINHTKPLLLRVSYFAKLIEIRSKNKAEAIEELAIAEKMVEKCNSRINVIDEALEEISI
FT                   GVSTREDKNTKRLRDERTFLNQKRRVLVCHEMWFRAKQRYGLIVGHLYT"
FT   CDS_pept        join(1699541..1699568,1699799..1699914,1700123..1700223,
FT                   1700372..1700453)
FT                   /locus_tag="PKH_143780"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143780"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143780"
FT                   /db_xref="GOA:A0A384KP91"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KP91"
FT                   /protein_id="CAQ42160.1"
FT                   /translation="MPLNVVTPSEPKDPSMIYKFNINETYSGDLEGILVLCLLAILLGI
FT                   FLKVIEIIFVVIFVLISIFLTARNGEINIVSILPMIIMVVMTSGMTWLQQKNFNKRQLS
FT                   KFEI"
FT   CDS_pept        complement(join(1700823..1701576,1701754..1701824,
FT                   1702006..1702079,1702223..1702356,1702534..1702609,
FT                   1703106..1703811,1704042..1704121,1704293..1704386,
FT                   1704627..1704848))
FT                   /locus_tag="PKH_143790"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143790"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143790"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LDW4"
FT                   /protein_id="CAQ42161.1"
FT                   /translation="MACINQGEPITPRVKFRTVQKIKTQKYISDQAYLIPENGGTAVYL
FT                   SYELNRTLENIFNNYSINGYMGVNEFVKMCYEYNLLPKNRNRNILYYIFKSSKPSDEDY
FT                   IEYRFFFQLLQKLSAYLFRKLIMTEQEKLNVLIKHLTSLCNSKISTHKEKYNVGIQVSV
FT                   RKENKGTNAVCDMIDQCCDTSVEVKSVATAMDTMDSMNDKDNLRERHVNQGREFQKEKD
FT                   EVSDENNNGNTSHTQEITISDEQKMKERINEIEKLSIHKEDMNERLKEEINNALNIIKE
FT                   KNKVIENMKKSNIQQLEAERVKIIHLKNEIQKLQNEKGVVDLNKESMSHSSFKNGEEET
FT                   THRNDITTTDMQHMKWKILDNEHLKLKRLLVLPGEEEAALIKVFSAYSTYCGETAEYVM
FT                   SKRNCANFLATYYLLRKNGESTAQEDLDVKTADILFNEVLYKRAHAEKTNVGEGVLTYF
FT                   YFKLFLSRLGKHLYPQLEEREGFLEIVLNYILVMKRNEDFKNWKKKSIKIKKKNKIRIA
FT                   CSDDLNLFGENIVGGYTSSEKGTTCDKLKKKKEKAKQNTDNITNNLLSENGKTAYSHTD
FT                   LSFEYIESNEAKKKMNTNKSRENSINKMHEERLNHNAADGNTNASTTRTTSGKGNFLKS
FT                   KLIYNNLIHYDEVSKEGRSSLDSVQSDDFALTCKKKNALMQPLKIKHNFNLSKKHFRNL
FT                   TSSNMKPNSSLKNMFPLYDIEGELWHSKSERKKTFLPQFGRG"
FT   CDS_pept        1708079..1709665
FT                   /locus_tag="PKH_143800"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143800"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143800"
FT                   /db_xref="InterPro:IPR022086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1X7"
FT                   /protein_id="CAQ42162.1"
FT                   /translation="MRSTEKSNNDAEEVTGEINYDELANNMLEEMDKHIHEETQEFHHS
FT                   PGNVHYRSVLGGKMNMGVENQATELQKAYQTNDHYNHNQGNRIDEHTVHGGSYPRRVMT
FT                   ALGPLPLPEEFKKNIPEKFVAKPIIEEREIYVSKKERKQREIEIPHVKYEHTFEKVKKQ
FT                   LIVNKLVPSVSEVIKEVPKEVLKPVIEEKIIEVPQGVKYVEVPVEVPCLYPPKIVPKVV
FT                   TQYVERIVETIKPVVQEKIIEVPQTVIKQVPKIKTVEVPYYIPRYVEKIVEVPFKPNGE
FT                   MPQLGTHIPFPISESFPPLKPTQFLSNPTRQPNQAGQFEQHGKSSQPEHLHAQRSILSQ
FT                   INCFPNSGKSIMNSSEQMFGNLTMPPTTLKPIGGNSATNTPRSIPRNIPRSVPTGSNSP
FT                   FSSNQNFRKNENLFSQIENLPYIHNLPDGLKWQYPDGTLSNQQLLPNSNNAVPPLVFTC
FT                   PPEIGKVTCTKKDIQPDILTKTGVYEFDGFKKKGTSQSLFPPLAHHDRVPFLPSPASPG
FT                   TPDVKNIQENN"
FT   CDS_pept        1712065..1714521
FT                   /locus_tag="PKH_143810"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143810"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143810"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KMG4"
FT                   /protein_id="CAQ42163.1"
FT                   /translation="MKNKRRGLKEQPRKKPLDIEKKIRNPHKYEEKMHFDNLTKGELYV
FT                   PESCKAKKLAMLCNRLFYFDINDEELLDRYAQRAIVIVNSMSTKEISLILNTMRKYNHR
FT                   NEKLLEAFAKHIPRKLHKGVPQDISLILNAYAHFNFIDNNLFSRICEEIPHKITYFQPF
FT                   HISSVVNAFYKLKIKDRIIIDDLVDETIERIEEFDAKSLTNIINSFSKLNYQNENKKIL
FT                   WVKFIQGVKNLRKDFNLLEITLITNAFCKRKFKNENVYHLLSEILTSHIFEMKSVNDSN
FT                   SFLLCTIAHAFAKVKFYDKDLFHFIFSHFTNEDNYASLDSQHFAQLIYSCAVFKHDDKL
FT                   FLDTYTNMVRKRLEGKSNELNEQALSTIAYAYAKLRIRDVNFFVQLSSYIIKEKICLSP
FT                   QSLSLICYSFSKLKIKSQMLFYFLSMQIFQNMNLFSKQGLSLILSAYANLQIFHMKMFS
FT                   LINKYLNLYVENFTQEECVLISGHYQHALKCINDEVEGVGHNTDRLGSSPSSLIATSNM
FT                   KKELENFIHLLSDKIEQFKREKEQRKGKEPTASYQQDDFTSNEGDDDACDDDNDEDNFF
FT                   SIFNQNDIMNEDSADVANHSGQIPNGVEELHLGITPNQLTTNKATFDEAERQLYYPEDP
FT                   FNEQSDHIQDMKKKEEDALKIYKKMFLMDVEGTTSTKGKRLLINEKLNERLRTILSKQD
FT                   ITTEDENTKDITTGDENRKGDRQRMEKTTKSLLQLMTSNKPPKINYEKENFIKSAEQVE
FT                   SEFIKAYVSEQQEQCDDDKDGSTERRKGRRGRKKQIQNMLSRKYQPADDLPTLQKKWND
FT                   LYNPSP"
FT   CDS_pept        1715502..1716842
FT                   /locus_tag="PKH_143820"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143820"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143820"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040323"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L5J9"
FT                   /protein_id="CAQ42164.1"
FT                   /translation="MHSGRIFKNSYYLPFKSKCLSNVNNQLAEQSYHLHYFLLGTSHPF
FT                   AENEIHLIEYNDQSCTVRNVEIFDHKEEVKHLVCLDMCGKGDAKGKDILVCTSVVVSGD
FT                   VGRTSQLPVNAGGLEYRCFLHRGSLNNFDEEEFAAGEETDPGMEQMDEANQANQANQAN
FT                   QASRNLDDPGGEENGPAKSMTNELMNDKGAKQKSMSRGKGKAALDKLCELKTDQPYVGI
FT                   KNIAVEEHEGEFRRIAVIDKYRYDIFGRSQSDMDFVTSKNMNHELNYGIFDPHHENILT
FT                   VISDTNVYGYDTKNDVEIFSTFANHKADLSSLDFNPNIPNVIVTSSNDGYVKFWDLRFL
FT                   TDAFLTVNIHSHWVTSIHFNNFHDELLLSTSSDNTVKLHKIDYPAKLNLKKKDTNYQLL
FT                   KTYSDHEESVYQGRWSKTDAWVFASLSYDGKCVVNSVPTEEKYRILL"
FT   CDS_pept        join(1717765..1720073,1720351..1720429)
FT                   /locus_tag="PKH_143830"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143830"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143830"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCP8"
FT                   /protein_id="CAQ42165.1"
FT                   /translation="MFLLRIGKVLVFLTLFVSCVMNSWLAILSKRLFHQGRGKLNFIAD
FT                   NKTKYGIKRTFSFSRKRMRESELKNRECEKNDHRESSIFKYTKYDQTDETYLRVLEKKA
FT                   NEIKNSKNCFNKRIKNVRAQEDGASEQRMDYTTLHLLAIELNALLQDCVVEHITQADHK
FT                   TIVLHLNKRGEKDYYLYICYDNDNPVISLGLKIKKLFNRFIDDDYAQKLNPVLKYSLIS
FT                   DIYIKKSFVKILCIDFILKRKTDEDIDIEDIFGDGGKGDLSNSARKVTLLFDLHNNSCI
FT                   SFLINKVNDEILISPHNYVTEKVIDKSYKEGHIYNFPTNQECKIIPNEYDFFSSFSNLF
FT                   KARKEQIFISSLLDLYEGLSYNTVLKFLDYLNISRNAKFEDIDSGVLLDFFNKTYIKWV
FT                   RFLNLKEKDEALSFDPHFDYSLNLYSPVKFLKKGKVRDATSQGVCAVPTIMNNGKVENE
FT                   TEGCRLEDKVEGEQNDKRDHTNNGQSNRDGVNKSALQGKETHFETVIELVYYYHGRGLS
FT                   VNKFYTILKFCKEFIRKKIPQYEEMINQYKNDREVCERAYLLHENINKLSVFNHTISKM
FT                   TDWIDKKTFDALKLIEKELKCNSLEDNRKKYVKKMEENKEKEEILKKKILNVEPNVIKS
FT                   SQNIYKGSLLIKINETDLSSPFLIIGRNSKQNEKISTQILKFNDLWFHVHEHPGGHVIL
FT                   RNKKINGQIITADLNLADIKIDEDIKYAANMAAYFSKARKIDKTLVCFTFGKYVLKDNT
FT                   LSEGAVELLKYRLVYGRPSKVYSIIKDLNERNKEMELSKKKK"
FT   CDS_pept        1721089..1723293
FT                   /locus_tag="PKH_143840"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143840"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143840"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KT03"
FT                   /protein_id="CAQ42166.1"
FT                   /translation="MPPVRALLNVAVIAYTLLNNGLCVLTSSRSGQRIYPAHETRQGRS
FT                   RHPRSHPRSHLKSAHLYTYGYVNAYPCGFRKNAFLPRHPKGNGSLTEEEALRMHLLKGD
FT                   KRYFEKKKKGPEKKLYAESMFFNPKQFKNLFPEDGKKKATGKYDDDCLDLEEVENLQEI
FT                   SPDLYKKLSDYRKEEALDESKGESAEPEETFDGVDPKDISVYEGLPLLMIDGKDFDGFP
FT                   DNRKVKISPQIATPFDNSEYEEFVQSNGGKSDVCAGSDGNLCKGSKNKGSYKSDSDLHE
FT                   SVRAEEGKDEDIPDFERDVLSIIGEGKQSHPKSRSVDENSGKELNKEEKIKRYKKVGRH
FT                   HHIDSQLGEILYDRDYPGYIYLNHGEDIKELDEKSEYDSESPGYINPSNVFLRTGRKRE
FT                   EQKKKDSGIKQKRRWNVKGEKDIKRGNWKYYDDTVKDLLDSTDQEKLEENYYSNNYYQR
FT                   TNNNTGFGSLDKVQNNYFDVQFIGSAETYPANVSVGMNFTWPINFIPMLCKQYPKRLGQ
FT                   PIKSDIFNMGGFDSLQLWFYPDGTNNSIDGFCALKLVMRPGSYLPVKIFLFAFSEYNYV
FT                   HTQPFYKESADYVAASLNLCKCLLKTKENLEKIENNKDYVILGPAGNIYIGVGIFDDTY
FT                   DLDEDFKKFYSISNKYKNKKECGKQNHEFKYDWDEGVHIFDNWLKKQTAVTEDKDELLP
FT                   VHYTHSELYENYKYRYVPEKNPFKFLNKEPDRTKWNRHPF"
FT   CDS_pept        complement(1723951..1726380)
FT                   /locus_tag="PKH_143850"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143850"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143850"
FT                   /db_xref="GOA:A0A384LH98"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LH98"
FT                   /protein_id="CAQ42167.1"
FT                   /translation="MANDVIDLVFSLILDTEIYLCAFLLLTYVTSKKINKIIQSNFYQK
FT                   DTLLNRLSKHFYIVDVKATFSPLKYMLKSALYHTYYFSTLLFLIYLFRLYASYKLWIKV
FT                   YFFSLFNIATDQSTISDDNFYTDYYNGKSNKFLLSYLVAFISGVTISFIYYKYLCRVFK
FT                   GKHKYVTVHKSSLLHYCFELAKINFGEYVKVKPKKGSKFRFILDTSIKVHSTFSGDSAA
FT                   TKGSSTGNGKGGNGRGVGSSIPNAVTPKAKRNFLFRIFSIGYFKKHVLYDQEVLYEDHL
FT                   QKKWQVEQKNKWSFTLMLIKLMGKIIQAMMNSINVENNVTGKDASGKTGQAPTTAPTTT
FT                   TATAEDTGEKAPQTVSAGVETQQVEGETNTEVNQAEGEGAPKGEEVTKVEEAPKGEEAT
FT                   TEEKQQKGEEATEEEKQSKEEKQPEEEEEPKEEEEHNRKAEPICVEPPLQKQLNDQPPQ
FT                   EQSQGKTNPTSMTEIKVETQKSSEIPYSDIKLCELDLRPYDIFLCNSHYQFKSILEVLM
FT                   LHIPIYFMFKNKVYVKTCFTIAMYLVNYLLWNFITILAMIKPSLFVYYYVLNEHINNIL
FT                   TKNINDHEKNIILHFFYGFFFASLIYLKYHFNMEFKLIKVDHMNHFHRIIDRCIAEANK
FT                   LKSRGIIKNFEAMKVFPLCIDYKNKGIFIDRGLLRTTAELELVLKQRKLKNIKICFRNV
FT                   RQIAKYCDEDTAMEMFRRLKFVLVNELPHRVALNLSRIISDEMYDRIKKNSIGSSSSEQ
FT                   LKKHPPDCLCEMLKNTVIHDFIKETMCTEKFNAEKEIEHTGQAYVGTSDNKGACKK"
FT   CDS_pept        complement(1728129..1729649)
FT                   /locus_tag="PKH_143860"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143860"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143860"
FT                   /db_xref="GOA:A0A384LAZ2"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LAZ2"
FT                   /protein_id="CAQ42168.1"
FT                   /translation="MKWLPIIPLFPACCISQRSMMRELCYVGSVALSPMRPKKNAFKLR
FT                   ERGETTRLFCANSEMSNFYGINESGFSNTRPPPYLLRFDKCNDVIAYTNEIDNESLKQI
FT                   KNLAKLHIIKGHITILPDVHLGKGIIIGSVFLTKHFIIPNGVGVDIGCGVLCVKINKLK
FT                   KKNLHEGVINNIYKKIKRNIPLSFDYHEKEVFDAKNVLDELVAKYASSNMAHIMNPKHL
FT                   KQMGTLGGGNHFIEIAYDASGDVKAEPINGNLSGEAHQNDNTQKYACQQNHYPESDIYI
FT                   LIHSGSRNIGKSTAEFYDDLASHESKVKRNDLAYLDLRKKHGQNYLRDMQLCQEYAKYN
FT                   RIYMMKIIEQIIKEELNCTLDWQNAINIHHNFCNHELVNYFHNGEVKKEYMYVTRKGAT
FT                   SSMKNQLGIIPGNMKVGSYIVRGKGNKLSYNSCSHGCGRVLSRTHAKKIINQADFVNIM
FT                   KGVRCDTSAKIRDEAPQAYKNLNKVLRNQDSLIHVVRRLLPLINVKGG"
FT   CDS_pept        complement(1730447..1731997)
FT                   /locus_tag="PKH_143870"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143870"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143870"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KD38"
FT                   /protein_id="CAQ42169.1"
FT                   /translation="MEKGLLNGGSSFKRKYHRANEHAQYEIPKSRLFHLVTRIGISIIS
FT                   ILVISLFVKSNSNSNINMNTKSARDIPIMTTIDDTTSELLNSFGFPPNSKEVVYSNLEK
FT                   WGFNLSDIADAEVNKNYEEANLDNYKYSIRTYKNILFSFYEKKESSQIEKNSLLYTYLE
FT                   ILERKEINTFYDFLHHFLVLQDLNCLPVNYKGIYTNGKLFLSSHMQNITKVELSNVQTL
FT                   INEGPYLYVTFHGGRKKNSIHNICKFSRDGYYLGSVLLPFEEKGKFFNCISLRGLLIHE
FT                   NGLYVTDSFKENSKIFHFSESIQELSNRRAYISTFIQQDPQNNPLMIHPYGIKKNDQYF
FT                   YISSQNTGTVLRFDVDSGELGQPIDFYKDVSNGLVIKLNRNEEIRGLDFDTMGKCYVSN
FT                   KQTGVHVYDQNFNLIKIIPVFSPISILFHKENDHIFVGSSKTHDIKEYDINNFELIKVI
FT                   KHPLLRHVAGIIIHQDSIFAVSQRKNKLLEFSISTTLLKKVLVDDFADVGERVMLSLT"
FT   CDS_pept        complement(1735054..1737498)
FT                   /locus_tag="PKH_143880"
FT                   /product="endoplasmin homolog, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143880"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143880"
FT                   /db_xref="GOA:A0A384LP92"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LP92"
FT                   /protein_id="CAQ42170.1"
FT                   /translation="MKLNRVFLCAVFICALVPNWVPQSCNVLCESNEGKVEEKESKEEP
FT                   KKDADNIPEISDSEKPTSGIEQHQYQTEVTRMMDIIVNSLYTQKEVFLRELISNAADAL
FT                   EKIRFLSLSDENVLGEEKKLEIRISANKEKNILSITDTGIGMTKEDLINNLGTIAKSGT
FT                   SNFLEAISKSGGDMSLIGQFGVGFYSAFLVADKVIVYTKNNNDEQYIWESTADAKFTIY
FT                   KDPRGSTLKRGTRISLHLKEDATNLMNDKKLVDLISKYSQFIQYPIYLLHENVYTEEVL
FT                   ADIAKEMENDPNYDSVKVEETDDPNKKTRTVEKKVKKWKLMNEQKPIWLRPPKELTDAD
FT                   YKKFFSVLSGFNDEPLYHIHFFAEGEIEFKCLIYIPSRAPSINDHLFTKQNSIKLYVRR
FT                   VLVADEFVEFLPRYMSFVKGVVDSDDLPLNVSREQLQQNKILKAVSKRIVRKILDTFRT
FT                   LYLNGKKNKEELRAELAKETDEEKKKDIQKKINEPSTYKLIYKEYRKYLKTGCYEDDIN
FT                   RNKIVKLLLFKTMLHPKSISLDTYIENMKPDQKFIYYASGESYEYLSKIPQLQIFKKKN
FT                   IDVVFLTESVDESCVQRVQEYDGKKFKSIQKGEITFDLTEDEKKKEEKVKKMYKALIDV
FT                   ISDTLRNQIFKVEISRRLVDAPCAVVSTEWGLSGQMEKLMKINVNNSDQIRAMSGQKIL
FT                   EINPDHPIMIDLLKRSVSNPKDSQLTESIKIIYQSAKLASGFDLEDTADLAQIVYDHIN
FT                   QKLGVDNNLKIDDLDPAIFETKKLEQEDSGDGQKFHEEINIDDEIQKQDSATESSSKND
FT                   EL"
FT   CDS_pept        1744412..1753051
FT                   /locus_tag="PKH_143890"
FT                   /product="AP2 family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143890"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143890"
FT                   /db_xref="GOA:B3LCL2"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR028078"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCL2"
FT                   /protein_id="CAQ42171.1"
FT                   /translation="MNTPYSCERMSSNCQVSIKQRKLICTQNEEANNKYNEHSVKNNYQ
FT                   YCSDRNVQMYSNICNVLRGGSVRNGSNGQNWSGGSSGCNTSYTPNGLDGPSANHMLDAP
FT                   GEIYHNRVHNKSEANRNKRPYVHSQNRMTQEINEINESEKSGACAKYEVYKDTYTNQVE
FT                   YFTHCKKKKNMNIVNATTDSSHTNFTFHGSSSCGMATFMNHSTGESSTTLDNRPNGITQ
FT                   DNRNYHISSNQGRRHLMLHDVRSYGNKEIQDNIFTQNCVLNTFENAQNYSSIVPSNGVY
FT                   QTEQMYSNEAKDTSDNFSSLCLGGNKSCREVIYGKSRTEERKNYHDGKRTNDTYLAENV
FT                   DYDTHRNSIRNVDLLSCTSCSSVDNELSSSLNHLNASGKCSSTKYECNEMKDLLRKNIT
FT                   YNNVINNNVINNNVINNNIISNNIINNNVINNHIINNIITNNIISNNTISNNTISNNTI
FT                   SNAAISNHCNSSKVVSNNFMESVSIINQCVLNESQDMLCGRENKKIDPISIATNLGDHH
FT                   MNANFQNVNRIRANDNGDNFHVSNIYGMGNEKNNFVQRNPTDISKTWQLAERYEIFRTY
FT                   QENPPNDVSISDNNIYCSPRSGEGGDITAARVSLFNNNFCKSSCRFIQFNKNHVDSNAT
FT                   YEHGKVESEAKMKGTPFLMKYSNMPTSGKAALLDQMEFNHAGRNGITRRDTHKNVIKLE
FT                   NQHVEGKQGQSFNQNISLKQRICNVDDSHGNISAPVINTYRLSQSCQKEQMPVPSRYDK
FT                   QGSDILRSCVELIPLNQMGGNGSASKSCHLAIDTDRSIGIGIDHVTGDPPKQTNNIHMV
FT                   SACTVNKKISLNYNLNGPSGEMHVNSGDINASVSGTVTCANRQCGKSTCIPQASCTSSQ
FT                   ISTKQICGNQINTNQWNELVNMSTNYNMEGACKSSVSRCAEGGNTEKKCAIVVDSSTKQ
FT                   RQTLKRPTYRNYCSMGNSDGRLRKEELERRNRHTEMCQQNGKGKGVTNNKENVAVDTFY
FT                   PSAQMEGGESGGRGIKSQSKMRNDQLATTTKISSMGMSMEKSADHSADDTCVSMNCKKS
FT                   EKHKMKKMCDSFISLTSCGSYFPRKALEAQLAAEEGKKKKKLLDILFAYKSAPHIAKSQ
FT                   TIGSGRNAMKCGLTEHSAGSQVKGKEKKKKNSTYPLSYTILHEGHNSNKQNSLKKIMID
FT                   NYADRCEEKYHKSFTHECENLEKKKKIENSFLYVSKADGEKLSHGKGKVISSSSTSTVG
FT                   SSNSSGHPQEEEQLGARDLQEGGPMGVSDECAYVNVISSQVSTFRRIGTSGELANDYGT
FT                   VNGDSNTPMMNVTLQGRFDNKRNVIKDYQSYINCVGSELFACGGWSSDARDMLTYGNSN
FT                   ANANANANANANADGNSNANANGNANGNGNANSNASGKSDRNGNSTSGSVIINSNTNEE
FT                   KKMRTQNDVVVQCDRSCGCNNNGGSIGNISAYVSGVYNIRFPTHDQRFIRRSDGNTDGE
FT                   VNMPSAPNVPHECSNYVLINNRSVELPHGNNGVVCTSNASSIQNASNGSNKIGDTICNP
FT                   AMCGDVVGNNGNSDNNNNVVLHASEGNFSEKLNSFQGGYGSLAPKCATSERRANNTEDN
FT                   SKGHSVNGINGAGCVSIARGIRDVNDMSSVNMVNSPCQTQRNPRKDKTQGWESQNNDLN
FT                   SKSIPQEARDGEHMRSMNQCGGTILVNKEMRGTTTPFGCPENAQKGTTLRICNRNIHSE
FT                   GAICTNGTVMNTFQGSDRNLHSDNPVNKNVVKLFNGQVESNCKINNANGNGVASSFINA
FT                   HTISTNVNPFYRENEPTRAMGKGYVQNVAVNNFIHEVSSCIGNDGKTAGTGRSSKGNNT
FT                   NRRAQKERRSTSSRKASTRVATKSSASTTAITAPNIASNCTTPTDSTKGVQKKGKGEEH
FT                   EREDNEEELHEKVKHLPKITGVSYDKKQKLWVSHWRSNCKTIHKYFSVKRYGFDNARLL
FT                   AIKCRKQNTKYIPTDQVFAYKAGTESSAQPGIQSKGGESCGGEIHPSGQDIQLTGILSD
FT                   RKPSRKSYSIRKKNKGRTKTCQGMDFPREPLKNESEESVTKGVGAQKVDGDNGRIGRAN
FT                   LIKDFQNIGHQCSPPMSSDHPGSGLCSNDHASIASQRRGRTQHLHSPETRNPGFSPMQQ
FT                   SHQGVIYPQKVQGSKDQEQMLRENDLTAKCTVQGEAGDVYTNSGKMCVPHFLKKQGNHG
FT                   TNSSGDGVSGNMNNISNDYLTDTLSSTMSSTLSSTLSSTLNGSMNGSMNGSMNGSASAQ
FT                   NAEEAEQGQGVITSRTTQQSKNSGMHIEQGKNEKVEKSSAKKDYLINTQLYNKLINNQL
FT                   YNKLINNQLSNDRIKNNNYYCSLINSKFYIQVINNNLHAQMGRNQGEATKEGSNDVYYG
FT                   EFKNDASSGKNSFSNSGSISNKETVEGKDDHNLFLRSGRGAGDTSEGVPGGDTRKTNPT
FT                   FTNAGITYAGKIIPPREYANNGTGPYSKNNNSRIDGNHNSFRSDSPRMTASTPMVQNYP
FT                   KVKDGNILLSCGGLQNGSDSNKGDKNCGGRHVKEEAPYFNRTTQMLENNFSNEGASRFS
FT                   GGEKFLRGGTIQFGTTISNNQGGGMDISNVVRNNHNVNDALNPYKRREGQLCGDGNNSR
FT                   AIVNGNGVNGIGVDDGGLQLNRMATQGRHFLPASNNNGSNNNGSNNNGSNNGTNHSSSN
FT                   RSNHNHHPTNNHLPGNHNSDHHVSSNGRNCFRSDRQDALEDQCTSINNDPPKEPEQYGC
FT                   SGNFACNNQYGAQFYADGNYHHGNGVNIKRGIIQNGYLLSDQMGNEILNEGHSKVGETG
FT                   IRQCSQGGSPIVDPSARNPVNQMDEEKNKLMISKITTKYILTDIKNKCLRNCSSNFLKN
FT                   FPDIKNVINKHINKISEANSIYTIRPYIQLFSKLLEKRKLLHMLAPNAQELYIYSLHKL
FT                   PL"
FT   CDS_pept        complement(join(1754056..1754306,1754744..1754810,
FT                   1754945..1754996,1755203..1755279,1755493..1755578,
FT                   1755857..1755955,1756917..1757061))
FT                   /locus_tag="PKH_143900"
FT                   /product="ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143900"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143900"
FT                   /db_xref="GOA:A0A384KX83"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KX83"
FT                   /protein_id="CAQ42172.1"
FT                   /translation="MDGEKASTKLNVVGLISGGKDSIQNLIYCSKYGHDIILLAHLIPY
FT                   ENQNETDSFMYQSVGFELIPEIAKCMEKPLIQHRIQRKAINVGLDYEYNSNDEVEDLYE
FT                   LLLEVKTKYPHVNAVSCGAIQSNYQKKRLEHVCERLNLQILAYLWERDQKELLQNMIEG
FT                   GLDAILVKVAAYGLTKEHVGKSIKDMYSYLEMMSNKYGLNICGEGGEYETCTLDCSIYK
FT                   HKIIIEEYIIIQHTDDSVCPVFLFKPLKWRLEKKNL"
FT   CDS_pept        1770351..1778165
FT                   /locus_tag="PKH_143910"
FT                   /product="AP2 family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143910"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143910"
FT                   /db_xref="GOA:A0A384L451"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L451"
FT                   /protein_id="CAQ42173.1"
FT                   /translation="MQPQNKELTEKTTHLDTIMIGRFKSEHRHCGNTLTDNFEQKVNFT
FT                   PCAAGESGNCLYALCTSQPSTTETFNLGITRRSRLSRNRETSYQYNTLIRKFNEEARNC
FT                   YCANRNRQNFTLKWTLNRSKKVSNKSRAIIKRTGRMYQKKILSMNSSISSDFVSRGKKG
FT                   TNMRRFEEGRFRRLNVLSAKKEMLSFINTDASALKDMFLGNIHRSDSCSHGGNIYGDRN
FT                   NDMCVAAFKCCDHFVGHANCANYMLADATVGTEAALTPMEDRRETDGLKLKIDNSNIVD
FT                   LMNEGNTHISEQREKNEHKEEICNSSHENINLERGKSKCSWKKKGLKIEKEQEDADKDV
FT                   VGRSTLYYGMENKLEFPVNIEETSPSNNPPKDGRWRRRRTAPKNGSNVSAWKNVKKECI
FT                   SNTGICPNGCPEEDMNIEGLNDEFSNHWRNDEKEHYGEENKMYVPCITIEEELEFNNAG
FT                   TPSIWLRNTEPIEEFKEHPEEESPINSCNKWNIVSKNVNRNVSPYESEIFIPYEEMEKE
FT                   HAPNNEMMHSGIRRNEHMYESNLAVPLNHFNAPSQGWNYYMANKIGTHRTACLCTEGVG
FT                   LSKGTQWNRNNYIDMESCIEELSGRSISEGNLYEGQHIANGISNEHASMGNMWHGYYTA
FT                   CSEVESNLVVNCQVSSHAVEGNPVGTYSLGSYWVDIYPVERYPAEIYPLASNWVGSNRM
FT                   EMCPPGWVMKKDQCYSVPEVHAEEEAFASGSANPWEREEMGKEEQQSAHTNTCSLSSMK
FT                   KEELTLPSNVTKMEKHVKRKVNVHSILNNNRSLSCGMKREIKMEVPDTGVYLTQGATSK
FT                   LHTIADRERSEAPTARTSSIIPILDNDHLADTLGNQFDLENNREMLYSIPGELPDDRRL
FT                   VCPHTHMLDANVSANIRVADGTACTALIRSNTNAGILVVCSRSQGQGENELIFPYNDVI
FT                   HDNNEAFSEVATNSYYIPYPTWDNYPNLGMQEKFREYQYPYISSICPNECMSISGDYCA
FT                   DYPYNRPIDVNNSGEVDPKYSNHYFYPSWDNSLQCSGAEAIRNYNGICCDSTCSCNGGN
FT                   ICDENLGCNNGESSQGGKNSHYTDTFSKHGGNSCTRNTYHKLRRSKSLITQGYTYYQND
FT                   PQMVISDASNNLKDQYSQRSSKKRDSFTRFSVKGEYYSTSNTSNTDVISENSFLLIKGD
FT                   NNSITGHIGREQMDPKDETDVIPDGKHQSDQYIHRGACSGTLHDSASNFSSYPVVNLME
FT                   GESYSPRRSGKWEVMPRTSNNNASDGYGRMKEHVELKLESRNVQLGNPEGYVEGLLPGD
FT                   DKGGHTNDMKVKVKREASSDVQSRYESGNESDSHRGDQLNDQLNDQLYDLQMIAVDNAH
FT                   NTRSAKNDESTHAKGESGEANSPNYCRTKCTTDGIHNYNNHEVGNLSADRANSIINSDK
FT                   PYDGCFLEDDSKGSCRDALCTNGDKTFARQEAPKNILKNISACDRWNSGKDSSNLCSYD
FT                   SNGRREYDACGYLSRINLPHISDQRVYKIRYPVNDGCSDFSHSSRENMQSNHHINRMGT
FT                   TNQVNFPYGDCSRNYVNADPSESVTHITGDGSYPRDNFYNISDYQHSPNGTNYGDKWNN
FT                   SSGTFPLWWTPCHGNNGDSLKKPLYFLQDKFSTASDEVKHPSVNKNNTNETNMYMVTNG
FT                   TTLKKELKADTNSSEGTNSFRIKSEVANEDSMNLTNVPMSSECNSTLDTNTNPLSNNTY
FT                   NLLSISTKCDSLGFSNDDGTRVHGEESPSGVNQGEKINTIVVEEQPYRAYIPDGNSNTF
FT                   QIYEGNGTKDGEQVNTHTWGGNHFGTCVMENMETFEGGINLRKMPSSQMCIPRVKDENE
FT                   GSSTEIGSQKDEENGVGCTPQNYARCEGEGDMHTNEEMRDEGSMSVNTGINERVNANNG
FT                   DVSTYENRTQGTHDGNIVQNLNEMDTHLKNMNCMYTPEKYNYLNEAYFLSNPVNEVNFP
FT                   NGVWQERNSLNHANYEEYIQQYSYSHSYMSGMGGNFNVERKGENADRGSGDNEDGKSDR
FT                   PSDSGEKHTNGAMPHSIGMPIECANSIYDHQDVSGSAYYPGHIANNSNAIYGGMTGNGG
FT                   NVQGILDQTGFDCMNSAMYNGTSPSGVNHTDRNIVAGYSYGYPSGLCGNYPYGYAYEMN
FT                   THSYADENKSVSQSCTLENTNGSTEDVHNISDAQVDRVSCKYIESDNDGADASDEDTDD
FT                   GTGDETEDTDQEMSSENAEEKKASVSIVNVENVNNTTEGNPIITSESRTTITNLGSESN
FT                   ANGGSITRVTENSSSTMEGETSPNGVNSVKSESTACSFNETHKKDRCIENCKGEKMDHG
FT                   VEAKSEKVVKRRGRKKNNSDDFKYAHEKKKELLKKKYNVQKDVVLTVEEGDLKLIAEEI
FT                   IKNTSLLPERGPYGRNALDASHPIHSVWKDTSRGHSSWRCRWWENGKRLSKNYNVKRYG
FT                   EEDALKMAIITKLRNSSPADRILYLNHQREFLNLCYANNWIQKRESDRAEADQDTAKIT
FT                   LQKDDITKGEKRSKRSTTGDMDAHETNKECNQEKDSKTIHLSVPSITYSTNTSPDDAKA
FT                   PLHGNNLRRKNKRTLLTNTRSSKKCRTLKCYPSGPNTDTMRHAQEGDGTDGISERNAMH
FT                   EVSAPNAVHVVNTQGDVKLEVI"
FT   CDS_pept        1781978..1782541
FT                   /locus_tag="PKH_143920"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143920"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1A4"
FT                   /protein_id="CAQ42174.1"
FT                   /translation="MGNYCRKNRAKEPKRREIDELAEREKLESEVEEQPEQIPEDIEEL
FT                   QDQPEEPPEEEEENEEVIEYPIQENKSFDENNLDDLDRSNSDIYSESHKYDNSSDKLET
FT                   GSQLTLSTDATGIVQQVTKLSEPAHEESIYNTYKSVTPCDMNKLDETAKVFSRRCGCDL
FT                   GERHDENACKICRKIDLSDTPLLS"
FT   CDS_pept        complement(join(1786369..1786509,1786646..1786699,
FT                   1786790..1786903,1787156..1787358,1787645..1787729,
FT                   1787875..1787940,1788106..1788231))
FT                   /locus_tag="PKH_143930"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143930"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KGN5"
FT                   /protein_id="CAQ42175.1"
FT                   /translation="MDQGVEKLLNQINDLESKNRLIHMQIEEMKTTEKELQKSEKELVS
FT                   DIENICKQLKSMEKEEIELNNDITRVNLICKNVEATLHNEFVKVEIAAQKINQVYCHEE
FT                   NEKNINTDLGKSIDKVKDCLNKMNPSNEDLIALKEVRRKNFLLNNVSIEDLYEIYEDTK
FT                   DQYQENSFKNQCHKIAIVDYKTHSYFCNPTHLIHMTNMLIEKVRESTPDQNFNFANLAS
FT                   YYGLCKGKKKERIENFGLSELNKIMINHYKAKKINVNSSA"
FT   CDS_pept        join(1789339..1790597,1790857..1790926)
FT                   /locus_tag="PKH_143940"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143940"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143940"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LP25"
FT                   /protein_id="CAQ42176.1"
FT                   /translation="MVPTTWGNAKGVRKIFALLTYKKYDKPFCRLFISVSPTSGAHNRE
FT                   LVRGGAINTSTQLIVKCVSDTYKSKNFSKIKWDCINNDILKNLDKFHVKEILKIVSIVS
FT                   RLHSGKSILTQFIPVVKGKLCSMNYDDVVRIMSSYVKANIKDDLFYADLCAVVRKYYQH
FT                   VEAPWLINLLFNINMCNVKNDNIRCVERELLDHLTEHIPFDGLANGCSSGAESEHSRKG
FT                   EPPKERKNNSKGNKLEEVDEKYIPRTKLYDARKYDLILFFYSFSNYVFMDYFKNAESSS
FT                   LRHHFAKKLERCHDAVRKVSQSNEERLLRESPPFYLFLLYKAILNQIYILEGEATSTIL
FT                   LDMVKDKIKKVMGRLENREISSKRGKTNEIVKYINILQQNLFPYSQNRKNFFLCHFENN
FT                   LELVKVLLSILQESNHSDMNRYYLWHREKVQEVQKIIRLIEME"
FT   CDS_pept        complement(join(1791096..1791137,1791270..1791457,
FT                   1791788..1791830,1791957..1792079))
FT                   /locus_tag="PKH_143950"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143950"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143950"
FT                   /db_xref="GOA:B3LCL8"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCL8"
FT                   /protein_id="CAQ42177.1"
FT                   /translation="MISLATDILYYTYGRNLGNFLFNTFLFFANYLNCVCLLLKKISCL
FT                   FDRTNYRELCSLCNIKRANLNGLQMENKNLGLLSIASINNVEALNKSLLEMETQINDRL
FT                   STEFEDFYEDEYNFDFLDMVQENDLDE"
FT   CDS_pept        complement(join(1793785..1794782,1794947..1795208))
FT                   /locus_tag="PKH_143960"
FT                   /product="CAMP-dependent protein kinase regulatory subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143960"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143960"
FT                   /db_xref="GOA:B3LCL9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCL9"
FT                   /protein_id="CAQ42178.1"
FT                   /translation="MNDQDIQKQFEKYEESVKRNSKKNILRDKSKSSIDGGKSNLSSSS
FT                   SMNKREDGDSQYKAAHNDAQEESQLSGANQLPSSVAKKKILISEDYSSDGDETDCLSEV
FT                   DKKEMELKESDIVNLSVSQGKRMSVSAEAYGEWNKKKLNFVPKVYKKDENEKEKIREAL
FT                   NDSFLFNHLNKNEMETIVNAFFDEHVEKNVNIINEGEEGDLLYVIDEGEVEIYKMKENK
FT                   KEVLTILKSKDVFGELALLYNSKRAATAKALTKCHLWALDRESFTYIIKDNIAKKRKMY
FT                   EDFLTHISILKDMDPYERSKVADSLKTKTFSDEEVIIKEGEPGDTFYIIVDGSALAIKD
FT                   KTVIKTYSKGDYFGELALLKNQPRAATVKAKDSCQVVYLDRKSFKRLLGPIEEILHRNV
FT                   ENYKKVLKELGLDTACIEGN"
FT   CDS_pept        1799587..1801047
FT                   /locus_tag="PKH_143970"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143970"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143970"
FT                   /db_xref="GOA:A0A384LIL7"
FT                   /db_xref="InterPro:IPR018767"
FT                   /db_xref="InterPro:IPR040202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LIL7"
FT                   /protein_id="CAQ42179.1"
FT                   /translation="MKICESKLPIIPIEDAKHYSCSEDNDTINLENNSNDLNSYQNFLI
FT                   GSSPNDGVHKCRDKHMHSLVKKEKGREKNCSTGGSNAGSHAGSHSWSNRARMRTTNRSI
FT                   NEKGLNLIKRKKGLMRKDPYGSTHLVLGNIRSGRKLKRKLLWNSYYGDQNTNVSELSYI
FT                   KEFENNSFMHDNGHHMLVYENKYPDYSALSKRENRSNKIKNFFVYSPDIIQRWIRVIFN
FT                   VIITSLIVTLIYFTFISVREDINKKVAIQMQNVKEESESCKKQYYAHKCGTVNLPILND
FT                   KCEEWLRCMKTDHKLYQDFSFLSAQMLGQLINAFIVQFEWKSICVIAFIFLLIFIGSNY
FT                   ALSIGGGGGARGNGNEYNLYSPHMSPAVHANGSIPPFPYYHFYPFMPQGVNYGGPSNNP
FT                   DVPMMNIPFSQNKYYSSGSMGRAGGGYPPTNYSYLNQYTNNSENNASTQSNSRNKDYSE
FT                   VYNGSSKKDSKRGSKKLGFLKYLTPGFK"
FT   CDS_pept        complement(1802074..1805595)
FT                   /locus_tag="PKH_143980"
FT                   /product="dna gyrase a-subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143980"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143980"
FT                   /db_xref="GOA:A0A384KUU8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KUU8"
FT                   /protein_id="CAQ42180.1"
FT                   /translation="MWFICLLFFALVTHLFLPLRDLNSFFVRSEKWEKILPCHSSPAKS
FT                   SAPLFIHNAHVGVTKGRSTLASHRKGITGRSTDGKNGDTFLSPFLLLARKGNTEGKPDG
FT                   KPDGKPDGKPDAEDVASSAVPTSTVGNDPSEEPSTRMAKRKESNYAGDAKKVGISDLVD
FT                   ESIRGIKGEYHDVEICDLLSKNFLSYANFLILNRCLCDYRDGLKTVQRRIIWSMYEINK
FT                   GAEKSSYKKCARIVGEVIGKYHPHGDKSVYDALVRLAQKHHNNNLLINGYGNFGSVEYN
FT                   AAAMRYTEAKVSNFCYDILLDEINDENIEYVRNFDGNEVEPKVLCSKVPLLLINGCSGI
FT                   AVSILSNIPCHNLVDVINCTISFLLDANIRDDELAAIIKGPDFSTGGIIISKASQLQNV
FT                   YQTGKGNIEIRSNVFLEYTKNDKVQVIHVNDLPNVNAEDIDTRGSKKLVIKNLPPNVKP
FT                   NELIENMINILNEKKNEHENILQKIRDESEKEDMRIVLELRKNSQVEQINDFVSFIFKY
FT                   TQMQITYHCNFVCIGHQNSYTQFSLKSFLQLWCENRINFIKKNLTIKNQNLQKELHIID
FT                   LYILIQKKILEIISFLQKNQNIEEIKNFFKENFKLNDYQIHHILSMKIQKLVNIKNVDF
FT                   CTHKEQILARMEQNRDLISNVDKIKRLIIDQLTYIKNKYGINSVGRFAPPQSVKYRYVY
FT                   INPPERNHHFKEHSLALVNAERDGPSGYGGDAEDLKGERKISKKDTLSDEIRNQEEQQT
FT                   PVEDPALPKARNLRGVKKIDPTTQYRQTYIDSIHTDVKNVYNNDYVLVLITYGGYVKKI
FT                   KVAEKLKNHQNNIIKLSNVKYILKENEEKKLKDGGAPVEAANVVESGEEGANSMSAKSS
FT                   SLNAINCYKVKKSILCRNKDKLLLTDSQNKAYILNVYDLQTSSYDSKGTPINQVIHCSK
FT                   NITGMTKFEENKKYLIVCSENGKMKVINNDVFLKKKKKGIRLFKNKKDIHFSYCNFSDN
FT                   CIVGTASGHIIQFPLANFKISKKNSLGNKCINLGKNDKVVDLLAYDNDEKNVGNFQIIF
FT                   LSKGGHGKMINLEELKVQKKKGKGYKIMKFKRAKRDAVLQGEVAKEEDKENKNHEKYVK
FT                   DADEFLGFKLYDMTKKNDNDFLIMITDHAILIRKNITLLKKKNRKHSSQIYAKLSKLNR
FT                   LVYFDIM"
FT   CDS_pept        join(1807627..1811346,1811558..1811860,1811991..1812344,
FT                   1812539..1812960,1813125..1813338)
FT                   /locus_tag="PKH_143990"
FT                   /product="phospholipid-transporting ATPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_143990"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_143990"
FT                   /db_xref="GOA:B3LCM2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCM2"
FT                   /protein_id="CAQ42181.1"
FT                   /translation="MVDDEELKRLRFVLSKKVGRIKYFFSYMFYKIFSHFYNKKNKKRE
FT                   RFVNIHGRTSPQFFCDNKIRSTKYTVITFIPLFLFYQFSDFLNLFYLCVSLLQIIPIFN
FT                   TGYVFTFVAPLIFIILVSLINEVVDDLKRFIKDLENNNEIYYTLLENGNFEKIYSKDIK
FT                   VGDIILIKSKQRAPADCILLRNLSKNEEYTFKVEEKKFFGSIKLNKNSNVYNKINKNYY
FT                   HFNKNIDNELIDDRYNESNNNLSETSNHQLFSENEKSLNGAKEKKFLLKDKPEKSGHKN
FT                   DMNSSGELANFEKKKKKKKKKKKKKLKNRNLKNKDAGAGGSTETANYTYVKTDKIDGET
FT                   DWKIKYPISIFQNLKKLKDFFTIDILFILEQPKNDIYKIEGSFVIFKYNPHGDFQKEEN
FT                   NNTMGMSDNPLMNYSFDMIRDGEVDLERGNRGGVAKAGEPAYGEEDNDDDDDDDEDDDD
FT                   DEEDDEDDDDDGEDDEDERRKELELENVADGNEKGVHHKGYVNLAEKDTDYVYSNNRKE
FT                   KKMNNEMVKFNDLEKGAVVGVGGSGGTMSGQNRGVIENYNCTKNNAKKSGNYVAETSMC
FT                   SVFNNEDNFNFYNVSYRKKLTYDNFILFNSVITSSDVLCLVIYTGSDTRVNMSTQISKI
FT                   KRGMIDNKLNMITLFLFLILALFSMYMCTVKLNNLWYLNFIRFVLLFSSVIPISLSVNL
FT                   NIAKIYYTLVIQKDKEIETTIIKNSAIIENFGDVDYIFTDKTGTLTENVMVLKVIHIGL
FT                   DVIHAENEKNNMLQGNMENKGKGNFNKHMLSYDLDDLNEDVDGSSFYLGSNYSKNERRN
FT                   KYSGNKNELSALRQLNKTVNPMDRINILHDEENIDEENLDYENFDFGNFNEHSAGSKSG
FT                   FSQNNYRSANLKPFKQNSLAMSTSVSGGGLGQRRNDIHKKNSVHLEKKKKVEQMVDEFL
FT                   KYKLDPLDYYNDNVEDVEFLKKHRVFQTFLSFLICNNIRTLAKESNNDGDSNGSVNGTA
FT                   NGSANDSTNASANGGDSKEKDKVKKKKGEKETDTQKNFYYILKVNRKNKKENKKKKEKH
FT                   MDSSSGAFSYDKKNLESNSSEDSETFSHSDVSYQCSSPDELAFLKYATNCGFILRKKTA
FT                   SRIEIKYKNLVMEYDILLHIPFSSETKRMSIFVRNVKNRNIYFFIKGADNILIKKCHEK
FT                   YKTFIYEESDHLSNLGLRVLVHGFLNIEEQFFHTFSNLYNKNKDVKGQLENILDYVEKN
FT                   IKVLAITGVEDKLQEGVGKTIEMLYNSGIKVWVLTGDKIETAICICKNANIKKKKHNIY
FT                   IFRHENIKSTSNLIRDFNSILSNIDSYVLFFDNIIIQNCIKYIPNAFVDFAANARAVVC
FT                   CRCSPIEKKEIALLIKTIRRKKILCIGDGGNDVAMIQAADIGIGVLGKEGKQVVHDSDI
FT                   IVSKFKNIKKLILYYGNNTFLQTSSLCSFLIHRGFVLTYLQFIYSYIFFSIPVSIFQGW
FT                   LQIGYTTYYTTAPFLSLLLDVKIKKNLIYLYPEIYKNKKHKRKLDLKSFFIIVWISIFQ
FT                   VLPDGLRAPTVHAPLLRRQRHTIHYSCELFFTTSFHLQGTVVMLGALKLFNDNYNNLIN
FT                   ISFSSLIVLEIMNIHLEVESWHPLMISANICSFIVYIFSMFILRNYFDIMQIMSVMFWY
FT                   KVILIVLFAWLPFFIIKKVKNILTPSQFFKLA"
FT   CDS_pept        complement(join(1813527..1813571,1813768..1813847,
FT                   1814231..1814345,1814536..1827885))
FT                   /locus_tag="PKH_144010"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144010"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L7V0"
FT                   /protein_id="CAQ42182.1"
FT                   /translation="MENLKCVICGSTSFRVEEAQVVCNECNYVNEIQQEQFEDEYAEQE
FT                   IDEHVNKAYLEKDFYEVLKKLYKNDKIISRIKNYVFKENDEFFVKYQKVLLNFMYVFIT
FT                   EHHLPLLLYDEVKKIWFYLLKVNIMNSNVYIPMGDAKDSVKSVFEVIRAQKLEDIAGHI
FT                   LKNENIIKGIKNVIKKMGLSKLSYFFIIQKKIMNDIGKSLEFLPRKSEVSKRSDVKLLK
FT                   IYKQTALLDSEKNNKENFLKINEIIHNIRKSKLTKEEEELDQDGHNHFVISNVFTTQGG
FT                   SGNPPGYVPHGKTQGEGILPDHQLMEAPPRPNNFGNNFEDFDVQEMGDGDGMFNLANFP
FT                   DLDQTDQLAHVDRTNQVDHANQVGQANQVDHANQVDHLNEVNQFGQFDQFGQFDQFDQL
FT                   DQLDQFDQLDQLDQLDQVADHIGKEKTPNRATIPEDTQTPKDVENFIQEENYAQGERVY
FT                   HFCSSFIINQLLKHKKLFRPIDPNVSTNYMNRSINHTNVIDLFYQHDFLYYFHEELRKK
FT                   CDIEFLSFYDIIQVFKGEYDYMLPPSLGLTTGPYIPTSEKETSESNSPTQEDILTQQSN
FT                   DPQEFHLQESSPFDEATQVKDKSADSFDLEMSEVPFFEEIKMEQSSMGAPLSSGLLKKA
FT                   ALPSGDEHSSVVESLRDNISLGGEFSEFIGPKGEPGYQVQLDQVEPSQLEGLYEEGFGV
FT                   EDEQNALVEMLKTDQLEKESAAYKKNKRSAEDVEKVLKNYQRYVELRKTIGKGVLQNKH
FT                   AVRIETLSDDEKLKKKNAQKKRGAQEGKNTLSRQDQRENDTDLLSQTSPLINQINDFIP
FT                   EYDVNDVYPSRTGVPSPGGGKEGFAFLQAETVVEAPPMDEGATTDKAIKGQGTNVGGTS
FT                   VGSTSGPPNASVVTSIRTVYKKLEYINNIKREKSITIEKHYYDNGLKKAEKNYSKIEIF
FT                   VKGSILRQMENENLKSENQEMLYIPDRYLIDSYIFDGLYEKFLYISNLSKFRTMTIKHV
FT                   YSEYVNFFLKDYRQYLIDDETYKFSYNFSFDLLFYLLYYSMRRLQIHCLPHNMTNYINL
FT                   DNFNLYKIFNNVPELLQKIYKDESSIYSFPLKNTNFSEIKKSFFLRNLKTGVPFLCMHN
FT                   YEHTNKHFTPEEQNEIKANQGKKKKTHPHNITYFKNIKHLKKINSIITYFTKSKWVNEI
FT                   PLFNSTLIIDLYNQINDLVFKFQLPNFVQIYSMKLLHMNIFKYRFYKFLFNVYSNQYDD
FT                   MHSELNNFYSFKHILKDFSEFYSGKSAPIFSKKEVNRYILYLMKKEIYFKKKILRKKKY
FT                   IHRNTGQVNYNVYNKLNYFYRQKFICTFFITFKSPISVEKKRFYSMAAACVLTACKFYY
FT                   PMLSCDFFSFQNMFVPDKFESFHRANHYHCHMPQAVHFYNGGNLQGGSHAGGKQRTKQG
FT                   TKHGTTKRTKQGSKQGSKQRTKQRTKRDDQADQDASIGEHPVGSTLHRQIKASLRRDKH
FT                   KTGKEEEPISLGSRHHGKKRKLSESSGQLDFPKGGPRAKRTKHGGSNGDEVLPLDDGSL
FT                   MGESLRKGSREGSHTDHAYDHYSEIFTDESDTSDTTDTSDEVFSFRPNDGEQNGHGEKE
FT                   LEHFFAQEYSTDGSDCDSNNAHKRGSAYGKYYREIIFEEASVGKKPTQRGRKSKRKTNP
FT                   PVPIRRIHFKSSIQKRNFYFVPIPSIMKLFFNYRRFNSRDTSVYSLPDMNLGASCSSSD
FT                   EMDDEEQYISHVALEGNPSSTVTRKDNKKNVKKTIINKQGSVNHKETYLNLNKQRMILI
FT                   NISNQESYSGSGKKRSRYEKKPVAISETLVVYQNPYCCKEFLDPPPKNLSPLERKFHKM
FT                   KERLFQSLCLSRSPQHLANFNFDLKKLLFYSAIRSVMDECKLPPREAQPCNELREDASE
FT                   WFVLLKMLSCWRRKGTCEKFHMGNNSSGIFNSNVDGDTAKGGGKDRSGESPMGNGSDID
FT                   SRNNSTLGNHPGGNGTEKEKDQFVNFNGETIEQFKANSLTRREKNLYRALKKQSKDING
FT                   EDAKEIADDKSQIIKQRHLIHSKKYEFLFFRYAMLEYHSMLKCLRECQFMVDTLNVLII
FT                   KTWNIYDTLFLYYQIKHTIKEFLKCFTQVTNMLHYFLLMMKHKEYIHAKQFNCFFRNKY
FT                   TKRKNKFSHNFKGLFFVFELYSVLYRTKFKIPSYFKYCPGALFINNTSLIYYKKEPYRG
FT                   DIGKRQETFAHLYNIFLGGYCEYLNNLIYNVFNLNVVKETMKKKMKNALNTIHGIIRNT
FT                   YMDDDYIHSYVFPLTRKNLFHIIVRNVKFFSLSFEGTLNLVRGKYATCLDQYFEPIERC
FT                   GLSSLVDVVTVLSVYPSCGGAKKGGSYPIIGSPKRSRNTHRVLSKYLTLILNMQKKKMS
FT                   IPYLFCDNSSPWNRTEESGVYFLHHDGSDVINEWIHFLMSKNYNVLNNTHLIDILKYKA
FT                   IADVQGQACNQLGRSEDNDAMYNFFQSTCYNIEPDIGFHHMVKLFKYFKKVRRIIPRPR
FT                   DVFLLYYLSYCTNLFKRNLLSRSELYINNSLARRILYSFLPNLFRWNQKSNKNSLLMKN
FT                   KIINYVQLFRFILRGKRNIFLASEEGMFVSFCDLSSRCIHFGEKKKKILENYPSSDGGK
FT                   TNATSISWDKQFQSTLSPWRNRKHECSKYMKWINLVDLSKIYEKFARNLQCPFWGTNEL
FT                   LLNRIIFFNLTNEIVISELWQEGRQPPEMEDICHPSGEKPSRVHKRKGSRPQMRQTSSM
FT                   TTPLQKIAYSIVLDNFINNNKQLILIRNANRLRNKLELNMEKEFYKMRYSIKTTTKNAA
FT                   NASSSVSVCSSIPFASLFPPEIKKETRGRKKVTDSSAKPPKIVKYSAPTKFMKRCSVLT
FT                   SMVYEIDSKIKNCPCSILGKEDPIKSLVTFEEPFLLKEPRVAEAIDFINMINCKLCTKM
FT                   KSLFSTVPLDGHLISYLEKRCAHIFSKENLKEEIFYFAQEIFAKLKMNDSNGDTITGGH
FT                   LQRRGKHSTERNMKEGNPDGNDPSDTPTEEDEFLYLSTDVDSYKTDSMYPLQMKKNQTY
FT                   RDLKKYFRKNQMQLNIAIEKNEFCELNKFGYFFKESEYNRRDATIIHECYRIFANVLNK
FT                   MSTCLNNLDEGGVWGVPIYRRLFEWYSNLNMYDPFLLIHNRPNDYNAGLMGGSTRVTVP
FT                   FPTGGEPPSKVKGSTNAHLSNVVMRKKMRKCSGKFTKRLHAKPHICIYNDNIFFKANDA
FT                   SLKAEVDKSDKYDNSMINYSLNKNSHFEFRPHVNSFTLRLKNDYIKKKNKTIYDHVKKK
FT                   QIHKIRYVQNVVRTQKYTYFFFSCLAYPISHVPRIMYLFSIRYFPSLFVKVANYLNYFK
FT                   VDQHLLQFLSTFAVSTIEQIFKNIKKRKNAENIFHFIRFRGFYVNPFSLLGSIYYSKDI
FT                   QLLCSKFKLSLCSYFNTLHTVLSVEGMKKESRVIIQERDKLGLEDPSETGGEHTQQQIR
FT                   RHETNISQDRTQTDENLSQIDPDLFGEIESVFDVPGKESSEVTPPEEEDNKSEVTVSNT
FT                   RRRKGKKKKKEKYNDSHNSMMESYTGMNVKFSDDEKNNIDDDKINKFFEKINRRCSTSF
FT                   SKQSREIRNISLLEDTIRSGRNPKEGLKKMLFTSGMNKLFSRENIIEEDEDNEDEIFLQ
FT                   RVRNFNPLSITHNVLAIQPSERRSKKPKQGEKQSLVRSKLESKAAPLSKRLSNPSENRS
FT                   YRGQLVHTEKGNHSSLQYYLFRDDETNLLSVIEKEKRASQEVGGSRRSRPRKNSQIREM
FT                   TEVAEMPEGADGTLIQNDKDVNDDCVSKKHLEMYDLCVDQVERDSQSNLYGGSHVASSS
FT                   TSRNMSVVGSHCASWNGSRNASMNYMSVGGSRGGRKMARKVGRKVGIDKIGKHRGNEGD
FT                   SHFKRGRPSKCDKPSKQDRPSKCRRHSKKVKRIYDKCQREYLDTEIAQPFSTPSETINL
FT                   YNIILNSLNNEILLKNDSITYGKYIKKTPLEFNYIVYREFSTHTNYYSETYDKSALNEF
FT                   VDILYTDKFRDYYLEGTEAAKAGGKELDVFEQGEDAGMLWEGEEVNVLEQGENAGMLWE
FT                   GEEVNVLEQGENAGMLWEGEEVNVLEQGENAGMLWEGEEVNALEQGENAGMLWEGEEVN
FT                   ALEQGGDSARLDFGGDDAPDTYKEGSENKSQSDEFFCLNDDLLLAGEGDDPLREELDGS
FT                   EGAHQGNPQGDLQGEHYDDDQHDDQHDDQHDDQHDDQHDDQHDDLQGDEEHDRESAPQE
FT                   EDNIRSMMNQFWEDDNLLENIQIEQKEMLRIQEANVPDIIDHDESTTSQFSDCYESSAD
FT                   SEAESVNQNSYTVCSFYLHKPVYIIDEQTEISQLEREMHKKDEIKNDSSSGPAVSQTMH
FT                   NLFFPLKKDELSKYITKNDRKFKKIYKKLIKKMQYDQNIKRTSYAIYDKTNNFLMYDYK
FT                   CSMYKNIFGKFTRKYVRKNKYINRKGIFDGNNFIVNTICNDIYPYDLEVRKVVQIYKRN
FT                   KLFIKNVKQRYISRRYRHSFPWVGDNMLVSPNDVDSFIMAGYSSILTHQNTSYLKNFNY
FT                   HSANAFIPLYNKNLPRNLEHLSTMMCLLIKAFSSYMGCPSNDLITACKEVECIFFRFSP
FT                   "
FT   CDS_pept        complement(join(1829359..1833181,1833372..1833931))
FT                   /locus_tag="PKH_144020"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144020"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144020"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCM4"
FT                   /protein_id="CAQ42183.1"
FT                   /translation="MEEGTLGGKKTSPPFDIESYENLIKRERSDNLNGSCREEKEVSGS
FT                   DGIMKRGNTPKAGENKWMKNEQNKCIIFSTLLRYKKYLTKKGNTYFDFNQTNLKLNEKE
FT                   FLLQSSNYFHLFDISSLFYPHVYVNVNSHMSINISDYLNYITRTSPEYITAEDSSVDAN
FT                   EIMQYASPQEFILECIQKVEHIEVFKKVQLVKKLLLTVNREVAQKVQTYVDNIPEVNPN
FT                   DYIFVQTNRQNDLLFGYVKSSKFNLIFEIFNFKKFFKNCHNNNIDVTIHQVKDKGSDGE
FT                   SFVQRAGTEGGIYLKEQSIHVRKDAYQNIKFCSVHYCYYYFFKNAPVKYIFEEGKRKKK
FT                   IFTFSLCLKYVKNHLFLLMLYNYSPPSEDKKNCVNVEEAIPNLEEMEIHNKHFNLNETD
FT                   KNVFKRNTFFVHDLYDHLKCKILNLISFVEFPPNDYIVDIHLTKLKTCNSSSRGDYSFS
FT                   VYCLSNGGVVYIFICTLMMRDNICEESFQVDISKYYHFELKRKDTYHSIKVVKCSSVFL
FT                   RALCGGGTQRRGRKKVNRRRKNSCAEELTSNNKSEVSHTLEEETVPPLQMGNVGEERRN
FT                   LISSWISSDGLDPTDGSAEMDKYKYFFLIITSKCDIFIISLRRKKKGEDIELVNYSCTN
FT                   STNPNDVIRGVLVNKHHFEKTDEAENRSKPKTAMGHTNRCIAHQHHMKQTNISCPIFEL
FT                   LCYFENGDVNKYNFVCTAKEQFLEFFLTKNEMPTGELLSKKQFFIPILFPFNEQVLKKK
FT                   KKKKKNDNSVTLYNTQTSYFKTILFIYFQEKQFENVCLSVNDQCLVITYVKSFCKLLRK
FT                   IRSLIERVKISQEKLHRKGNVTSQDQVGILQMGRKRNSRRNNGKVEADADFSPDEETNF
FT                   IEGESMNGNLFTQRDHKTHFWEYKYILFGFYDLFLINQNNTSGNVRGHLDENARNNPDP
FT                   AVSEKEKRKDESNAMNSYDAHSHFNFLNLIKEYLSYDNLVGCISNVPSGDKNRKVKMNF
FT                   YHFLQTLCHFQANYVSEGNSFFHLIFNVLCQKNIYTDGVYSNNAVGRKNLSLGMDPLLD
FT                   IRTHFCILFSFFIHMYNFCLKKNGISSDSFSSHITYFLINKETRRNKKRFRYVYRPESR
FT                   QGEGKTEHTDNDANGKVDHLVGQKEELHMNSRTKQQAIPEAVPQTTPQTTPQATPQVTP
FT                   QVNLVTMRKCLYYISKTRKYLQSIFGVEAKGEDTSRGISSIPHVYTNLYLCQVLYIMLN
FT                   TLRINNTNLFVNVAYDLRKNNMDYFYLLILLNVYVLHNSLFSHGGHQNPLSGDGEENLH
FT                   QFFNHIFEKKNIPNGGKTDTERMEGIEIEQDAFERHQVLIHDFIKKMTSRLKDDHYVIE
FT                   RIYFKINCVLCGKVSVSNLYNPYYICEQKHIFNKCMVTLCCIGKSSLIIPSVYVSPDLS
FT                   KPVFEGPISILQFNLRVKLDCTYFCSFCHLFMTTQNSFFAKHFLFNQCPFCNHDLVAI"
FT   CDS_pept        join(1835492..1836193,1836367..1836486)
FT                   /locus_tag="PKH_144030"
FT                   /product="integral membrane protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144030"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144030"
FT                   /db_xref="GOA:A0A384KXE8"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KXE8"
FT                   /protein_id="CAQ42184.1"
FT                   /translation="MVSKKTLEARKAFYDDDVEKSKEAHDSYHSLDKHGEQHSLDKDNL
FT                   KTIIFGSLDGIITIFAIVSGCVGAKITPAQVIIIGVGNLFANAISMGFSEYTSTTAQRD
FT                   FMLAEKKREEWEIENCPSEEKQEMIDIYMNKYKFDSEDARNLVEITFRNKNFFLEHMMS
FT                   EELGLIITHEDKNESLKKGIIMFLSFCVFGMIPLFSYVAYTFFFQYTDYNTSFVVVFVS
FT                   TLITLFILGIFKSQFTNQKPIECALYMVLNGSIAGMVPFLLGILLKNNISD"
FT   CDS_pept        1838213..1839139
FT                   /locus_tag="PKH_144040"
FT                   /product="mitochondrial carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144040"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144040"
FT                   /db_xref="GOA:A0A384LAN0"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LAN0"
FT                   /protein_id="CAQ42185.1"
FT                   /translation="MSKDLVSGSILHCLETASLGMPLEVWKTRMCVYRNENTIRSFCTI
FT                   YNKGVGQFYAGFYAKLIESSSKGAVLLISKEHMIKFCNNLNINQTTSGFIGGAVGGISQ
FT                   SLVMTPCTFFITASIDKKINYREKLADIIKNGGFTTLYKGNCAMCLRQGTNWASRQGLT
FT                   EWVRNLFIERKRKAERLRQTEGQVGLKNEVMHKGNNFHQSTPTKDTHSIGKQGDTPQDL
FT                   SPTEELLCGVLGGALSVWNNPFDVIRVYMQNNANKNINLTFLQSFVNLYREGGILYLYK
FT                   GVIPRCFLCIWQTLFMVTGIKILNKYY"
FT   CDS_pept        complement(1839691..1840380)
FT                   /locus_tag="PKH_144050"
FT                   /product="ribosomal protein l24, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144050"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144050"
FT                   /db_xref="GOA:A0A384KLL0"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KLL0"
FT                   /protein_id="CAQ42186.1"
FT                   /translation="MSRYVKYFMQAKQLDKRKRKYGNLDFLELSKELSIPFPLRERNQP
FT                   KHLDLSKYLNIKVGDLVKVIYGPYKDREGLVLNINTKRNTVIVDGCNMKKSAWNVTNKN
FT                   IGSIITQEMPIHITNVAILDPITKKATVVKRRYMMHGECVRISKISGCAMPEPVNVQAI
FT                   KEQNNYEIFMHKKKTGPPIKDIYAERDCKNFNLLKKISYEIKKKRFYEMKNFFNNSSPG
FT                   QEAISPG"
FT   CDS_pept        1841687..1843042
FT                   /gene="GTP-CH"
FT                   /locus_tag="PKH_144060"
FT                   /product="gtp cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144060"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144060"
FT                   /db_xref="GOA:A0A384L1R2"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1R2"
FT                   /protein_id="CAQ42187.1"
FT                   /translation="MFKRGDLNEEKHSGLDSVHTYGQGSWMYREAPLKDGQSVGVSGNE
FT                   DQREGWKCVLNTSPMKTNLGLGLFRVKNGIENNGRGCNNCRDGDEHFSYTSQPTPSLIN
FT                   KDSELRYNGISISREMEKMTDYQTNGEELSHLSEEASLGKGHQNNAGSSMEASPPCAIR
FT                   MEEKRGAVNGLRRKVIKRVEKKDQGGNSCDDSRNDRNLDDISSGHTNDSHNNNGNTNGC
FT                   DPPPVRRKEPCGIDTPRESNEKAGTKKDEQIADISRSIKKILRSSKVPPKDILKKTGRR
FT                   FSDTFLYLTKGYHMSVEKVIKKSLYKRNYKNNSVIKISGIHIYSLCKHHLLPFEGECTI
FT                   EYIPNKYIMGLSKFSRVIDIFARRLQLQEDLTNDICNALGKYLKPKYLHVNLVARHLCI
FT                   NMRGVKEHDATTITNAYYEVKNDTCVNHAGNGFTCPSFHNGNNPSREDIAPV"
FT   CDS_pept        complement(join(1844000..1844106,1844267..1844449,
FT                   1844607..1844772,1844996..1845115))
FT                   /locus_tag="PKH_144070"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144070"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KPX9"
FT                   /protein_id="CAQ42188.1"
FT                   /translation="MDIFNCQYCSVSPFDYILDFIYGEKPPKKEEKKGSHVTYDDSTSN
FT                   NVSQVLSKVGDQVEKRSTNEILLLCRAWENYVHPRAKEYWKDSQQLQNILCKIANGIAK
FT                   NDDPILGDDYACVFWYGDKNKNDNCPIISVKKGNDNVETITYVNRVLIFLYADEASFQE
FT                   LQKKPKKAFTMACGNTNCINLTHISLDD"
FT   CDS_pept        join(1848675..1850786,1850885..1851055,1851178..1851285,
FT                   1851415..1851461,1851641..1851701)
FT                   /locus_tag="PKH_144080"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144080"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144080"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="InterPro:IPR038499"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZG9"
FT                   /protein_id="CAQ42189.1"
FT                   /translation="MQVVCDFAHLKMLHGTVPIGKIIYANLKELAKNQEYRFDEEIENF
FT                   SKLREKIMTMQSKGINENLLKLYKEYLFYFETFRKKNLLRERKKLLWTNDAFDEYKKVE
FT                   YEFEREHILIIYNIGLVAATMLKIKKNSDDIKMLNRMSKDVVEIFNYLYVNMNEDRIPE
FT                   LPDINCLSCYIFLCISMAYHENMFYNTALAKKYKRNLLAKLSFNIHCHFKNALHCLEGK
FT                   ELHLFFRNPSKFSSSAEVRTSLQNIRSSSSPFYNFVKVNKMIFICISNFHTALKYATVH
FT                   AENAEDNIKIEKYDLEKIGEIICRLKYSQENVERCVELCRKYDFNINLTSLKEKVQRAL
FT                   EYFEYENKNIYFEVIPSYESLNEIKGTSEVLKLKEIDVSSIYIKTDNISCRLKLLFNEK
FT                   AELVYNIYNNEAVAVYGTFYKQFLSLRDQYRMINLSYRKNVLLTLHNVIISTYNKITNV
FT                   HRPTNFENNLTFLQNMEQNLKEILTQVENSLTAEHTNHVEFQRKFLNVGINQESINSYN
FT                   SFLYHLNIFKKSLEEIQSSVESFRKFLQDNQMHFHICQMDPSTFAKYIVDELNTCTTVK
FT                   IDSLDHEYMHYKNLLSEDRDNETHSVSSMGDFSEVSSTSAPSLNYFDFHAFLKNQNLTY
FT                   GAQNSKGVNEKNLFHYDSVNNYINVHSEEKMFFVILAIYFSLSIQLTAFGADLEELRSN
FT                   MHDVFLNSISEVRDEDKLNDLLQKQKVALNGKKAKLEESVASFEKNLNQFYDYYHEYNK
FT                   LDYFKTIEDLNTFTINLMSTVERLNEMNKRHSYTLKNSLVFKDDINRYIYMRESERSTI
FT                   RVQQIPNGYPRNMHSGHQHF"
FT   CDS_pept        join(1853641..1853699,1853853..1854813,1855783..1856214)
FT                   /locus_tag="PKH_144090"
FT                   /product="SICA-like antigen"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144090"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144090"
FT                   /db_xref="GOA:A0A384LFP8"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LFP8"
FT                   /protein_id="CAQ42190.1"
FT                   /translation="MNGQNGNGNAVEDGDKQGGWTISRALKKLETAFTTDLNDYGPLLK
FT                   KCQEGVTKSSISDSSHQNILCNYITSAVRGTYGNRKSGAGSVFSGLKRTERCYILRICM
FT                   KYLIKNYCVKGEDVTTILKAMEPQVKKWSVGGEGKEEEKKKNRRAFGRCIKKSWSEEKK
FT                   GEIKLKCEVIKIIEQIEKNISGKWSPLKTLPGAGSGTCSTASNTHHGSQYVNDCSGGGL
FT                   TTTTTTTTTATQSNGSDDDGDDDDDDDDDDDDDDDDDDDGVPAPTTTQSLTSHSSGHGM
FT                   NGSFSQSLPVKDGKGGKGRKGTFLSFPSLSSFPFDSIHPYLPLVPSIIGIITITYFLWK
FT                   YFGQLGKIRRFRRAPLRIPGPSVQEQLLDHVEEAGSHEYRLFKERKRRSAPTRTKRSGR
FT                   DPARSGRVNRGTIIEIHFEVLDECQKGDTQLNQKDFLELLVQEFMGSELMEEEQVPKEG
FT                   VSMEEVPMELVPIEEVPSLGSRLLV"
FT   CDS_pept        1859701..1862325
FT                   /locus_tag="PKH_144100"
FT                   /product="polyadenylate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144100"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144100"
FT                   /db_xref="GOA:A0A384LEX7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LEX7"
FT                   /protein_id="CAQ42191.1"
FT                   /translation="MLATGTNIMHPSFSTASLYVGDLNEDVTEAVLYEIFNTVGHVSSI
FT                   RVCRDSVTRKSLGYAYVNYHNLADAERALDTLNYTNIKGQPARLMWSHRDPSLRKSGAG
FT                   NIFVKNLDKSIDNKALFDTFSMFGNILSCKVATDEFGKSKSYGFVHYEDEESAKEAIEK
FT                   VNGIQLGSKNVYVGHFIKRSERATNDTKFTNLYVKNFPDSVTEAHLKQLFSPYGEITSM
FT                   IVKTDNKNRKFCFINYADSESAKNAMENLNGKKITDDGQIDHTYDAKKEEAENANANNG
FT                   TNNGIATGADANGVEGEVGKGTTVDGKGDNKVSTAGDTGKSGEETEGGANTTGATSESV
FT                   KGNEGNKVESDDKANETSGVTSTDGASNVKEDGASSIAANAAAQGESTNGINKKDSGSE
FT                   SADSPNILYVGPHQSRARRHAILKAKFDNLNMESKNKHQGVNLYIKNLDDAIDDQTLKE
FT                   LFEPYGTITSAKVMRDDKEQSKGFGFVCFAQQEEANKAVTEMHLKIINGKPLYVGLAEK
FT                   REQRLSRLQQRFRMHPIRHHMNNALNSPMQYPNPQSPQLQFNQNTLNYGRPVLTPFNQN
FT                   NLISWRHQQAAQQQVVHQQAAQQQLNFNANLRGQMNQMRFYTQGGANMMNNSMNQNKVN
FT                   AQLHPGHQYPNALGQGNPQQPNLSAPGQHNNNQAMQQQPANNQMLNNNMRNMNNRASRN
FT                   MGAGNIANIPNQKQLPINMVGKQNTSQGSQMNHQGPPPPQQQQGQGSPQQQQTQQKSPQ
FT                   QMQQQVPPNGNFKFTSQARNRMEMPNKNANKVNAINNMNVNFNNSSTLTAAALASAPPS
FT                   MQKQVLGENLFPLVANYHPTLAGKITGMMLEMDNSELLILLENEEQLKKKIDEALVVLQ
FT                   KAK"
FT   CDS_pept        join(1864205..1865208,1865361..1866108)
FT                   /locus_tag="PKH_144110"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144110"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144110"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCP9"
FT                   /protein_id="CAQ42192.1"
FT                   /translation="MDNSIIQDDDVIITDTFLSDNEEEEQFIKQKAFAQRNSRVGIKKS
FT                   DDNTTYVENPNWRSVRNTNFDGPNEDGASSPEEASIILKNDNPREKENGRDNGEEGFFD
FT                   FDNYLKDDDNVQEQGKQEDRGKKLRSVRNNKVWHDSDDDVLERDSKSHSRGFAAESEDD
FT                   ESLDGEQIEIGHETDEEHLIKNEQSENYFEKYIDKVDIETYEGEEQINAASTIKMEDIY
FT                   IFDNNEMDSHIKKKRRLNKMNEKNIFLKYYLQKFTFHRIEDKKIRQLVGMPKANLILPV
FT                   YNSDLYVLQYKERLLSMSKKISFRGRIGHVQESNGSVYILMYDNYVRNYNLEKGIVYKN
FT                   RIHPGNAGRVIPMEIKFFHTNNEENMGLSEQSNNHLYGISFRRSRKINIYDTRSFDVVK
FT                   SFEMDYKCIGMNFHQKSNSLFAIDSKGNLYNWCLNTNKLINRVVDNYSVFPSCFSIHGD
FT                   NLVTGSFTGFLNLFHVDNLTTPIKSFKNLTLPVSNAIFNPSHNCLLYYTKLAKNGIKLI
FT                   DLHTNYVYCNIPWFNNNVRYNVLAADFFNGGDNMCFSVKANSFYVYDLLGAGPVASGGE
FT                   LKATSVV"
FT   CDS_pept        join(1867047..1867304,1867485..1868063)
FT                   /locus_tag="PKH_144120"
FT                   /product="chromatin assembly protein (asf1), putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144120"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144120"
FT                   /db_xref="GOA:A0A384KRH8"
FT                   /db_xref="InterPro:IPR006818"
FT                   /db_xref="InterPro:IPR017282"
FT                   /db_xref="InterPro:IPR036747"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KRH8"
FT                   /protein_id="CAQ42193.1"
FT                   /translation="MSEVNVTKVIVNNPICDILDPFVFTIEFEALNKLEADLEWKIFYI
FT                   SAVNNDGEGNQDIELDNIFLGPIERGVMMFDYAVNPPDYKNMDVDSVLGLQAILISANY
FT                   KEKEFIRIAYYMNSFYKDMELREKPPAVPQYDKICRHIFVENPRIVKFCITWDAEEKDD
FT                   FKEFDKENEQIELMNSIKMNADQNSNSNITNESTQENIFVSSDIHGNVGTNGKMSTHME
FT                   AHENANMYGNTYSNADLNERGVLSSNGASTDLDKCELFNANINGISRITIDNNNNA"
FT   CDS_pept        complement(join(1869764..1869880,1870412..1870520,
FT                   1870732..1870818,1870975..1871251,1871380..1871488))
FT                   /locus_tag="PKH_144130"
FT                   /product="Cytochrome c heme lyase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144130"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144130"
FT                   /db_xref="GOA:A0A384KA25"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KA25"
FT                   /protein_id="CAQ42194.1"
FT                   /translation="MQSIGSTIGDDQNGEKVRCPSSLVENLKKMPKEVKNEVINERNMM
FT                   PEIPNYSLSEESECPLKRNRDVSSIPKNTKENWLYPSPQQFYNSLIRKNKHIDKNYIDA
FT                   VVTVHNEVNEESWRHILKYEYLHRSKCSEVTLQRFLGKFDDLSVKAKFRSIFSRLGRPF
FT                   DRHDWYVNRCGKEVKYILDYYNDESMQDDKNIYIDVRPAMNSFSNIWDRIRYPFYEFYF
FT                   KHIKRYELFR"
FT   CDS_pept        complement(1872725..1876426)
FT                   /locus_tag="PKH_144140"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144140"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144140"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L8N0"
FT                   /protein_id="CAQ42195.1"
FT                   /translation="MKGKGISTDAPKEERTTKRAKAKKTTKCAKGKAQRNKKRKQGKTL
FT                   KGKEPSSDESDVYFYNDLRRWQNNVKVPIWLKKPKDKESIKEFYKNVIKKLLRVKNKIR
FT                   AYKIEEAYLIDCLRKCLMDLNLNSIRYLDYVNYEMFRRPRAGECSDLLKNDAKDEEKGK
FT                   CSNHTKEEVVPVGTQEDIAKEFPLKDDNYADETTHIRVDCPTGKLTPPTAEEITCLIES
FT                   LKKALSVEQKDKKEDLMRHVFNKVIIPGAFFENNNFCPIFMNLLKLDIYNSCCLSGTEM
FT                   SPQLMNLIQLLNNFDEGVADAPSTGKKQKDLPSSSSASTPKGDVQNADAKQKDAKQADS
FT                   QQADAQQADAPPANSQRVGKHHNESEDNSYREDRLFFQSQTSLFKLSQYCIEKGIVENQ
FT                   QVASFDTIYIYNGKEYQCGSYKCKNKKKRLLSHGNLKYSLDVTEKKNESLHFINEKRVI
FT                   LENDSTLRNRTNCDSLYEEDLNHAHVKRQYVEDVTPVKVGKEVEEGLANESVPSVKAKE
FT                   TSCGREVLEILSNSDEKEQLQYGQLAPVEKETISSVEASMNETDQSFVSAVSVVKGTNK
FT                   FDYGGCFPQACTNEGCKEDPNNYLRDDMLKLDEGGNATGGEGLDEEFLHGGDTNMFGTP
FT                   RKATAPTGTETFRLYKENGPEGNGQNVELPLQVVKPGIKNTESNIKIRKRKVSDSSHSD
FT                   HSSPDKSQSFLFNTYELFMENGKIKKNKKLNSSNEFEDLPIEGKSSTEESHDSKGSNFT
FT                   GAQVRFQLESNEVGWDSSLNRNHHIISSSEKDLPTSPFPSSRHSQACHDSDMSVIVEKI
FT                   NYDREKDFGSGGREINTMEIFSPSRTRTKCIPNLLSDFSVEKKGYADERDKNVTCAMGR
FT                   FCNDTSVNCIIDMHDYLKGDGSECLPPKVISHSEVIVLEDNDEEGNEDNTGGSVDRGNY
FT                   DSVRNCEDTPQTDKRTPWMNTPRINELDLSIPAETPKTKETESKKELSILNIDINKMNN
FT                   VVLEELMEFFGLKSKTLSRKTLITELTRIQSYLNEQFEKMAKEYHLPISTQKDPPKLSK
FT                   AKSIEKGYSADCSTYRDREEKQKRTIWNNGCSSSVSHSMGVPLANDLNAEVQRFFQNEE
FT                   WFDGSLVGGGSTDHVSTTQMISNEVSTTQKSPHPLNDDQAKSQEDYLNHMKKKIKQMEL
FT                   KLLFERIDEAIGVNEVLHDHIKREKEIEYSLLKKYLVDCKLSVNREIVMSYCKDKDIQV
FT                   VLKKKTKV"
FT   CDS_pept        1877795..1878763
FT                   /locus_tag="PKH_144150"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144150"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LDE8"
FT                   /protein_id="CAQ42196.1"
FT                   /translation="MIPQLLQKRAIFHTVLSAHGRTPYAECVSKSKRTLCELFKRHFGV
FT                   SGSYGYSIFSKEGNCDSNVGKNNLHQYEEKNMGNNFLKKKNFYFTKWPGSVSKLGASYF
FT                   FGKKYNMGFYHLLIEEEGKIKKDIALISSCNAKSVQNKKIENKMKDLSCGYSVQIVLSG
FT                   KGVKCYYEDVSYTPFRPTYRGNTKQYYTFKNSPTSEVQGMENKNTEGGVEENESSEVSN
FT                   SPGGKEKDKWYKTKTVKKLFVRLGIGTKNIDITRVLTMHKRYVSIDVDRTGTIINVHGF
FT                   NKKYVGSVSHRLYRIVRMNVYTMKGGYVYMHKPKQKVSKKK"
FT   CDS_pept        complement(join(1879360..1879636,1879903..1879958))
FT                   /locus_tag="PKH_144160"
FT                   /product="RNA binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144160"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144160"
FT                   /db_xref="GOA:A0A384KH14"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034150"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KH14"
FT                   /protein_id="CAQ42197.1"
FT                   /translation="MSRRSIRLPAEVSRILYVRNLPYKISADELYDIFGKYGTVRQIRK
FT                   GNAEGTKGTSFVVYDDIYDAKNALDHLSGFNVAGRYLVVLYYDPVKAQRKKELQEKLKN
FT                   EQEGKN"
FT   CDS_pept        complement(join(1881073..1881166,1881429..1882965,
FT                   1883178..1886427))
FT                   /locus_tag="PKH_144170"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144170"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144170"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCN9"
FT                   /protein_id="CAQ42198.1"
FT                   /translation="MLAYARKINHIKKILYREKVRRNKKIQCHIQHVPYNDQYKETVTL
FT                   SYKKGILTQVIEYAEKERSFSLLSNNVGTHTKGRSDFLPPRKGSYLSVPSAENGSAWVA
FT                   STPHGAPPQGERNPEDGYTNGKRGRNLKVETSSHESLISTSPQGTCRESRPIMPHTRKH
FT                   NIMVIKNYQDEGNEEGKQNRLVMQYHVGSIKGVMTILDKCQAYNYKNVNVLEDICEVIP
FT                   SLSLQDTNIKDLLSILHAFIKLNYFNERYFNYMFLRLLNEHSMSNSDLISLLFVLSNVE
FT                   KLNALSCVLLYKINFMFLHRMYSFSLHQLHNVLNAYLKMHKRLSDREEFQRGSTYEEAK
FT                   THRRGGRKINSKFFDLFYKLRFDEVTKTWGSAKTGESAKTGESAKTNSPLNSVDIIFRL
FT                   IEILKKEKIPMEKLNKFITPQDCLNKAFINHLKKEIALLLLKKLKSEHVLYNRLERKRL
FT                   YRLRDSLLGHPKEKDPNGEVKVSKKGTPQLDSQKDKKSPMGIHLEERELNSVRTSPQEK
FT                   GGNTGSAAIQLKLIKRVKNELSARILVPLIRVCDIRDENHYTNDKDGENRLSSDCPSSH
FT                   PDCNLPRRNPPVDFLLHCYKHLPLKFDAKSLVVTLSCFSQRRQTQTDEVLHMLMNLIEK
FT                   KINKFTPEQIVDMMKSISNLRDERIPNGILNFLIRFLFNKNGIIYLKDEHICSLLNVIQ
FT                   KKKKFINEDGIHYISHFVVNHKPPFKNVKNMFSYFSFHFHFNKFHNHFLSALYCSFLSD
FT                   STDGDFLQLDHLNRALSSTLVIPTTWKYQKRVFKKIDTCLLSTLKRMNRSDYFPRLRDL
FT                   SDAVQLIFHMNSSMTSEVYKSYEGEINKMRRNKRSPWDDTTNWVFATKNGANGQVRKVN
FT                   STKIARHKDGRQKRKLQFYYARNPYNEVYLMTSSFNLRIFILIRKIVHKVLNGKGCANL
FT                   HSEEIALLVKAVTNLHELQKKITKMNGTYTYFYVGTKWRCKKNKTINTYFLKIINQINK
FT                   DILQFLCKMEHERIFLCNVHMLRSNYLFEPLMNEQFVLSHLQQSVRRMENRPISTDTTV
FT                   LFFNFLSSYKIDEMVLSSRGVHLKDMLQSASVSRADFEQLERTLMKAFLDSQKIESPNR
FT                   KREKLFAHMYSEKKRPKSTIRNAIKYFFLTYKFRNWEYLKKYQQERKIYINKISKNLER
FT                   KMLKRKIKKMDDLVKRNVSFKHMNKYNKFLIFKFTSKWKNKRKYLVLKCTINSSYVDAN
FT                   DMIELLFSSVVMSIRHFVNHPKGSFLRAPGHPTCEPPMPEYSKCVTFLLKKMIVLKKPK
FT                   IVNITYPLYFKLCLCIEAIKWVYPKLMKNYGHILMYWKKVMATHLGGEKTFKNYFDYAQ
FT                   SGGGACINAINENRMLSASHMLGNGNDWGTVPHTVTPSKGKTQQSLMNHRNDALQRFLT
FT                   YPSISQTNYKYKLKSKKKYSLENCLYFKNSKCYKNIVFHDMHEHVSYLQNISHQLYINF
FT                   VHWKRRQLRRSNNQGGQKKKKKKKRNYKSVIQLNCNYAKRNSILYKCSFNIIDVKKVEM
FT                   FHSHLVRVDVAKRNRTGNIRTFFVFPYAPFNLNTVVKNGTSTDNAMQLCASTFCKRELF
FT                   LTLFLMNAELAKHIQTEINIVPVATDKLNNIRSRKQLHLYLSAKLLC"
FT   CDS_pept        join(1888037..1888045,1888288..1889055,1889224..1890102,
FT                   1890228..1890593)
FT                   /locus_tag="PKH_144180"
FT                   /product="KIR protein"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144180"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144180"
FT                   /db_xref="InterPro:IPR008780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KA98"
FT                   /protein_id="CAQ42199.1"
FT                   /translation="MSTAPNLKNLPSRTDYYTKFNTGQYGESYGNSCTLGWEDKLKGKL
FT                   SKYGGLSNMETRIMNAYCYACKKKEQTESDHGNPCRFFYYWLGNMVPKGANTYNLSEVL
FT                   DSIYQAFEGTPYKNKCEINYEDVEEINFDLRRRIHDFAYNYKTIQGLVDKCGHTEAKEY
FT                   LRYLQRISGACRIVGVDCPDGEARESGTYCSDYKEKYKAYCEDKLEELQGKLTTFLNPN
FT                   SNEAGSSGSFSESGGHHNGLAGAEGKGGSDGGGSHQKEDDLSWLPSKEAYREIVSITDP
FT                   CEGHHDLISEVQGALGEYNVLGGEANSIAKWFCYPLGKESTLSTDNSACYYLYYHVGDS
FT                   YSSYFHKDDSPFWNFMDKISEQLGKLPVGKEKKCQIELSNIDKNNFIWEKRVYDFYKDY
FT                   QTIKEKLQETKPPCSRELDQYLTEAAIGYKLIDIYCKSNRSTPSGSKDNAYCVKFNTDY
FT                   KQRNPWELLNSTCKTELEDEISAYSETSDINPHGEPEEVPVSPATTPTVSSGEVSSTVP
FT                   SPTTDPIFSFARDGPIATSGLVAVGLPAIAYFLYKHTSLPFWLHEQFGGRSNHMSRSRR
FT                   RARRSTGPNFSNFTEDVSTEVPTEYSSYLSTLYPLEESIEDNSTTYYEESPQPSPRRRG
FT                   QQQEQRRRRGPAPPSRRRERTDNEYRYGRGQNISYYRM"
FT   CDS_pept        join(1892193..1892485,1892626..1893631,1893753..1897060,
FT                   1897195..1897282)
FT                   /locus_tag="PKH_144190"
FT                   /product="tRNA synthetase class I, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144190"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144190"
FT                   /db_xref="GOA:A0A384KLM4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KLM4"
FT                   /protein_id="CAQ42200.1"
FT                   /translation="MKRKEILTVTVILLVYVITQQWSSLCFRRTHKVAQILNEYLFDGY
FT                   SKAVSPCFIRAVKYDKKRKCALKEHRNKIRDVVRHSVNLPVQVMPTTYASFDRQKDIQD
FT                   LWNSERVYEERNFANVKRCIRDGRKKKEKKSILREEKNGFRKCGALTGRKKPAQTEPMI
FT                   KKKKVITNLRWTEVIGNISNKGRRTQDGYRRDNYVDPFGKSIPQNLEKKKRLIHFYKKV
FT                   YRKIRIIHDGPPYANNDIHIGHILNKIIKDIYLKYLLMRNYCVMLIHGFDTHGLPIEYQ
FT                   VMKMLNIKNVQEISLPDFPKGSNKQNFQIFILNKGKIPEGRSEEHFLTRWLTNKEKRHN
FT                   MEMYPNRLSDRRSTFLRNLLHREDVPLVSLSQTEKKIMYFKSLCKSYASHFINEQFMSL
FT                   VSYGIWGLWDYTYVTFYNIYEAIQRAIFRSLLKHKHIYVSNRPIYHSYATQTVLSDSEI
FT                   IYKRRTCNSFYFFFDMKGVSDSLALKLLGASARNEPIREMLQVGDHPLSDHELEVICTN
FT                   LGSSPRGVSSDEKVLRELLDRTKEMIKRKLKILVFTTQMYTIFNNKCLLMHAEYIYEIV
FT                   KVKFEKEDSLFFLICEKSLDMFMDYVKKYYLKGSKILEMKKIMKLKGKELDKCTYLNFV
FT                   NQVENNFVFVSKNEIDESFGSGIVHVAPAHGFSDYNVYYQNNERRKVHLGQEHYHEDKG
FT                   RGDTQMENFTKEEKIKKNFHIGEVNSVDENVIDQNDDLKEEYAKVVRQNCWKNANLIRE
FT                   DAMSGKGEMSPLLRNLLHGDVESTPKININREDIHLIFYYAFHKNVLFHFPYEHLYTYD
FT                   WRSHTSVQIKSLLQIYVDIEKIKQNKAFYESIRRVNFVNDHVKDALIKNIENRNEWCIS
FT                   RQKYWGVNIPLRDLIIGGDSKVSFRQQILDVWFDSSVSYLYVMYMCKHILFNQYFRRMI
FT                   SSRRRKKSAHTFLGKSTSSDDPPFFNVYDVYNQLEGENRGREESGDGTQKEDLLNDIMR
FT                   KRKIFDPEIMYQRLMKRLKSEKSYLKFGSVNDIVHSYRNRKKKGSFFVKDMGIHLCCEG
FT                   VDQIRGWFQSFFFVYFFLNSIRKKDGVRVEAGINTHRKVGVNSESNVWPKEDDALPIRN
FT                   VIVHNYVVDEKNVKLSKSLNNVISPRKLFPLRGNRSSTTNAVSSEGTCTEENVTRRKIP
FT                   LEGNVIKKKKISKRTPPPEGKHFNADIVRLWVCCYNFVNKNVSVSHKILEEINKHIYLK
FT                   IYNTLKFLLNNLYDFDFSDVKLVEGEKELQMMDEYILSKGDNTIRLCLKAYGKFQLQIL
FT                   LKHIMNFINRDLAIYLDYSKDRLYIHERNSISRRKCQKIFYNILMDMLKILAPLVPHLC
FT                   EDVYGTLLSLKEKVGKVPLEERKRGKHKSLFFCQMPTVRRRKEVHLETLFFVKYFVHKQ
FT                   MNAFLSNSLEGVVYLYSDNEDVIRLVKHFLKTPDPLSSFNNHDDLRFLFNVSNVILCEN
FT                   LMDLRKMDPAFRTYKIPLVRAGEDGPQEYDEVDQLLRANQTEENPFQDILRAGNTSKQA
FT                   TISVGIGKSTGAKCTRCWMYGTVRAFEGELFCPRCLSVVKKYFN"
FT   CDS_pept        complement(join(1897673..1897870,1898162..1901152))
FT                   /locus_tag="PKH_144200"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144200"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144200"
FT                   /db_xref="GOA:A0A384KRY9"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KRY9"
FT                   /protein_id="CAQ42201.1"
FT                   /translation="MNGEEVSAPQGEMAEEAEIQSGDDMNYQNSTERTDDLIGSQSMME
FT                   KQDGDDDEDDMEDADNDENDAEEEGISKKESNPSDDPHRKDESSNVKVEEDPTGNNSID
FT                   NNSPYVNHSAHGGINQLGISQIDEAANVHVNSKKGEEVPPGSQEWIKANVEEAQGGIPL
FT                   NGGMSGELNGELNVEGGAKDEQVNPSENLHEIPSEGSKNAHAKQNQEHEPVFMRPSNTY
FT                   LRNIVKKQSPNIKNSIHNLNFPNVNSMTFDPYYGGEGGKISVGGADGSVIKNTQLPSGA
FT                   TMMYSTNIAEEDLHHIYNLLNGELTKSPDNDKEIHRVKDEIISLQRNNPTEVLTLQRCY
FT                   ASVRGNKKLIDVLFGLIGGGNVEAPNKWDYSFSHGMPMNYLSYDTVNNMHQMWRQEVSG
FT                   WGGAQRNFFPLNGFDCSASQGRGVAQNWEKEKKQKQNHIGSCEVNEYANMRGGDPLTNG
FT                   GGGGVLSGEVNPIQWNIHPQGLHTHGGVAPWISPPSMVYGKHAPAEQTIGGTPWGASGM
FT                   KDYNPHVNTFEWLNQNVQTKNEKYKGSSLGVDYYNPLSEGGRNTIDWNNTGQGSKANHQ
FT                   QGFSNMYKCVSCKNKCSHVYYILKPNNVKKISYGVLDKCVWCKSCFNSSMYPSILNRSN
FT                   FVKVNIPYSFVGNDWSVAEVEKLIDGISKYKNDWQKISEFIGTKNPYECIFKFTSMPLS
FT                   NPYFDIDNLFNINNVSFKSFKQNNTLLSLLSFICNYISPYIGAYAAKKIVDFILNKKRE
FT                   CVAREKEKEQSEECKKQGQWEKRENPDVQRGEIKMENFEAHQSKGEPSSEDHAPDEDPN
FT                   EANVKAAESVKAEAEGASEHKTSDEALPEEQHDDVPKKENEETGLNVSESANVPDVANV
FT                   KNATNVGEEDTANHQMNNNAEIKTERGQDPNMPPEGNPDFVPLNINLPPKDSASSTYIL
FT                   NEKDMQEIHNTIINASKKRAQQLADLERHNVRKLLKELALISTRKVKLKLKQYQYLQHY
FT                   FEMQNKQMERKRARHGDEATAEKDEQNNANEDNEDNEEKEEKEEKEEKEDKEEKEQKEK
FT                   SEENEKDTHDAPDE"
FT   CDS_pept        join(1902885..1903615,1903743..1903968)
FT                   /locus_tag="PKH_144210"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144210"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144210"
FT                   /db_xref="GOA:A0A384KWL7"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KWL7"
FT                   /protein_id="CAQ42202.1"
FT                   /translation="MKLDRKKDFKKKLVTCFSLLQVSDPIKVIVDETFIHLCIVHKIPM
FT                   KEELAKLINRQLMLMTTKCISTCAKKTHNEETAYGIRKITHYKCNHNDDNVRNSVDMFL
FT                   KKMNSERNSPFSVNNFFENEISVTHNFDSVCNVKGNPSRGKALNGDEAPQTVSAGVETQ
FT                   QVEEETNTEVNQPEGEGAPKGEEATTEEKQPKEEESQNVGQSEWKVQLSDSMKCIIDLV
FT                   KNNNEKKFFVATNNNELRSFLRKVFIVPIIYISEGGTIKMENLSTKNTNKKAVVELRKM
FT                   KMLKWERELKMSEQKRDKDKVKKNGKKKKKTRGRNGR"
FT   CDS_pept        complement(1904663..1905367)
FT                   /locus_tag="PKH_144220"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144220"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144220"
FT                   /db_xref="InterPro:IPR013730"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KMP5"
FT                   /protein_id="CAQ42203.1"
FT                   /translation="MKKRNLFSNKNRHIKNKNYLRKKNKYFTDQKFLRKFKKFAKSDEP
FT                   KKELVRSDPIKNFFFTPNHANQDAHAGEENTEEGKEEEQGTDIKSANGDDIQEDQREDS
FT                   PIITKHNNGITHSLRGNKTKGSATKKKNSPDESQQHPKNDSEDETQTEHQRKNHGRHGK
FT                   SVYSKEINIVSMKRKERELYLKEKEAAIQKSEQEKKKKKMIRIKKFKKLNKKTKKGQPV
FT                   MKNLINHLLKKI"
FT   CDS_pept        join(1906401..1907566,1907730..1907979)
FT                   /locus_tag="PKH_144230"
FT                   /product="ribosome biogenesis protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144230"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144230"
FT                   /db_xref="GOA:A0A384L4C4"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L4C4"
FT                   /protein_id="CAQ42204.1"
FT                   /translation="MEGKISMQKNGAVGNKKSNRGGKHVIRRRREDASQRMEKRIGKQK
FT                   GRSNEEGRGVEETECGAPHNGKYYNPVMKGKGANCRFNTSMFRNGHRNGNMRGVPGKGK
FT                   YQSSFHGGRRKSRNDAERYSYGGISTGDVDNQGDEDSGDTNSNTYYYDNESSAASEGEA
FT                   PMEQINHEEEASGKEPHINSDQQPTMDYMEYKNSLKKGEDPKCDNKNTLDPPEGKEEIG
FT                   VDVPSDDDQKGVFKIFLLFSPLAITSIRNRKCVINADEHMLFLENQLKGVQDLLSSARS
FT                   AKENVFLKNKVEAIENKLRNVRLDILFFTLLCLRDSVINKRGKLQIYVHTVNGLLIFVS
FT                   PSFRVPRSFSLFKKVMLNLMLRNVVLDPDGRPLLKVLSHPVKHYVGSSVCIGISSMGFP
FT                   ADVKKLTKKIKETRNEYSFFLSLSTAFDLTHFIELISKTDSESFPFDYIIRLSDLPLST
FT                   VAVCSKLTHFLNE"
FT   CDS_pept        complement(join(1908138..1908196,1908427..1908496,
FT                   1908729..1908889,1908984..1909112,1909253..1911476))
FT                   /locus_tag="PKH_144240"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144240"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144240"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K922"
FT                   /protein_id="CAQ42205.1"
FT                   /translation="MEKESHAQRKKKKKNEGEGSEQGGSPHDASNSDGNNLDEGLPENE
FT                   ATDSQDEMSDLEDLPEYERELILAKRHEEHMIKEHRRILLKKVKPQPQVEKTDQDDDAN
FT                   YVVQGGKSVTTVAGSKAALGKAKKKVASALMDKANVSGRSTKEGATAEKKKNKQSSKTG
FT                   RGGTTASSAMERDLHRNESCDEIRKGKDSSLSPIQEKEATKWGENEKSDYQADRVKSGT
FT                   EGDGVKGKALTKVYSDTADSSVSDYSSHKKKSVKKGKKKKERDLHTKEGVIKHFDVTTS
FT                   EERNDLYSNEKGEKREDWNRRKKVLKKGSHLYERKKAPSDKSSFSDDSRDSRYSHYSRS
FT                   SLGSRRIRVREKKAREGHTQSRSDTKDHHEGKKLFEDSKDGSEDYGAGKGEQFAKETIT
FT                   PERLIQLYKEEKKIKLEVYKYITYEIITYFQLKKTFLLDMSEHVNFPYHVIGHLVKVND
FT                   ANLLVKLSSEDRIKNDAVGSSGVGSKPLGGTADGVKNAPTEQRRKAKEINAPNEEVSNT
FT                   TTDEQAIQKNKKNIYFITNVIKSENYFCIDRHTNVKFELAHLENIENVNFFSRMKNQMV
FT                   KNKKIYINEVTSPDNSSLLQGGSTFLCDLNNICDQKFSVDEYNCIKLFSIDLEVLKNFH
FT                   QFLREKIEDLKNFRYTERQIEHLVEMKKKQSFHEIFSNKKSLDALPISRVTVQREICSI
FT                   QREIDTLNYSKRKTNPRDLHALSQLEQQIDALTRKKDILKGQLQKARTNLAPNKNTETV
FT                   HHERDKNISKVKPLKNYRSGPRMEELPHKLLGVEERKGISQLANYIHEEKKSFINFLTG
FT                   KFVDLPLHVHNKIVSHFLLGCLQKEQEYLDNPPEDSSDDESGEDYHLFGVNIAGRVTPF
FT                   EELKQKNFN"
FT   CDS_pept        complement(1912813..1916685)
FT                   /locus_tag="PKH_144250"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144250"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144250"
FT                   /db_xref="GOA:A0A384KC72"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021841"
FT                   /db_xref="InterPro:IPR026825"
FT                   /db_xref="InterPro:IPR032878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KC72"
FT                   /protein_id="CAQ42206.1"
FT                   /translation="MFLNLIKGLEKNEAKEDVISINIQKLLADKTYEKRKKGAQEIAEV
FT                   VKLLLLKEKEDEQVQVDHILNECNQDGGASGEYNNFAHKDINTFQGFNSQTEVDVVNSE
FT                   HYFRDYTDQGKRTDEVSVEHEKRTDEVNVEQDNNHREKKKSGEVEKMSSMLKEPSEEKL
FT                   LLGSEIIKKLLLEKYQENFHIDLAIGKSTGLLQGKHERGMSTITPAEMNQMEKKKKKKM
FT                   NKLGISNRLSELSQVNKILYEHDADIENVTNKYQNKKVISIINFLEEKFVQSIHPAERC
FT                   GGLIALAFISITVDTQIKFYFSAILKLIISCVSDPDPKVRYYVCESLYNLCKVSKSVVF
FT                   YYIEDIFDCLFRIFSDTCPNVKSGGAFLDNLLKDLTCSYNNVFNIYKIIFILKERIGIE
FT                   NSNARQVILSWLLLFQNIKTVNLFEYFHFFISDLFLMLADQNRDIQKQANQCLDLYVDK
FT                   IITSNYEQVRSFFKHIAFIFIDFCIHKNTIIKHKCLLWLYHFIQILNVHFYAIYRNAKK
FT                   NNLFICELIKRIIACTAHLHFDIHYTARKCSELLISFIKFSEMKCAPLLTKLICSIICN
FT                   TISKVELSAKNEISQTGETRHSVEAHPASEGNSSREINRRRSKPIHVSRRGKRVTDHTP
FT                   QRRSQQESDHTVGGRSEPGKDSSRQRRSLNCESKENEAGEDNMPERTDKTDYPDDPDSA
FT                   NEAYLLEGAHGGAGSDDFSFESYNLFYQEGDTSDEEGSKEGARADTSPNGIDGEGVQAN
FT                   EQEGDQQKEKEKGGEEGEVPPRCNNYNSKFLQKHERLMSELRMKKIPLRDPLKTEAYYI
FT                   KKLAKRVSHHGNVSEGEITGAERGVSRDSVQGARADAERETQLSGGANGKGASNRRADP
FT                   SSDMEEDIFQDSLDKRSIYPVIICLQWLIEMLMYKNEVIKKHYDEIITCVFKCLRNNDK
FT                   QVVLLSLTVLSAMCSTVDNKFHFYQQVSSNLIALFRNDENLLIHKGKTIVQHLSRCLNN
FT                   KKFFAYLSYSLINEEKIPFVTKFIQVLCWVLLTSEETKYLRNALFLKKQYSLFSLILIS
FT                   WLRNPISAISFLLWLQKYKLAYLICSYLSLLNLNSDIFHQLDNLIFLLESPIFSKQRIH
FT                   LAYPQNYPFLIKSLMILSLMLPLNTSNNILQKRLQMSQLSILTNGQKVSSFVDAHNHNG
FT                   LLHGEEISSMKRNKGGEEDKKGEMDEALLNVAQDLQSSQTDHVMELLKMEDEEEKKEYS
FT                   LIELTKEERAKEEATWNDKYNYLLSAVRKKLITQGLPDQDTDECTEFVNIFKTVLRSSH
FT                   IVKYYV"
FT   CDS_pept        join(1918640..1921826,1921951..1922222)
FT                   /locus_tag="PKH_144260"
FT                   /product="ubiquitin-activating enzyme e1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144260"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144260"
FT                   /db_xref="GOA:B3LCP8"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR018965"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="InterPro:IPR032418"
FT                   /db_xref="InterPro:IPR032420"
FT                   /db_xref="InterPro:IPR033127"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR038252"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCP8"
FT                   /protein_id="CAQ42207.1"
FT                   /translation="MLPAPSIVTVPTLLTVQTILASPVFPSPFPPPSAQKKQRTYESVN
FT                   VEEMEGKRENLEGCNLVPKKENGEIDADLYSRQLGTYGFELMNKLIKLNILIVNVKSVG
FT                   LECAKNLVLSGPKSVCIYDNELCQVSDVGVNFYIDEEDVANKVTRSDAVIKKLKELNRY
FT                   VHIYNYKGELDENFLQSFDVVVCCDVAHSHLVKYSKMVRNISSPNRKIAFLCCNIYGLC
FT                   GYLFVDFGKGFVCYDKDGENTKSCNISKISKATEGVVSFDFDKGAPFQKGDYIKFANVE
FT                   GMTQINNKIYKINDMQKYTFTIGDTSQFDEYLKGGECTQVKSHLRMNFQPYDIVCAKPL
FT                   AWDEVSTEQVGMQNSPTVFEGETIYEEVPPPQSFLISDYAKCDMSNQLHYAIQALKKYE
FT                   EENNNVLPQNSEEEAFEKVFQIAVHLNQADKELKKIYTVDEVKKDIVLKVAKYCTAHLA
FT                   PVASFFGGLLAQEVIKYTGKYMPIYQLLYVDFFECISLGGESDSGIKNDDIAKENSKND
FT                   NVITVFGKAFQKRLNELNVFLVGSGALGCEYAKLFSLLDMCSVEHSGKLTITDNDNIEV
FT                   SNLNRQFLFRRENVGKSKSLVASGIIKQKNPNINVQSLETKVGPENEHIFNETFWEKQH
FT                   IIVNALDNIQARQYVDNKCVWYSKPLFESGTLGTKGNVQVILPFLTQSYNDSYDPPEDS
FT                   IPLCTLKHFPYDIVHTIEYARDIFQGLFYNTPLSLQEFLKDKKEYVRKVEEEGNNASLL
FT                   ETLENVLSTLREVSKECNFNFCVKKAVDLFHTNFINQIDQLLYSFPLDYKLASGEFFWV
FT                   GQKKAPQVISFDINNEFVKEFLFCTSNLFAQVYNIPQCYDLKYILDVASQIEVKPFQPK
FT                   RVKVNMDEKNLNNISISFVDDEKLIHDFCKELLNIDCQHVKVSPIEFDKDEETNMHVNF
FT                   IYSFANLRAINYKIETCDKLKAKLVAGKIIPALATTTSIITGLVGIELLKYVNYYGYVQ
FT                   MYVKSTEDKRKQMKDLLSYFKNAFINTALPLILFSEPMPPIKMRDKEYDDLMKGPIKAI
FT                   PNGFTSWDKIEIHIVNGTIKNLIDHINEKFNIEVNLISVGNACLYNCYLPAHNKERLNR
FT                   PIHEIYSDITKQKLLDDKNYIVVEASCSDQDLVDVLIPSIKFIYK"
FT   CDS_pept        complement(1922679..1924457)
FT                   /locus_tag="PKH_144270"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144270"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144270"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KL18"
FT                   /protein_id="CAQ42208.1"
FT                   /translation="MLRNNQRKLKKLIFFSFILISFLAQMNQCMVAKCHLPHVINISSK
FT                   RGSETEISKLRSRGGKNGMTFSPQWQVQKGREKTKRVLTFVKTNYTVRSYGGRKNRRGK
FT                   SPCEVPTRCSAGKVVSNSASDIHGGANPEGGAIITSSAEMMQHLTFNFEEECNEIMVRL
FT                   GNFLQVSPHLLFKDACVNLNKLFTNLYTYDNENVPFATTQHTLNITDEVIRHNKFKIYC
FT                   VLGLKVLRIFLIKYLRSLRLCIPVEVRKRYILDFLKIEYISKIYDQKYNLIKYSTFQKL
FT                   SEKLKAKLIYFYLALKPQDVSNVLIKIFKAANYKDENELLYKYVYTSKFTSRGGKRFHR
FT                   IISKEYLELYEKDKLVKRHRCEDDLLWVRFFSLLKLHNPEVVEEKKLLKQTYRLIFSKM
FT                   GFSNDGLVRLFEQRGFRIFDALPMENQTGGPQSCDTTPSETSTVNTRTTREKVQIGGKR
FT                   KAQLVSYLGNLRTFISNYIRRNNSIHHKFHVLKTNIDIPRDALHDGAVTPLTNVFHAAA
FT                   CNGPDGNDLSPSPPGDVELYCETVMNNMIDLVLDIMIEAAGFRDIATLFGIYNSLKGNK
FT                   DFKLLNFRGKFSGNKA"
FT   CDS_pept        complement(join(1925727..1926014,1926199..1928493))
FT                   /locus_tag="PKH_144280"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144280"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LAF4"
FT                   /protein_id="CAQ42209.1"
FT                   /translation="MKSKALVLCSQRRFFSLYNFFICVRKGGEATLIKDIKQRYVREVI
FT                   KYQAQKKDTTEEKNEKSKKEKHLVRLGKCNGGVQIKCSPSLIYLLSLKCGYVESIWLNV
FT                   SKNASCNSLITLQDIIRRIPWDSYISPDHLEDIPLKITSRKSKLFDVADIGRAVRGKLN
FT                   EFVRSYRGGSNITGERYPSPDACLLTPLLEDPPPDEQKYETNVENQKERTKKNTWNLLA
FT                   VHIENNLCNVDIKFTGKLSPRFYQYCHVDDQLANVANYNKCDELNFNSLFNKDLNIGDD
FT                   QIKSIVKDNVPFWSIFEEKKKIQLSDENTPSGEESHHYYKYNYFGYSRKRDSSDHLTSA
FT                   KEVAPRGEKCHINSYPNENNHSPNVSEPSNEKELVSGFEIALSAGKKYAHEETYTDEYT
FT                   HDKVTRNIEKGKRENQNNCTETSRTSALGISHTDNERVLNYLRDMEIKRMNHHNNNFFL
FT                   SDDCYDTASCIYSLALQKCLKNQKHVKLIWDPFCSNGNIIFELLFYFLRIPIYSDHQIL
FT                   PFMNLKIYDQEEFLRIYRYVLDNTADAQNHQVQLLGTDSRSIMIAQCKKNLVRCALYYK
FT                   NIFEKVQKNKKCAYRGSSTVGADPSPSSCGSYLSRDSFLDGALGDHVMSEHDGEQEEEM
FT                   DVTGESCAAPFDEMEERSYLRDMDALRRLQETPRGGLPRSGIQTEIVPLEEASSKVPTE
FT                   TTATTTTRGAVESVITAPDLHTMSVSTAEDLKYNLDFPLDISFHKAHFFNVAPFVKDAI
FT                   IITKIPHFTFVKELGVNKKTFTLYEQFEQMLSSRSDWKGVYVLIRNEVFLKKSKLEWNK
FT                   MLHLRDSKGRHLTLLSWTGRKKNLYSFATEDDKLRELERFSESLTFEA"
FT   CDS_pept        1931384..1932133
FT                   /locus_tag="PKH_144290"
FT                   /product="Hydrolase / phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144290"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144290"
FT                   /db_xref="GOA:A0A384KPD0"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KPD0"
FT                   /protein_id="CAQ42210.1"
FT                   /translation="MRMFTQKQKDTYEIEKMDGVYSHGAYLNIKGVDYVYRKFSMIDIE
FT                   FILFALSAHNALNNAVFITPNVVYVFNDEPEFKKHYAVCGLKDYVPTNAGITQSLDNRQ
FT                   NAVLLTHVKDILMIGDIVSIEIYEKIHPQQEPLKNLQTELYGELENRFKVYVPPHRRKI
FT                   VLSPINTSKIQTIQLYAQFYDIPLNHILSIGNDNNDLEMLASTGYSVVVKGSTKPALKV
FT                   ARCISTKTNNENAVANIIFRVITGRYM"
FT   CDS_pept        complement(1933120..1934913)
FT                   /locus_tag="PKH_144300"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144300"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L6Z2"
FT                   /protein_id="CAQ42211.1"
FT                   /translation="MDASTWKMNGPVKSGQGRRASRPKVEQPADSEAEKKNFCRFYICD
FT                   LLNMIYSTYKNTKPMYVHFVCSKERGNESEEESGPSSGNKSGRKRGNTFEKKTQRRTVF
FT                   SGRKGFQYTPNSVLEQYFPEHFKNVHFLCAHYAMWANEPCNEDSKWDSLKRGNRKDGSE
FT                   KQRRRGGITDSHVEQINVTYRKEQTFYFIFTFFMYPNFLWEEINIPIFHHRGYIECKFD
FT                   CISNFMKLNNGVDLINRLKLRAHNQTLIQCIRGGATSGGSPNGGNLNTGILNGVNSTNQ
FT                   TRGDVHPLPFFISSQCLRKNYQVCLTRVISFNDRGVYCKRDQREDLPIQLLLLIQKKLH
FT                   KRLKNMEREAALMCHLRRIETKGGGHTQGHPPKFVLAKEDTRKTISDFIPTIKSDDHSD
FT                   GTPRSSGTRRGDLHVDGLKSNHSPDNLAGVDYEEIHKLINSAETIFKNRISDQQLEKLL
FT                   LRMRNRGNAHSQTTRETFPHLPNLANIANVVNINKLANVVNINKLANVANINKLANVAN
FT                   INKLANVANITSIPKLGTPNKGLSPSGPNFPKDEAMDVHLGLDAYYEFLHSGKNELINT
FT                   LRDSWQFGIDVNRTNKKRKIA"
FT   CDS_pept        1939900..1940781
FT                   /locus_tag="PKH_144310"
FT                   /product="haloacid dehalogenase-like hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144310"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144310"
FT                   /db_xref="GOA:A0A384L0X0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L0X0"
FT                   /protein_id="CAQ42212.1"
FT                   /translation="MDNHSADKKVEETLKGADIKLLLIDFDGTLFVDKDIKVPSENIEA
FT                   IKEAIEKGYMVSICTGRSKVGILSAFGEENLKKMNFYGMPGVYINGTIVYDQIGYTLLD
FT                   ETIETDVYAELISYLVENNLVNQTIFHRGESNYVTEDNKYSDFLQKMYSENRSIIIRHN
FT                   EMLKYRTMNKLMIVLDPSESKTVIGNLKQKFKNKLTIFTTYNGHAEVTKLGHDKYTGIN
FT                   YLLKHYNISNDQVLVVGDAENDIAMLSHFKYSFAVANATNSAKSHAKCVLPLSHKEGAV
FT                   AYLLKKVFDLKK"
FT   CDS_pept        complement(join(1941665..1941700,1941829..1941874,
FT                   1942004..1943022,1943165..1944277,1944475..1944681))
FT                   /locus_tag="PKH_144320"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144320"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144320"
FT                   /db_xref="GOA:B3LCQ4"
FT                   /db_xref="InterPro:IPR009755"
FT                   /db_xref="InterPro:IPR040371"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCQ4"
FT                   /protein_id="CAQ42213.1"
FT                   /translation="MDHEGERPPGGESPSSPDKDKCKEKHTHDEFLAQDSNERSKRIIR
FT                   KTKRNGTISAYSPAQISEPVYQWEVSSNDRVFYDKMNDLIIHQNVAAKALLVTDIKKMK
FT                   ENYQAVYVKFDSELCEHITFAPNNTFFLYHSTNPNRIQISDILNNHNIYLSVCISNLSE
FT                   CKILATFWLHACRNEAGESNTGTSSPSSPTSTASAAATSSADFAVVTNQGVEIFHLSFD
FT                   NLTITPLKKHVMKSEQCWYDEKSSYIALLSSTHKTHVIFPYLLNNSNAIKLQKIELNTP
FT                   KGEPISKNDIEIITLYDETYCIHKDYKNGRISFRCLSSSLSFDYVLDLFCNGVFETFSV
FT                   DNIFGVFNYANEKVYLYDVKYQKKRKTNFITSLSEHISSSHTINIAYLTSPKEFRTHLV
FT                   LSHISFHPFNVLMDNQYGNVYKIRVDYDLFMLQICQHFANLNTSVDVLLRRPNCKKRIT
FT                   EMFFLSLENDIQIEDFLTIVNIINLNYRKLIEQSAKKRAPLSVRAANHKIIQPVDDIIK
FT                   NLGNKTLITERDIVTDVFHSFMIKKYGLDRKETLFNFSLNFRQMEKAKRERKRSIGGRD
FT                   EQGDRYMEKYRIRRRSPENVDGNAERDRVSPRTEESTIHEEEYRLKLSYSELQSIPMFL
FT                   LYVLEYMKSLLMLNIIPNRILQTFLFDICIFYEQDNCLRQLLQFYVIADSVEVTKRLFH
FT                   YWKLTQHTWAYQLCLDMSLRLGEYEMVLHLFLSANKYIKIIDFIRKHNLIDYPIAVILQ
FT                   AIENDFDSPDKYIILNHVLSSLTRWIHDSDRDPEKYPLPNLQNCEKWVTLVEE"
FT   CDS_pept        1945374..1949195
FT                   /locus_tag="PKH_144330"
FT                   /product="RAP protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144330"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144330"
FT                   /db_xref="InterPro:IPR013584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LMA7"
FT                   /protein_id="CAQ42214.1"
FT                   /translation="MLQSCAGSCTLFPSHLVCRRRDAVYRIRVSLLHPQQRQHNSCSNT
FT                   RHRKIVVIPFSQKDQTLYYKNIPFCVELLDAKNKKDILEIYKMVRNEDDRKNFPSDFVD
FT                   NLFSCTRKFVRSLLPHEFVRIYKTMIVIGKKDKELDLLMHQQMKRIHANFDVITISKLF
FT                   QLFTIGKWRPVYLIKMLTETFLRCLEREGVNQSDDQRINGSTDESTNQTHQCTTDSTLR
FT                   PWHVRELVAIFCFFRIQSEKHIKNIFHHCTPWIGKNIQKFTPKDVTIILYSTVHLGRQN
FT                   PIILSAAVKHVTFNGDSFQFFQLAIILNCFASLGEKNSKLCKVVCDQVKRRMRPTLSPG
FT                   ITSPGVHPDEVVEIGPTDIEADCATDVFGGSSANAPSVFAVNQKRESTDAHKNNKRCSI
FT                   QGGYPEPKDVSVMVNALIRLEHYDNATFNCLIPYIVNHASKFSPQSLSNLVHAYSQMQI
FT                   KDTLMLEKLSEECIIKMKKFKNIEMSNLASSLVRLNVKNKVLFTYMIDEFLYRATIGVK
FT                   YKNYQFDVVSLQQFAYSFSKVGLSDEKVYVILHRMLLRRIGQLRKNSKKGDRATELLVG
FT                   RKDEKRNGQPHDQPDMRSNKHPVSCLGGIVSRGPQFDFLCLSTIVNSYASAKIKTKNLF
FT                   HFISYIIREKKKRKEILSNQSLCCLVYGLAKLQLPDRKIHQLLLKEGTERVDTLKPFQA
FT                   VLLLYSFSKLRIYSRMFVKKAVQLCSRNIHQLTLADLSLACYSLSNMLYRDVIFLYKVS
FT                   KVILVNNFEFEKTNICQLFNSFTKLCFFYKPIYQLIFQRMVVCMHDLGEKELANVSLSF
FT                   AYYFHTVRLSVCEGETEKKERKENVKENVKENVKENVKENVKENVKEKVKEKVKEKVKE
FT                   EVKQEVKQEGEGAPSQGIPPSECHLVQSHPELFFRNELNIFFNLIFLLNEKYRQKMSII
FT                   SIQQLQVVDLYLRAFFPMYCNFPGFLKTFFIKVRSVKQCIDDYLMMSSKTHRNVSRFLS
FT                   LVGVTHRSEVQFGPYQLDIVVDLLQNKKKMRGFVRTLDDPSVEESSNVDIIYKTKRLEG
FT                   QRVITENSYSDGSNAHKVVEKKIEKNILVEVDGVSHFYRESHSRAINSIIKNFILEKCG
FT                   WHIIHIPYQEWNQCVDFKRKVLYAVQVLRQILRISREDISVGDFLHLLRDPSPVQGQIY
FT                   RTTEVACATNNEEHITPVEAETRTSSHGEVKSETEGMDTPHFYTVSEEELFRNQTKNRS
FT                   RHQKGLMQKMHQDNQLTYPFNVVHPRGSAEGEVVANGTQMSSQPPMSP"
FT   CDS_pept        complement(join(1949766..1950381,1950627..1950805))
FT                   /locus_tag="PKH_144340"
FT                   /product="proliferating cell nuclear antigen, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144340"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144340"
FT                   /db_xref="GOA:A0A384L0Y2"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L0Y2"
FT                   /protein_id="CAQ42215.1"
FT                   /translation="MFECRIDGQFFKKLFETLKDICTEVNLECDENGIKMQSMDCSHVS
FT                   LVDLNIMSDFFQHYRCDKNCVLGISINFMLKILSVIKEKSTVFLFKEDNDNEAVLNIGI
FT                   IDEEEQSNTEDSLEIQVKLINTQKEHLEIPQSEYHCQCTMKSKKFQEFTRYLNSIGDNV
FT                   SISMKKDTMVLSTTGADIKVTKQFTNDMADISITCSKSVSQEFATRYLVMFSRASSLSD
FT                   EVYISLSPNIPVSIRFNFKQPLTDLQDSSHLTFFLAPKIGEY"
FT   CDS_pept        1953926..1955785
FT                   /locus_tag="PKH_144350"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144350"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144350"
FT                   /db_xref="GOA:A0A384L282"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR039241"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L282"
FT                   /protein_id="CAQ42216.1"
FT                   /translation="MKFNKRKKSFKIKKKSYGGRKEEGYNSEIESDDILSSEASESGNQ
FT                   RIKVGKKKKRHFASVEGEITDEDATDGNASDLNEDGTTSGEENGNTFNNPEERKIHLAK
FT                   KYLRDMGIQSSDDENSQSDSPENSDDEDKSDSTFSDNRPSHGNDEQREQVSKLMMQRER
FT                   QKSRKALLNLGNKIKIVYDDKLASSKGISKKGSICMNSSGENGQSGHTGKTDLPGEHAF
FT                   FFRGHKKSVTCVASPDFNLSFFDYYEYDMATSQCDERDAYAGYNSGKFYRDDNPRNSPQ
FT                   VDEHSGDNVEHVMQPKVFPNVSLSTAYTGGKDACIIEWDLARGEKVHIYKGNPSAFQDF
FT                   GKSNGISHFKSVMDLYCHKFNSFFISVGADNLINTWDNRVKRTCTHSVVGHKNIISGIV
FT                   GSNENTEELNMEHNFFTSSYDKSIKLWDMRFLDKCINTYMGHTNNILSMTSLTQNKLIT
FT                   SSSDYTLRFWNTKNDNHILFNLNYEIVESCCSLNNRVFVAGTFSGHIYIFSSSYKKPIC
FT                   ICKNAHSSYAVTALVSIPFTDIFISGSYDGYVNFWQYKSVNKTSATMRKVLAVPVNGMV
FT                   SQFSFSPNYAYLFAAVGDEMKHGKWTRTCSKNGLAVIPLRFLR"
FT   CDS_pept        join(1957545..1957625,1957837..1958622,1958823..1958936,
FT                   1959084..1959184,1959333..1959387,1959520..1959591)
FT                   /locus_tag="PKH_144360"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144360"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144360"
FT                   /db_xref="GOA:A0A384L8D5"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR006155"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR033865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L8D5"
FT                   /protein_id="CAQ42217.1"
FT                   /translation="MNKKYVYWEKQGNDRMCGLHCINAILQGPHYSEDVVATIGREIDE
FT                   KEREFLKSSGGAGENDMNELMRRNSSNVLDDGFINISVLIECLRRKNISVKNTFEDDLK
FT                   KILSSDHQDIGYICNLQQHWFCIRKIYNTWYVLDSLKSGPLYIKDINLKYYFNDIINKY
FT                   HVFSVQNMNPYVSLPKADINFVTRNRNQFYLCTSEISEISGVSSNGFIMEERVSSGSPV
FT                   DKSSFFSSTGKDKPNKFKWPEGGGRKLNDQEGSDLVGVGGGAFPSSVNDPDDELQMALR
FT                   LSMEEYVKNLPPPPPEASTAENCINIMIKLSNGKIHRRFCNTETLADIFYWLEYEWVNG
FT                   LELGPSLLLRSSYNLYQIYPRRKFCKYQNGTIELQTGDKVEQVQDTPLLDLKFEKEESF
FT                   ILS"
FT   CDS_pept        complement(1960639..1962183)
FT                   /locus_tag="PKH_144370"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144370"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L3G0"
FT                   /protein_id="CAQ42218.1"
FT                   /translation="MVFLARVTIVFLLVCALLCWAPTIGKEKKTVKKEVCFFQKLRNKL
FT                   INYIASKKKFDSNGWIDLSLLKGEKFHPIDLRIEDDKVICNSNKQIMEVTVVKQKFLKH
FT                   TVDASYHELTVHTKKMPSDGKHLSIIPLMKMKTNKKQGGRTTLAKEAWLSPVYAFPPNF
FT                   EGYIVCTKKNTNALFVPKAVKPVQFVSGPWKVRVSVNFYKCPLSNFGRIFQITIIDQVN
FT                   ILLNKEKSFIWPIPLTSFFQVYDLHLAVRECKKGNFCDLEYTPNRDGSNGTLTLNCQSL
FT                   GKTKNLSMTNALLFSAYLGMAVAQGLSYPLTHKSPDDYLNNQYSDASTGTPRIHKGVTK
FT                   SYLMDEDLEERHKSSLKKLTLITNLLFLGGTGIANAAYGIKTLVDIVKNLKSINEEFEQ
FT                   ALSFYPWELRYPKSDLGSQGGKMPKVELEKKTEKSGKKAEPKEKGGNINKVVTMYEMDA
FT                   SQIIQTGNKQGNQKEGVTQKKNKKSVNDSQVNDSKAPPKENEPSILKIFEQNIVDN"
FT   CDS_pept        complement(1964676..1965155)
FT                   /locus_tag="PKH_144380"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144380"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144380"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1J5"
FT                   /protein_id="CAQ42219.1"
FT                   /translation="MEIDVQCLIRALAYFTKNDDGELCEEDVNVIFNKILSQNLSHENV
FT                   RELIKNVKESIQWNRSNYVENFVLTPSILHILINRQLKKHDLQTIFKDLFSCIESNGKI
FT                   GKAELGKFIDLCKRNATTEDSSLSLRKFNFGVTNSGESVDYNTFLGLMEKYLKKV"
FT   CDS_pept        complement(1966201..1968342)
FT                   /locus_tag="PKH_144390"
FT                   /product="ATP-dependent RNA helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144390"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144390"
FT                   /db_xref="GOA:A0A384LB10"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LB10"
FT                   /protein_id="CAQ42220.1"
FT                   /translation="MKSILGLKCVGCRSSGRLALVSKKFLFVNIGSKSKFGSGLVGQNE
FT                   KNGQVTANVSKRTVFIESNVKNNHVQEEQHKSALPTSTDESTFPDKELLNSYIDEQRID
FT                   AETQQGDYRPLGGGEDVEAYAQFDRYDGRGKDDGENGFMSYNRKERPFNNHERGRNRQN
FT                   HGISGGRGQKYQSSSRYNNMEEEDYESGKSNSRRTSYSRNLNSQDRYDQLGENLKDIEW
FT                   NKVDAKVQRQNLLQDVSGKKADISPEQLDAELKRLNIYMNNESGVLNNLASNFSDVNFH
FT                   EAIVNHLNAKFKEPTAIQKVTWPIALSGKDLIGVAETGSGKTLAFALPGLMHILKQRER
FT                   QVEKENGWEQGQEGIGEKTTQEWTNESMQGATQDAVQGDTEGATQRSGDRYVHQGDRTV
FT                   YGLILLPTRELCMQVVDEIKIFEKELDIRSVAVYGGVPKYTQINNLKKGADIVVATPGR
FT                   LLDLLENGVIHLLRCIYVVIDEADRLLDMGFEKQLKKIMTQVNKNKQLLFFTATWPEQV
FT                   RQLAYDFSSLDPVKIQVGKSELTANKNIEQSVIVSSSIDLKKKLLDWLKQNYEGNKILI
FT                   FCDTKRNCDNLCKELRYHQYNALAIHGDKEQRERDRILNNYRSDRCNILVATDVASRGL
FT                   DIKNISIVVNYDLPNTIEDYIHRIGRTGRAGKKGKAVLFFPYDYYVPQKSRFARDLVKL
FT                   LNKANHAVPAELREIAGTR"
FT   CDS_pept        1970421..1976432
FT                   /locus_tag="PKH_144400"
FT                   /product="ion transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144400"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144400"
FT                   /db_xref="GOA:B3LCR2"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCR2"
FT                   /protein_id="CAQ42221.1"
FT                   /translation="MRRSVAKDLEGGNNLTKKGAQGVKKEVVISANVLQLSECRDEEQG
FT                   EEGGTFNSSIHGQEDQLRKDDTGYARRRINSSSNYDDGDPMKSERQKSTLEQASYGTQS
FT                   RKKKKKKKNQIQMFRVQNYIYKVFTSVLSLLIVVLILYASIDISTNYGPIIIVYIIILE
FT                   FGSMLISYILLQFPFFYRILKNVFTRARNVNKYSHQYKPFYYDSPSNSDDKDSISIERG
FT                   KDKRRRNTFALFSINRNNKRYSIKTLFTGYKSKKGKKKGRKDASGDGARLDEETPIGVT
FT                   PCEGASRRSRVQAGPGNAYKRQSIYLDDCNMWMNSDMKKVNKKKNFNLSRSLSFNINLN
FT                   EENDMIMKDSASLDDIKIFLGHQTSKFVANKDKLKARKSSIYNKYVPLTFTSSYKNNMV
FT                   TQFLKAHTENMRPVSSEYSSSESEEDENSGRYKKMYIGKGDTGRRSDRQATQGGTTKGG
FT                   RKYTVHDAVHDPDDKDDVERGPKHMMSREIRSHSRDHTNMATDMATSLYATKSAILFSN
FT                   KKKKKKNQYRKLIKGRTRYFKRITCINKVKKFFYFFINYNMKSSRSTNNLFLFFRGVSL
FT                   YIKHRFMHYLSYEPVWIIAILIRIVLWCIVWLWAASYMERKPKNFKITEWNMKNVPSLY
FT                   GYIECTFQWCGVFDYFFGLYFTNNKLKYIFSFFSVIDFITTPVSSLIMNTLCENKYSQN
FT                   YWFLILGPLRFLRLVRAESTISSCFFWLSDVKIIIIGIIILALAILFTFSGIMYILEAP
FT                   DIERDFVSPLDFVYFGVITMSTVGYGDYTPVTPAGKCLTMFIIIACISFVGAQFKRLKE
FT                   AMFSPKTIMGIIPKQDDDYILILGPVSPTQLLYICKAINNSFPNSVESIFLFTPLPVII
FT                   YRFVYGSIVKNTNIKVCINGGNECFICPSIIYDAVINARALYILNNVDAEKYTLLYQQI
FT                   FLASNNLNFSNNDPNQRISSNDILHNNIINKFNKDKPKMCRYSDFLSDYKNEINKNNMN
FT                   NLEMNININDSHVVKEKDDQECVLRFIGTYNICNTLIPITLQLSNNTYEELVKSMKVYN
FT                   YLSIEELKYALLAKSVNCKGLFFLIINFFYKPKAVKSLKKYIIDLKLLMYNRILKRKNR
FT                   ERVNNGGVKINKISEISSSSSGLSFGGIVPYLKGRQSTTAGGNVHHIANTEKVDTHSSS
FT                   EQEHKNKVGVRNMGKRHSVNYKEILPLNSMDDLDFTQTPNYQNYYRMLERVSLNMYYYL
FT                   EGLKYNIYRFQFPECMRGFLFQTATEYLYQKYSAFLIGIITINKEIFLNPVDYIIGEEN
FT                   KFYYTSAFSGIILTTSLDNLIKLSSIKNISKKVYEYNERRISERFRGNVGAQTKVPGLS
FT                   TKRQEAKMATMNSSVVYASGVNASGVNASGVNANGVNANGVNASGVNASGVNASGVNAS
FT                   GVNASGVSTPAPRGKVNFDPRGGNSDSSNGHQGGEDDVQDNDNNNNNNNNDEKDDSQDD
FT                   GSVHRPSERHSKGESREERVAPRNNLLYNFFLGIYEVDNYISAYRDIFREKEKPLLLVC
FT                   GWPDNIHLFLKHLQVNSGNWLRHRRKRKKRQEKNRKREKGGKMQTEGTHMEQRGEQSIV
FT                   HVNSPESDSSCSDDSCGYSSLQKRKAPGGKIKYNIIILSLHVPKFNYENDLLDFSHNVA
FT                   FIRGSALNSTNLVQAGVFYAKRLIIFNANHSLFIDKDAYRIDNEVIIIKNVIYQLYNSV
FT                   LKSRFNYMNLVKKIFKNEFKDVNINEKVFASEAPFQLNEMIRVKTCSSASSSSSSSSSS
FT                   SSSASSVPPRLGATPLRLRGDCKTLNIFNINRNPYLICMIKNSESLEYIDGSINLSYEN
FT                   YNDNEKMNKIWENCGEYIYTFELVSANIFVDEMLHNLVSFSLPISKYAIEYSVIYSLIG
FT                   IDINEYSKNAKAFHKNLKLCTGQVNLIPIPSYFYKKSFYKCFSYFLHNKQCLCIGILRY
FT                   MDISPLCRKSRKLFVLSCPSRTMKIERDDQVGGRIPEKLGRKKWLSRCVYYFFFLLANF
FT                   YTHGKLIKGEA"
FT   CDS_pept        1977316..1980357
FT                   /locus_tag="PKH_144410"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144410"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144410"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KXC5"
FT                   /protein_id="CAQ42222.1"
FT                   /translation="MKPVRRRLAKRITSFYKNVSANAALFATNLLLYHFDRDLIATLVQ
FT                   TYKRLLKKHEKEKTGFHEEYLLIFNYIIFSHVNFVLPEFSKNNTPHFDIAYDLSECTDG
FT                   TTPLLNARRLIKRGKCNASKLKRLRIKNGTHVRLGYVTGETPHSCRQGEQNGTSYKAYQ
FT                   GTGRRHKHKIAEEPNKGKQPDEWNRHICDESHHKRVNRWESKLLGRFGGAYGRVHIREK
FT                   GTSNYIVKCITNTCMHNCASSRFPFCASMECFEAGESQLVEQLKKLYVHVHYWRCLMEL
FT                   NVKCRRTWKVSQLASEEKNIYEGIYKNIYYLFKRMNRMHFQNIQMINRKKQQLSITHNC
FT                   EMENLISETKVTTVDNSEGTEKINELVFKHIAEKEALCRHAEHEVKVMQLVNLKEYKEH
FT                   IFYIFNIIHRERNVLSLPPLPVDELEEVDAVVSYKSIRAHPNGFCPSMHKERYIYFARI
FT                   VEYFHLFYLYKLIKSNVNVMSYLHLYVKHSLCDTLRVSVIFSLGEVEDIFLHHSKNNEV
FT                   FKERLYGMLSQAGYEHYACRIEGESTTYHCTNQVTNEITKLGACEGDRAEEGDRTNGTP
FT                   LWMCAQSKYFDARGQFKSKLGAVPEERAPFNGSYDSTHKYVRDNSSRFLLEDNTSVKEE
FT                   SYTHLNKISLREKPLNGLVLYLGNDTNGFCKDNVYQSIFNLSMNKTDFVFPTLKEQLDM
FT                   FHEFVSPQQEMLRETKHGQKCSPMMGTQLRCGNIIITRHKNLKIGMGRSTPKGEKKNKK
FT                   KNFKSEEGNGGETRNTKSTYDMGTIKNSGNDLFNLEIINKRNFPSSIMPIYEQLKKNSQ
FT                   YFMNKEGREKSVNSDVKENTVCKLHENILKKKKKKIHVDIIFHVIIPKNVNRKSFKIIL
FT                   LSLLKILDLCRDYHVSSLTCPLPYVHNVVYKNKRPVLYAFMYSIMFSLLNYIKFTQSSS
FT                   KQVSVLHFVFPNLTYREGGTKSEDNTVEKNKVKNTPPKEGSTLDGNTNLDRTSEKRMSS
FT                   MASFIQRVATDMGGRYMLVESIYR"
FT   CDS_pept        complement(1980550..1983162)
FT                   /locus_tag="PKH_144420"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144420"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L0S9"
FT                   /protein_id="CAQ42223.1"
FT                   /translation="MTKGKRINRGMMGGKVKLSKKKKFAKKMDALKGKLYRALGERLSG
FT                   DEGGKRHPPWETKISGWTNRTGHEPTSQANRDMEQKMKKQQKGEKRVHKDEEEEHQFGR
FT                   DPYRSDPFRGKSHPRAINPDRYNDPHRKEHKVKRIDGVDIEKKRGTPHRMQLRWLHEEH
FT                   EKSLIHFMKRNQNLSFNNYLDDLRRVYFCTGKTTDTYRMMIRDMDTNMRAILGVKHQHS
FT                   RSAPPERSPASELSLPGSASLSTSACASSAPCAFPVGEDQVNHFVEKQYLLSSTIELFY
FT                   NLGKEVMYLTELMKSRRHEIAMRQKLLKEVQIFIKAVYPQVYLLIFGSCNTELDLYNSD
FT                   IDICIYNNVENDRTNIRKLYNEMKRNKLFQNATIKQIIGAKVPIIKCFFTHIQISIDFS
FT                   FNQVSAIVSTVETQSFLKKNPLIKYVVIFFKIVLSEYNLNDAFQGGISSFKLFLILVKF
FT                   LKEHVFVFYEKNIYLYIGEVVHKFVSYLSLFRDKSDDSMASFFSAIYNYNIPTQAINQS
FT                   TQFVGHAPTPFKPTLQLVKRRSTKVIKKLFNHIFCKLGLANQNFNEKKGDFTFDKLFQV
FT                   RQSMKEVLYSLADMLIYLVRKKNKNISPEYDTVIFSDALSIVAFFHFLREERLNRFLRD
FT                   TYRFLHHKVVSLSNNEIPIQIPPTDHVIIDIYDESKVEVTQEQYLPPEVTRAEVNAPNG
FT                   HLSDTQEEKHNHNTHSDGPIDDTCDKTGNMADHLVKRSKELPSFLRYFQCDTFDEVQAN
FT                   VNHLYLSMGHKINNQNRFVKKICSKLVIINSMMDLNKLLSNRFHYHQIFLPSTEERKCK
FT                   DPSTSPHEGGPQDLTKVAALKRQMLASLVRFKNYDPSEVMGFEIKNEFFVNSASTVFK"
FT   CDS_pept        complement(1984201..1991595)
FT                   /locus_tag="PKH_144430"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144430"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144430"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCR5"
FT                   /protein_id="CAQ42224.1"
FT                   /translation="MGKAEMLDDYSNNKHEEGSLPIMNHYSVEKNAAYVERYHICEVGT
FT                   KVRMTEKKECVVMRKWMLKVRKRSIHKNTKLIWKKKKEKKYFFTKWDQGKMLYCDQCDG
FT                   EVACTAVKKANEVSCQTWQSGGDKNGLQFYWAHQTEWSTPCMLYSLGKSTAHFERETAT
FT                   LLLLPPECQAQVMRSARNCIQSASGVTSTTLERRRCTMRRKKYPYIFLIRRWPGGDDTT
FT                   FCMMTKISRGHMKFSLSVRIISSFKVLHPHEDENGLPFFHWEGRMTTRSKSGSGEKAYR
FT                   GMNLVREKQIDKKKKRRNGEKKEKKSHFSVGNSHLCKVYVILSATHGAGVCHPHNREAS
FT                   RRGPSAVVLEVKSEVEQVEGLQSQEARKTQQAQEGFEALEGGDLCTISTAGAIPTGVST
FT                   PIPTPQVKRVKLCQDRPRPEGTPLADHGVGNYRIDWQGRIKRKKNVTRYNVQFTCPFPS
FT                   RHLKKSKEGGTSLCIQCSRYLLKIRTVKIYIQSNDTTIDSEKKTEQPFRVLQLVVVPSH
FT                   RCDTQSDDYDKGSICSNYVRTVFSLLTRNDEEEDYIICLNSLFHLFVLSAYHTGVVNRI
FT                   DHKLSRCRNSCLNPHCICVALSDEEEESVHMGKGTGNCTEEKYSHPSRSMSGYTTPPTL
FT                   CLNRGKQKRQQTSSQVFSNTKRCDKYRLSAHRNPPLPFRGYEVSCEYAAPNENKVTAER
FT                   FQCKKKFYDSQHHMCKMWVVKRGAHFFYFPRTGGSAPTSSGREGDKVTEHERHNCCGSC
FT                   ASTQINKVTSADYCFCDGHQDIYTVKHCHGNPPNRMEKKHHQQRPRKQELHEQRPRKQE
FT                   LHQQRPRKKQPHEQRPCKQQEAQLQWRNRGSAHQGNSINHTCKNVSGQRKQDEINVSEA
FT                   DNTMSAIPERCTNERKTKDCLSELISMPLCKKQLSNYYHCRTRAFHMRIPNCWPNTKYA
FT                   GEYTNERIFSPLEKEEDRIKHIKEKDANHLGSSSTPGKNPLFNDAYQGKFVFRNVSGSQ
FT                   ILNGSREVIKGFDDLGSGAPLFTHPKEGHNPGCPSKWLSVVKRGTNYLMEENKKRNSSN
FT                   WRSTHGTLINEFSGKRKRKLSHFFTGSCEDKAEECSSLGIERESPMWFAPTHGEEKKCS
FT                   VIPNNYVDMGHLHNIKPIDRISITPTPFDTSSLEERNLTAASHMEGDIEEISKLARDTP
FT                   ARRPCFDETSTDEDSFVEENIPCRAVHWMENRPKRYIYPSNIWTAKRIEVALSEGGNSN
FT                   RKEVVNRCENGSDVTNVSDMREENTIRKKLINCNDVDEGSLSPLGGEGKKNKMVSEHGS
FT                   ILSDELPQECLDSILQTNNNITSGCSGSDSDISNGSDSQIGVETKRNKEEKMDLEVAVM
FT                   ERHSSILVNRGIRTKKCVDYSLYNTYAKSSFLQCAEQADNHFIGNYLDRYNDENFHHLR
FT                   QKVKLCLSRTFANLKTTSETCVLHFTNLIFDLYISRFNSKNEIIESIINDIVTEEKQFS
FT                   DVMIQLLKEFYPKVYNEFVFKEQLKGKYNILYKELKDSCDLIYHFIAIICLFISQKYYN
FT                   YRLISIDLIAKTYCKSHLEGLRKVYSRNNELIKDASPDYYSATQYLDSTFSAHSVNKNF
FT                   ALEVEICILKKLNYDLSIPTPYSLLDSLLKANENINFLKLKNDYNATEGEILLRIASID
FT                   NIFLKYKSSTLSMAIYEILNFNICKDKMQKELFHFTNFRDDFCFSPDKHARPDNAPNQV
FT                   DHANQIDRSNQIDRSNQIDRSNQIDRSNQIDRSNQIDPANQTDPVNHANISNCKRPPQA
FT                   QNEAAEKKKKNELKLLKRQARSLVIAEEEDRFITASNYINQKANLYQCVKRTLICVCSV
FT                   IKKKVPRYYYDMDLDRTDRLKGYIRNFHNGKRAYLDRLRAKREEVKGGTRTGLPKDEEK
FT                   TGPSNGEAPEYATATTSATTATSSAAMTAESPSPLNSKKRKRVEVAGLKNSDDEQKDQD
FT                   KFQSAKNKIKKKIKKKIKKLNAIRWEDIPIHYCTPYVLQGKEIKIYIKKDDEEVIHQDG
FT                   SGSGTHNGDGGRKNSLSNTKGESMRSTDTQKKKKNNKKNYIIGTRTNSTDEHLVFYYNY
FT                   LSKLRSRLVQGLRYFLHRIKRIKSRHVCVSLVNLSYLLNKGGLRKKRKKEKKNKNIPLY
FT                   KQLVNEIKIFFMWLYKLTNIEIRPLIRFADLKYIACIKSYERNYANYVSRTLTRAAKQE
FT                   GEKIQGEKNREADKRDRKNNGSAKRGSSKHRHRSILQKKYSQEVSQFTEAENKKFYPYL
FT                   KRSNSMADLTGGHCTGKMSKKGVGRKKGKEIKGKCSQKNDLVQNKTNFYEQTSQIAQNE
FT                   EYEIASCKKKKKKKKKNEQGDEGDDQVECNVTNELDMQNTLDDFLLRKKEYESLEKEKP
FT                   LLEEQLEGNTDQMFSMPYQDNATKISSDWITINDPQVDECAKELMECFLKWKNKNYISK
FT                   NWTFNEYPNCKEYYFSLVFGDLKSSETMKGIIEMMQMKYNHLLNIYKEINVQADCMEYD
FT                   "
FT   CDS_pept        1994581..1997271
FT                   /locus_tag="PKH_144440"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144440"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L9D5"
FT                   /protein_id="CAQ42225.1"
FT                   /translation="MNQVSAKPKLKTTEFVGGESRGVRFMNRAKGHLSAVTKNVANVSS
FT                   AANPQFTHKTTFAKNSHLKLRTNNPVFKQPPKSSLKSNQRSSLKVSHVEFAKYSNKKAH
FT                   HNGDDNGGDMGDGYDNDNAGSNDCLNDDARDEMNDKMHNQMNDEMHHQMNDEMHHQMND
FT                   EMHDGVHDDGGREAKPGGTKVPVSNARNATNAEGRKSYLNTFPLRKYRIDKYGESGKTT
FT                   TIGSGKNNYNRGNPKLGQKKVLSQPQHYEREEDGAGENEWGRKAEDAIYSYSSPMKRKY
FT                   DTMEKVHRGAATRRGKGSDSDSNSGGDIREASHMESEKARRDTNIQNKRYASESLPHDS
FT                   GNLHYDNNLNPVNISNGTNEKINAYGSMMLYSNEKLLGSNNTGLGAHPSLNSSGFHGIN
FT                   QENGVLSRSYQPLSTTGGNTAGNATDVNEGEGNVKTTLLGRSYAKFDRLRKGEAMLAAP
FT                   AQKYQQQTQQQQTQQQQTQQQQGQHLNNPLQYLSKDPRRTHRRSRHTNYITDTNSEKMM
FT                   NNSMSSHNELFNSCTLDRLSEEKYNSYANKRRDGGMDTQVGDGMDGGDLGINRISSVNR
FT                   NTASNGSQKFSRLLRNDPMGSHQRLGVLRSDKGVLKNRHVESSTVEFRNMSTSLQYSED
FT                   LPLGVGKGGSVLSMRGLDKQEGGDSEDDYYRNVVENITNCSSEENDMNILYKNIVNLND
FT                   SVLKMDKENECLDEIIKTNNGISETIRTIQHVVLTRKKVIQDKRNLINEEYELISQKLK
FT                   ECESIFCDSNEGGNGEKKLKVFYEIDEKKNTLKGKYEMKKMLLKKAEYKIEKLQEYTDA
FT                   VKLKTIAISERYKKTFLLIEELFRLKIIKDTENEVQVCLIPKNTKTNMWHKLQLDKREM
FT                   TSDACDYLWSQIESFVDKEALNSYL"
FT   CDS_pept        complement(join(1997809..1998651,1998845..1999905,
FT                   2000076..2000805))
FT                   /locus_tag="PKH_144450"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144450"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144450"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L4H8"
FT                   /protein_id="CAQ42226.1"
FT                   /translation="MHSAEEDEKSDHQAHLKDEDPQDINTLEEDVGEINPRTSGTTPFE
FT                   EEEKADLKREEQEDVSSLHHSDILDFYFHDKSEGEPNRGSGVGNSVDHERVVNDEPVEH
FT                   CSDGNHHKDEKDDEGDGSSDKATPKNCVNGDSAAEPGARDPFLLGVREDADMDISINQE
FT                   KERSCIPPNEASENSYEAVQVKVHNVDLMDADSNALEEMNEGRSEKSDDGKMKMKIHNL
FT                   LKLIGLLKAQINQKDHEIYQMELDFKLKNQQCDRSSGHLNDMFVENDTFSDNTEGASGG
FT                   PASMSGGVGVAGGRSCPEGGDFLMRKMKSILISQNEEIVSLNEELKKKTKELFFLNEEN
FT                   MTKNEKLAELKKEIEENYLHLRAYKNVKNEMEIDANNKVHRVENYLNVTNQKLLKNDIS
FT                   IKEKRLNIEKQKRVIKELYNQLNKKEEKITELRSIIESIELNNNRDIIKYKQSNTDLIN
FT                   RLSLNNSLMNSQKIEIENMHMNYKQLEEELKNKDNELKKLHENLLAKDEENNKMVHDIN
FT                   RLKFDMEIKNIDVVNVKQKIKHVKKECAIHLKKQKEHFTSVINEIYKEKDEAIQGHVEE
FT                   FAKLSAHYNEVLAANETIQNELNILKDEVLKKACEVEKLQDRLLDYESKLLIYENNNEI
FT                   KILKKNEDHLRKLLSKHIHRNEKLLNTTLLLQKSTLENNTLEKKIIELKAKTYRKDQEI
FT                   KKLQETNCKKKNSIRNSNISQRDDSIELSDHLKDHYSSGERRRIAPDSLMQYTDDCLGA
FT                   RNNMLDYNNGAEKNNALDAMLFEGESNLIMGVKDDAGSEVSLPLGTPVATNSAFADDPV
FT                   YVALCEFSHSIKETNIPFQMKKINGNLYLLNGKEVLIKFINGDLYVEDGSHLVKLNDFL
FT                   LTNGPS"
FT   CDS_pept        complement(2002983..2006333)
FT                   /locus_tag="PKH_144460"
FT                   /product="radical SAM protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144460"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144460"
FT                   /db_xref="GOA:A0A384KYI0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR034687"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KYI0"
FT                   /protein_id="CAQ42227.1"
FT                   /translation="MGEGQCEREGVPGKGVPEGVATEEVRTHPGQLPDDKVDEILGEVS
FT                   DDEGVGREEGCESRPSPEGDYFYINDAIKHNYPLEYEENKIYPKVYCYEPTNFENFKKK
FT                   IKNKNELRHYECYSSTMNEFFYKYNDNYYDDILKNESFKKFAFELWSKRKEIKNETEYH
FT                   NMCIQLRKKYKVCPSKHQISVALQHHYLQAARNSKGGKDCTSSHVDEPLNVASTSHTSD
FT                   VSNQSNQSNVGGDATTNEEEGGNTTSGGQDGDQMDFLQGKILSGEGLPEWNAHQGCEKM
FT                   DEEREKKPTNVVTTTEEEEEDKIEVNKKGKDVKFVLETVTNMIVTTEMKNYKDLDKDSV
FT                   HFLQINKRKGVRSNSGVLVVTIITHPHKFSCKYDCYYCPNEPNQPRSYLSTEPAILRAN
FT                   QNNFDVICQFFNRTTTLVNNGHVADKIEVLVLGGTWSSYDVEYQREFIRDVYYAANIYP
FT                   LLKNRRKKFSLEKEQEINETSNCRIIGLTLETRPDQINKEELIRLRSYGCTRVQLGIQH
FT                   TDDFILKKVNRQCTLQDAIRAIYLLKENGFKVDIHLMPDLPYSDVKKDIEMFKHVLSSP
FT                   NLQADQWKIYPCEITPFTRIEKWYNNNEFKPYFETDKNLLICLIFLVKKSIHPWIRLNR
FT                   VIRDIPNPSIIAGNNITNMRQLIANEMNIRSIFCQCIRCKEVKNQEIEKKEGSIFLQIY
FT                   QYQTLGGEEFFLTFQGVKKVRKGAPNGAKKKKGKKKEEQHRTERNVNSGPADENSSRSE
FT                   HPTQVSAAPPKGEGVDENFIGLSSVNLFADGGYEDGNIQPQSGGENIEVDMAKGVATTN
FT                   RASTTNRVTTTDGMTTSNEVNAANRLTSLHTRDDKNEQALLGFLRLRLRNQNDYCDDRP
FT                   FKCLEGSALIRELHVYGSLLKHDDFKEDLNFVQHKGLGKCLVLVAELIAYHYGYRKVSI
FT                   IAGVGTREYYKKLGYEKEETYVTKELKKECLYQQYLLNADRIGKQIFIHKYNLEHCLYL
FT                   MHRSIPTPSRYKRSEIEEDMNTFISENIITLGSDQYLHCQQECSEVCLINIVPDLLVEG
FT                   REKHTILTKQNKQTKNISVRDILSQWTGKILHSYGTKSWIRNAYFLFFFSTTMFVGVSL
FT                   WGRRRMGHL"
FT   CDS_pept        2007403..2008812
FT                   /locus_tag="PKH_144470"
FT                   /product="rna pseudouridylate synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144470"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144470"
FT                   /db_xref="GOA:A0A384LCL8"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCL8"
FT                   /protein_id="CAQ42228.1"
FT                   /translation="MLIARGARWRGHKLKGSLHSWGGQLRRYISENVTKEIITHSYDRK
FT                   KYEQNVHMYDTCKSYVDSKQKTFYDYLKEETPILLPTVRGRRYSPPRKRKKDDEVELGS
FT                   CTQGGGAARGRHNDPTESEQVKVKYLGEYKKWSKIISKRGNNGGGKEEEEGEIHMVAEN
FT                   YKAEKMEGKHPHKIEPSIGDEKKNHISDELMHISIDNSKLFFPNKKTEKCREMKITQYC
FT                   WHEGLCSSRFAFNNLSRGIIQVNDQVVFENIIISPGRDKVELTKVGKELLRNKNITIIL
FT                   NKPKYYLSILNDHKTNKKLLARNLIRNENKFIEEEHKCMSYFINKNVNIEKVNKLYVCG
FT                   RLDANSTGLLVFTQNTLLCSYLLNKHKHQVEKEYMIKTAEPIEEVHMELLRKNILVDGK
FT                   LIYKCRIQYVDSFTLSFTLYQGFHKIIRKLCLLSNIKIKALHRVRIGGIHLKGLPLGKW
FT                   RFLMPNESFFL"
FT   CDS_pept        2009468..2009911
FT                   /locus_tag="PKH_144480"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144480"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCP5"
FT                   /protein_id="CAQ42229.1"
FT                   /translation="MFNIYTRGFSKKAGWSWIKNRRGRKKIISFAYPPKERSSIVKLTD
FT                   ESDKLVFVCNGKLRNTFMTTVKNTKETKCVVKNDTIYTPCLVVSKAKCHTLLESFTYDE
FT                   ILHLEKMAPRILQAFEEAQKRVHQDGKNRVLSKHEAVKFRLVE"
FT   CDS_pept        complement(join(2010190..2010743,2010871..2011315,
FT                   2011415..2011687))
FT                   /locus_tag="PKH_144490"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144490"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144490"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KC68"
FT                   /protein_id="CAQ42230.1"
FT                   /translation="MKIDLELIKSKSEHNEGLLEDLEEVALHQLQIKKIEFLNTHCRNL
FT                   KILLLQNNLIEKIENLHQLKKLEYLNLALNNITLVENLHGCESLRKLDLTLNFIDLSTI
FT                   EASVTNLKKNENLRELYLMGNPCAKWIHLKLFVILHLEKLEVLDGSDILTSDRIMARQR
FT                   RETIRNSLQDELKKRKEEGIGHSEHYDSINQRKEIYEEIEREEVKNTRTDERNEKRAHR
FT                   EVLPPYTEEGDIRQCNEGHYKFLFDEYSSNKHTFLKLFLPKYLCNSLIQVDVNVNYVRC
FT                   VIKDKLFQLKLSDAILTDLTKISRKKYTGELHIKMTKKNYKGNKIFEGDPTSEGDAPPV
FT                   VGHSLLPSRSSSVSSTSSSSSASSTSSFFKKEYPIYANRRRHTTNSSLALPNEAKGDFL
FT                   LQAKETKYSSSLMNAIPSLEKITK"
FT   CDS_pept        2012344..2014629
FT                   /locus_tag="PKH_144500"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144500"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144500"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KK54"
FT                   /protein_id="CAQ42231.1"
FT                   /translation="MIRRGRNLATAISPLFRTSRKIQTFVGRKPGSKHSPNHHDAFSNR
FT                   NDDNFSYRNDDNFSYRNDDNFSNRNDDNFSYRNDDNFSHLNDDLSFLNDDIKHNLFRLK
FT                   CMEQKKIKTDRIVYKKILKDLLKKKESFVANDMVELLYILIFNDLYHLDICSNFFFHFY
FT                   HRCVYSGRYLEGVHVNSVVHLIFSFYVFEGYGFFGGAANRGRANSGANSGANSGANSGA
FT                   NSGANSGANSGIKSEDNTESSTKRYHEYHRNEEYLSFHLYIHLAQYIHLNMEHINKNHL
FT                   IKMLLVLSHFTSNWTITALMHSEHTQVVEEKSALRDVGINLFYLIESFAEKIDIAKDIK
FT                   KVYSPETINEKEKKKKKEKYLNMIDNSSKNFIYIDNESNDNKLICLFFFVLSRLFFPVC
FT                   PNFLFHMESNLEGIPLPTDGQSPKQPSQEETLMCEKKNGDGTMEEAHNTFCIDRSIPDR
FT                   SCEKLKFTLVDMFMRHYREVEMRNHVFYRNVDTQKSGLENYEIYKNNILRAMRKYVFLD
FT                   DIYSLGVYYKMVFFKAIYSLHFFQFPFLRHLYDIHSYSTSRNVDHLDYNERLHFSGEGS
FT                   DVVDGEMVEQCYPEKTCAQKQPQKRWSEREKNKIVDLAKRGDIFNNAYVNLLNYIESDI
FT                   KNCSPDEALNTLLQLHLLRSVDNHFVLPLISKLCNSTDKLRNEHKKKMNVIIISILSFL
FT                   SPHIASIESIRKGPLRDVNVFNHTYCNNDVYVGHLQRLQEFVQLLHNKQIFKRKRKELL
FT                   SWSNYKCM"
FT   CDS_pept        join(2016622..2019284,2019400..2019619)
FT                   /locus_tag="PKH_144510"
FT                   /product="nima-related protein kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144510"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144510"
FT                   /db_xref="GOA:A0A384KS50"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KS50"
FT                   /protein_id="CAQ42232.1"
FT                   /translation="MPSKYDDGESRLNEYEVIKKIGNGRFGEVFLVKHKRTQEFFCWKA
FT                   ISYRGLKEREKSQLVIEVNVMRELKHKNIVRYIDRFLNKANQKLYILMEFCDAGDLSRN
FT                   IQKCYKMFGKIEEHAIVDITRQLLHALAYCHNLKDGPNGERVLHRDLKPQNIFLSTGIR
FT                   HIGKITAQANNLNGRPIAKIGDFGLSKNIGIESMAHSCVGTPYYWSPELLLHETKSYDD
FT                   KSDMWALGCIIYELCSGKTPFHKANNFSQLISELKRGPDLPIKGKSKELNMLIKNLLNL
FT                   SAKERPSALQCLGYQIIKNVGPPGGGGVAPMPGAVVTRRNPSKEHTGLQLATVENGKNG
FT                   EDVNYGISQNVLINQRNEEQHGRRSSSSVSRQSVNNVTNKDDRKYPQDGGTNCHAVSGH
FT                   YGGRVDKDHTERTRIEKENAHRKALEMKILEKKRIERLERERVERLERGRVERLERERV
FT                   ERLERERVDRLERERVDRLERERVDRLERDRLEKARRNSYYLKSMENGLSAGGVPTDGS
FT                   SVGATEGRNHSGVRSSVHCSIQSSVRGGVHDSVRSGVHDSVRGGVHDSVRSGVHDSVRG
FT                   SVHDSVRGGVHDSVRSGIPDNVRKSSGVKVEGMGNARAPVPNQGTHDGSFSRGKDTSNH
FT                   VSSYKPYIYDSRKEKNYQETFDRNEVHGYRKNSPITTIVPSSHVMQTKGNTGMSVNSKY
FT                   LGGAGYGGYSNNHSATGQYVGNPMESVKYREHNKYSVVGLAKNAKEVYKETVNPICSTE
FT                   SQYERVYNHGNRGGHTHSGSGSSGGERTDHRDGGTCKSNRVSNIYFNDNARRSVSALPH
FT                   MNAINAKKSSIYNNTCDEGTLSKKSVEVDRSYKHLEKDREYLLEKRKMLMEKEKGIYNR
FT                   MRHNNDYAYAPVRAFDRGEDKKPNELDRRNRSLSMCMNEQEKRRGSSTYNVKEYHDEEE
FT                   ELHNSYTLQKRNMYALKNFTHKGPDAYTCR"
FT   CDS_pept        2022103..2025498
FT                   /locus_tag="PKH_144520"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144520"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144520"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCS4"
FT                   /protein_id="CAQ42233.1"
FT                   /translation="MCNCVRVHDMQDASPLSPMQTPREFSNFPIGQEVLIDKVLNEQRY
FT                   QHDKRKKKKKGGEEDIQEQLHYYLNEKYELFIGYNHFMNTLFKKKKVLRVSHGKDDRRK
FT                   IKERHSRREGSRHTGVAPSNEGATKVKCRGDSHSRDRDNGRRNSDRRNGKRRGVHPHGT
FT                   HEAHVKNEEEDIPLKGDQGREKKTKMSGLRHKEGDSKAFKSSSSPQRCTCDCHQCRSPL
FT                   GASDPGDRVNDVLDEQEDDSSNYRIDDPSNDRIDDPSNDRIDDPSNDRIDDPSNDRIDD
FT                   PSNDRIDDASSYSSASPAHCSDVSDISNLSPDAFCFEKQFKYIYDLYRQNDKNVYLFYN
FT                   PPVCKCVNKSFKEKYYRSLCRKYPCLFNCTFEDEEGDGRPNRGEGAPKGEEVTKVEEVT
FT                   KVEEVTKVEEVTKVEEVTKVEEAPKGEEPSKGEEEPNDVKRLTYAEVASDAVEMKLYAK
FT                   AFFELCLLQGGGGDRVKGVSKDMEKNTSGDAVDEGAGDAVDEGAGDTVDEGAGDTVDEG
FT                   AGDTVDEGGGDAPIKASPVDVTQRENSILGEEEEHMLKKFFNKCLRRIMRKKSPTCENG
FT                   SCCGLLYVPYSYIVVVLNRKVENLSYICSYLKLPSSTDMYYNNKRNIVTICTKNSVHEF
FT                   FCYYSLRENRYIKNILIYDIFFDGFIPFFKPLLNLKVKKNLEKVMNYVNYNKGCNLSIV
FT                   FFWTGGREETGVDGAQNDMQCGVENPSDHSISSSMSSMSSGGGGGDGGGGGGSEARHAM
FT                   NLRVCRIININHPNEYKGMRSRLIKKKECTEGTGGRERKDKMNADQEYFANLCNGSEVI
FT                   NNININMVVDKIIDIASRKESSLCDENCNFKRHNKRYGKKRNIQIYLCQSINSFSFDRR
FT                   PLFIKRREITFSSFVHFQNVIKTYLGGSRNNLDVLIRRRMEEDVFDMDLRKRNLLSSFR
FT                   GEEESDTGGTTADLVEGERSNLDHLFNETLFFFNDNSDLYTYEEYKKAKLQSVGRGGEQ
FT                   DNNPTAEQQHNARGRNWITRSATYAERENLWDSLCTQYAQNLFNIYVCSFLNRQNSYKR
FT                   VTSPVGGGGKKNNIIKINKNKGDKMSYQERIRFIKECYFRLFRFYKEKFRVSLKKEEED
FT                   IVHRNNWVSEDSFIALSRKGTMSR"
FT   CDS_pept        join(2026100..2026128,2026362..2026452,2026648..2027772)
FT                   /locus_tag="PKH_144530"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144530"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144530"
FT                   /db_xref="GOA:A0A384LJV9"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJV9"
FT                   /protein_id="CAQ42234.1"
FT                   /translation="MFPSVQLKRSTLLRLSKILSLSAVTSRGKAQELIKNGKVKVNNQV
FT                   VRQNVVVDINSAIELDGKPILVDVTTKLWGIYKPKHVFCSSETNYEYEEKKQALKIAPP
FT                   HELLPCGRLPERGSYSTTQLEPGDMRKTFLPEGRSQIVQARRSDHYQGYSGKVDERLRM
FT                   LNWKEDIVRYPPEVRRNPDELEKPSRSEPQKLNTNLFDFIRKKNKAYETKNNIANDIPE
FT                   HLIVVNSLSASSEGLVLLTNDGDFARNLKGIENNIITSYIVKVKEELTNEKIKLIEKGC
FT                   NVGDVHIRPLDVHVIKQHSSSPKWIKLTYVEKSHTYLNLLFSKYGLTIRKCKRFSFGPY
FT                   KASDLSENFLTPIKIHSTLSHLIPKYSPKLILAQPTGNVLTDECDKFVLVKDYLKNSVI
FT                   RGVTHQTTINGDEVT"
FT   CDS_pept        complement(2029084..2031207)
FT                   /locus_tag="PKH_144540"
FT                   /product="merozoite surface protein-9 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144540"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144540"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KRT7"
FT                   /protein_id="CAQ42235.1"
FT                   /translation="MRVSIIIFSFVVFLVKGHIAKSDDKKNFSKLFDANLVNNYEKLFK
FT                   VIKCQYCLTQKKGAQNEKCKKIMKECKHLLKDGEYMTMLKDLMSDLKVGKNEHVYGPNT
FT                   EELKKIINFLELHKQEIKKIKNMIDTIKNNKAILLINGGDNAMVHKLNKKMKSLKNGVE
FT                   YIQKSQEAITKHLSENDDEVNNILPDMFHLKGTTNKNGNELIQLGNVTDTDGENNYELG
FT                   NLGVEDVIKNSMKGLFKDGEGLMDVVKNTLMQEGGGIGGELVSLIEKGKEIGQKIVDIE
FT                   GMITNKDGTANADGTTIEKLDHFKTELSSYEFLITSLKGIVLGKLKDILLRLLYKAYIS
FT                   YKTKKAKEFGEPVPSEVPEEEYLNELKKGGLELGIKILFNKLRYLLIVIKKKLFPKKFG
FT                   NKEDKTKKGENKALPKSVTLESAKLNSNMLRGSVCEEDVSLMTSIDNMIEEIDFYEKEI
FT                   YKGSHSGGVIKGMDYDLEDDENDEDEMTEQMVEEVADHITQDMIDEVAHHVLDNITHDM
FT                   AHMEEIVQGLSGDVTQIKEIVQKVNVAVEKVKHIVETEETQKTVEPEQIEETQNTVEPE
FT                   QTEETQKTVEPEQTEETQNTVEPEQIEETQKTVEPEQTEEAQKTVEPEQTEETQKTVEP
FT                   EQTEETQKTVEPEQTEETQKTVEPEQTEETQKTVEPEQTEETQKTVEPEQTEETQNTVE
FT                   PEPTQETQNTVEP"
FT   CDS_pept        join(2034765..2037534,2037663..2037880)
FT                   /locus_tag="PKH_144550"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144550"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144550"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KUS1"
FT                   /protein_id="CAQ42236.1"
FT                   /translation="MSKFLTTLIFLFAFLHGGGRLALSVGIRQKGPRLINRLSEVRSIP
FT                   GGEVTRGPKYRVNTYQRKREVKKRGKENFFIGCTSNPSGSRKDGYRQKGNVRRKKTFLF
FT                   DEGENEKMESVDPELYESLSGCIENEMKDNYLDSMIECTEDDYHSEDVHYEADDLSEET
FT                   KRKKYHTYGRRFSDKDFGGDNVHRYYQHLPIYYDGENDGPMKKFKRVYNANKIENLERN
FT                   IREEDLYYPSVPVHWKVYVCLLLDKKYNYENENDKQVYERFNKNVRHRYALEFLSWVKL
FT                   STRIYQNTSKVLMTFNLKRKENIFGNLLFFTSVNLHYADMFLKSNPYVKLGLCEELYLY
FT                   AYEQNNDHFLLGTFPNLFLQKNYLFIKFFNQDKLNHINDLYEKHMRFFIRSNMIFKLGV
FT                   LKQAPKDNLKDLFLTTKQYLPITEAQTKNVLAQFDEEMGAFEHCSSVEVDSDSTIRQIK
FT                   SAHHRMNVANEAEKMDSANASNSDNGDNDADARDDVDIGGAPTGKFARECLAELTIANC
FT                   KDEEEAQEFLEKDPYTRSCLYESIFFCEVREVAPHVQYTEGYIPKAKNYMDYHHEVDTN
FT                   LNPNYDLEEKPEYMENRSLAQKKFANHEKVDMDILDTFIKLKYTNREVDCEGGEAEQLA
FT                   PEKDLTTAENESEATVESSPQPPIALFNSRKKKKRMNKRYRVKIVDYENEYMEYLCNVQ
FT                   NNKIVHLKKEERNIPLDEVTPCPSRDIYDVLVEDMKNPKIYRKKDIILVDNTLQFFDHI
FT                   FFKDYLSNFVYITLPPGEFIEEAYAIKDEKNYDFTIFNNSLASQEDFLKRQNYQPRFLK
FT                   GIWLKKDQSKILFYDKQNNALMYGTGIDKTFSWDKKVHPRIMKRALINMEIALETIRQG
FT                   SCILNDDITANQETERTIKEYTNEYTSFEQRFTAPHNQLVSSHGYPDYKPPPGLEYLNP
FT                   HIWEKTPEEHKELILDTDRVQKIHSKFLKKLELYKASIDDDPFTQEVPTESDILGNSNM
FT                   VQVDYL"
FT   CDS_pept        complement(2038117..2046678)
FT                   /locus_tag="PKH_144560"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144560"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144560"
FT                   /db_xref="GOA:A0A384LBY2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LBY2"
FT                   /protein_id="CAQ42237.1"
FT                   /translation="MYTEKLNLNSENEKITSLDFQPCSTVNRLAISSLHQIKIYRIPVY
FT                   DTSSKGKIHIELLFISNDHNLVYINTIRWSFNGQYLASCDSGGTLVCYELNSQKNGKVS
FT                   GEEIKNLPKEVSTKYTVGNISTQGNSNNREEWKITRYIKILESGEIFDLAWSRDNEHVV
FT                   CGVSKGMVYIFNLKKSYISHKLFVKGTRENIKGVSFHPTNNCILAQSSDNIVCLWRKMN
FT                   IYPEQKNYLLTCGGQGKRSFEKEEKEDTCSPKYDCTNTNQAGEFTQSQGINREYFECLY
FT                   EEQMNETNQNIDTPTIRHIYFDTFGKYASITHIPNNGRNCGVLLKINNSDQINRRRLFL
FT                   DGHSSCIRVAKIGDKVFIDRKRKKLYSLYCQCSDNGIISLWKIFLKRVQYSGKMHPPQG
FT                   NPHMVQGRHPSEVVKHQHQHQQQQSYGTHSEHPPGRKTHKLSRKKRKKVNRYAKCFLII
FT                   QSLLEEQTCAVDASWSSASDQLVIGASNGSVYIVQINIRALKLRPFYNQVFLEINEITL
FT                   KCNRDHATDMVQQNNPKVKSGKDIVERKPKNRITPKIKYLYDEHGNVVENTKSHEIIHI
FT                   LQCTVCNYNVDIHPYFSDSLKWNFFLEDPISGERKYRNRTVRYIYDFPSFMRWFIWIVV
FT                   KCVEFALRGVLPLWEALAAAAESHQEVSSEGGHSGQSNYSGGGGRVNKGMSGSVMGSGV
FT                   GGDGTMCSGGDGDDEDDGNDRDRGRGNGHNNDAGGDDDDDDDKKEEEQEGVDIGEDEEE
FT                   REYVDNDKGGKEVIPTGRNLSMDSNPRVDSNPRVDSNPPFGSNPRSSNRQSKGRGEKNK
FT                   INKIKSTKEKKTRRRSSVEKKGRKYTESHLELGRYLTSNENLSIVNVEYVNEDNENSNK
FT                   YSYDNNHMYSNRPRRTSSGYLANEEGSRSSPMNSLNDDESMEESNKNIDLKILDIIRNN
FT                   YNKDSYAATTIPLLDEDFCGLPRMEDCGGMDSYVNKVEGNSRYPVQKEREGNMRLSDLK
FT                   GNEDRKKRKVKKESSGANRRDTKGGAKGDEGKKRVKRERKEGIKESAKEDSKEGVKDGK
FT                   KRQKKGRATGVETVKGVTNQTVDGHCDRQVEEANAARTVLSDRQAERPVEQSKGEYSER
FT                   PSEEKIMESTEQLNWDPAGERAEVEGGDCAPTFRKETRRETRKKKQKGGEDKEIGHMGN
FT                   SMEDIQNEEKGENLRVEVQDRVWSETSEAKKEARRAARREARREARREAKREARKEAEK
FT                   YPSENPNRDPNGDPNGGLNGGLNGGPNGDANEGLNESPSAKRKKRPKKRRTGKDSDREW
FT                   ENFNPHAELRYVEESQLVAKVPPRGCKEIMDSYNIRKKEIRTGKNRSGEFYSSNDVNVG
FT                   ELSRSNQAKGNYTSEGLEDCNNEEQTNVTPKYGMKIQERQFSQPCESIKKDGVVRSSWL
FT                   NDGELVSRGRNNNMCVREDEYSDGYNSGGAYSGECADEYMDARSGVLNDDYRDGQLEDG
FT                   QFGEPIGKSCDTRSISNQEMKTKQKRSFERMTPYNSYERRKREQPKKKGKLEGKVLYSN
FT                   GILDQRLHSAPVKTSVVNREHVMQGDDTWVRGSLGGVDRVDRDKVKEHLEEEMHVIAGG
FT                   EEGDDEEGEESDVGDSEGEGVNAGGATRIMHLESLKVQQSPKETVPMQQSSRRTQLYGE
FT                   VDGTHNYTERNAKRVGGEDLFETEEHYGWPEREGTDQDETNPYGVKKENHDEENENRNY
FT                   LSGNTLKRYTFDTGNNSSSKRIPTEGLKRIIRGGGSFNRNCEQGERRCINRYTSSGREE
FT                   DAFISDEKGKNTYNNAMNRSNCSVDERVDFAQRDRNHTDNIHVEKYKNKIFFFDSRTEN
FT                   CTISCMLGDGITNPIDDGCHVMRRRKPFYLLWEDEVVGKFIKQALFGNYLFVVTSENGM
FT                   YILNVFHIESRLVLYNFVFPLTTDICDICIIRSLHLGTETYTFFYLHDCKNRYYIYQLV
FT                   NYCTVSLLYEIDTSKIGVQVQNMNINLMERLTRSGATQGGIKKRKKCLRNFARHMLAKQ
FT                   GKGNVVSGKKGNHKRGRIRGANILNGLLKKFEKKKKKKKKMVMKKMTRTKTKPRTKAKP
FT                   RTKTIQREKKKGEKGEKGIKKLIKYMTFFEHPSEINNGEDDPEKVNLKWMKFSGNVGRI
FT                   NRENALGGMKTYPFYLGGEYQMEAKTYQGGVTMRRLAGEGDYEHHVSNDIGEVTLPVEN
FT                   NITLGSSNVYCQGTKLEGEMKMPSSLVPANVSNLWTHYPAHLLTEDQADVYCLVGDENG
FT                   RNCLHPTKGKRHMDDVFNRNIQGSDILYDSIYRKKNFLYSYMCIFVYFKNGMIFLIRRN
FT                   LIVKGGGTGDHQISNHPIIISLSEHLHHDDGVTLATRLDNQYYNKSLYCDVQIEEVDDG
FT                   TVNASMVDDTAVHGAAFLSRNAHVARANAYISTCENLHAIQKEGLRNLYTYSNFFSVYD
FT                   FDIKELLKGDDIFEDVGTTRGKTKKLLKEKNRTKGKDLQGGGENIQGEIPQEYFFSDEK
FT                   NGSTVNTTSDLSPNINMAHQMYSIAKRKNCLLKDINEGGIRVNHLASPVQGERLRDPPL
FT                   KEAMLDTVMWGESTQLEGKWMQTPQLGSEKVPWVSPHMDEPNSHFHAHSSPATRHHLPW
FT                   GKSNEEVPNAVTGFPEGEAQFLSVDGRSRNDASNDVGNHVGNHVGNDFGNDVGNDVDNH
FT                   VGNHVDNHVDNHVDNHVDNHVGKDFSDGDFADFIGSDYEDCSDGYLEDTPTEKKTNVYL
FT                   QTVKFLQTQMRYSILLMNRRIFLKYLHAYLNLIKEYADLQRIQQIFLYFMHTTLYHSQT
FT                   FLSDLHIFLETMDEPYWLDTNALLSMNVHFFFLLVFIYDNYLLPIYRKVRRRRKDGIQV
FT                   NPRLEPFLVFLRESRNCIYHVQKIFQRNFRYIASS"
FT   CDS_pept        complement(join(2047912..2047987,2048117..2048184,
FT                   2048299..2048460,2048561..2048637,2048748..2048819,
FT                   2048981..2049065,2049186..2049374,2049517..2049537,
FT                   2049688..2049756,2049960..2050085,2050234..2050338,
FT                   2050469..2050532,2050761..2051004,2051106..2051172,
FT                   2051272..2051469,2051726..2051866,2051988..2052047,
FT                   2052206..2052253,2052356..2052443,2052543..2052703,
FT                   2052850..2053164))
FT                   /locus_tag="PKH_144570"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144570"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144570"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCS9"
FT                   /protein_id="CAQ42238.1"
FT                   /translation="MNAVRKCPSRSGSSKSILFRSVLSGGTPERKNNHHLIHHVRKSPF
FT                   YTSVVVHNFDLRANQHLLLSNATIVNDEKALLNGCLNFMKNFESFAAICCACNDPKNKV
FT                   QLKKSIWFSSIGIEMQDFIQYCYEGGKEFQNDEIKKILEEIVKSECPVILRDKNSVLIE
FT                   PDVAPKKIVNSAKRMRYFFNISEVHTCRSCHQKSRCKRFLEKYTGEPDFSDFTRLMIGF
FT                   YHVSKAYTRRNEMDRLELRHVIEKVNYFHFALLYMYNYLLKHKHFNYNTVEEGNRSAIL
FT                   TYLRERRRNFLLLKNQREQEKIMNIPKEYSDVMIPTEKAKMKRRQRNVFERLQRFRRRS
FT                   QLPEDEEKFIWMEEQEEEEDTQERASPADSYDGSLQKHSTINNDLKNDLHNITEDENSL
FT                   VEIKENNEPLASFRFHYMAKMNKHGAAQEISNYNKMYNKYSRLLQKNVCINLDDHDVNE
FT                   DIIKAESLLFKIPEAIGGYTFINYIERQPNNFILPINENLYKGIQVYKREELNLGDFWS
FT                   NITNEELKIKRVGFYNPFNIKQSLEIAMQKKGAHPRRETAQEKDEEITDLSDDLSSFQE
FT                   YLDVRKKSEAKRRRGERRRANLENSPSYATASPVDERKSKNSEENNDEDARFAYFKKLR
FT                   NERFNVDQYEEVKEEFDTIYNEAYTAKGERDQAYHHTHHIRRRLTDEEKGQRGVTPEDI
FT                   QEERRRLMQEGRRELKEMSFYLFKNVKFPELPAELSSGEGLSSGEKKRKNLNDELKKYI
FT                   RPRAQVDANTQKRNSNVPELTEETIQAHCSSSQGSRSLEIMLKKKRKNFKGDRNVQER"
FT   CDS_pept        2054079..2058725
FT                   /locus_tag="PKH_144580"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144580"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144580"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LL03"
FT                   /protein_id="CAQ42239.1"
FT                   /translation="MNVVELLEKKHFKAIERNIERRKLKKYFFAFLRFNNLYKGKNKAV
FT                   GKLWRDISAGGEYLDIFKSFSFVNFKYVCEFVKRLGGEVSSPEWMDGQDGLHSLEWPYL
FT                   PPTNVGDDIERDPQGIANLFLVQLFRVVRLHGSVKKRWESGNTKGEGPLEGASTDEGKP
FT                   CMDIPYLSDIIFINQKREFEILFNLMHPLVHNIYTTNLIADMMMKSPPIDMDKCYIQLL
FT                   ISVLLHIYKKKKHVLFFYFMIYKKWKRVRKNISNSVEIIIEWESIKYFMRKNKKDIYHF
FT                   KCLRYFLLNLCDRSAIHQMLNYVFSCLRDDFLLNHPNIWEMDFWTYRKESNFYEFAFFL
FT                   YLSIEDLCDPELVFFLPSVEKIKKLLQCDQPTCVMDIYLLLHFIDKCDCDLSLKLRLIL
FT                   VSLIRCANSPDLFRQNGGNFFHAVVNPARAQLLGGPLSEKVQLPGSSQPDDSPPLGSAT
FT                   LDHRRIAQSVSTYLSDKDELIMHTTKKEFFYNAACIIKYVHITCYNIVNNRKEYTVKYE
FT                   HLESEREATTAHPYEYNLHSDVTNYKSYLSSSVSGHFCRKYATLVSILLHMNLLRLSDI
FT                   WSFTLIKLVENNLFFQLMNLLRLRRKSALLCLTISSLLKVRYEAVQEYARATSVGGSSN
FT                   GILGGGLTGGLTGGLTGGLTEDLPDDLVSYPYTALYEDLRGPALAKRRALRKEVLEYAS
FT                   KENKLMDILSYLSMNIKKDILKLPLIILKYLYKNVLKYLSKPIHDMKKSIRHYFDRMSL
FT                   RIGAYLFELIYIMSIWIYYQGEVHSIIQYRKKFHLFPLYFILVDIYVKFAEKYSEKNNA
FT                   ILPSLLSYSFVQGFLFLFNYPRAISIMGRGLSRSNTVKVAINPFLGDADQSGIRGEKKS
FT                   QLLRRACLDYPLTCSIYPSSDSGYPSPCSSIQRGIPPPSCRLTQMENVNLSEAEQKGKR
FT                   KDMDLVSRKSSSSEEYSEYIISIIEKFIEENRNEVLCYFYTLLMFTVARVHTSVCYRYR
FT                   EINYLVILHVLPWKSSLNFCRMDSKLSCFFFQKYYECVHALLPEIVLTHFSPGVEDTHM
FT                   DTKHDEDGYITRDLVDTCEIDTSGSYPHLGTSNGLYAQIVRAREAIGRLFLGRTEKNST
FT                   GYAPDGVIIMGLESSLLRNCLLVITFIEVIFMNGGDDMVSHSTEGSAPLGESIRSDPHS
FT                   IVDRFGRMRNFSHLMKYLIDEQLCAHYISVFQNPVNFFLRISSKYTDLLIRHNCLNSLM
FT                   CFIFTKLQNYLSLIPPRLCAEDFLPLNVDDITALQETAVAQCMLNLRGGEGDSTYEGGM
FT                   SAQATGLAKPMGAAEPTDLTEAIGPTEPTEPTEPTKSTEPTGPILGDLNFFLKKMDALV
FT                   KTLSESSLQSLCESGFDIQSAFYLSFYLRPPTFHTVFHYLANNMMAITSDSFNLEDNIT
FT                   YYKQIHIKKKETVLNPYNVLNKTTFYTQLVVFYLIVNANNERIEVEPYKKSLCGYFKGC
FT                   LQVCFRPYVDEFVASIIPIMLHFYYFFPSFIPELLGALIQIDMKKENELLCRELSRFEK
FT                   RVRRVLEVSYVHNPEGAQPTGVSHASGV"
FT   CDS_pept        complement(2059390..2065440)
FT                   /locus_tag="PKH_144590"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144590"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144590"
FT                   /db_xref="GOA:A0A384L9C6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L9C6"
FT                   /protein_id="CAQ42240.1"
FT                   /translation="MNGKNAKGKDGARKQGKQGSLIASMSWFGFITFEWITIILNKLKA
FT                   EDNFTLPKVEEDAAIEYYAYNLGNNLRGFKKRRRKNDNSTVNSNEGSHKSSLNGMSNTE
FT                   TSYSLQKRGIIFALLKTFKNQLSCITFFYVIHTLYLIFVALCIENYILLIRGEGNPWIP
FT                   FLRKHKEIAFGLFLIGVICFDLFFDAILTFFDYRLRLNMEITLMYFLYKINLENFRGTL
FT                   SSSPYIALGDMEDTSPMLKGEEDSPSPEMNRPEGETKTGDDHSVKVEGVCSDRLGGDPI
FT                   TCSSIGCQAIPCDPIGCEAVSGEPIVIDTVVEEKGSVGSKGEVKISDDHLGGESKEKTI
FT                   KREILSPRVEVDSTKVNGESNEYPDEAVQEEDDKRDNDSCDINIYNIMFVDTPFLIYFI
FT                   SSIIDFCNMVIKFTISFYMFYYKMGREAVVNGILLIAFLYSLMFAFELASSVFKIRHLR
FT                   CRDSRINNMHHILKEYKLMKMFNWESIAFDYVNRHRKKEMKVCTIRIYLNSLSNYINAI
FT                   SMNVVEVAIFFIFIRGELNSNKPINVSSIITPLFLYKSLIAGMSNLPNIINNLLEGAIN
FT                   IGRINRYIEHYMFQFDREDRNGYCTYRNDHKIGIQTCSTFGRHNKMKSNSNKHCDDSNW
FT                   RSGFYKYFFFNKGYGMPGKGKSNTNGYYYRSEKGNDALGGVVAEKVTGRLSGVSIGGGK
FT                   GHQASDVILKMNGCYFSPDKSPTGKGRHSRVDSNQTDALLKNVNLTLKNNTLVVILGNV
FT                   GSGKTLFFNSLFGKLKLSQGNCYIKNFVHDMPVMYVPQFYWVTIGTIRSMIIFGNRFDP
FT                   YLYYRAIVQSELINDMNTFKKKDLRYVGDEHSLSKGQKARICLARALYHHYIHMSDLLI
FT                   DYEKDIRINKEWREKVMLEKLYGTDNSSCKEPSGVRSDSSMGHHEREKGKNILIKGEKV
FT                   GKKKEGTYDEPLSQEEKYQLHDAYHSTNDTLNETNMINASLHGSPVKSGKYRKEEQEGD
FT                   QKQNGRGSNGHVIIGPTGEMYTENNNLFKKNSLLKECLEQEQMSYLYLLDDLFCALDPC
FT                   ISKNIFYNLFCSNDDVEGFKRNCAFVLTANQNIWNSFLDEDIIRQLQYGVEIYRLEDRT
FT                   LVYEGDIHTYMKNNGIVAQRGKGSKEGSSPIAPVKGNTNVSASQTASSGEAATGSSSSS
FT                   STSRMLDFFSEQQSGRKYSHKNDMKFQKFVALKELKSTYSCRIEPLDSPSVHEFGRKYT
FT                   TVTQNYVEMPNGYITNGYITNGYITNAMRNVSISSIGSLNKTMINSYAEVLIKEKKNVE
FT                   GVGNDNRRNRSFDEDDKITLHEFEKVSKVLQAKLKQNYIYEYMGNEDNGDEGEEEELRF
FT                   KGNIKWETFAWYLRMIGTPLIAVILFFMVISIFTDEIKNMLLFMASTLIKSKGQRESEI
FT                   LEKQLVYMKWFVLLPCVSLVTTLTSFMLIAHGIAISAVKVHTEVLMSILYAPIHAFYSN
FT                   NLGNIINRFITDINVLDNGIIKRIYKTFYTFFRFLFTIYLLNYMVYQTIYVLPIIIFLI
FT                   YVCVFQRYSRGCKEAQRGYLSAHAPLCTIYSNTILGKEIIYLYGKSKHFLDLYSKGVFN
FT                   YKNYTIFKWCLTIWASLYVQLIVLCLTSFYIIYPYVLEPYLGDKKDPHFMNEEKNANTI
FT                   GYCITFSCSLGFIIKSLLYDYTHVEKEMCSTQRLEECSQMFKEQVNYDDKEGMLPTQML
FT                   TMQTASTQVPVVKDTPPMCAPENGKAKYGLHFENVFVSYKKKIFIDRSRNLYYYANEKS
FT                   CLRNLNLYALKGQKIGIVGRSGAGKSTTILSVLGLIPTTRGTISIEGRDIKTMTLEERK
FT                   NTIGLLPQSSFVFFHWNIRTYIDPYKNFTDNEIMDAFKLIGINLQMEDLYKYIYKQKKR
FT                   ASQDGRRVYNGRDKFDKSKSSSTVANSLSLSDDCIRYLALVRIFLNRHNYKLVLIDEIP
FT                   VLNLNLSNSNTNNFFSSDVKSFEYIIRNYFSHITVLIIAHDVSTLSCCDFIYVVAKGEV
FT                   SYKCSYSDIKTQAALAALIQKQTE"
FT   CDS_pept        2070048..2072840
FT                   /locus_tag="PKH_144600"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144600"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144600"
FT                   /db_xref="GOA:A0A384L2M8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L2M8"
FT                   /protein_id="CAQ42241.1"
FT                   /translation="MKLQYHLLLFTFLLSENVLCHKSISENVKDGSAVRNQGGCVGSEN
FT                   LTHGGKKALWAWGGNDKKGEGNKSSNREQGLMSSVVGSVKRMLFFNDKEIENHVQGISD
FT                   NVQEMKDGMIKNSSNIVKHASKIKDELQKNTAYWANVVKTTVSEELHQIDQFSKDQLDK
FT                   LRKNPENKFFFTKLFSAGSAAADTSSPHKDKENKNGGEGGVLLKGPNGHNDPQVEKEQK
FT                   DKSFWDLMHTRGRNASSTPDGKEPSKGFLRMFKGDTTEPSNSAEKKEPSFSWFGMQSSE
FT                   NGVLNGKNSPEAKSVNGTKGQEVKKKSFLSHFTSESNEEGNLPKGSATQQNNANDDTEK
FT                   NHTFSFNFFKKKENNEEFSSGPISEEDEQQNDSQPNVKRTFFQWFNSPPKGEKDDEHLS
FT                   NKEHSGGMTQDSLKGSQHGEANEQGEENKSPFSVFNMWKGPHKEKEEKQKEEVETDIES
FT                   KASEVTDGDSSEKNKNGKSFFFNPFGGLKSEGESSHTEVTNPGETTNAEGIAHSELNRR
FT                   SGFLVDIMKNIYDGKSDETGEKAEKILSFIHTEHEHDVNTNCHPLVSFKTCLSTCFNVP
FT                   PAVEGENNDGPNEKKKNLSVGDYKKLEKCISTCRNRNFNEQTPGCATKDGSVITNNKIN
FT                   YEEKLKNLENSNYTWEQQSSVFTDLTLRDKYSDEEEKQAVKIPNGEMLSGNSTWMMDAS
FT                   GKHLSVAQREEKSGSDKIPTLSDSPLGTHLYSMDTGNSSMGVHKRESTDGKNTMVGENS
FT                   FSFFKGFAPQTGSTSDVVNTLGATKPLHEPHGKNKASTDGAVAKLNSEMGTHGEDLERA
FT                   QGRSGDNNDDNDDDDDDEEEDMNIFRYISKGFFLLLLLLTFFVYLSAFTNIITQFYVSF
FT                   KEKVCLYIKGHCTSPFHQPHAESTQAFLTKESQHSYATPLHSSYDNLYHAFHDNTCDVA
FT                   "
FT   CDS_pept        join(2073996..2074074,2074298..2074569)
FT                   /locus_tag="PKH_144610"
FT                   /product="macrophage migration inhibitory factor
FT                   homolog,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144610"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144610"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LDV6"
FT                   /protein_id="CAQ42242.1"
FT                   /translation="MPCCQVSTNINVSDDDAKKALMQIENAISQVMNKPMGYIMSNLDY
FT                   QKHMRFGGSHDGFCFVRVTSISGISRSNNTALADKITKILASTIKVKSDRVFIEFKDCS
FT                   AQNFAFNGSLFG"
FT   CDS_pept        join(2076664..2076750,2076872..2078419)
FT                   /locus_tag="PKH_144620"
FT                   /product="t-complex protein 1, gamma subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144620"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144620"
FT                   /db_xref="GOA:A0A384KRP1"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012719"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KRP1"
FT                   /protein_id="CAQ42243.1"
FT                   /translation="MLKNPGAVLVFKPNTKREEGHKTQLSNIQASRAVSEIVKTTLGPM
FT                   AMLKMMLDPLGGIVITNDGNSILREIDVAHPAAKSLIELSRSQDEEVGDGTTSVVILSG
FT                   ELLSIAELFLKQKIHPTIIVNCYMDSLSKVVKFLESIAVQVDVNDEKSLLKAIDSCLST
FT                   KFVNRYNKMVSKLALQAVQCVKIESNVMGKKEIDIKRYAKVEKIPGGDITDSYVLKGVM
FT                   LNKDIVHPKMRRRIKNPRILLLDCTLEYKKAESQTNVEILDEQTWNQLLLQEEIEVKKL
FT                   CEHIIDSRCDIVVTEKGVSDLAQHFLVKKNISVIRRVRKTDLNRLERISGATIVNRCDE
FT                   IVESDIGTKCGLFEVKKIGDDYYSHFIECENPRACTILLRGSTKDVLNEVERNLHDGMN
FT                   VAKNIILEGKLLYGGGCTEMRVGQHLISQASQYDDSRKSIMEAVGSALEIIPKILAQNS
FT                   GANVVKTINELRIKHETPGGEKFGVDGITGEIIDVSTKNIWDLLAVKKQIYKSAIEAAA
FT                   MILRIDDVVSGIGKEDKLQKPVQNQFD"
FT   CDS_pept        complement(2078711..2081566)
FT                   /locus_tag="PKH_144630"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144630"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144630"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJW9"
FT                   /protein_id="CAQ42244.1"
FT                   /translation="MKKMYISLVLLYCTILNVLHALFNKCGGMTKKNPLYGKGLSYISF
FT                   LEKQNTANSVHLKHITMIKRKKKKFILSKKRRDANMLITVRPSQAKVEDGLKMSSPLFM
FT                   LSQDCPDPSDGTNDQSGGSGEDGGGGEPDTPSRDEPYRQLLSATEALSPNSPGHDDGDD
FT                   IEDHQDAMKKKKKKKKKESKGWSGNTAEEDETNLDEDVLNMDAPEYDAHLSQLASSYLK
FT                   KAETMDQKQIAGMDKEKMMDEYNRLVQILKDSTHKKMSQYEGNEKKNMYELNERIINSS
FT                   RKLNLEKMKKEIEKSFTPNDAVEKKIHDYMYMFTQSVGAETQPGVLPDGITGGATPDDS
FT                   TTGGSTTGGSTTGGSTTGDSTTGGSTTSDTPRSTSGDTNTPQDDLLREDEERENREILK
FT                   RVSSGDYSGVDKFHFKFSAKDLERMKDIESTEEESTEERKLVDAAFDRIIKDNTLVNEF
FT                   KEKEKALLQLYERGRKENKIERDEQIENLKYYNEMEMQKRKQGCSQNGETTNGRIPEGG
FT                   TACNTPPGELIDKKLFFNRVSSKFVDIKKEDIEEMSEAQVRDELRKRGYPTFGSIKEIK
FT                   IRLQDVMRIRKNHEYDIRTILKKPEKHVLSHIRLDKLKENLKEFKENDRYGDTESKIKQ
FT                   LDAAMEISNFINDPVDYLRIDTTEKFAGIAEEYPDGGTTPHGVTPTGEEEEEDLSKVPI
FT                   VNDFNFTEQISMAEKLKKNFSLEGDEKEPDQVVQFGNEGDSQSTFSSTFSSTFSSTSPS
FT                   SLPSSFEGELQEQREELYRKEVLKFGGLQETVEEFHSKHSLPLDFVGDFICKVSSESTH
FT                   AINRYRKRKKEEMEGLEKNELELLISSNSINRDFIVYKFVHTNELISKYLTTKDIITLI
FT                   EYSNMADPVDIINFYSPETIFMLSEEYGITVDRVIDTCTRLNIRLPFGGDTHLNGNCFN
FT                   VLTTYLARMRNGEKRLDASKG"
FT   CDS_pept        join(2082206..2082286,2082460..2082552,2082834..2082926)
FT                   /locus_tag="PKH_144640"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144640"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144640"
FT                   /db_xref="GOA:A0A384KCF4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KCF4"
FT                   /protein_id="CAQ42245.1"
FT                   /translation="MKKAAFFSTLKYVGIPSPLTVNRNMRRFNMAENDRKIFFSFNLFS
FT                   IFLFTLPIIYLTKANYKMCEENEVVYNKLCGSGVNITKGIFSN"
FT   CDS_pept        2083188..2085302
FT                   /locus_tag="PKH_144650"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144650"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144650"
FT                   /db_xref="GOA:A0A384L7T0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L7T0"
FT                   /protein_id="CAQ42246.1"
FT                   /translation="MEKGKDKRNSQGDVFAPAEESQPGKTSKGESEQTAVRGMSALRKI
FT                   LYLLIPLSVKLPLLAKLILLFLLSKLLKHAVSNVLIHFLYRKNDEAFQQLIQLLLLEMR
FT                   LNGGKKKERNKSNFKTVRPMVDGVYSNIQGMMKYIIRMYFFLYGIRYSGLLLPEDIDEK
FT                   AELMSTPRRVSNLWVLRGAYLNLFVALLGHPGESDKAECQLHHWECKYPDPAERNLYKN
FT                   IRDLYKVKYQKEYEIMMRSEYFFLLQRFCEFVQHTGRKAFSYIHLVILSTMSIYCLCRS
FT                   LFLLTHHIHVLEKKKLYERCCEGGSASNELFRLLIESVAHMSEDLAREEESTCAEGNHL
FT                   DDVIVHNDNDNDNDNDVDNDVDNDDDDEDDDDDLPNGQLHIYEAMQNKLRLCLNMINRI
FT                   KNKHPRYATKMLVKQKQARAQDLPGYEQPVPTCEPHKQKEVYETEPSNGQTEGETAFDD
FT                   PISQRKEEQRDGSLTYSVYLYESRTDEKETQREIKRQMESTSVENISAEHSSQQRQSQR
FT                   EKKEENRTEGNRTNAPIDNHIACCGNVDEMDKKHMEGGSSPHHCADPHGRSKPPSNLSY
FT                   EVLINELKGTFTKKKRYIYLRKKLCFDESVGEFVMREVSSNGKGRSAEGGVDQSVDHPS
FT                   VDHLSVDHPSVDHPSVDDRSDDSGGTKQRSHVRAPSGENTREEDHLRPMVDVSTFRQSI
FT                   AAAISRDRNI"
FT   CDS_pept        complement(join(2086006..2091215,2091352..2091595))
FT                   /locus_tag="PKH_144660"
FT                   /product="myosin d, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144660"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144660"
FT                   /db_xref="GOA:B3LCT8"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCT8"
FT                   /protein_id="CAQ42247.1"
FT                   /translation="MASLQLKSNETFYYSNISNVREDEGKGSTNGAGAPKRDTSYGRND
FT                   NDKLHTDKYVWCLYNNMYKKMETCGFNESRKTYTLKRKGETLENVPAEKVIPCLKEHIQ
FT                   LDSENNIDIIQLNEPNVIENLRNRYAKNKIYTFHASLLLAINPYKQIEGLYGVKSMNRY
FT                   LNKFGKGCLRKGGSNDLSNKRSMGGRTDQCLDDRNDPAHIYDIGSMAYRNMVMKRKRQT
FT                   IVVSGHSGSGKTENCKILFKYFHYIFFYNGGGSGGDNELGEYGKEKGLLKEEGEVSAKS
FT                   ASIESRVVVKNHQRIDKLIYINSIIEAMSNAKTIKNNNSSRCGRINDLVFEERKKTDET
FT                   IFNYCFSYIKIFILLLEINRCVSHNKGERNFHIFYQVIRGLTDAQLNQRGLVRHVHRYK
FT                   ILSCSNHVDTNFSSTDESALDEERKDEKNFQHLMEGLRYIQYDESRISELIDVIAGIIH
FT                   LGEIDPGGEGEDERVESEEHNVSNPEAQPKGDSLNSDSYKNASACLRLPVDDLQSMIRF
FT                   KCIHVSGERIRTHRSRENSLYTVHSLIKVIYKNLFRKVVSDINRIHLSANESEEIMNES
FT                   VYAKNNKIISILDLYGFEDLASNDFEQLCINLANEKLNNYYILNEVEKEKMIHKEENIL
FT                   WNEVSIPNYKDTIHFVERLFSNLDDITKLNNSGQKKVDDNFFSYLLNNEKTYLEKGIYG
FT                   FVNRKDDSHTDRKHNIHRNVFFVRHYAGCVVYTVNDWIRKNSDRVEVEIEELISQSENW
FT                   FLRGGGEVSGHGEPIKGGIETETTTSPLRGGVNLKKLQNGDGIAERRVGNLRSDANCFL
FT                   ATSRAVATQENMHTSCNKSILSVSKKYIKELDKLFSSMEKTDLHYIRCILPNEQMREDT
FT                   FKRRLIYTQLKQCGAIEMVKIVNRGLSHKVLKAEFLEKCVKDIPNELQYCRQDDIVYYF
FT                   MRLFGEKRNFQLGTNYIFMGSSVYTDVHAYLYGDNLDDISSLSLVEERKEKILHEIRAM
FT                   RFRRCVLVIQIHNWMNSHYRIYLNKKKKMKEKACDYIFKMYLIFKTMMSVKRSLSYNVR
FT                   RLHMVLARKAYVGFFKQMRGVKRGKLNKGSTSFGGAVRSKVCAEEGTKEGTKEGTKEGT
FT                   KKSTKEDSKEDSKEDSKEDSKEGTKENTKKSNKEDNEGGLAAKLHGPHFDAAGTNGLSQ
FT                   VAPEIFVATPDNYHHVYNNIDWVVIYRQKQVHLYNIAYSFERVYKKYLPDFKAVTVKKL
FT                   ASGDDYPFAQLHTDSHVPSPIHCIGQHPLYKNIFLAVDANLCVRIFAYPTLDSIKNFLK
FT                   RKIELMKKGSEDIPSTYLPQLHRSRRFGAPSGGASPMGETTRESSPGELFSEENLNMFM
FT                   HMYKDVYVLSSLGKSTGGIETGKHGKMTRKKKEECTLIKLIKREEYMEEYMYTNPSFKI
FT                   LKITFLQTSISHFMCLSYSQIGQDHYLLVTLVNYYSKPIYHYTSKINISNVIENELFRK
FT                   FFLQYCGDSLSSGKTECERKYPTKGEEFPPWNEKEEQKKRHVENYLRTIKISLINNSHV
FT                   VIHGACLLSLVEIQRYDMCSAEVSIREYEYRYLAVVFNLMCFEIFSHVCDENFKKLSHD
FT                   VKHNLVVGELFRLREEKKNTHIRLNGAGNSGNFANLGRPCDEGKKHLDEVAKHLDKTDV
FT                   EEPRRQCSFYVFSPRGEIYLLTNDRQGEPSEELFRHGPWGIRKLSVSRLKREETPGDGA
FT                   NGESENKGEDVPLCSYYGIFCMNISYFYKQEYYKSFVTLNSSVQATIRKYVFKQKEAAM
FT                   EGSRCIRTSFFPDVCILREWVQGRNVGGMKRDCLYYSLRNGGEAMALCRGDGNPAPPPD
FT                   ST"
FT   CDS_pept        complement(join(2093056..2093151,2093370..2093432))
FT                   /locus_tag="PKH_144670"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144670"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144670"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCT9"
FT                   /protein_id="CAQ42248.1"
FT                   /translation="MKLSILEDRLSKYKQELSEMKDMNNPSKLEDVERIRKNIKFTEDR
FT                   IHHCRKK"
FT   CDS_pept        complement(join(2093839..2094249,2094339..2094404,
FT                   2094572..2094649,2094776..2094919,2095037..2095093,
FT                   2095471..2095528,2095679..2095725,2095882..2095909,
FT                   2096002..2096042,2096180..2096276,2096439..2096527,
FT                   2096621..2096679,2096779..2096851,2097025..2097123,
FT                   2097267..2097337,2097480..2097603,2097778..2097855,
FT                   2097968..2098024,2098194..2098258,2098429..2098477,
FT                   2098630..2098753,2098872..2098975,2099095..2099199,
FT                   2099382..2099417))
FT                   /locus_tag="PKH_144680"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144680"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144680"
FT                   /db_xref="InterPro:IPR033551"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCU0"
FT                   /protein_id="CAQ42249.1"
FT                   /translation="MKNKNKIKRCLDYLRSNRDKIAKDHANLLPCDKESVLLTYLKEFR
FT                   LQLAKKYDAHFCEFFIDEYGERRNICSSIIQVFFPFDKGNNYKEIYTLIKSYFTFEVVL
FT                   KKKIKTLLLPNVALVFDWKIADCADLCTIVVSSLRTKNYDAYVVCGEAPFSICAKDDKK
FT                   NFCEFNLQNWKNYEGKEEDAVEVLDIQEKKAKYRKLMNIGVRSEGKRKFEDEGSNEEKD
FT                   LYLHMWILIKKSLDVKKDMFIEMGSGREYDVDDCPYRSIFYLWNEKNIYVNIRKTEEVA
FT                   TLVSELQNNEYFVPAFYDQIRAKALTPIIENRLYKIRKDRFLLKYPQGSNTIFYKNCKK
FT                   DQYGDFLQHDGLTEMHTHYGNKFYTDIEWVCSLFKYRRDGKKAKLYFPKKFQTVEYYDS
FT                   CSYHFLKTLKESIGFYSHFSFYPNRPDGLIHYLEIKDTKIMEYFSNRNDQVTYRSMCLS
FT                   PNVETKYKLKMFDGKEYYVIKMTVKYKDEHRHNGIKKKTFLIPENKIILVYYNNCNEIS
FT                   NTFEVYEKHIWYNRDTEENEEIVKYKKNYVYKHFVNYSDPLQKEEERNLFDDIESTYKG
FT                   VICAIRKERNQMKQTEEEYQYKPQNITNKNEMIYHDNEQMKQFNKSVIEDEMNVYNFYN
FT                   SYPWDQHAEVSMNNSFFLSKKKILKVECACDEIAYVSSEKGHELARPPLRQVVKKKKKK
FT                   KKTSRKEGQLRTAYRVELLLLFLVR"
FT   CDS_pept        join(2100216..2100454,2100761..2100878,2101037..2101175,
FT                   2101467..2101542,2101649..2101758,2101969..2102134,
FT                   2102314..2102398,2102619..2102809,2102930..2103057,
FT                   2103142..2106533,2106689..2106847)
FT                   /locus_tag="PKH_144690"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144690"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144690"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCU1"
FT                   /protein_id="CAQ42250.1"
FT                   /translation="MRKRKIKEKYIRALFTAVEEQEAQQLRQNCHHHFKSFATHDVYLL
FT                   NGKYYRVKSEDGAGMRKTVLRCLHKHNFYVPKKIRIIFKKFLLQNEATDAHNFNYDVYL
FT                   LLSYLKNPNVNEATQKIVDLDVFRTRINKENEKTIYFFNLFLNYACNHFQFKYKQGLNE
FT                   VLALFFYLKGKYFNLVDVYFCFQSFVDRFLKEFYYDDEFFFLQISFYLFKILIKYHDPV
FT                   LSEVLETNKMPPEIYAASWFLTLFASKSNLEISNAIYLIFVLERNPFFYFFFSLALLIL
FT                   HRNIFLCVDSSNLPELLSKINIFNKKFLKKVWSLGKYLEANTPVSFVHKLFFIKNVLMY
FT                   LTSEHSGNGHQKKDILLQFFNSIDYMSVNAYEIIKNISLGKNNYIFLDIRSRRHFRTFH
FT                   LKNSINVELVEGYADLLRDKIDSQDERKKQKKERKKERRILSQSIFHILKRYGSREVAQ
FT                   NSELLFSLLLMRKYNLCLGLSYDDNILLRRVASVPVQRGNPLDLCLLRRNREKKSRRGT
FT                   KGRRKRIKREKHREEEIFPNLHLLRGNRNGEVDLNFFTCKIYGRRKLSMGETKNGQIKW
FT                   KMPEHVHMKYVEERKVKNQKRYYSDDDVLLKPFSLTCHHMKKAFLSKVQKELRKKGDEV
FT                   KGKDKWKCIPSNPPEGKKEPTYTISQTQNLNTSSFNLYLLIKEKVLCNERCLRFRFEDV
FT                   LTPEKHVVILYDDNFDNAKYVRGFYYELLFKTKLRQVSIIEGGINSYHNLMRLDLPNGK
FT                   NSSVGSSFIATAGNTKDEKSIHGEETSHLYTQHCLLGRNKKAIKKFFHTNHNCYLCDYR
FT                   YFRKTKKKILDDCFFESYSNFSIFENFFSFLNEERDDISFSSFYDHIIWMRSMGDHGGD
FT                   YSYPGGEHNMKKDNVEGSSFTFSGLLNYIKRKKSGANDSSVFENGQTFSPHSPGGETFP
FT                   RDIQKEAHVNSFVAEKKISESTNGDIHICNNATVKKHYFNLSRYVDYCSRKKSDLLNLS
FT                   SSVQPQGDESSSWDSPRVNAPPGEEKGDDQIMGEEEMGISSLQNDDTKAKLNVSTYSQW
FT                   RNDAAEEEHIAVECASVFGRVDSFAEFASEPMKNPPNKGYSIGSDHVSEGIRRSYSSSS
FT                   DVYNLYSYIDIVCYRSLLLKGSSRKEDTSPKRKLYNCFITYIYQPLIPHNIRSNNIISN
FT                   LVQYVKYFKCIKRKNTAINDPNLYLQCNKLDSNLSFRMDSNVPLRMTYFPFRNMGSMHL
FT                   LHSARGKEFLDGGSADLSYVGATNTPDKQYSKQCTTVWDERVNDLILSNTCLKNKPELG
FT                   LCKLMIYDHLLILYGMPYLYEVSLPGRCEKVTTETYNQTSTVEQVGESLHMVDIGTKNF
FT                   LKEKEEYTTEGMDHEAWYLSSKSGEELQKVIVHKHKDLKKKDVLFNIDSYKISGIDINW
FT                   AKVSPHVLRSITKEHITDTYSYYKSYFSVSNSNLSASTEMCCPSVSSSLSSDSSSYSSC
FT                   VSDEPNFSFSDYHSLYTKNAKMMKNDEKRRRRKNPPKDAEAPLRCDHRKVKIDVVNIYA
FT                   VFDIHTLCKITTKRGSARTLYFYFVTNRNTPLMVLNFDSDMEVQSCVRSIREIYSRYAN
FT                   GERETSGEAAGEVPKNATRGE"
FT   CDS_pept        complement(2107428..2108552)
FT                   /locus_tag="PKH_144700"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144700"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K9G8"
FT                   /protein_id="CAQ42251.1"
FT                   /translation="MEGDPKCTPQGSAGEEEKPGKRLVVENCGIYMNKMKNAGVVCNRI
FT                   TELNINSRKQVSTTKSDSSQMKDILSHGNDQAMEMHPAKRPLTSYSTYENQNKYFETKL
FT                   VPDMQGKMSICVGRKSGSATVNISIDEYDLGKTYSTWKKIFDKSSLQNKSNLVNNLFLT
FT                   VDEDADRSDKLPVIKNRNPPYANPDGPFEKERLDLPKQARDNLDRTLTPLDCADTNSLF
FT                   KKKNFHTYRDSFLLMRPHGEVLLDEVKGVRRTRFPWAHSNRLKHILSYSYAAGADAMNG
FT                   DTNYDHTNYDDKNYDHTNYDDKNYDDKNYDDMISSHASNDAPPHFGSHHVNGNREFAGE
FT                   GGCSSHCHTPNDASKDVFNQQGTCYRAPSLTEIE"
FT   CDS_pept        join(2110800..2110899,2111022..2113786)
FT                   /locus_tag="PKH_144710"
FT                   /product="SPX d0main containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144710"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144710"
FT                   /db_xref="GOA:A0A384L9W2"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L9W2"
FT                   /protein_id="CAQ42252.1"
FT                   /translation="MKFSKTLQERAHPKYREYYIAYKELKKAIRLITGKDTSTFTIKEV
FT                   TTNFGNTRGVSGAEYQSAESRFQNILNEELDKINNFTRKMIKEWYEDAQICLQKLQKGN
FT                   SVLDTPQIVKKLNHLGSTLMFLQSYRIINFTGFRKITKKFDKHNDKVVSSSFYITVVIK
FT                   SFFMAYDINLLVCILSLCYKHYREVRKVASVNISTGDNLEGKLTLHRGATTTQNLPPRP
FT                   PGEDHSREEHHEMESTSILYRKNRNRYSQSSESHTNASASAVSSSPKNNVHQLSNEENT
FT                   QKTIKHTKYIVKAQNLMNVKVEISKYYTFHYYDLKEHELIPPFEEFIELISTSKIQNDL
FT                   TTIYFDDSMFSRYHKYVNGSSENGRTSECIRLRSYRYIDAQKESTKTVIQHFNLFEPSS
FT                   DSNEKYVFAKDVPQKNLKIYCVNDLYNLRKGYTSSDSSHSVHGSDSLQLQNYEQCIHEV
FT                   EKNNLNACLKSKVNRIHFGDDNVSGYIDENICYWVYTDKGTIHGCDELDSVDGDNSELD
FT                   EPNKGKQHNPITSEGHHDTGEYKICNEEETTTKGRRKYAYFDYAVIDISVKQISNIDFS
FT                   FQLNNLGVVKEIWGYSSYLQGISMLYPHRISTAPHWRIYTHPDLAKLNGEENSIRGMKK
FT                   TKKEVVQVGISQNEAKKRKNKKIKSGNLQGKGSNKSLVSEEDNDTELSSSENTVEYTER
FT                   VEKNLNGKKDENKKGITYTGASARIAHESEVIFRNEIEKNKLTSTRHIHLNIGRLGSGD
FT                   YWNSGGDCIRAPYSGDCNNNPKMKSQEKEIQSTIRHTLAEDNNLYEPLLDPMEETPSKG
FT                   NKSSSCKISSFFKRIFFRKNNIVQIKRPKTAVVRVEPKTFFANERTLLQWLNTSVLLST
FT                   ISITLLNFSNSYGFASGVIMAPVAIFFILYSFYIYLKRAEALINKEPINYTDKVGPGVL
FT                   VITLTFALSTVVLLNIYSRLKGEV"
FT   CDS_pept        complement(join(2114187..2114348,2114731..2115384))
FT                   /locus_tag="PKH_144720"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144720"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144720"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KF56"
FT                   /protein_id="CAQ42253.1"
FT                   /translation="MEFSSYAGVSSERLASLRNLDIRRKSVYNGSNFSYGNNIYEVLHN
FT                   CCTEELKNEEDTIGIDPFGNRYAPKIGNRRDRNNCDYNYAGLRSEIKNSINVRNRRIKS
FT                   VLNIHGGESVKDTIQHNGGEEISNPKHFLSDKGYVLTPKRCLARHVDDSEIDKYFSTKY
FT                   AVTDKSSGRTEIMVERKPGCSNIIVQNFSEFDAYATYKRQDERKKDRDSFVHTKMGIVP
FT                   KDGTPTDDKKCKARALFTEVHRSDNIAPENYWLCPTVDSEKKKKKKIFA"
FT   CDS_pept        complement(join(2116838..2117148,2117291..2117417,
FT                   2117630..2117668,2117893..2117976,2118112..2118177))
FT                   /locus_tag="PKH_144730"
FT                   /product="Heat shock protein hslv, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144730"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144730"
FT                   /db_xref="GOA:A0A384L1U6"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1U6"
FT                   /protein_id="CAQ42254.1"
FT                   /translation="MFLRHLSGFIRVPPAISRTAQVRNYFAPTGRLLPPRHGTTILCVR
FT                   KNNEVCLIGDGMVSQGTMIVKGNAKKIRRLKDNILMGFAGATADCFTLLDKFETKIDEY
FT                   PNQLLRSCVELAKLWRTDRYLRHLEAVLIVADKDVLLEVTGNGDVLEPSGNVLGTGSGG
FT                   PYAIAAARALYDVENLSAKDIAYKAMNIAADMCCHTNNNFICETL"
FT   CDS_pept        complement(2119202..2120497)
FT                   /locus_tag="PKH_144740"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144740"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144740"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPE5"
FT                   /protein_id="CAQ42255.1"
FT                   /translation="MEQVKILALYDNNDLVLLNAENERCENKFEATVKDADKKICQLKN
FT                   GSFLLLSVNKKVVSKYVCTKSAPISTKHMRVQLNVIRLTNNEKIIIGGDKLGNVYVWSA
FT                   LSGLLLNSFQAHYGIVKDIIIDQIANVLYTYSDDNVVHVYNLPDLFRKKKINPLLRYQH
FT                   SINATITQILSITPNVYGSYYSLMTLTTNGTLHVWGLKSNEPTHILKTHSENCTYICTN
FT                   DPFNTHLYLCRENKIFRIPFSQFDQREEDSSAQVSQGVYHGERRAEEKLSAYGDYVEVK
FT                   NGEQNAEIHQVQRNTSRKCESKVNFQNCTTFVGHKSQVIKCHVNNKRENMISLARDGIK
FT                   IWDLFNCYAVKTLKYGENIIDFFIPFVGKQSINTSSYFMEFPHLLLECENDVKVHKVAP
FT                   DLCEGSSYDGPLADRDENLLLQMETMFAGLED"
FT   CDS_pept        join(2121814..2122049,2122220..2123114)
FT                   /locus_tag="PKH_144750"
FT                   /product="Sun-family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144750"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144750"
FT                   /db_xref="GOA:A0A384L5T0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L5T0"
FT                   /protein_id="CAQ42256.1"
FT                   /translation="MNSTRLRHIENALNSFNFMSPLDIYMRLYFKGNNIKNRDKPFISE
FT                   HVYNIMRNKTLLSYLSSPCPLYTNVIKTYFSSDKWKYEMNNEKIPAHVRYSFPKELYEQ
FT                   LVNCYGEKKSHTLMSILNEKAPVFLRVNTNKISRNDLYKLLMSKGVSVEKCVNSPQGLL
FT                   LTKSCILKNNYEYNKGYFEIQDEASQIVSLKIPVQPGYKVLDFCAGSGGKTLAFSPIMD
FT                   NTGKVYLHDIRDKMLSQAKVRLRRAGIHNYILLNSNHILLKKLVGYMDTVIVDAPCTGT
FT                   GALRRNPEMKYKYSNSNLYEYVNLQRQIFQQALLYVKKNGKIVYITCSILDAENVHQVK
FT                   YFCEKHNLFLSEPPFHSLPQSKSMDGFFLAIFERRD"
FT   CDS_pept        2124446..2126692
FT                   /locus_tag="PKH_144760"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144760"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144760"
FT                   /db_xref="GOA:A0A384LFR6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037363"
FT                   /db_xref="InterPro:IPR037596"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LFR6"
FT                   /protein_id="CAQ42257.1"
FT                   /translation="MNELVVFDSNHQKAINDCELDYYSKKLATCSSDNTVKIFDVSLSK
FT                   EPVCVAEMRDHSSAVWKVCWSHPKYGNLLASCSYDKSVIIYKEVQMNKYNIIYVNTEHN
FT                   SSVNYIEWSPHEYGLHLGCACSDGQISIISYDLVKGSNEEGQWNKYSVKAHLNGTACIS
FT                   WEKTHKNKHMNEGTTGASAVAAVSAAAGAGGGGDHPNTFQLASGGFDNQVIIWMFDNST
FT                   KEFHKVYQMKDKPHNSSIKDIAWRPNLNNSTNIIASCSDENIVILWVEDISNKQWRNGQ
FT                   VIQVQDKISKVCWSPNGTILAIACTNENAYLYREGLNGVWEEVCNLADNEKLHAQMEAQ
FT                   ENLIDNVGGISEGAGASTMPATTVGNTSTNQVDPYAGSYINNNPGTHSEPPNALNTVTT
FT                   QMNYGKPLPNNIGVNPVGAPNSSVSTPGMVRGSLNVPQTSNNNTPYGQSVTAPMTPGVM
FT                   PPPLKNNSTMSQQNVTPNYLIPSHKKTSTSSVTSNVSSYPMGGPPVGAAGLAPPPPPPV
FT                   AQDQGNAPYGGLNYSPPQVPTQQGGVSAPQFPAIPSPTNIPSVVPMGNKPSIPGPPPPP
FT                   GGPQQQAQQQAQQVQPHPPYQPHQPPFPGANSSTMNFAKPSSPMPPPQFQGANANKTNF
FT                   SAQQISPPPPPPPPFGSTPPQQGPPVPKGMNQTNTFSNFNPNVMTPHNAPPPMGTNPPG
FT                   PHLKNVPPPGNSYPPMNYSHPPPPPPNMMGGDPGAKPTPNAQYGAYPSYNPPPQ"
FT   CDS_pept        join(2128601..2128690,2128867..2130534)
FT                   /locus_tag="PKH_144770"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144770"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144770"
FT                   /db_xref="GOA:A0A384LJG8"
FT                   /db_xref="InterPro:IPR029732"
FT                   /db_xref="InterPro:IPR033757"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJG8"
FT                   /protein_id="CAQ42258.1"
FT                   /translation="MSQENPDVLFREERSELLEGSLSDHLSEFKKREHVYLACISSLEK
FT                   EICQTHTYLNEWRNMHMYEDEEGKAPKDDIVNINSLRNLLIDPSINLEIKELRQKIYEV
FT                   TRKWNLAEEKLQGFNFDAQATAGQRLISKCKKLQDENYELGKTLEENTLQPLSIQIINM
FT                   KEQMLFYKNELKILKELNADIDEDNELLSQQLGELSKKYTQISKEKASLEEKNLKLRNH
FT                   VNALQLKLKAQTHPQEGESLVDVDRHSRGASPRSASHRSGNRRSASHRSGNRRSASHRS
FT                   GSHLSRSSRTYGKYTTEHRHDTYSSRNTSPHNNPSDSRKVSQSNYEDNHRAGERYSKYR
FT                   QDDTHSNIRDEEEESGWREGYKRSDSHLRERKSNPDDDTRTYYNGENYRKRSSDESRER
FT                   KYRKMDRHHHRDRKSDREKEKEREKEKEREKHRLKDKERSRKERGREKDKDSERERDRD
FT                   RDKDRDRDRDRDRDRDKDRDRDRDRDRDRDRDRDRERDRERERDKGKDRTKTKEREKAK
FT                   SKHKSKNKEKGKSKGKRDENYDSSNYSEPKRRSTKDHGDDHRDHSNTSKNGDADDKADD
FT                   FDRYVYLHK"
FT   CDS_pept        2131761..2134352
FT                   /locus_tag="PKH_144780"
FT                   /product="protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144780"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144780"
FT                   /db_xref="GOA:A0A384KZ39"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZ39"
FT                   /protein_id="CAQ42259.1"
FT                   /translation="MKIRKGKIKTNEKDYNYGGEFESYVYSKEVSNDVKSSLIEGEKLS
FT                   NKFRNRGLTRDKRATVNTVLDNRTLLILKKLKDNLLNEIYGVVSSGKEAYVFNSHKYLS
FT                   EEELRGVKELLLGRKHGGCDDQHSDDQHSDDQLSDDQHSDGQNGHDQHSDHQHSDGQNG
FT                   HDQHSDHQHSDDRHSDDQHSDDQQDAGLPDVGDAHESLYKVYHLSRHFDEVGKEKREEW
FT                   EEAQGAMGAEEYEAEEHKAAEEDGDPNVRGVLDETYDIIDKMNEMAAEGDNHNWDPFQN
FT                   KKVAISFATKVYNTSVLVFKKRSQYIEGEFRFRNAYTKNTNPRKMVKQWSEKEFRNLRR
FT                   ILICGLRCPYPLVLKSNVIVMSMLGSLDTACPKMKDLILSPLKWKELYIECICILRQLF
FT                   CSCKLVHADFSEYNLLYFYNHIYIIDVSQSMEHDHPYSLEFLKRDCVNITNFFKKKIGT
FT                   LQNDMQESVGQLNGMLQGAKIHEEVTLKSRCGISREGEEDASDNKNGVNYTNCENGHTQ
FT                   KNSENPRDSKSSEPFYSHVQILPLKKLFDYIVSSSLPQDVTYFLERDKKEIHMDPSEIT
FT                   YLQIFGLIKNTTPIPKLNLRNIKKNRTYFEKLKRATGYYVTKYFAKNQSHIKKHADKSQ
FT                   VEEQIFLSSWIPSHLNEIKDIKTIEKDLKLLKKGKSMVSNFISNNHHTERSKHAPKNNT
FT                   FVEHNNLEGEKHSDAATEEKNRRTNGDCTLHAEKEEMAEGFTRTYTQKENLNDDDNGGD
FT                   PYEQVKETHKNGERGVLDGLSDKGSPKSIEKVEPSKNLLDEHKSDAANDENNFLNSEQE
FT                   EEVKFKGIIPEGVTRKEWSKLVKEQNREKRKHKIPKYQKKKKKKKAHLKKK"
FT   CDS_pept        join(2135737..2135745,2135906..2135965,2136101..2136220,
FT                   2136339..2136400,2136478..2136527,2136662..2136801,
FT                   2136904..2137276,2137485..2139466)
FT                   /locus_tag="PKH_144790"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144790"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144790"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCV1"
FT                   /protein_id="CAQ42260.1"
FT                   /translation="MAQFPLNHLGEANHRQSITQCVKENNGITKFFLKDLIKESSLKNA
FT                   ASVSDEKAEHERRNVQKDDKNQPFNVTYTWETDPISGFRFVNVLNKKDKKKLGIQCIYC
FT                   RDKKLFRFKRSVLYHMVTFDHGLKSSVMEELQVPSVVNVNLLHLNEKNADERSEFINNF
FT                   NEEKCAQRRAQSGSENFDRRGIGEEPERKHARKCCNNYELIKLEIEFVATLNLLTCEEL
FT                   KALFCFFFPEKIFSFSECTNKEIIIEHFLQNISSVSTKYSSLIKSGMCLAYDEPILNKD
FT                   TKYVTLQEYLNELKISREAQNSCIDEPNMEGEVVFHDINGKDREGTEGDIGGDGANMGS
FT                   DAADEMIAIEEILQISGNDEHGALGEREVEPMHKETNVANHVTCNIANERTDEDAANIT
FT                   KRRKTKKPKGLDASTGQLNPKNHILININDCDILKHNDKIFINLSSLREVKADAERKKE
FT                   NDAIIIVSGSGEAGQLSEVGTNKVCTNMVDRNDVDPTIADHTTEDANGNEIAHSAKKGS
FT                   SERINNSQTSEASAEGGNEKDVNPPLGISINRKAKRSRNKKDTNEKCTTQVGKRVPMGA
FT                   ENCKTQSSQPKKKIKVDDLQGGNSAQTILLSQDEQMKQHLEEGKAQTEECNSKETLLNE
FT                   SSNMNDRHDEEKAKNSNNNRTKEIYLQSSSNNSGTPSSFMDKEKEFNPNDELAHAINVE
FT                   DKDIHEMDYDTVYVNHSKLGEAHEKNTAPLDQGECIRKVVPLKGVAKMMTPKMINREEN
FT                   VKRKKTKHDDKRNEPKFCKKIKCPTRHNEINKNEETPSNSRKKKGNTLQLPERDKAENN
FT                   SSLRNSINLKGGKCVSNTGGNRAISCVKKNSIKGKILTKKRTHVGDTSHDGNNHLGEQK
FT                   SNASLHKQFNSVSVEGNNKRVSEKMLNKQLCNVSMDNIIQPDVMNLSRTRSCRLGRYDM
FT                   G"
FT   CDS_pept        join(2141015..2141063,2141192..2141330,2141558..2141641,
FT                   2141814..2142015,2142135..2142255,2142394..2142440)
FT                   /locus_tag="PKH_144800"
FT                   /product="rab2 gtpase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144800"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144800"
FT                   /db_xref="GOA:A0A384L487"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L487"
FT                   /protein_id="CAQ42261.1"
FT                   /translation="MSPYEYLFKYIIIGDTGVGKSCLLLQFTDKRFRADHDLTIGVEFG
FT                   ARLINLDNKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLNRWLDE
FT                   VRQNSNPHMAIILVGNKCDLERREVSAEEGAQFARQNGLIFLETSAKTAKNVEEAFIYT
FT                   ARKIYDNILEDVYDLSNESYGIKYGPTSQYSRVKLDMPSMPESRSSFGCC"
FT   CDS_pept        complement(2143342..2144490)
FT                   /locus_tag="PKH_144810"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144810"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144810"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KFC9"
FT                   /protein_id="CAQ42262.1"
FT                   /translation="MLWKQLSKVPNMLLGKRGLRKAALRFRTIKRALKLLLKLIRTGNI
FT                   HKLLNGVTTQIIKLWAKCVNNSNAIMKLCNEYYKISGLKVPICDFFFKNKMISTKMDKY
FT                   SIATPRCYKKRKNNGVTNKSRKSTHENICSSNSNDHYIIDLYNETHIQTPFNGSFLSKN
FT                   NDSTCESNCNSTQSSDCGGANENEDLKSNSYLDNDIPSLETLEYDEDEVNESIKNCYLY
FT                   NGYVNATTYKNSEEYKFLNHHLNEEKNKCADIAIDVSPQSYYDEQLEREKDKREACSLS
FT                   KQEEESDQTDAEIKHTQRKKRKRKNKIYEIYNSETTMTQNLYCENYLNENYSSSYDCSS
FT                   DYSDDDISANDFTDSDFDDNYFDDVFENDFMCNYSVYSYEAI"
FT   gap             2147935..2148034
FT                   /estimated_length=unknown
FT   CDS_pept        complement(<2148038..2150725)
FT                   /locus_tag="PKH_144820"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144820"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144820"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCV4"
FT                   /protein_id="CAQ42263.1"
FT                   /translation="MGSKDKDNLKLKYKILSTSSNDKDHDVTNLLKNTGGEIYKPWLSG
FT                   KNCIYPQEIILQIKSSKIKYLEFLSHEYSISKKIEIFVSNDNKDYLKAGFFRFNDNTST
FT                   SYCARELKYVYLPCTIKCTFIKLKLHNPYSNYLNTHAQVGLYYINIIPEDIPLKIMSEI
FT                   TPAFLKLTSLAYNRNEDYNDNMVNIKKVLLRKKGGNVHRSNISNNNVIDNFSDGETHRG
FT                   SFRRSYSKGDKNKINCLYEKLENKIKCFEELKGECVAKEEYNVASELKKIVNLFIFLKN
FT                   VITFLKEKKKKYVKEENYGKAKRLKEKEVKIKIIIKNIEELKIVDDCSRKWYYEWLSLY
FT                   YKELEFYEAEINKIMSTENIKIIKKKSGLLDQCNTKNYNGLDLKNVLLFISSDDEKKRE
FT                   LGFDLSYKPFEDHGKRNKNFWHNNIEPLCLIIKRGISDPCYNIFIKSVVTLEKMLLLFQ
FT                   DYFVKMDNIDTDKSNSKSAEYIKCIISALLKRLDDSNLDVVDICIKTIMMMLHNNFISF
FT                   KSVFSTILSMLFYLFSGDTTSQINEKIIVSLMSFYYSLINKYYASVKNDINLKKVLEII
FT                   SIFLEVDVEPIKQTSLDFFVNIYNRVENKNELFEEFLLNLSFDTKNLIINRVNQEEKEK
FT                   MKISIKDNNEKKEIENETPEKSCMFVNNDELLNKNYINNRHLKTQEITPCENNIKRVHE
FT                   TGNIRDNVMESNKREYYSTLVKNTDDSKQTDRHSKLTTVENSDLKKEICPSAIKELQEE
FT                   TENKQNEESEKPQYIDSIPGKETKTDFIPLSGLHKKNSIGEHAKHESISKVEQNNIVKK
FT                   EKAMDQGEYVEDSTRTDENNEADIPAFTCKYCFKTDESFTEIGLEKHWIKKCPMLCTCP
FT                   NCFLIVELVVIHDHFLSECSHSYMY"
FT   CDS_pept        complement(join(2152211..2152411,2152687..2158571,
FT                   2158821..2158989))
FT                   /locus_tag="PKH_144830"
FT                   /product="amino acid transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144830"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144830"
FT                   /db_xref="GOA:A0A384KUK8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KUK8"
FT                   /protein_id="CAQ42264.1"
FT                   /translation="MNIKWLPNISLNYKKKNGKQKFVRSRKRFRTITWKYTKTIGPFAS
FT                   FIYIFNQSIGSGLFDIPSLIDEVGWIPVIFGNLFVCSVAVFCSLMILRAMTMIPKNKNF
FT                   EQRIEYSAVIKYFMSNEKYKFVSFLYHLGNLCNNICGILVISKIVDMFIIKLFGSTILF
FT                   QVYPQIKVSKCSLSLLDSMYNGYYYSSTGHYETVVIGGVTIGYIINAIICIHLSSKGLE
FT                   ETINYQYVVFMIFMTSFLYLSVSSTIYLLSQNYMDQNGTLSKVDVYNNLILNRAHLETD
FT                   LVKNYRKYKEINHVPRNSQLCKADPFFDQCPVMDKLGRNTFSVETSENEKVVRRNHDLK
FT                   FFPREVQMGSLQRTGKAFSCSCLSLNPLYQKKAYVFRNNIFYFTVSSCSYRLNIKNAAS
FT                   LQHFYSVYKIYYSSKSSSGRVANQKRSQWGHTKKGGSKREERKNHIGGKFSGAHYPNMR
FT                   EEAQKQNQMFFTNLYYMISRIEGIKSYCMGKTFANFIDSYGFVSNIPSWGNEITDDVNV
FT                   SKAIWLTVIFSSIFYFIFGLIFCLNNSFQKINTSVLYLFNFVAVAPKVITGSISMRYDL
FT                   MNLDICSDNAAFFLGCIAPFLSAWIFSNSMIFSDAFNYTSLICGLFCNFLSPAFAYISA
FT                   CKRNKSFYKNPLRKYTIVNRKKTVFSNSSDIRKALGNIIDTFDDNDEARIVEDSNNEME
FT                   MEKDNYQLQCDDEGQEEEATLGYRRSLSLNRYASQRESNFSSISRSSYFKFVNGECLPK
FT                   SYSKDSTGHDSLSERNSSDFKLSNNYDSNIGICAHGDTTVEQPLRIKRDTKEGGGNDNS
FT                   SSCFGKKGNKKKKKKGVMFFDEIEECSSREIFKSKGVCNSGKNEGEEEDTLNSDRYTKG
FT                   SHSNDGDICGETKEMSFLTQLSPTNQTDDTWGIKNSSYEILEDVNIKKVKKVKKKLMFS
FT                   DEVQLCNEVDEAAEMKRKNSKGVRFIEESKEPTMEDAKKEKREIPFSLNVQFCTEEVNG
FT                   RENNQFSITVNDETVREKEGEQGGNMNPTVDTENMVEKRNSEGHKTILFEYENGEETES
FT                   VKSQKREPVLSSTKENEQQTGQISKKGCAGLHEPVLDNPVQESVNQTCSVQLSPRYEIR
FT                   IISNNACVGNAGEKAKQCSNNSGKNCEIDVGDQKEETVKHSENEHTSGADNIKLKEKEK
FT                   KGGNLLCVNFQEHIREETAATLSENINTKIENTIQYVRNFSDSAINYDAGDEMKRGELK
FT                   EDEVIRKNRSFEHHEQVFKRQREKLKSHYKYNISNVLEKIANYDDLIRGMDHIDRKEIN
FT                   GENFLMSTSNRFKEEKELGPSNRNILGMGSTNDKSFVEDTLVEEADDTLNKENTFISFE
FT                   KYDAVVIPNVLLDRTCESNSYIGKDRNGFKKVLFSEPIQEVQVNETGSFDHASTEGRAY
FT                   SIHLKKENSKDEEILIDNLKDLSEEQYLNKNSSQLGQSLDIRKMRDHIEEKSQSCHFDD
FT                   VLTTENSNNCEANVNMCKMNILINNTSYRDEQEALLKHSKSGALAGEKHHNMSVLSTEQ
FT                   GENTHNEQNSPSLRENKDDLLSFSFLNNFNKQKCASCEIISLPEHAAMPQRKMKTLYYE
FT                   EPSNEVDNGDEKLHKRSTLFVRQRKKLKSSFHANGDMIIGNHKEAIHKEQINEFRKQIS
FT                   KESCIFNYYDDEKCAEIAQGEACQMDKEKVDQVMTKNKVPENNEELEIPILHIMKSYES
FT                   QTATQNIDVEVKDSVKSKSTGDPRRKTCYKFADISKLISDIDLCEFESKENDMVNRGHH
FT                   NVGDNNEAIQGEDIADHFSTPTNDTNLESNKRVNFNEEKDTSTETEKPNVVKELQRIYS
FT                   ALSTKLHSEDSEMCTNDDHDYTDCVDFRCFKIIDNVSPVKHYYNAFRRSKILDLKKYDH
FT                   IYSNNFVIDDKTNMDHLCSIFLFGNPLERNEKYADNNNNCNNVDVGGEQKDAISDAQNE
FT                   WLNQQDKCDSTVTFEDKKENISSNSGLYEEKGFLIKRSFSGSLESHNEVLKRCIFEKSD
FT                   LSGSSILSRRKSNLKFSLNEEIINTEELNDIFRSNDIVGDMRKNSDKIEVMKIRIHVYP
FT                   ALLQKYHVETTYLLLGCLTAFSFVGIITDFLFG"
FT   CDS_pept        2161376..2161804
FT                   /locus_tag="PKH_144840"
FT                   /product="DIM1 protein homolog, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144840"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144840"
FT                   /db_xref="GOA:A0A384KZ28"
FT                   /db_xref="InterPro:IPR004123"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZ28"
FT                   /protein_id="CAQ42265.1"
FT                   /translation="MSFMLQHLNSGWAVDQAIINEEERLVCIRFGHDYDPDCMKMDELL
FT                   YKVAEDIKNFCVIYLVDITEVPEFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINW
FT                   PMNNKQEFIDIVETIFRGARKGRGLVISPKDYSTKYKY"
FT   CDS_pept        complement(2163417..2166599)
FT                   /locus_tag="PKH_144850"
FT                   /product="ATP-dependent RNA helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144850"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144850"
FT                   /db_xref="GOA:A0A384LLC0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LLC0"
FT                   /protein_id="CAQ42266.1"
FT                   /translation="MRMREKAEAHKRPIEFEDDETKKKIRTEDDESLKDEKIRENSLHP
FT                   LHLEHRKGRNKNLKNDAEYVELLKKDARRKYLKEREREKLDVTKKLLDDELLYSTIKLE
FT                   GKELKELELSKRIYDIAKENIKLREKLKENYYLFQEDLDKFDATNKGTDVDATQVREGK
FT                   GDPSAYNYDEQIINKGILKFGSGGAVSAGLKNDFVFEDDLANRKSIKREESEEKRKYER
FT                   EKEKKKRKKEKERSDSGSAVDSGSGRGRKHRGEKKRIDKSANSSGRTHTYRGLHKGRSE
FT                   HRERDDRGVQEVCEEESRTRETSSRGKKRKKGSEHGGEHSGDGDDRKRNENGLTDVVEF
FT                   VHLDSFYGMDEKERELQRLFEDIKRKKEKKMKKIIDDRKRLPIFSYRYDILKAIKNNKI
FT                   LILVGETGSGKSTQLTQYLHECKYHLYGNIVCTQPRRIACIAIANRVADEMNVKVGKEV
FT                   GYVIRFQNKTSESTKIVYMTDGMFLRLLLYNPTLDDISVLIIDEAHERALHTDVILPIV
FT                   KDICNFREDIRIIISSATLDAEKISTYFNCAPIFYVPGRKYNVDIYYTINNESNYLSAI
FT                   VITILQIHVTQEKGDILVFLPGQFEIELVQQELENKLIELAPRFRNMIILPIYSSLPVE
FT                   QQARIFEDVADEDHGKGDAPDSGNPGAEQPDGASSTNTNIQTNELAPADQPKAIMRRGT
FT                   RKIILSTNICETSITIDNIVYVIDSGLCKQKVYNPNSGIESLVTLPCSKASVNQRTGRA
FT                   GRKQDGKCFRLFTKKSFIDLNDNSVPEIQRCEVSSMILLLKSLGMDDIINFDFLDPPSP
FT                   VVIIKGLELLYSLGALNDEGNLTKTGRKMAEFPTDVKSSKMILAASEKYNCVEEILCIT
FT                   AMLTHANNIFYVQKGKEKEAENVKKMFTIEGGGDFLLLLNIYKQCEENNFSTSFCYDHF
FT                   LQYHTMIKIKDIKTQLVSICEKIDLPSSSCGIQNHDAICNLKKCIVSAFFTNAALPVNK
FT                   NELKIIKLNQVVSIYPSSVLAKKNIMEEHKNACIIFYEVIKINKSYIRHNIPVTKDMLY
FT                   EIASFYFLSKIA"
FT   CDS_pept        complement(join(2168673..2168742,2169143..2169276))
FT                   /locus_tag="PKH_144860"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144860"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144860"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KR71"
FT                   /protein_id="CAQ42267.1"
FT                   /translation="MLLNLNTGIFPLIGISWRERFIPVLFTPFHYLRPRKQTQRVDRCR
FT                   TKKQYKNRRHFRGYYYRWMGSY"
FT   CDS_pept        complement(join(2170472..2170870,2171120..2171776,
FT                   2172058..>2172705))
FT                   /locus_tag="PKH_144870"
FT                   /product="SICA antigen (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144870"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144870"
FT                   /db_xref="InterPro:IPR024285"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCV9"
FT                   /protein_id="CAQ42268.1"
FT                   /translation="DEIKVVLEGELKELLKEMNDDQKQTTVATYCNNVSSSSKNDTPGE
FT                   ITAKQKACKLFASGLKHISEIKDDSSKDDGPLKRTMMCAALNLYADQLISKSTEQCPLD
FT                   KNKMEEAIDYAFKNSNATKNSGSSCTTQGPNFCFECKRQKSFPDCRIGNNPKDKVKERM
FT                   NELLEQNKDETKMEQTLDKINSKDTFCTELQCAIIKKVKSTGKKLQNGTRPSWSDIDED
FT                   AKGELSKLLGHMLQSKKQEEVIQYCNDDSKWNTLRNKEKQTNKAACLLFASGLKHIYNQ
FT                   HKGSVKGPVNGPSFAQTMGCLFLKEYAKQLKELANKEKKYNVHPDCSVGSGIEHAFSNS
FT                   NAIMESVLTQCKNNASINDCFVCTQNNDYNNCKIGDDNIGSKSKELFTEPNSKKHMQET
FT                   LENTVCPILLTDILTPFLPLAPVSIGLSAMAYYLWKYFGPLGKGGRRFKRSPAQASRPS
FT                   VQEQVLDHVEEAGPHEYRLVKERKPRSAPTRTKRSGGVNRRTIIEIHFEVLDECQKGDT
FT                   QLNQKDFLELLIQEFMGSELMEEEQVPKEEVLMESVPMERVPNLGSGFMV"
FT   gap             2172737..2172836
FT                   /estimated_length=unknown
FT   CDS_pept        complement(join(2175486..2175914,2176153..2176812,
FT                   2177246..2177959,2178867..2179520,2180205..2180834,
FT                   2181162..2181271,2182361..2182883,2183052..2183140,
FT                   2185425..2185944,2186203..2186805,2186939..2187036,
FT                   2192915..2193725,2193833..2193940))
FT                   /locus_tag="PKH_144880"
FT                   /product="SICA antigen"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144880"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144880"
FT                   /db_xref="InterPro:IPR024285"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="InterPro:IPR024290"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCW0"
FT                   /protein_id="CAQ42269.1"
FT                   /translation="MAPTAAAQGGGTTSMFQEWLQHLSSNGKLNANENITEQLKENLMT
FT                   TWADLQSRLKATEPQEVKELCAKVGKLVNHGGNEKDHYLKNICKAIVIIKYFISGVDAK
FT                   WDAGKDSIRKEVLTTEKAYPRCIVGAVAMSELYGDHCKLKEVIEEIESAVNDKLEDHLK
FT                   KDGKNLQDQLNNCTGVDLNALLIGKAILGDTIKNWKQEERVKGKQGNGEWKAWVPWVYW
FT                   QIVCGSEKDHTKLQQQKEKNKEVLTEFSGMDKANTELMNELMSEKEILTLEDVRKVLET
FT                   SIENGKPLEVTNLMNKLDGTIKQKQAEVCMKQDGNSLCDRLKCAKDHWKLTDGKGQPEK
FT                   DFWNNSVQVKLTSLFSDAITSSIGTPANHCDNAQDLDTANKAACNHITALLSKMNTTTN
FT                   GTNQLSEQIIKCALLNAYAKKLKDEAKEKGYCDIDKGLQEAFSKSSTIMQSASSQCNKD
FT                   TNGPNSCFQCNWNNNDELKNCRIDNGSSPKEEVKEKVELLLKDNPQTKQEQIQQTVTEM
FT                   HNKSTLCERVKCALNWYEKKNGHTEMWKKVEEEVVQPLGQAMSSTAAYGGTHCDHLDNK
FT                   NKEMCLLFAKGLHHMYKETNDSGNDATKLFKRTMMCAALNAYAKKLKDDAARKNGKGSC
FT                   DISGGIDHAFGKGKDIMGSAAAQCQTGNSAHCFECTQDQSLENCSINTSGGETQEVKDK
FT                   LTTFLNEEDTGLKESLDKICLPCLDKENLCERAECVIGRWKANGNSHPTSDPWDDVKNE
FT                   LKSLSEEIQTNKGSVSNHCTDLDGDNKEACLLIASGLKSIYEIKAGQGTGKTTRKELED
FT                   QLFKRTMRCVLLNAFADKLEKLPCADEKNVKDAITKAFNDKNKDIKNASDVCKNDGDKC
FT                   FKCERYESLASCLIGENSNKEKVKGKVEPMLEKYDTLKKESLEKTICKPCTGEGKKDFC
FT                   QELNCVVDKWGERKNGSSSGTTTWENMKSDFETELKLLLEDMKGKQTDVAKYCKGNGSA
FT                   GWEDGAAGEANKKACLLTAAGLHHISNIQLEYNDKANPGKGHDNNPYDNQEFKQFASCL
FT                   MLKAVAQKMKEESKICDIDQGIRVAFLKAKDIKKEFCKNNKPCIVCKLEDNYDTCTIGN
FT                   SNVKNKLESLLTDNEHKDNVNNTLSTITKTEGNVGTLCQRLQCLASRVQLTKGKYSADD
FT                   FWGKEGGEVANLWKELAQAMTDNGGQDKGGQCGTMDDGSAPGGAANGRPATDPEKKACN
FT                   YLYAGLKALYTTTASPSSSTGNNGILSQHPSLGQTMGCLLLKEYAKKMQSTSTCVIDSG
FT                   LKRAFDTAGQGSNGVQCKWNEADYDDCQISTTKASGPTTPTPVKDKLDQVKIKIDGTAT
FT                   DNLTEVNKMNNLCDYIRCAAPKWFKNKATAKGGNSNQTWCDFWEREGVRPKLEDMFKGI
FT                   ESDGKNKPNTTICQQFGDDNPHSVERKACNHITAGLEHIKTLSGSGVGVNDNQLLDRAV
FT                   GCIALNMYADKIIEESNKFCPIDEERINLMFKKWNEKNKLPSSCSTGSGNNNVCFECTR
FT                   HKDFNNCKLSVDKNLIKTTQSGASGTCTSNATEVKTQMGGLLNNEDKSDPNSIKSNITT
FT                   TLSFITEMTSSFCTQVQCAIKKRLKIKNGQATSSGTITQPWKNIEEDATKELTKLLEHM
FT                   MQPSEQKDVDKYCKDNEDKWNKIGHKEGKTNKAACLLFASGLKHIYTRGKGQVNGSVNG
FT                   PSFAQTMGCLFLKEYAKQFQKMAEVKKQGNSWVHPLCDIDKGIKHAFDKSGEIMNDTSP
FT                   CKNNGPNSCFVCTQNGSYKDCSIGNESVKDNVGTIFQDDQKQKHMQQTLENTVCPILLT
FT                   DLLTPFLPLAPVSIGLSAMAYYLWKYFGPLGKGGARFRRSPAEIRGPSVQEQVLDHVQQ
FT                   DSSHEYRLVKERKPRSAPTRTKRSGPVNRRTIIEIHFEVLDECQKGDTQLNQKDFLELL
FT                   VQEFMGSEFMEEEQVPKEDVLMEPVPMELVPIEEVPMERVPSLGSGLLV"
FT   CDS_pept        2206204..2211930
FT                   /locus_tag="PKH_144890"
FT                   /product="asparagine-rich protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144890"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L7K5"
FT                   /protein_id="CAQ42270.1"
FT                   /translation="MEEIRQEVNAREDDECVKKLPPGKSSNDGAAVNGKGGKGNSRCNG
FT                   GSGGTAAAGTSGGAGAYLFSLIDRFNSLKKAEQKVGENRSGNFKKPDECNSTDENGDMK
FT                   KGTDHASHDGDVKEGGEADPVAKSESSSGKKVVNKETKEGVEEEEGSEETDETGEIAQC
FT                   VAQSCDQKNPQDEIDEGASEPVSCNSAKKAISKDAREDKEEPSNTSNSVKEGDDNTSND
FT                   NGSSRASSPSDRDASERVFSDRERGSCNGDSLRKSSCDGELTKVQELIKQIKKNEELYN
FT                   AELNGDLFFLYDELYHTLLDRLECTNVKNREMKKLVKREIEKFKENHSILSEYLKRCEH
FT                   EVKATLVSWASNVGEQTGKHVGNESGEKLGKQPGEKSDEQSRQESEKSQQAPPKQLDEG
FT                   KLNQVKKSFYEYVEQKLNNDNYDGSVLEENLLHNRNMSLLFLLFCQKHIIYFVEEIFST
FT                   MCPIVEEDENCKNQMSLLLKRLNCMNSILHFLTTTNERNGDVDSAVQIAGNNSGCMRQL
FT                   YSDKAFKSDMMLCLNGVSTQMKMDLMEKNDYMDVKREAEELGEKGDVHTPLHEQSHSDD
FT                   LQRHQQELNSKTNFSSLSNGSNKTSKINKPSLNKKTYNYFRKDMNETQVSLSTCLTDTS
FT                   AVDKKMRDKNVKNKVMSNENGSSSVVTPSDKEGASSKKAPYENTGSGSANGSGNGSRSG
FT                   KNTQGNGATNDYFSDMMVYISWVPKSARCQYPLELPKNSAERNKLAEYIEAKEQMLYIL
FT                   KLMGYEEIDNIYFHPPKGSHIKIKFKTLACMNKFLKAYKNTPDKWKEDMFNFFNIPLRS
FT                   SISVRDLRIERAVPRSSAAEFKKIKKMTKNYQDLFLFKDNYNLCEDGNNSTSKMEKVNL
FT                   QYDAFNKHIIVHNNSGGTTAATSAVASAAASVSGGPTAAGTVGMVVTGHSQQHYNGSTQ
FT                   YSLKKNADQGKSISKMKGLMGSMGGELSPGVMHSVGGSASPLDDLHNGNMSLGVDSTST
FT                   ASYGALASFSGYGGGVSTGTTNIMGGAGTSSSYLNSAGNGMNSGAHAHHPFSGHNNSSN
FT                   TTTTTTTTALMMSNGMLNKVSGSTGNALHGVYIGGKNSGSNVGDEGRTFLSGTHMGSGF
FT                   MSGMSGVGSSVNGHYGSYVGSNLGTHLGTHLNSDTFNHYSSARMHSGGLSNKGGSGKQS
FT                   YPVNHTNTMCMPRSSSKNLYFMKSAKNVNNKANCVGMGSSGSGGDVVGGSFLSSSKIFG
FT                   SGNSSNNNSIHVMNKDFLTNGSYTLKKQTHYASFSNNSNGNMNSLNDHLYAFNSSVGST
FT                   TNVNELSNVNGAHGINGGTIGSSGIGSHHYGNSSSLIGNTIQNNTENSNNNNSNNNSTR
FT                   GAQNRTTNLNHFSTSSAHLDAATFTKEKNYLRGFKSSYMGMGSFGGGSVYSENNLNNSC
FT                   SNSCSNSIINNRDGLMGFSHGRVGGEESLKSHNVSGNESGSGNCHSNKYGSDLASQKYG
FT                   TQNDDMKEDFKNLINIDFINDIDMDFEEKNNDHMSVNNASDHNSGNVYKGFHHLNNRNT
FT                   DNGKRFNALGNCMSEGLLSGNATCMENHPGSSGIKASAFEKFDKFEGYGKYDRYDKIDG
FT                   YKKYENYENYENYDKYENYDKHDRYDKHDRYDKHDRYDKFERYEKLPFEDMNHERSYRM
FT                   SGEGDEEEEDYVAEDAEVDNFNDEMNVEENGFAHSNVSISNNRKVGNAFGVDVDDDSGM
FT                   MLSEEFNNYFCEENPKTLYNYYGSSNGGGLGGGMRAPHTTSTATTGNKSSLHLNLSTSG
FT                   NSAHNGSSAILGEATLSNNYSGVMEPSENGLLTSAANGLANSSGNSTTNSVANTGLINT
FT                   TSSLYRNTMTPKLYIDGIAMNSTFGKYDEGHFCDVNKEDNKLRGTGGAGSAGVADYDLK
FT                   MSEEDANKSFLSYSFQSSRVDNEQSFSDNYVNFF"
FT   CDS_pept        2213786..2216869
FT                   /locus_tag="PKH_144900"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144900"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144900"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LD24"
FT                   /protein_id="CAQ42271.1"
FT                   /translation="MLDERERNLQRYALHLEKKDLVFKGKKKKNDLKNILYFPSLYWFN
FT                   GQFCPPIPYFSFERHEGGKEEVGNPHLEDEKKKRAFRVNMVDLLTCGVHKNSVIVKRVV
FT                   KNEVLNVSMFSNMKVVSCVFYVNIEYLMGLDAFFGTKTNPFFFCLSLATLGTEDQGTGE
FT                   TQPENKRRAHEAAKGGKRSDGGAKIESLSPLNLHPPLLSCDIRNALDMAPRQLFLYNEK
FT                   KEIHLFDYVTNKSLLITREKIQVTALQFSFLHISEYNNLYNKMETDMYEGGIRIVDLDK
FT                   VGKQLWSKNRYCFEVLEEWLSGEKGRKNQPNEEEAPCGECGVHKILGRMFYVLIYGDSE
FT                   GNVYFLIPEKEVKMIKNFRRGKKIQLIETNVKAYFNTGGESRIATVLRSNVNVFLAYRD
FT                   CILVFNFPLYEPLFVVNVADEVIFCLSACLNEHGEVYFAFSTQRCVRIGEVSRGGDVFR
FT                   VEVDTTQVDNTKEYPPQGSITQVQHSANRPHISKQQKSHICVCFGRENDLYITSGDKGT
FT                   IHRYNLKKKQMTHKYDPRCKRIFHLSMCTVNGEDYAYIYDAEKFLCLFQLTKQKNVYKV
FT                   FTLSVWVYQILCLRTNIIFSLGNENVYSLEVKKEGNNNVTVNNVTVNNGTVNNGIVNNS
FT                   TVSQRNGNLFLTKPFYSDRMSVCTYMTNHPYLPFVAFLNKKLQFGFFSLVDSQRKSVIV
FT                   PPIRENGNVFSLCWFSTRKQLDILNFQGGGEDLTVGDPLTLNQFKDEWTGGIIQNRGYK
FT                   NKKKDDNIWINAHMAHLMQNSSYDTYLVVLNADTLFLYNILTSQVIDLKDYLKKAMPQF
FT                   DGKNNFLKSTIYGKVCYVFIFSEKNKLFIFDQNFTFCLRTISVDDRIVRFYLRDGYLFI
FT                   HSNTSIYFTSLRNALSLFPDVVQGGDAHAENLLFIKVNTAETFKIVLFDFLCVGEEMYL
FT                   AVFTKRKEILVYRMRMGVDDNKEDDTVKGTENGRSAEAQLVGQFLSFYKFEHLNKVGSI
FT                   LSMKFFYCCTKRRTYLIFGGLEQFLFFWDFAKYPLVRR"
FT   CDS_pept        complement(join(2217034..2217123,2217236..2218837))
FT                   /locus_tag="PKH_144910"
FT                   /product="phenylalanyl-trna synthetase alpha
FT                   chain,putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144910"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144910"
FT                   /db_xref="GOA:A0A384KY48"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004530"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KY48"
FT                   /protein_id="CAQ42272.1"
FT                   /translation="MLLFFALYTFLIAAFFTQLRRCYSGLNPPHHCISNFTLSKLSNSS
FT                   YHVKNDIINYGRFKYVYTIKNHPIHHVTTRILDHLKRESSFWLVYNKCPLYQSNLCFND
FT                   ILIKNTNDTTSVRNNFYFSDSLLYIPQATSLFPHVYHLLRGGQKGRHIPHCEETPNGDI
FT                   STNQTVIQNECTVEEETEEAVSRLPLREHCQNGGIERTTKGSEQTVEGKCHNALPQLHG
FT                   GTENLLIISNVFRKDNIDKLHFPFFNQMDIYIKIKNELIEKKKQLLYFLCSMLNSIFGK
FT                   THKWRIKKDSFDFTTDSLQAEVYHNGKWVEILGCGILKRKILFRKWKQYDVGDYLAIGL
FT                   GLDRIAMIMWEVNRIRDLYLYITNTWGNTLITKKMNKEGGAKSTIGNVIEHGDIRGGDT
FT                   HANVSVQTNGSTVRKEPADDENILVDSPKLEGTHLRNALLNLLSRKRDLNRPMSDSFLY
FT                   FLNLYNIRHEERDISFYVNSEWDTERFTKTVLHSTTPVGSSPMLRGIILLDVFTHEGSG
FT                   RTSYTYKFLYAAPASIRDQQTFKGLVKEEHERLVRKIVRMYNVSIR"
FT   CDS_pept        complement(join(2219770..2220885,2221380..2222399))
FT                   /locus_tag="PKH_144920"
FT                   /product="chaperonin cpn60, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144920"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144920"
FT                   /db_xref="GOA:A0A384L8E6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L8E6"
FT                   /protein_id="CAQ42273.1"
FT                   /translation="MKVKPAVVLLIVALLGCLLKCGHSVKRKRGICGKRRGLLNRRLKY
FT                   INSKLISRRKENYVKVKMTENKVKGKDIIYGNECRNELLRGILTVSDVVKLTLGPRGRN
FT                   VLLEKEYGSPLIINDGVTIAKNISLKDRKKNNGVKLMQESTNISNDKAGDGTSSTALMT
FT                   ATITSKGIEEVNKNHNPIPIQRGIQVASKMIIEKIKSLSTPIKTYKDILNIATIASNND
FT                   THMGSIIANAYDKLGKNAAIILDDNADINDKLEFTEGYNFDRGIINPYLLYNENKDHIE
FT                   YNNVSTLITDQNIDNIQSILPILEIFAKNKQPLCIIADDFSNEVLQTLIINKLKGAIKV
FT                   VPIRAPSFGDRRKDYLKDLCIVTNSKYISADVGLDLNNLHNNMSSFDNNYLTLLGSANT
FT                   LIVKKDRTSLITKEEYKNQIDDRIKVLKKELEETTSKYDKEKLNERIAALSGGIAKILI
FT                   GGNTETEQKERKFKYEDATNAVKSAIDIGYVPGGGVTYLEIIKSNFINEIHKKIEEDLQ
FT                   NTANQEDKKYLDLVGNLESEMELRKMGANIVVSSLDVITKQIADNAGVNGENVVKIILN
FT                   SKDKYGFGYDVNTNKFVNMVENGIIDSTNVIISVIKNSCSIASMVLTTECMMVDSEKKD
FT                   KGILDSSINSPNYLQKHRRAGGYSRKLDHMDDDEDEDDLDDEDDEEDEEDEEEDDEDED
FT                   EDGDEEEDEDDGYNYDE"
FT   CDS_pept        join(2224755..2224828,2224979..2226446)
FT                   /locus_tag="PKH_144930"
FT                   /product="lipoamide dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144930"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144930"
FT                   /db_xref="GOA:A0A384L8T3"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L8T3"
FT                   /protein_id="CAQ42274.1"
FT                   /translation="MNAVVSGTRRVVFFPGRRHFSSKKDYDVIVIGGGPGGYVCSIRCA
FT                   QNKLNVLNVNEDKKLGGTCLNRGCIPSKSLLHIAHNYYEAKNKFKQMGIIVDNVQLDVE
FT                   TLHKHKNKCMGNLADGITYLYKKNKVNHIIGHGSIVDGNSVLVNSEGKEKLVTAERIVI
FT                   ATGSKPIEIPLKKLNDDNVKEAETVVDLLQYDHQMIQTSDDILNFKKIPKKISIIGGGV
FT                   IGLEIGSVFAKMGSEVIIFEYNNRLCSFLDADVSRVLQKTLEKIKIKFAFNTSVIGGNV
FT                   ENEQATIFAQNTKTKEIQKVTSDVVLVCVGRRPNFDNLNLDKVNIELGKNKKIQVDESF
FT                   GVISHPTIKAIGDAIDGPMLAHKAEEEGYILANILLSELKLNKPKKSHINYDLVPSVIY
FT                   THPEVASVGLNEEKCKQMNLSFKAVTFPFAANSRSRTIDDFDGLIKLLVENETNKILGS
FT                   QIVGNNASDLILPLSIYVGSGGSSKSLSKIIYAHPTFSEVIKEVALQSFDKAIHM"
FT   CDS_pept        join(2227624..2227777,2227902..2228137,2228480..2228572)
FT                   /locus_tag="PKH_144940"
FT                   /product="Cytochrome b5, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144940"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144940"
FT                   /db_xref="GOA:A0A384KZN8"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZN8"
FT                   /protein_id="CAQ42275.1"
FT                   /translation="MATKKLKVIGDKDLQKLKKESKCCIIINDLVYDVTAFLEHPGGFD
FT                   VLKEHDGKDATEAFQQIGHSPSAKKLMKKFLIGIQKNSTLYNKKAATKMVKGKEEFVDY
FT                   SEEETKEETEAKEGADANGKTSKKEKLPEEEKVNYPLVASAILLFSITYYFLFLKK"
FT   CDS_pept        complement(2228842..2229891)
FT                   /locus_tag="PKH_144950"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144950"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144950"
FT                   /db_xref="InterPro:IPR007590"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KVK0"
FT                   /protein_id="CAQ42276.1"
FT                   /translation="MLSLKASRADNFYYGSVEDERTKKKKEEEKKKKNKKDYNEIKFEV
FT                   PYTIICTKCKSYVYKGERFNSERRQVGFYLSTPFYSFTFTCKKCPNVIVFETNPKDCSY
FT                   DIIQGARKKNEQFENVLTEQGRNNVNSIDFEKNKKKKINPFLLLEAEALRKKGREGEQA
FT                   NRQGAEQDTPSGERPLGSDDTSHDELPTDHSSGGELPNEEQSNGEDDPPSEEYMNDVIK
FT                   QNYRRNHIMKNDFSCNSNLRKQLRDIKRAKIQELQERKRKNLFIDIVEGDPLEEVLVKK
FT                   YVRYGEKLRRGRGTQGKDTQREGILASGNHSKDRPGIDPPIKRKLAKSNLIKKKKSSIF
FT                   DQKYLKKGK"
FT   CDS_pept        complement(join(2231673..2234092,2234242..2234521))
FT                   /locus_tag="PKH_144960"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144960"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144960"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L342"
FT                   /protein_id="CAQ42277.1"
FT                   /translation="MREGNDGHLLIGISSDAFFNILKFLTLNETLKLKLVCRHFREYIK
FT                   DEKAFFQNEWICLNNYIRFVRLVHPEKFGSFLVSLLSDEQNVYASPLSARQDLQFGITK
FT                   KQLLLCDKPFLKKITLKGDFLRNTNLYDISQVLRAHESTLQELHIHGLNDVNCPLFIYS
FT                   HHDILFDFLSKEVLMNNLSVQRLKKSSLKHIQNLLLQRNGGEATSARLERPPLGKSSAG
FT                   ESPTGELPTGELPTEELPTGELPTEELPTGELPTEELPTGELPTEESSAEESPAEESPA
FT                   GESSRMSSPRMSSRAEEESSHDGPTERVPIGRDKKVHLLCEHIGVVYNLRKRCFEKIQN
FT                   YKPKLHLSNYISSLSCLEVMNLSGIQSYDMIEMMISVQLPSLKTLNISCYDYFFYFYHM
FT                   VVSICLYGSGKEVFSRYLDLKNMELNREKNERKRSEWYERNKEMRQLIKETDEEVIQVN
FT                   KISTACQKRYEEDVINYYALNVSRNDKKIFFTPTYKDRICMRGINRPVHYADGSYICHD
FT                   SDGEPDRQNSRRDDEGVPPKARHDQHDQHDQHDLHNLHRQHTHMDQLSQHAEAPREDSP
FT                   CSTLRSVGSSDDSPYSTLRSVGSEASVESDQRSEYRTEEKASPKGTPASVPARAREPPC
FT                   QPTSRHTVTRVTEGKLKKLKRGGYIWLVENQKHKKNISIEMLYLCKNIIEKEEKKGRKN
FT                   IICLMNNLNVEHFSLFNYGLSSPFLWLLLLIRCEKIKTLSILDLCLSHLLSALTFLEAY
FT                   LKQHLFNFQGMMRRRRKRLGSIYFRFNDEEDINFINRMYSRIINELNLSNFGPRKNRVL
FT                   HIVIYVYNNKKENKQFVKYIRKISRSLWRCNYVVHYSIQYYKYKYFNRYFDIDNLYRDY
FT                   VMNVLLTHHKLNQRLISRRALLPRQDRP"
FT   CDS_pept        2235266..2236288
FT                   /locus_tag="PKH_144970"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144970"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144970"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KDJ4"
FT                   /protein_id="CAQ42278.1"
FT                   /translation="MAQRPRIIWRLSSCAQLGYRLIQEPMPKGKKKIFSFFRSGIHTNS
FT                   EGYQVLLKEEKKKSDDCSVTFVESGRDDHQDGLVNAQGKAIGGLHMDRDSFCPYLTKRK
FT                   TALKFFPYHVKEYQEGMLYKQSDGSEKAFLYSTKIKKCQYSDRISSNLYVSCFSAGDDG
FT                   GRVCRKSLFDILFRKFSLLYLFTDTSHVHEVKKYLADFARQKGEHGKHTPHTHHQISII
FT                   EDGKFLKLRDRQQPIELYYCYVSPYRYLLSTYFSKKIAQDLKANYFNGNNFFFINDRLR
FT                   TDVEDTLLLPGSRTVSSFTPHDTLPSLLLVDDFCYVRYHIKGLFTREASHYLYNVMKGI
FT                   "
FT   CDS_pept        join(2237235..2237486,2237590..2237688,2237868..2237974,
FT                   2238136..2238196)
FT                   /locus_tag="PKH_144980"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144980"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144980"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCX0"
FT                   /protein_id="CAQ42279.1"
FT                   /translation="MCYLKRSLSKSVNSLVLHFEFVKCKNLARYRKKGKYYMIISYDNL
FT                   LFYEKDFYQVQFQIFFADIRQIYMCDESNYVHVTLKEGAAINDIGIKGINKSILVKQLC
FT                   VAYSTYYMFNLNMNIYMPITNETYEERCRRTGHHSQTRKVDLSVQPFIGYRKVVFDEYF
FT                   FFIHKSFQS"
FT   CDS_pept        join(2239096..2239137,2239340..2239394,2239545..2239616,
FT                   2239791..2239875,2240146..2240233,2240376..2240457,
FT                   2240618..2240701,2240800..2240904,2241034..2241098,
FT                   2241210..2242412)
FT                   /locus_tag="PKH_144990"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_144990"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_144990"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCX1"
FT                   /protein_id="CAQ42280.1"
FT                   /translation="MNLSDDLAKWSGYEVYLKNETHTIVCIILRRTFIPPLLDKCQDIF
FT                   VTFKISHQSQQEFNVTDKDLYAEVYVVANSITPNDIHNTFYANLIQVQVDALLYNPEVY
FT                   GYFESTLKIKPSYFDHLKIFFKSMLIILKEGDVVISSEVIDFLGEDTKVEKNLEYLLNV
FT                   ILNQIPGVNLLDTHRSEKIKINRILHRLSDYLIYCLDSGFLSEKFNVTDLIKGAIIINA
FT                   DSMLAMKDMMNFLLHLRKRDYSVGYRKDCLELLREEENTPVEGPTSTQSLGMGNTKAAI
FT                   PVAARTKIERLLDSEDHSVSDFLLFHLHQCGYINRHCRYKHDTSYKQIIACILKYGVNM
FT                   KIKKKILKKLLIFSNDYKNKYDSSLISAIIYFLASLCEEKKKKKKKNSIVLILSILINI
FT                   TNNNDETKNILIHFGIHKICNLLILSNDCDVVEKIVLLYINLSKSKWMCEGIVNSGILL
FT                   HMIDILFNTYSINLRSKKEICINILCVIGQVCNYCKTYAQFLFSHYVEILTVGICIYQS
FT                   TDIQQFEKVKLIYFFKKMLMHSYEMKEQICLQLSPLIIMEIHSASEDRDFIYSSLSLFD
FT                   AMSCYKVNCQHMERMQIIPLLQFVKTLNVVELYKRAERIETTISKNGQLL"
FT   CDS_pept        complement(2242956..2243249)
FT                   /locus_tag="PKH_145000"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145000"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145000"
FT                   /db_xref="GOA:B3LCX2"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCX2"
FT                   /protein_id="CAQ42281.1"
FT                   /translation="MIRLICACRFKKSSAFATSMSLLKRIKVSSLKDGIIKKSICEAQG
FT                   KVTVDDALQYFTKSELFFLFVVPFTFASAYIVAMWTLFKYICDIRDVRPRGE"
FT   CDS_pept        complement(join(2243699..2243776,2243940..2244117,
FT                   2244281..2244346,2244451..2244499,2244588..2244634,
FT                   2244736..2244825,2244989..2245306,2245573..2246273))
FT                   /locus_tag="PKH_145010"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145010"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145010"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCX3"
FT                   /protein_id="CAQ42282.1"
FT                   /translation="MESFLRGIHSNVYLKGRYHWKSTLSSKGERKKFCCYHLRKSVSRE
FT                   EVPPFNDAGQGAKHPHCQLPSNENDPTWYHNVGVNVEERGRTVSPTTKKFREKLFREKW
FT                   LHEIRLREKWLEDKRSGGYFSKEKRNAWHGIPSSCHFTPCSSRFPPSGRLFTSFQSGPQ
FT                   PKHKHNQIVLTDQFINRENLKKEISDTHKKLTADSFIDKRKEEIYFLLKSAIMPNLKGK
FT                   IYFIGSCENHIWIKNSDIDCCIVVENCEDKNSYLYILKVIKSAINLIYPSLTVNIIKAS
FT                   VPIAKIYKEQNNICDISINNTVAIVNTKLVSSLCNTDERVTIINRVIKYWAKQKNINNR
FT                   SQGTFSSYALFLLTYYFLQNLETPLLPPYKSIERENASSFEINSEYFFLQDDVEMPFYT
FT                   DASDISRKLDSPRKNEDDVSKLLYGSFCRNGITLDIYNNQIIENKDMTANIFCPITKKI
FT                   VNTYSINTWKKMFEKIRAAHERLKSGKSLDVICEETKNTTPNRKIDLKGK"
FT   CDS_pept        complement(2247017..2249383)
FT                   /locus_tag="PKH_145020"
FT                   /product="elongation factor g, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145020"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145020"
FT                   /db_xref="GOA:A0A384L433"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L433"
FT                   /protein_id="CAQ42283.1"
FT                   /translation="MIAYGSPALRRHMCVLAKRIPKRKKVFLYLNSGGWRAFSSICVDN
FT                   LRNIGISAHIDAGKTTLTERILYYTGKIKSIHEVRGSDGVGATMDSMDLEREKGITIQS
FT                   AATNCNWDFNNKKFTINIIDTPGHVDFTIEVERSLRVLDAAVLVICGVSGVQSQTLTVN
FT                   RQMNRYFIPRILFINKLDRDGANVERTLSTIEQKLNLNTLLLQMPIGIEQKFKGVYDLV
FT                   SRKCYLFKGVNGIIVEEVNDAEVTAHDPSFSYEMMDMLRIRMFEKLADVDDEFADIFLN
FT                   QEMNDIKTEDVIDAIRRCTIKNAIVPICLGSAKNNVGVQILLNYVCSFLPSPREVGSYG
FT                   YVYEGSNHEGSNHEGSNHEGSDANEENSASSSGATVPQGKNRKRVDLQCDSTLPMVGFL
FT                   FKIQEDSMHGQMSYFRIYQGKIKKKDNIMNMLTNKKEMIKKILKMHANMAQEVNEAHAG
FT                   DIVAINGISGRTGTTYTNGVASNLHLLNIHVPKPVISVAVEIEKKGDMTKLTKALNKFV
FT                   KEDPTFHVKTDEQTKEIIFEGIGELQLEIYKERLKREYGIGIQLKNPKINFKETITKPY
FT                   ECTYTYKKQKGGAGLYAHVHAIFETVSDDYNETSYCTFVNEVVGNDLPKNFILSIEKAF
FT                   KEQVEKGYLNSSEIINMKMRLIGGKIHEVDSNDLAFKRATIHLIKENYQNFVPVLLEPI
FT                   MVVEIISHYEHQSNILTSITKRKGLVTNIVNHMNAVHIYADIPLKHMFNYINEIRSITQ
FT                   GQGTYTMEFARYEQVPKSDLDEILRSANNANKRCE"
FT   CDS_pept        2250730..2251230
FT                   /locus_tag="PKH_145030"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145030"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145030"
FT                   /db_xref="InterPro:IPR013865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K980"
FT                   /protein_id="CAQ42284.1"
FT                   /translation="MKDSEFVGGKLKLKDSKIKKGSHSKESKYAAGRHGKKKKNKIITE
FT                   DKTEDKADRRNYDEEGGTMYNDQGYGQEKDYVMSADGKTSIRERGSEKDGTGKLADETK
FT                   LKEVLQLNLTEAEKAYQLVLKKREKQRIEKILKESYRERLQKFNDNLASLSEHFDIPKV
FT                   GPG"
FT   CDS_pept        complement(join(2251772..2253851,2254374..2260246))
FT                   /locus_tag="PKH_145040"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145040"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145040"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCX6"
FT                   /protein_id="CAQ42285.1"
FT                   /translation="MRMVISVGEGVMSTHLHGSETTNNMNQLLMTNGTPNQHRYEGTDG
FT                   TGGTGGTGGTGGTGGTGGHSVVVMKNQMAQGVNTQSALQPTDYVDHLKEDTHILPKASD
FT                   TVVENIMPFYLNGDEDTPDCNPTQFTFNQYENTNVCFDKENSYTTPINQFEYLNDMDTK
FT                   VSQLYEETTMEGTHNDDGATNLQIEQISSHVPYMHMIPNDQRNEPGIRYNSQMNYLKKN
FT                   GKPNYGGIHGGIFSSLLRNAGRVDSYEVNSSGANFSGDKPENLMMDHILKRALQSSDIL
FT                   QNEVLSSDILQNECVPNGCSSDECASDGCTPPQQTISDHDVYPHQGNFTRGREDAKREF
FT                   YLNSQAILNTDHLTKQNSQIRYSTVNGGVFHQSYSDSYRPPIEGSLFYNAQFDGEGIHN
FT                   QNENNHSNKSVNRSCTDGLYFYYGENNKGDDGTGEKSFYVSSGPVSDASVGSVSTGLNT
FT                   QTTNWNDKRMNNFAPFRWSEVRRADNSSTVRIDGLSVIGERSPYGVTSERIFSIRRKTD
FT                   ALSTVNNTSFNIACPNGEEEISPDFSVHTTQICRRFNQEGVPPEEEKTYGEYSTGECQE
FT                   IYSITNKDTLPNYICKSTKGISDLCSTFSGGDLSSLAKQMDTLHGEVYKSDSSHLGLDR
FT                   SFTNSIQCINACVKAEPIVGEECSEVAIFDHVNLGGRAHSRNLPHGVNKAEPSSGEMYF
FT                   PITMCASAPKEEYSEGTEPMQNPSYNGNDPYPTLYSQNNIYNNLSNCQKNNQMINPPGS
FT                   ATQPQQYNRFDHGDTNNINGDYSFREVKEEEDELPSAHNTYPYSYQSDVISTCENNPME
FT                   NHLLHRQDIFNQDNVSHFSLNSVAVDSFEDNYKGRKRVSSSSSNGCEVSGNRSVSMGVS
FT                   LHDVSPVGNSLTEGSTTGLQNQDPFSRNNTCSAYTMDMNVEGMERNHSSMLMPRLIHND
FT                   IPASANHHVGAHPLITMVENNSFKGSNGFVDASTKCVNVYGGVDMVVMSPSNKGSPNGA
FT                   TYLGDEHIYMGSNRSRIINGFKDPCSMQIDASNGLYPPNVSTNQMSTYPYDFLTFNQSS
FT                   SYYNGVNDAMVDGRTDDASYGYTHESVRGENNYVHLKGEYNNSDEEICSRNYSTKVNMI
FT                   KTRGYAHVSTGDYGKDSRSSTTTSVLNEEIITGSGFSGGNMTMQGGSCVDNIRGNLLKL
FT                   MAMKLSGNSGAGDTKGMRNIGCAGDMVYNTDYINFNDNPNKYNYFLQTSCSVRSAYPAG
FT                   GVSSKKSPIKNSVHVNNAISNFHADTPHMIKAAIAKRHTILPLSLRAHIVKLPVRTGPI
FT                   RTPRIGVPWISTHSIRCRRNCPPRLVHMFQLRIVTPGAAITRMSIIRSVDPSVNRSVHR
FT                   SVDRSVNHNCFKPINSAGGKIHAPLEDRARPNEQMLLMNSTHGENTETELMKDEIPHSG
FT                   NVMYGDNRACESSNNGNTPIERKATKKRSRKSRVKKKNKVFGGIVKKGGISFDLEVESR
FT                   RIKETPFCAYSLIDLLNNQNVGRREGLKTIVNEGREMMWCSCDIHHDGNSFTDYVDFLK
FT                   GKTMEEDDEGEEEEQQPQQGRAQAQGQAQGHAQAHANAHRQQFEENERTGDSRRDDHAD
FT                   RTGSREEYQIDSSHKKTERIRNEEPEKMMEEPVGNSEERKFIRKCDNVYYNVNKIWSAN
FT                   FNRPLGDIGRKLILKEIRELHYKDAAKTTSLLMREGLDYGKVRFMKVSELYHYMYALGV
FT                   FEYAVKISLEFGSNIRMSSVVSQGNYRNTCNNLNNGYQFCFICCSHKNHSLSYNPVGVN
FT                   LREHRMYIRSSSMLMEEFAARYVGRRPENPTTRRVPIRKFLLSMGVNSDPVSIDPVSID
FT                   PVSIDPVSIDPVSIDPVSIDPVSIDPVSIDPVSIDPVSIDPVSIDPVSIDPVSIDPVSI
FT                   DPVSIDPVSIDPVSIDPVSIDPVSIDCSTSDHVSCDRVGSPGSAGSAGSSGPTNAFSCR
FT                   TSSALSSGPSTRLIGEADASPLEHIWCEHGFGSSPHGEANEAKEKKKIIVAMEPMRANQ
FT                   TPKTVQTNEANEVNEVNEVNEAAMFPRSNQGARHPPVVPPPPPPAQNRMIPLTGEFLAE
FT                   GLHPKGEGECQNDTHNKNSVSDAEGEGGPQDNRSKGEDVKKGDEDDNGSSGIARGTTTG
FT                   NGNGTASYNVSTHSYGCTSDHTSGNGSTSYTYSGRGVTTVATYQSYLHNNCVYIPEMLS
FT                   HPRRENITPYGYTEGRLSPTGEVALSSKLKEEACSNWKEIIWTINKNEEPNCSEHAEEK
FT                   ERILMKGMNNTYEHNQVKDAFPYVHAEVTSKGELPFYVGPAKICNPPGDARGGHHDSVK
FT                   EDEEKLAQGEKVNEVQREVVKKEERGNVCNDVEVRKTVSLEGEPPQCNYLLGDEEESEL
FT                   HTEKEGARQSKRKNKIAYHTAEGGSMYKYAFPSTCFSASRTRRTGRDAASIIKKIKRNK
FT                   VYTSIINNIRREMYARKDAEKTNDKIKKKKKKKNLTLVSNNHCLKEIKELLLFHGQKVI
FT                   ELDQFEKVGSEMVCRSVERIHPHPYEYPTLSWREGRSVSSLQTTLQMIPRHINTDNSLT
FT                   HRKRMHQHYSVERLCKSNVMRTGRRIKWRKNRLHNVIEFARFFREVSQVRKPKNGSHSE
FT                   GDCDSKELLKKKGGGSRGGRSSPSSLSGRTNCIDTHIETSDGGDISMDGGTTNDELQGA
FT                   PMKRKKRRA"
FT   CDS_pept        2265686..2269189
FT                   /locus_tag="PKH_145050"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145050"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145050"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPF8"
FT                   /protein_id="CAQ42286.1"
FT                   /translation="MNRSNCIIYFKDLGVRTPPPRWSFKSGGACFKGILLGGTNAQGKR
FT                   SAATLGQLIDRRKKEVDLSTNEEVIRRYKRANIKKILQGVTKPGELQQGNGKQDGARAT
FT                   ERHPKEQPHMLESLVGHSNMEKNGTVHGKEKTVQFYTPINRKGMLDAGTRGLHKRDDKQ
FT                   VVQDEQVKDTVDKLFSSREKKKNLMKRIIFNSSHDYLEIINKYEEEKGREDDKFYNCLN
FT                   SAGKNADTFFKKEEEIQGDGKTHTGFGSTSPIDDGYLFEVDNDITNDTNEKFGLLPPNG
FT                   NSKLNVSIFSEVGKKDILESCKRRKNMQSEINKNSDAKNIFNKDIYFWLKRKVHRSVGW
FT                   ELTAESLNKGEEVIDVTELTCAGEHSLVGRSPSEVREEATSNVDNNVNKCVNGEAHLSM
FT                   DHIISEEGPAPNLMEPPQGKDPPRGTYLQRRAAPLHFLKRLSGKGGDNPHKEGNNQEES
FT                   QQINMEFTREDVPRDGYQGIVDNSTNVFKQLRDNYHLFKERNLSPNLLESCEKYVSYYY
FT                   GIEKEEKIKELRRYLDLNFYDMIKEGQYNMDDYNNLLKSKILFNKEEEAFRTFNLFKQH
FT                   DLKINVETYNCLMYASVVHKNAKLGRLIYLQMVKDAISPDKHTYCILIKAHILDNDIKS
FT                   AFHLYRKMIKEDIEVDLPIYSTLIDGLIKHKLYERAESFFNYIINYRNVTPDEVLYTIM
FT                   IKKCAYRAEAEKCLNFYDTMVSNHMKVTDITLIEIIHCLSKRRDYFSQVFHFHNIYMAN
FT                   EMNVNHRLVLYLIIACSTTGNVKRLKEVLKSANKNRVRITEEMCCYIIRTFANNCRREG
FT                   ITLSDRHNNIRYAWAVVHELVRRARASNPTTNPTTNPTTNPTTNPTTNPTTNPTTNPTT
FT                   NPTTNPTTNPTTNPTTNPTMNEMVNGIDAGDSSPNEVSTTTGGEGKLPRVNTSNGEEVT
FT                   PLPGGTKILNSIVQLYIHCDYHDYAISMLKYYTHFECLPDVYTFGLLYNLLFYKMEDYG
FT                   RVLCLYDYMVNQTEVKADEKTLNLVLRAAIKTKSSKSTLYVLRQMYTAKVYPTAKTIKE
FT                   LFHVGRHITDIQVLINNMIKQQKRDIYEENVKDSQLIQLNIDEYELNLFREGKTFKTKS
FT                   QLDQVREQFFRRKERIEKEKRMSKGKKSSDWLPYGQYLQRKRKGGEAYAQRVDRPKPLP
FT                   F"
FT   CDS_pept        complement(join(2269754..2269928,2270030..2270091,
FT                   2270361..2270754,2271001..2272124))
FT                   /locus_tag="PKH_145060"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145060"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145060"
FT                   /db_xref="GOA:B3LCX8"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCX8"
FT                   /protein_id="CAQ42287.1"
FT                   /translation="MDGNSLISQILTEAEITELGLHNSVIRHCSSPYIINKKHFIKICV
FT                   YYLLSTFLFFSVYITIIILVLTSPRTELNKTIILILYIYIFLFFYIDLIVSNNIKYELV
FT                   NRYNIREVRQRLYGRFMGPSSGGDGIPTCTVGVTNAPIVNDIGKGEDPPQRGSRKKTKP
FT                   PAREDKTSRAKEKKKKKLFTSEKYYVVEEEEEQQPEQRHAQAHAQAHAQAHAQAHLQQE
FT                   GSDMEVGRRRTVNERIPPPADEEKFYHIDQLKNVNESINAELMKYIQYENNNYTIDNYR
FT                   YDVFLITSGFINQLNIFCDLLFLFHVYDYSIKLFSVCLFIYAYYLVHFGILIRFSILMM
FT                   RALFSIHRKNLSRSYRKVTLFWKCLLSFLCARLRSNQVVNTQPKIFFNKYISYNSWSFA
FT                   YHQGVSFKENKELLKVLRDSDSDDTKRAMLRVWRPPPNRVNINGVQINRGREKINRAKH
FT                   TDRHDQANRKLKHTKEECEKALRPSHVQIIADMSSFLSHYHILNIIKSKFLSAHSVYEH
FT                   VRFTLVFFVWKLLYMDVVLCLLKVFILFYTSDLLANVLFLVIGLVNIANSYVIHLVDNN
FT                   LMSDIGSS"
FT   CDS_pept        join(2274000..2287484,2287623..2287779,2287958..2287995)
FT                   /locus_tag="PKH_145070"
FT                   /product="asparagine/aspartate rich protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145070"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145070"
FT                   /db_xref="GOA:B3LCX9"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCX9"
FT                   /protein_id="CAQ42288.1"
FT                   /translation="MLEAEPPEEKKGEEQSISKYLRSLYGNGVANKKEVMKRLRRRLYN
FT                   DSRVEDIYRKLKEIHGNSGICTEQWKEGSFAFKCYNCEGDPTCAICAKCFFGSNHKNHV
FT                   YKLTHTSGGCCDCGDTSWDIKGACFDHRGMEEQHLVEKCILKDDIKNRIKDDLDNLVGS
FT                   LFKEIIFKDGHFLSLANAQYIEYALEFFKDLGITSYLFRQIICNVLTGAKIDYLINLHY
FT                   SFYTAVQRVLYSLYLSLFVHPYFKQRFAFKLAKYYSLVVRVVDNKSYNDNNCLNGLTVQ
FT                   VLTVPEIAYTLVVNNFLNDLIKLIEEFCVYNPTTRCIMLKNLLRSDIEVIIRICVDMKY
FT                   LLYHNDVIKILLFNKYIIKKILHLLSLLHRMNSQMRYTKAHIIYEDLSSSYAITIENYL
FT                   LRVFEPLANFCKREANANFRNLFLLYQLTIESICSLNLFSSSGDSSADMQGARPKRKIK
FT                   RDHPFFRVKRCILSGSNRVGPQSDAPDEEHAGSGANDTTNSATNDQTNNTTEDAKNGGT
FT                   NSKTQEQPRRRVKHLRSMHSPLVRFFIMILNFDVVKKCIDDVYWYKHIYLRRLRKKGEK
FT                   GGVTSSGACAKSEAERAHIVRAFLRDFYSVEQTPPETLTKRKDIQERYEDDGNKIKMKI
FT                   FHRKPFLNDLEEVKNEKTRGYLSEMKDLEDKYFKWIIQTIDSKEKEEDNKILYRKSIQE
FT                   KMVHVKCKNELIEKKIKKKDIEFNEFLEIDFKENRRDIYLDPLYIDLYMRDVFDFLNLF
FT                   NLKLLKYILFVNVHVLTFIYEIKYGYWVRNGPQMAFQVNEYETSFFFQSDLIGIQFAMI
FT                   MMNILPLYEKERVKIDRGILSMMEKLFCEYIGYDKSVMSDSVHGCTSATDSTAKEEVKE
FT                   EFTMSKESFLYGHIERTVEEGENISGRVSDDITHSDEYLRAEERDLIYGNRQAEGGDKK
FT                   EEANEVCGDDTEQYSYRGQSDFTKVVSERKKIDFDSMYTFLGSYALRREERELPIEKDT
FT                   DGNNPCNSTPKKQKWNDYLKQFMQERVCNPFVILYQLIFKTFRFNLNLINEEDIYMEVQ
FT                   IHHMKVVQRIFEDIYSGKLNIDSRKINYIFFFQLFYDLLVRLFNELYYLEFSNIPRKTS
FT                   QEKYKKRGKYYVKKILIQLLASKDFQYFQLEDEFPKQFRHHPSFYELTHKYGYTTHMPR
FT                   SNVNLIKLNKSAWFLYDAFWPIANYKDFQSANEKCIKEEKASYIGCSREEDKEYMNISF
FT                   VKVQNLLFYAFKRSCLVPMLITIFVINEAFQAKAEASRGDEADHGDAHGGLQEDTQGGT
FT                   HGGTHSGAVDGSTEVTIPQHSEPTDANATANVQANGAPSGEESEANAPNDNNNSNHLTD
FT                   NNNDNDNDNENDHDNDNENDDDDEAFPPGAFVLNEVDLYNLLSQGGGDATVEGENREEE
FT                   EESQGGASPGGEESGLTNGNPQQNDHNTTTNNTSVNASNTPNTRRNNNTYIIVDDNGEN
FT                   ETLFAEILISRNLHNSINMEIVNVTDTHVAEGQTNRNYRQFNAEGLSEIISDIISENNI
FT                   INDVIVESILENRSGLRYLNQVRDQEGRNIDDNISVEDYTSSEELNMNPIESFNPLRIN
FT                   LSRGREDTGGNGIPSPPSFPSTPSNSTLNNTIDIFIKIIKLFSIIMDATHPFKYLTGFY
FT                   YSNCELFGCEDDDQLSDISENRSTVSSAISSGVSSDGYRDNHLDGHSIPRWEGYPQEGT
FT                   GDESEKPLQGRGRNDVNDSHATEGGNSSKNDYPCDGAHKEVNTNEENFTIVEGRKEKEK
FT                   KDAPYCQVAKRVHPKGASPHDQILIFDDIHVIKRKRRGKRSTDEGTASSDIVGGAYGAH
FT                   AAPSLGTGPNSQPKERKKKTYALNNVALHSLMRTMSNINSNEDKCFQKVRDTIITRMKD
FT                   LLSENYDCKNVSMSNEFIQLAKKRQQDLLKIMQNQQLMFSQFLEEELDSDEDIIGEASG
FT                   VAGGEKSEGAGEGAGEGAGTDGTTVLVTPHKEEARATKRDKKTDDPDDIANCEYERSKE
FT                   RNCICVLCKEGMTRNNLLAYICFASHSNLLKKITKKNKVAFPCKHAAIYTCGHFIHITC
FT                   LHNTKIFTSRNSQSQTPSPTKYEFTCPLCRSIANCFVVYIPKRYVSEGDSYRIYECSER
FT                   ELLLDHSNRNLAELLRRTKRVEEIGDEQVEPKLTKTDEPETTSRSETTHERIVSSTDEH
FT                   EMDDNTEVASDRSFSSSASSNASIDSDIPEEFHFKYMRKGKKNISNDKGKFFTQEKKEF
FT                   VPNNSSHKVTYNLYDESKVEDMFNVRFKKLVSKRVLNGFLSYENYELNKKIILREVYLN
FT                   EGGMYDELYHKGEDSQRSSSGGSNPHEEGTPPGEVTPTDPPSGEVIPLGTRGTELYLHK
FT                   NTLNYENKEFTFSYKNSNFFYRYRNGFLASYVSVPLKYIRQVEFLMVRDNQLAQTSPDE
FT                   CMQFYFTAQIEKREEGKKTVEDENSEEVDVKEEPGTKGNAEIILNYHLDKSVLDFIKNN
FT                   LKNEDSNIDEAIQKYELPSSNHCSSSNGQINRWKEEMSGDQHERQMEKRPKIDSESTSK
FT                   LDGKSVHGALPEYVSCVGAPSSRVDVDVTNEDDKEGNNKKGGDNGEAYTGEISSSEANV
FT                   SSNLDGDISRSVDIPIGKAPESAPESKSDGSSAAFSKERTKEKCLKRRNGGGTSRTILS
FT                   GGREDHTQGINKNGQNNHKRDDNVGRSICRNGEDSEEGERYEPSTGGTKFQYRCTTKYF
FT                   KRHNTYRRQLNVGRSWDGIISTNKRYYLMYKDTLHNQKLEPSFDMKALRMSMIQLGLIT
FT                   ETSWRIFHHNNATFSTIQNHSRNYKNLIDFEYNHKNQDHYEDIDIEEVGVKDVMSMYET
FT                   VELYPDFLQDWKCIEFVNREEIRRLRREDLFFVNRGYYARCKRERRKGGEAIDLGTGGG
FT                   ISSKVLANALLNVVSNVVGDASPIIGQSAVSPIEEKKKKRKRKCDALNIKFWRNINTAI
FT                   DMDKLHWILYNEILVHLFYKNINYVSCNNLIETLVRNFFLHNHELNIVKEKKINNLFNL
FT                   QLWKNLYNVSFDYVYPYRFTDHNYKRFFNKIKNAHFLNKLAMVPLSVDVLRLFMHFFLN
FT                   QLLHTQADIQQFISISLIIISFQVMNEVFIREISKSYVRYIFSSFSPEQVRQNFENIAK
FT                   YIFVNLEEGTYQPMRGFNRAYGDRGESMLDHESCVNPPPCIKRNDDERDDGEKFDDEGK
FT                   IQYQLFHTFIFDYFVGENIAKGVANAHGEVKPPQNGYPQNDSQNDSQNDPPNDPPNVRS
FT                   SCGGIPKRGKERSGREGDKWMDNLNPMELFQGVKKLSYHFNQTEIKLLKDCILQSDIFA
FT                   DCTHGISCTHGSFAQEKEEKVEKSPEQARQKITHTWEGKQREDDHTDGSEKAKQEETNK
FT                   NKIKKLFILHETMKKLVQVNEFKKKTKKMMLLLCEMNDEYMKHMYFNGCMPINIFLSTN
FT                   FTRYDKFFNDYYPFVYNTRRNSKWGSFHVLYKNSFPHTRERKKGSFVKNKTVMKRDYNY
FT                   LASSSSGCGSGQANEAEQYTCKGHPGLASSYKRHIFEEQEVPCKSLGNEGRSAVDQSTL
FT                   QHTSQEGILTTGKVEGNRTTEYFEESHFPNELNHFKYKLYNISNEEISDLYLTNDAEDN
FT                   LFDPQMKNHDFEFRHINLVSQLRCKFENVPYVNHLFYMYNVYQNLFSLKAIKRIHNMRE
FT                   REAEIFVDQFILARVGDDIADGIPAEANFSDVSFDSNESINFSDGKSTGEKCHKCDDND
FT                   RYDEGVMKADTMSSSLSVLKEILDVGELIKDMKKNKKRRRKIKKNKYADDLFVNFFQKS
FT                   IKMVKGGKGENGKEKKGIPATSVGRKSSGATSYSSVLDTFLQRDSKSALQVENGREGEV
FT                   DDNSPSDVFVDPHDLKRVDISQGVHRDEGGITQKGENVPSDRNDVYGSSGEEHSVSEDL
FT                   SKGENHCNFQPSYEPSAYHAYSTTLDRLDIPDRFDIADTSDSSFNSQGSLDFRSLHDEN
FT                   NSSSDLDNTLFRRRIHEKNNPPDSFVDFMTRKKYASMKNKLKNCKMDFYKYKGINKILR
FT                   YHTLLKANGLNKIFFEYIRKIYSYVYNLYDFIPLYLVQNILLHFHGGQKEARKYYHVDD
FT                   TYGGVTHPEDGEYQFTKYSESFFRTKKWKKKYAKHRDRINGYHAHGGRSVRTNFRAGQE
FT                   SGEKNPAEGKKSYEEKARESGREQFYKDLHEGVSQFDSIQKETRTQIPSHVSADSNRRV
FT                   TEKSSSSASYTVNKKIKIEHSSSGKTDSMTSLLGAGGKGGSQVGRPDGGSSGSQSGTRS
FT                   GVGSSSPSDCFSGAIPKGRGSKRKTTHSFHPTDLKGEEMLSMKKIFYIFYHYLKSNHYI
FT                   DGKNPCTRIYRKFLKNYIKSANVYLHFVAYMLFSIYDCNALAKKYLDYIHLHSDLAKYN
FT                   IFLLMLNVNPQFHQIYAYQTLQLIFHPYFYQMYQIYKYLKIDAEPVLPHNFYENLERFI
FT                   SSRSLFQPSRNYFTMIKRYFKSKCVSCSKSPTIILICLFCGSTICLQESDNVRIPLSDS
FT                   IGKCGYHTTICGGDQALYLCLNVSSVLFASEHRFGLVDGPYVDKNGDVDPRLKRGKNLY
FT                   LSPHKMNRIYEIIVNSAVDVEIYKQTQKSD"
FT   CDS_pept        2288506..2290044
FT                   /locus_tag="PKH_145080"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145080"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145080"
FT                   /db_xref="GOA:A0A384KWI2"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KWI2"
FT                   /protein_id="CAQ42289.1"
FT                   /translation="MAKEVFTLDGGKISEFERLGLGNFDFLSYPQECNKEEMVSTLESI
FT                   HLSYLLAGCNVISTNTFQVNLHSLQEKGISIEEGQGIIDTYIDIAHNALLKYERIKRTT
FT                   DFPLHLGMTQVEEKESSPYDHLEKFQKMRIHWGILHPNDSVDTREYVDRFDLNDDVWTG
FT                   NPIRRCQDYYVAFSTGGYSSAFRDFSEYSGVLRKERKATNWGDGGGVVQPDKAVVGCRS
FT                   QNQSYDIIIKTPPEVEGSLMHRQNQLPDIEMVPLSSTQRSATSTEDFPNKHFFNYGLEY
FT                   YIDVRDEEIISNSKFRIDSYKRNEHKLQLFSVITSSNVREVFTLYHHLKTCGGGFEKNV
FT                   VVSFYCNSNKNIGCTDYSFLDMVLTLLYLDSRNHFIKAIGVNCVNIDYVRELILPLTRC
FT                   IKPDGNIDVNAYPCPNGELGRLIKTVLKDLKKNTYLGDIHFFASPNKSLNRVTYDHSRN
FT                   DIQFDISQKRHKHLYNYVGDWIDVGLTGFGGCCYYNPYDISLLDYKLGRMAQMQ"
FT   CDS_pept        complement(join(2290060..2290806,2290977..2291029,
FT                   2291126..2291201))
FT                   /locus_tag="PKH_145090"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145090"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KFV3"
FT                   /protein_id="CAQ42290.1"
FT                   /translation="MARGLNIVKAKLPKAPTGRRPIGYRGNHQHGKSLYDPVYPTTKIP
FT                   ASLVPRYPIDWRNGGRFLLCVGLRRIENRIIKRMKESQDFNRPECKTCNHDCIATYNRC
FT                   LCAWYCKNKFKHLYQCDELLLQYKGETKTDKPLFTAPRWVANRNSDKGIQYEFNEKTRR
FT                   FENVQGEEDMYKLFYKKLRYGADSTEHEGKEGNSIAGGTSGGSAIGESAIGGSAIGGSA
FT                   IGGSAIGGSAIGGSAIGGSAIGGSAIGGSAIGGSAIGGSAIGGSAIGIPAEEEQLSGSD
FT                   SDMTDSDEEG"
FT   CDS_pept        join(2292824..2295772,2295946..2296074,2296295..2296330)
FT                   /locus_tag="PKH_145100"
FT                   /product="peptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145100"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145100"
FT                   /db_xref="GOA:A0A384KYL9"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KYL9"
FT                   /protein_id="CAQ42291.1"
FT                   /translation="MMSRGYANLNAFVENDKHERWSNNREGGGTHKESKRINLVEHKRK
FT                   DSHLSNEKFQKHGLVPGELRSQASTNDQYHLLRRGSRGGEHHGEQKSNRKGDPKVHSKT
FT                   HKSSHHRHNKDTHRHHRRDSHRHHHHQHHRHHHHHQKEVDAKESSSGGLLWSCVKSVCS
FT                   SFASVVRKNIFTNENNTSENGRGKTISDLSRLIDKNAQRKKEKDLLQDDHSTTPLSKNH
FT                   NPVQRRDGRKKGGVLEQDNNLQNRNGEGIPRRNKKIKNASYEFSDNDLKNLFMLEGEER
FT                   GDIHTQEDAKRLYSGDGRDGKGERVELSREIVKKNDGVAEKVGEGASLRGEASAKGEEH
FT                   VKEEEFMAGPPTIPNIMINNGSFSKNSQRDDLNTRGRGVTLSSEEENTLGRLGGLKPGV
FT                   LDPRKNREGEKEEGHRRKGSLPLSGRSNRTSRSSSDVDGGALRDGFYGKDNLLRKLLEL
FT                   EDDEDNNDNDDSDEYDEDGKAKGRQPAQSNKKNAPEQNGYIKHCQGKTFLQNGLHQIGE
FT                   QMSSVQGENVEKLYYENIFEDSEKKGKSKSKSMDDPDDSDADSFKNIFYNRKMKKKKKK
FT                   GKLTCMPQMEQTTNGADGVDKKSGSDAGELNTGDADISDDVSSVDGDSHTKDETHKRAH
FT                   YFRNYIKSSEEIKQIRFEFKELIQTIDSFIVKNSTSDEINSSKNVAQRNDQNTETPNSH
FT                   KRESKNEATYMEMDKMNEGADEGSADEQSMKFIDGITSEDKSGYVILKNDEESLIEALE
FT                   KLRIEKRKKEEREKDGKVRESDDEANRIRKADAVASLDPDIFFKCINKNHYEKAAQILR
FT                   QKGENGVLIDKFNVPLLYSQIKCLMDTRWLNDEVINFYMSMLQEYNTKNIKKDTANNFL
FT                   PKIFTFSTFFFQSLNSNGTYSYNKVSRWTKRKKVDIFSFDLILIPLHVGGNHWTLGSIN
FT                   MREKKIKLYDSLNMSNTKFFEYMRRYLVDEMRDKKQMELDVSVWEYNPEGCSEEGIPCQ
FT                   ENGYDCGVFTCMFAKCLSFNRSFDFSQRDIKEIRMKMVYEISQGCLIF"
FT   CDS_pept        complement(join(2297062..2297208,2297378..2298436))
FT                   /locus_tag="PKH_145110"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145110"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145110"
FT                   /db_xref="GOA:A0A384KPA3"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KPA3"
FT                   /protein_id="CAQ42292.1"
FT                   /translation="MGKIACTSQAKTCTSTKELLEILQNDELPSVIMDQVGTFTRMKEK
FT                   QNLLYERILFKPTSFSTLSHFMEMIEKENLRREFDMYFYDEDFHKIKLNRDQNRKELFI
FT                   DIRGVHPEKHKSLGGIYNPDGSVKTKCTTTQLLQKYSVEALHYYNIQRYEPNQDPSSFL
FT                   IDKRRLTKEEYRYQYVSTILPYICFTLMLFFPHALICLYIPYMKEKNEKQRKICKFFQI
FT                   KQHVHMYKDIRPEHLQNVIDNNVKTLVFFYNNEIFMNMRMKSLMVDLSRILKKNSIPVN
FT                   VVGVDTAKHNIRYGVAKDFEEVLFPVIYLICPYHYDNDSGVFRIEGPLTLESICSQIAQ
FT                   FVHVPRNAFSQMRDLTRLSDNLQKCIFEHEVMNQKKDQILYDYGTEIAHLSCLHLNGQV
FT                   PF"
FT   CDS_pept        2299720..2310006
FT                   /locus_tag="PKH_145120"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145120"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145120"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR040240"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LB89"
FT                   /protein_id="CAQ42293.1"
FT                   /translation="MMKNIVTYRMGGDKIDQKKKERGRDSSERNPMGKGQPTLEKNNEK
FT                   NYTYKGGCINQRKTISGAEEMNQENLLLNMLNGGGSTMPIRHDDGTSPLHTHKNGRDND
FT                   IDGYPTRKDKKGNGELYQQSIKTYYELYNVIKYHNIDRDRRRNRLIHFCEGVKLKRSSK
FT                   INKHNGDVMDEEKSRRVAHSPFGQRPVSHQKDEKEDSLENILTLEWKDDHSSNYILDRC
FT                   NEQLLKRQVKIHQTDFIEIDDIFDEGKLSFVKNRKFCFYKNGEMNKFCRDKQGRKVESR
FT                   RISRESHLNGGKGAQVKSNKRVEEEEEEEEEEYEEQATDSSPRCGGANTYEYPPHRNGN
FT                   MDEGNMDEGNMDEGNMDEGNMDEGNMDEGNMDEGNMDEGNMDEGNMDEGNIDEENIDEE
FT                   NIERGDMPGESPIGIETLPEYSHERRSDEFPEMQMEGIGMSDGLEEFSKVTSSPHGLKE
FT                   AKQGGENSNEQMEWSEVDIDGEFAFGEENDEFQNDKGSSHPNVEGNVKEEDGFLSDLYV
FT                   GDTKEDPKEAGAEEHPEGDGEYDLDCEFEDVEVKEALDEGQDADSLMNLLAEEMVVGGE
FT                   APEGGNVEFEEDGLIGDFEEEGLVEELGEDGLVDELGEDGLVDELGEDGLVDELGEDGL
FT                   VDELGEDGLVDELGEEGLVEELGEDGLVGEFMQDEPPAEGSESKVHDHDFDTGSFAKVS
FT                   DLFDDIQVEDIGAEEEGEDSLLKEQDGVKMEEEGDYAEEYDGMAKHEQATLHQITPRQI
FT                   QQDGEDDGPLHVNVEQDFIKDLGLTKERENVTYNVMMYPYDHPSGGLNGTNYSGVQRNL
FT                   TSRENQSKRESYDFFKNIYRDYFNQSNRSNRSNRLNQSDQANEASQLSNEELHLFGADI
FT                   TKNSYLYILENYANLYKYSHLNVLNPLSCKDYTDYVFKGKRMESELIYDEQIIDEVFRT
FT                   HDDGGSEEVAKRAGTTRRHGTNVSKHAERLVYKNGKEVEGDIQRDFIIKGVTGSTNQGG
FT                   EEEYPSAVVPSGSNAENMMMNLYKRNHSNNHGEIPFMRKTNEMFYLNMGVEPSGWNYTG
FT                   ADAGTGPANGHHICLDNFTNIWDHLYSKRKHFEGREKNSILQEINKKLASQIQRNEQIS
FT                   FLLKNFFLKHSPTSNLLLTSLICSPDEFKQIFNQKYDFSLLRTPSNDTTEGENFTSVST
FT                   NDIGDSLHHVEKREKTEEWVGAPFGVTPIEMIPFTVTPLIHSNEQTNIFIQNKERRLEC
FT                   IESILSKSKNIFFFTNLKLDNCYKKRNPHEIENERISLSTVYVHTRMANAYFYNYELSN
FT                   KKGVIAFSRFHKLDFRTSIGRRSLVDPREDEHSDYQELPDYSDQGGGLNLGALKWKFLR
FT                   VTMRKGCVLGDAFFDSPSRESTEEVPSLANVESAIDVINAANVESAVDVIKTENATDRQ
FT                   TGPKLKLKLNAKNILPPKNQSRVEHQLDLLANILVDPDYKISSAYKIDKWQVQNMCDKL
FT                   PMVQYDEQTKKENPSFFFYDNSCLHLSDDSPLVIFEYIERDPLVLPKIGMNSKLKHYFM
FT                   CRNEENLYSLDFKRRMKRNMEPFGEMNVVNQPISYFGVPVRTKKASQKLSFLENELFKA
FT                   FLFTPPVYRAGGGGGLSEGEDGLSEEALADEVTNRMDNEPTANMITAPLANEEDIRKSK
FT                   ENGRQENLFYETDFLLIRNTCAGSESRVFLKPLHVDGNLYKAVAKEKGDASQGEVLPMS
FT                   RCTDGGYSDWGGTEGRIAEKPPIGEEVIHSDGVHKGGEVIPHDDGNHVDDGNHVDGGNH
FT                   ADDGNHADDGDSPVAPPLNCVFYNVGFLDLHVDITNPSYKKYITEKRNYVRTWMMKLIQ
FT                   KYKLKDTRKIKEMLKAKMCTFINEKDMSAVVKSIDFNVLLSKNYLNDEQQKNVFTLKNV
FT                   CTIECTYHYLQLLKYEGIDFHKMIEQEDKLNRLICILKIERERAKKNIENMKRKMKMIY
FT                   KRYCYKKEAKTINFHLKKKQINIKLIKNYNYVGSYFYDKHMLNYLLYIKYLISCSPWNV
FT                   LKDFSCAPSQGAKEGDEGIAGPGGEGLGRDGKEDEEVKNEGGGGGRRRRRRRRRKVEMN
FT                   MKEKEETRKKKNKIKKKRKRRGEKNTDITKEDAPSEVDWWEGDHSGGGGAKVESANGRG
FT                   RNRTRSVEDRRFTSDEPTKEELSSDEEKYRSKTIDKKRIKSRRREDQSEDSTEEVDDEE
FT                   EEEEEHLQKRSRRRRTSGGRRGSPNEDNKNDDQEIEKETNDKKTDSGTNRKKTRKNYSY
FT                   TAYLFNHVVCNEALTQMGERYNDKCHPQQTHDLRENNKSATSNWRGKNKLYSRNGSAHK
FT                   REVGRKDKQDEKRGDKRIEKKGTRMYGGNSKGYVFHGKGKYNFSYFHTKKRLTMDRDDA
FT                   VNLRRFRGTQGSHRGGIYEEEVEDNADNGVEDVDDDKSEISKRHNDHHEGHAPDVGRTN
FT                   QVIRRKRLMGGGVTKTNEEAEKKSTRSDNTLCSTRVVAHLTSRDIAKALLSIGFNMAEL
FT                   RKMSRCDQICKLKACIRNGRVNSQNKIIYTCMVKKIIMEQFKHLHVPVHLKISNNVLYM
FT                   SERKGVDGSDHPGGSLDPSFHGNRSNPLVSPSNILLQGENRHPKEDYTELYMNSKRKPV
FT                   EKNRIKLLRSFFQPPSSDVDESGSSFFLSSSSSSEVETDSSSDSSSDESSLLLGEGTPL
FT                   GRIKQKDRSARMGGKHKRRGRGLDEEESEEEEEKKHLEVIREMQTKKDQQEDDKDNYKM
FT                   VHCLKWTRVYVSRSDHSDPVSNHGNAQFQMYDHSKSGPCGGILNGEDALNQEGNPLHTF
FT                   PHPGKPKEAFDHGRGADKRDQTMLKHPMKDMDNLLLDEKAKVDRVHTLYIYGEKNINTF
FT                   LRWKSFRSVVRKYFTLVNANYMNEQAMGEEGTMRGKTTQRDNAPGNRDSHPHDEDDADE
FT                   SVGKENLFSNKVKKKRHRRRRRGIDLEGEEGGMMTASMYAAPTFKNVLRIFPTVGGELK
FT                   TWHSGKKQTNKNDIKQEKKKKKRDKLNNQSKIKGKERKKRRRGEFYVDVNTSVGKLMGR
FT                   KYVNTNYSVNIKMNKSIHKSASMAASRRRRLYPLATDQVAQMAMEKRGKRTRRTTATPV
FT                   ALSGKLQKSRRGFSSDVTNEEDQTGEETAGEEELVEPDGTDEWDEAAAEEEGAADDDSV
FT                   AEYAPVETNEASRRRQLRSQVARSNSSVTHSLKDEEDDSHRTGKNRKRGREEIEKGNDR
FT                   KTKRGDRSDGGNMREQSKDLEEQDFPSNLAETTEKGIRRNTNILLDSSANQRNESNEKT
FT                   GIESARKKMKKGNTYNNIKEVIERFNELLMSIMSSIAEVMNYKAFLNEVNETYAPLYYT
FT                   IIKKPMYINKIIFRCKKRKYNSLNVFFDDVNLIVSNCKLYNTPTSVSAYLCVIVDNMLL
FT                   DIVNKVRSDENLQNYNNILIEHFYKNKSLSNTWENLNMDMGGGRDQNSAGGLTLANNTA
FT                   PSLNMYSEMNSKNAPAGEGK"
FT   CDS_pept        2311587..2317496
FT                   /locus_tag="PKH_145130"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145130"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145130"
FT                   /db_xref="InterPro:IPR018838"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KWV5"
FT                   /protein_id="CAQ42294.1"
FT                   /translation="MNPYTIKRTYECLYTHQKIQKNKKWQEGYCEVIASYGGIKMNLLN
FT                   QSRTCIESSLSCEASFNNLQEEIELPKHLIQFVDVTNYAEDVIKCETSKKRRTLCTSQD
FT                   EGSIHANKNKKITTHSGVNNSRECMGSETPGVGMQYDATTFNDFKTDRYIRVNRKFEMP
FT                   RRIKRKVEVERHEDPHGEATQYLEDDHSGDESSEGEFPNIVKKKKTLDRTAPCQLPHNS
FT                   DNDERITVSYTNIRTFNNNKKNVKWYDGFIVKKNDLLELYNNSGGRLYIRSTDESIQQE
FT                   EYIQFGSYIVCNDFRIHSSGNPPESVETNPGKNNGMSKKVDARHGEGIPAQLHQVSRRK
FT                   GDSEGDTNVDEEEVDLCSDDNSRVNSTVAAKRRVNEQPDAKAVSLLNKYVRGEELPACP
FT                   SEENPGLMDISSSKKKKLRRDDRGGESDSPGDASSEEHRMYHQRCDKYRKDYKPNERQR
FT                   RDKIGFPLYKESGGRSAAYLCSSCRQEVKTYKEIINIARVVSQNNFSWVNPHRNIIRLN
FT                   LGIKLLSMRMPGELHALLPPGGEDSGHDRDGDPGIVRRPPCWSCTNGENRTYWNCINDG
FT                   NRPCWNYINDGKQLCWTDMKNEERHFSNDLKNEERHFSNDMKNEEQHFSNDMKNEKRPL
FT                   CNDRNGDMQPYGSDKSSERERPCGSDRVHGEKQPCGSDRVHGEKQPCESDRVHDEKQLC
FT                   GSDRVHGEKQLCGSDRVQGEKQPCESDRRDSEKHPCGSSTEANSNEEEPGEEGTSETEW
FT                   DTKKGEKNVEMVREICHDINPPSCPEMIPEEKCSEELPKLESTIERTHLNPYKIESLKN
FT                   FASTNSGFDASQIDQVRRQNLFLPIYVSILKEKEELKKKLQKIKFKNIPNFFLNKLEYI
FT                   HSFMNATLLQIHYQIQCKLLCLHGYLIPLLCEMRGDYLRGGSIMAYRRMLHSVGQMTGQ
FT                   FIHSRSDEDLPSDSRDVQTNHPNEEGNKRRKYSHGEDDYTLFIQNVEVLCSTEEETRYM
FT                   FHDNEQENFNLNSFDGETDMQGKRFFIRRTQKEVLLVNKKKKNKLTMEEDINKYVYMNH
FT                   LIVMSRDISPELNMSYPPYPPFTSSSRMKDSDLLLFVTKWNNFKKNYLEIYPVNLETLS
FT                   YMNQTFQDEEYVKSKEFLYFLKEYKVKVFRSCLFLVNLGNHIDNLKYLFFFHQNLKKEI
FT                   VPPPSTLFPPPYVDKEDTLLHLDGFFRQIGIKTSAWGSSCEPIDLYNVGGDYMDDLLNR
FT                   VRKDEQLNERQSWVIECMLAWFRCRMEKKENEIETEENFEEWEKCETEDTFDPSETMSS
FT                   TDERSEDELSTSTYNGICTTTHRGDSILVNGIFGSGKSTLICKAILYLDKVLTQEERGK
FT                   KRRKAEKCQKRNQERNEDMSLECSQSGGSEEKSSDKTSDLPMQVNHRRISQEKKKKILL
FT                   MCNTNLAVDNILLKLKFHFDFHDYARIGNIFEINFFLITNFISINSNDQKKTLEVKNYV
FT                   QSLARSTNLPPTKNQPTTDCPPTDCPPTDCPPTDCPPTDYPPTDHPPTDHPPTDHPPTN
FT                   GPTTASSSPSRSGTLPPTPETKLHKIKDMDKLADALMKKNNFVFRNKFKNKRVIAGTCK
FT                   SLQIYEKLSSIKESIDYLIVDECTQIDEMTLFHFFLKFGIRKFLLIGDVKQLGVVLKGP
FT                   SDLRRSMFSRLVENELFIAHHLKETDMLAKDEATGTAGVDDEIMDRIVNRVRSMREAEY
FT                   SALKSYLYDNMFALHGGGGHTYEGDQVNVENLPSQPPQGVEDKAIERVPPRTGMNHLIL
FT                   MNEQFRCHPEISAICSHLFYNGLIKNAKCTETIPLIYKPYGSHVNFILLKKAPSEVTFR
FT                   SSFTSAAEARVILTLCENMLASSINPEQIGIISLFRNQTFYIKNKMKESPYYERLRNVK
FT                   VSTVDSFQGIEKDIILFSCVLGEVSGINRVGRFRQNQSTPWRDDYFQAFCNNSNRINVA
FT                   LSRAKSQLIIVAQSSFVEGNHLWSYIKSHSKVYHCE"
FT   CDS_pept        complement(join(2317787..2318693,2318825..2319792))
FT                   /locus_tag="PKH_145140"
FT                   /product="DNA polymerase alpha/epsilon subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145140"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145140"
FT                   /db_xref="GOA:A0A384LI34"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR016266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LI34"
FT                   /protein_id="CAQ42295.1"
FT                   /translation="MEDLARERLIESARSHHDIKNINLYLANIEENIIRIKNEGESIID
FT                   EVFLAFNGSISHISLYAYLYDHKINVNLDCLQLIYEQSYIEEEKLIAEGNREQESVVDI
FT                   AKFDSDLIHYLVKECRNNYEESTSITTKEIEEIIANHKHRIFEESIAVYKEKYGDAIKV
FT                   FNCFIDFSHFFYDEKKMKFIKKKKRDFVDNYNNYIDANTDVEFYELKYHLLTKKAKGHA
FT                   SVLFWSDALNEIHIKNKTIITSVDAIKLTNTGHQHVIGILGLNRDGDMVIQGIRNEIKL
FT                   FLNRECVINHGLYCIGHVILVQGRMRLSNKTFYAAEIMHPPRNFEEERNEEDMFYDFEN
FT                   EKEKKQVEEYEIIVSKNDKKKNWIIMHDVYLDNPYTFEILDKMFSLYVNTYPENNLPIG
FT                   FIFMGDLISLKFDYNNNFHNVYIKGFEKLSVMLISKFKLILEHCYLIFIPGKNDPCACK
FT                   NSIPQMPILPYYVRKFQQNIESFFSSKKKIIFATNPCRIRHFNKKMIFFRQDILNDLIW
FT                   SSTINACNNEKNNMQNILLSTIVGQSHIYPIPHDNRILKRYSPFLFLYPLPNFICISDN
FT                   TCSSFISYASDDTNDSIISNSDMSFTRKKTFTVYNALQHEAKRYVVPL"
FT   CDS_pept        complement(join(2320905..2321012,2321156..2321256,
FT                   2321415..2321521,2321649..2321696,2321808..2321976,
FT                   2322078..2323239))
FT                   /locus_tag="PKH_145150"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145150"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145150"
FT                   /db_xref="GOA:A0A384LNC2"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR034164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LNC2"
FT                   /protein_id="CAQ42296.1"
FT                   /translation="MALIIPLLFTLATLLLHTQNVTVCSADHFGEAIRRKAFKVQRSVR
FT                   GDPGVNSAITSKRVNGASTTSKGNSLLEAKKREQDYFTLKINEQNFRWSLPLLMGSKKT
FT                   PLELGIVTSTPITALYCSYNAKPNEEMNNIKYEVNASEGVKYISCKSRYCTAIGQGNTC
FT                   APIEHFFKMIHDFGLRKKNCTNRFCTYINDINFLNVNTKLDKRNMSVCSFSSNLGSEQV
FT                   EGFYFRDSFYLYDTVKFDYKHFGCVTQSGVLTFNNVISGFIGLAYNRADAIANKKESSS
FT                   ILHTLVQKSVSKKNIFGLCFVEGGGFATFGGINNEALRKVLPVSKLQMGFQHLGGEDPQ
FT                   ATSHEIVWLAYSDTSKSTYSLLLKEVNMVSTSNRVENAIGRVAVIDSYNYFLSFPAEIT
FT                   AKLKTAIYNSCVGNDNKCSNIINKGVFTLKNGGVDDFPTVELVFDDGKVLIHPKDYLIH
FT                   EGDGVYRVLINSEETLKLGIPFFLNKYLTFDNENGKIGVGPSDCTFEMKGVSPGVDLSA
FT                   TEADSNDDPEDKDFTIEDFFQENKLMILALTSLSVVGAIVGGVFFFG"
FT   CDS_pept        complement(2324139..2325233)
FT                   /locus_tag="PKH_145160"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145160"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145160"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L6Z6"
FT                   /protein_id="CAQ42297.1"
FT                   /translation="MITSIDVVHELLTTIYSSIFSQRSKDILKYDVLLYLDDHYYFDII
FT                   RKVSEDIKELDPDACVLQREDDFNKIFMQFNESRNYIVKDKVYENENERRIDFLHEVLA
FT                   DLLCLLYEKGKNGFKDVRVITKRGRHTDKENTKWEKIKEELVQIEKLHGEQRKEATSEP
FT                   PLMAMLSSNPKGNLDETYIRQVLSIPKEHFQNEDIIIKQSLDKETEKKINELLEHLNLE
FT                   YEMRYYYLFLNHYLTMQTLFMSPLIDLTSEELKKIINRIVHIKRMTYQPVTIYDVLSFQ
FT                   YSNIAFFKSSHDNLASPVKKVQLVGETIERGGIPTTFSKKVIMKDVISANISLKEKYNK
FT                   VKRHNEGNFGGRYKARNYYDNSRR"
FT   CDS_pept        complement(2325857..2328829)
FT                   /locus_tag="PKH_145170"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145170"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145170"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K850"
FT                   /protein_id="CAQ42298.1"
FT                   /translation="MKNVARLCVWLLILANWNTLRSRRVCERGARGNYSRAAILSSGHL
FT                   NDHLNDHHNDHHNDHLNDHHNGHLNGHHRGRKTNDRNLLFLKNKLKEIWSKFTTKGSHY
FT                   FNEPSKEEQKSFNLKNVFQSFSQRSENDIISRVVVRGSTVISPTLLDNLLSRENIKTIR
FT                   HKDIEGVVKIVSNFYTKSNYLFSRVLRHEVVKDGNQDILIIYVEEFILGPGCVQIRVFR
FT                   RGRPPTTETGKKTETEMAKGTTTLGSTPTIDAETTTGTTPKTDAGTTPSAPPADANPQE
FT                   EVIFERKGSASGVNAAAPSPDDLQKPEAPSNKLRKLFEKKMKIKEGSIFMWDQDTFDML
FT                   LKSNLFNYIHVKLLHDKLENKHLLQIDIVENRKFSFIPSISKSFNSLLDLCMNVTLGYL
FT                   HSVNYGDKFRLKFFKNLSYRNHKHDYDIVYVNDIVELEKLRRNLPAYFIFGVNVNGAFK
FT                   KEQDNSALNECVNIMNRQGENEEKKESENGEENLNSSGEQHTGQHDVLPRGSPPQRKNI
FT                   YSYLHREKVFLFGIRKIWNTIFEIKLKAKKELFHNLLYFLGKRKGHSAGGVNSGRIFPL
FT                   HFLSFRRNLDDNQVLSKQLYNIYGSKLKLSSCLNAYSSSWFENSKCMKAFFNVKNKVDL
FT                   VFYFNMDRKFRRMEENTHEGETGGNEADVKSMILSFLEDANKRGGFFWMDKIRNVYLNY
FT                   TFYFQKNYKVNIFDLFCKLKRVFTYRGGKATEVTRHAANGKEPPLVLFPLLYKCKIIMN
FT                   QVHLLVNVAFFFKKTLWDLRQGYNLPSICGLVGGKTNGKGIWSYYYHQVKELFLENTQR
FT                   TRKKGEPNFEEELERITLPRGHTSSTESSPPNSTTYNICSVNLNDAQKEQQNKIKLTMN
FT                   YKLIFPVLFENYFLNMMDLKLYLFLNCSLFGSEGSTSHGEESAISPIAMNEDSRKSALY
FT                   NYLKLSFLRNKRKIHHSAFGLGLLLSNMNIFLNFQCGRRSMLPSLVLQLDQVTSRFKYL
FT                   S"
FT   CDS_pept        complement(join(2329452..2332426,2332539..2332770))
FT                   /locus_tag="PKH_145180"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145180"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145180"
FT                   /db_xref="InterPro:IPR006387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LE69"
FT                   /protein_id="CAQ42299.1"
FT                   /translation="MAPSKFLPTVLLFAVLSARPPSNSPVPYANAGITGEATSSVEGLN
FT                   IHGEKDQLYDLSHFSRELIEPLSRFLKSVPAAALREKVKTQVAKAAQSLHLPNPDEQTC
FT                   EINYADLCPEGWGDWGNGDNCISPATYQGPCKKKMASFVNSTPREKFHFSIKCDVSWPC
FT                   MHRCSEEDLLEECPDRWILEGKICHAPKSYMGKCVRKKIFTNFSREEKKAWADACDVSW
FT                   PCLKKNYNFNELCPKNWIPSPDGKHCSATSSYVGVCGPVLYLSNLNELEKKNLMRKCNV
FT                   EWPIRANAEENELNDQVCPLGWTSSTSNRKGGGTTCSPPHSYNGPCAQSEEIKNISFEH
FT                   MSKEEKYELSRRCDFMWHSKNEQYQNFDLACPYNWVLVDSADHICASPVEYTQPCNNIW
FT                   SFKGYTNEMKATWAIRCKAPFVNEATFRVRLLKGRKMGNHLKKGKIFGLNREMNSGGIL
FT                   LADTAWLRDGPIGSAKSNYHRVDDSTTTHEEFLPNHDESLMHTNGETLPLTEGRNVDHP
FT                   HEVILSDQKITELLLLKQASKDEELRRNIDEVVQTLRKGHSSPGKGNSFSFLQIKSKRE
FT                   KSINSTKDFHKEHHVDSSIIGKAKFPLQKGEADEQSPLYDRDTAHTTEIQNLKEIKNLY
FT                   ENYKLEKVDESYYGHICFEKNYLECPVGWTKLSAKQCMAPRWYRTNVHKCSSMINLNDL
FT                   TRSVYDVAHDMSFITFDEEKIKKLEKKCLLEFPCRECERDYVQVSCPLGWTETNDEWCE
FT                   APADYPPYLKKVCGDRVNFKYATPLIRRNWSLLCRSDWPCFSPCEKNYAAVCPLGYELI
FT                   NERFDTVNGKTIHVCVNRSWEPSRTEDDRIHVDRLADNWGNACLVIEVYNSVQIKKQIE
FT                   KKCRIIWPCLEKCIQDYHQTCPYNWLLKKNKCIAPYHYNPPQGCSKSFAVRSFSSFDKY
FT                   LFSNKCFSPWPCINACQQDWSQPCPAHWTPMMRRNGKNTVDRKTTSNSLFCKPIKRYMH
FT                   SGVCTDEYYDLTDFTFLQKQEFSFRCGVRWPCGNTSRLYSPNWQTENVYYDVGFQRLRT
FT                   LRFYDTHYASRYAKSGSSFF"
FT   CDS_pept        join(2335105..2338455,2338608..2338700,2338862..2339008,
FT                   2339188..2339289,2339435..2339572)
FT                   /locus_tag="PKH_145190"
FT                   /product="splicing factor 3b, subunit 3, 130kd, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145190"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145190"
FT                   /db_xref="GOA:A0A384KTF6"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KTF6"
FT                   /protein_id="CAQ42300.1"
FT                   /translation="MPVLYHLTLQKPTAITKIAYGNFSGPKVHEIVVSKGQVLELLRAD
FT                   KQGKLNLIVSKDIFGIIRCLQTFRLTGSNKDYVVIGSDSGRLVILQFSNEKNDFVRVHC
FT                   ETYGKSGLRRIIPGEYIAVDPKGRALMICAIERQKFVYILNRDNKEQLTISSPLDAHKS
FT                   HTICHDVVGMDVGFENPMFASIEQNYEMYDKQVTNTTEIDACTRKTLLCLWEMDLGLNH
FT                   VIRKHTLPIDMSAHLLIPIPGGQQGPSGVIVCCDNYLVYKKVEHVDVYCAYPRRLETGQ
FT                   EKNISIVCSTVHRIRKFFFILIQSEYGDLYKIEMDHQDGVVKEITCKYFDTVPVANAIC
FT                   VMKSGSLFVAAEFGNHFFYQFSGIGDDDNEAMCTSKHPSGRNAIIAFRTKKLTNLFLID
FT                   QVYSLSPILDMKILDAKNANSPQIYALCGRGPRSSLRILQHGLSIEELADNELPGRPKY
FT                   IWTIKKDNASDYDGYIIVSFEGSTLILEIGETVEEVVDTLLLTNVTTIHVNILYDNSLI
FT                   QVHDTGIRHINGKVINEWVPPKNKQVKAATSNATQIVISLSGGELIYFEIDESHSLVEI
FT                   FRKSLNVEILCLSIQEVEENKVRANFLAVGCLDNVVRLLSIEKEKYFNQLSTFILPNNS
FT                   SAQDICISEMCELGNDKERKLLFLNIGLNNGVLLRSVVDPITGTLTNHYSKYLGAKNVK
FT                   ICPVHVKKNPALLVLCEKTYLCYVHQGKYIYSPLNYDILEYASSFHSEQCSDGYVAISG
FT                   SSLRIFRFYRLGEVFSQNILHLSFTPRKIVPLPFPSLFYDHDTSIEIERQKNIRMLAII
FT                   EADHNAYDENTLREIQRALKGIQLEGEEHTGSNGPSHSDGRDLQDNLPNGTKNQGHSKN
FT                   QLLEQEENEQMENASSRQNGEVDHNDGEEDEEADDEEEELLYDRIGTVKAGPGKWGSCI
FT                   KIIHPVSLQTIDKISLEMEEAALSVCACELEALHCLIVGTTTNLSLKNRTATTAALRVY
FT                   TYDINYKLNLLHITPVEDQPFCFSPFNGRLLASVGNKLRIYALGKKKLLKKCEYKDIPE
FT                   AIISIKVSGDRIFASDIRESVLVFFYDANMNALRLISDDIIPRWITCSEILDHHTIMAA
FT                   DKFDSVFVLRVPEEAKQEEYGISNKCWYGGEMMAGSNKNRRLEHIMNFHVGEIVTSLQK
FT                   VKLSPTSSECIIYSTIMGTIGAFIPYDNKEELELTQHLEIILRTENPPLCGREHIFFRS
FT                   YYHPVQHVIDGDLCEQFSSLPYDIQRKVAADLERTPDDILRKLEDIRNKIL"
FT   CDS_pept        join(2340842..2340878,2341109..2341437,2341605..2341682)
FT                   /locus_tag="PKH_145200"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145200"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145200"
FT                   /db_xref="InterPro:IPR010625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJU5"
FT                   /protein_id="CAQ42301.1"
FT                   /translation="MGRSSKSRSGGLSTRSSFLKQNPSSGVSRGNSTSAQSYSGGALQP
FT                   QQKSGGFISNMMGTVASGMASGVGFGVAQRAVDAILGPRHIEVSHPNNNAHMNQAAAVS
FT                   SERNNDFRCKPLQDELNQCLTRHSDISLCQNYADSLKSCQQSM"
FT   CDS_pept        join(2342576..2343038,2343196..2343787,2343998..2344238)
FT                   /locus_tag="PKH_145210"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145210"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145210"
FT                   /db_xref="InterPro:IPR012981"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZ55"
FT                   /protein_id="CAQ42302.1"
FT                   /translation="MDNMYHSYFQEGERNFKFASPKLANLVSKEKTIRISPQKGFVIKA
FT                   YEKDGGKVYFNILSSNLIAEFHFKKMPDLNDNEGLRIPLSIGEEKQREDKKGQKYKTYD
FT                   IVLNSKVVSQSKKDLQLKKVIAELVQVAIKNKYNTDTCANLFFFPEHKYKGSNPDDQFI
FT                   KDDQQHKFNVVEEARNEAGASTCEEEKMNKEDIQNFLSVKKPEWDMWFVDKKTFEERHE
FT                   QMEMFYLPYMRTSPLSGTIDCFDFKPPFTSANGKQKEKIGKMGKIEKIDRKETKNNAIF
FT                   KSFLNEYNIELDDDFLRYQQVINTICVIQIQLPFFILAQRSDTRGERCPFAVHEFVNLY
FT                   VADDHLAVFFKKSPLFPAGHNPPYKNFNIRFPFYFESSKAVSQYLEKYHLLNIIIPVSR
FT                   SSATCKLFSGERVNKGDCVVSDDAETSDSSIF"
FT   CDS_pept        complement(join(2344942..2345048,2345179..2345290))
FT                   /locus_tag="PKH_145220"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145220"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145220"
FT                   /db_xref="InterPro:IPR006861"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LBD4"
FT                   /protein_id="CAQ42303.1"
FT                   /translation="MTHSAKDKNVRLERHSAGKTQAYGDQNVRAGSGKFNWGNTTTDLT
FT                   LSETKPTDKNDPMYDSEIEKVTKEGKK"
FT   gap             2346751..2349750
FT                   /estimated_length=3000
FT   CDS_pept        join(2352165..2352182,2352322..2353128,2353286..2353696)
FT                   /locus_tag="PKH_145230"
FT                   /product="KIR protein"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145230"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145230"
FT                   /db_xref="GOA:B3LCZ5"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCZ5"
FT                   /protein_id="CAQ42304.1"
FT                   /translation="MTKPLGQGDLEKLPSQEYFYSKFKSAQDTCDGVTSARAVDDPLKG
FT                   YDNLQNYWDHFVKAWCCMSKMEEGQQQLYEERCNFLYYYIGSLIPSTGAGGSFQEIMKK
FT                   IYEGLSKIDIEDKCSSAYTNIDRNLFMQRRKVHDFSYDYQIMKSLLAKNGNSCDGTYYK
FT                   HLQDAVKAYNDVCVNGGWRRDTYCNKFEEAVGGYEPAKVLQLTSKTETVPRMGEPSGNT
FT                   ILHRDVSLKFTYTSNAHEGYHTNASTMEDNIITAVYSSLGMMTLPMIAFFLYKYTSLFD
FT                   GIKNTFLSRGGRNNSNNRRGRRSTMGRNQHFDDTFTENSMDFSTKYLTDTSTNLSSEVD
FT                   STMNLSTASSTATEDNSAIYDGRPLRGERGASNYGEANNKQQQRQQEQGQRQQQQRRSQ
FT                   HGQRTNMAYHKM"
FT   CDS_pept        complement(join(2355760..2356473,2357066..2357149))
FT                   /locus_tag="PKH_145240"
FT                   /product="hypothetical protein, conserved in P. knowlesi"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145240"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145240"
FT                   /db_xref="GOA:A0A384LMZ8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LMZ8"
FT                   /protein_id="CAQ42305.1"
FT                   /translation="MAPFSFIKISTLIFAYLFLWYQTNYHHQVSALSSLKDDDVSDTTS
FT                   LTSSEEDINKTHGRLKTLQSDGPHVPHKGYGDYRPPQGRGEPSLRRGGGGTSPPFGGQY
FT                   PHPTSRYGTPKKDHVNSKYGTSNFGTLNSGTPKNKSFSRRSKRVKDVLKALWKKCVCQG
FT                   NKHRRLVIIFAVVIMVVLYLLFLQFGCSGIGGTHHFLFPKSMKMMGESGSDVVINIYSA
FT                   VEKASNTAGGAYVIPAIIGILVIGALFGFYCWKREQCNKREKF"
FT   CDS_pept        complement(join(2360856..2361254,2361568..2362215,
FT                   2362478..2363209,2364182..2364862,2366051..2366686,
FT                   2366802..2366899,2367035..2367545,2367840..>2368493))
FT                   /locus_tag="PKH_145250"
FT                   /product="SICA antigen (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145250"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145250"
FT                   /db_xref="InterPro:IPR024285"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCZ7"
FT                   /protein_id="CAQ42306.1"
FT                   /translation="IDFWEKDNGAVKALWDDLAKAMTTEGTKENGNVDCKGLDKPSDRA
FT                   ACNFLHAGLNYLYSTDTTATSLASSTTSVVDVLKNNPSFRQTMGCFLLHAYAKHMKEKA
FT                   TCLIDDGIKKAFDSWQNPENQTGTSCNGTDKNCIPCKWEQDNYDQCKINTNGGAPATGE
FT                   PVENKLKGIIEEDKENHVKTMAKKINEVTALCDQVKCVTARWRKHNTNGGSDRTWEEVW
FT                   KEVGKEIPNVGEALKKATSDGNKNEFEQYCNGLKRVNGVEQGKEACLLIAAGLKNLYDI
FT                   QDNADHVNASFQRTMQCVLLNAIANKLERLPCKEERSVTEGIKKAFENSEKIKGENNCS
FT                   SDKCFKCDRFKTLSTCYVNSNSDPVKTKVDEKLENEDTFKEKSLETKICKPCTGSGTLC
FT                   DQFKCVAKKWGALRGHSDIPPWDKMSGDIGGVLNTLLTNMRDKQSEVATYCSAWDDDAP
FT                   GKANKAACLLVAAGLQRISYFQHEYKPYRTNGDYNPYDNQEYKQLVSCLLLKAVAHRMK
FT                   EESKICNIEEGIKAAFSKADEIKKEKCINGKPCIVCTWDENTQDWLKDCNINNGKGPTV
FT                   NVKTKLNKLLTQEKNKPHVDSTLSAITKEEGNKGPTLCPRLQCLASRVQALQTQGQAEK
FT                   FWKEEVRDLWKDLSAAMTKTKGNDQTGSGCESMDNGSGTATKPPTKPPTRPATGPEKKA
FT                   CNYLHAGLKHLYTTTPSAPSTSGTGNPVLDNPLLKQTVGCLLLHAYAKKMKEDSKCVID
FT                   SGIEKAFKAFNDINNANCNGKGQCVPCPWNEDDYDNCQITITGTSDGTTQTPVTEKLAH
FT                   VQGEINTIAEGDLKNINDISTLCDYIKCAGPKWFKNKKETNNNSTQSWCDFWDTTVKGE
FT                   LLNMFKIIQTNGNDTSKTKHNTTCQSFGDGNPLSVERKACNHIAEGLKYISEVQGVANG
FT                   GTPNSTFQADDKFFKQTMMCAALNLYATKIGDESKEKCPIDESKINEMFTNWNQNHNSP
FT                   CSGSGANNNVCFKCTRQPNFSSCELSVDSSLISTTPSTQSGHNCNSNTDRDNVQDEMKK
FT                   LLNEDQSNLNSIKSNITNTLSTITEMKSSFCTQLQCAIKKKLKNEVKLPNGTPPSWENI
FT                   ESDATKELTALLKDMNDPKKQSAAAQYCNDANVAWNTKGHTERRTNKAACLLFAAGLKH
FT                   IYNQQKGHVNGPSFGQTMGCLFLKEYAKQLKQVANEEKKGYSWVHPLCDIDKGIEHAFE
FT                   QSESIMNATSPCNNGTNSCFVCKQNEGYNNCHIGTDNVKQKVDKLFKDDSTKQTHMQQT
FT                   LENTVCPILLTDLLTPFLPLAPVSIGLSAMAYYLWKYFGPLGKGGPRFRRSPTEIPGPS
FT                   VQEQVLDHVQQDSPHEYQLVKERKPRSAPTRTKRSGRVNRRTIIEIHFEVLDECQKGDT
FT                   QLNQKDFLELLVQEFMGSEFMKEEQVPKEEVLMENVPMEGVPSLASGFMV"
FT   gap             2370185..2372184
FT                   /estimated_length=2000
FT   CDS_pept        join(2374930..2375027,2375345..2375492,2375927..2376947,
FT                   2377115..2377422)
FT                   /locus_tag="PKH_145360"
FT                   /product="hypothetical protein, conserved in Plasmodium
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145360"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145360"
FT                   /db_xref="GOA:B3LCZ8"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniProtKB/TrEMBL:B3LCZ8"
FT                   /protein_id="CAQ42307.1"
FT                   /translation="MQVYIQTVVLWKYTQYACGRRSFKHTPVASTAFSSFPFFDFSSPS
FT                   ADNVISINVGGTIYMTTLNLICKYRNSRLCEIVLGNLVFLLSESVSAPTRGNICLGFIE
FT                   WFLSTSVDASFPIRRFPFRYVLCAGNRFEYILDFLRDGVLICENDINVLTRILIEAVYF
FT                   KLFSLIKILKKKIQLLYSNMGSNVNKNIFKNIIGTLEEKKQNKIKSKEKNNSISRMLNK
FT                   ISAHIKKHKEVKCCIVKKKKNHNVHSLNKVNLLNELNDGDESFTKGEVNMANYKLLSSA
FT                   PRDSGKEEKEIVFVKDLGDKEKNGANIDFNNEGKVNTQHNLPEIILPNPSTLSKYTKNL
FT                   DYNITNNFKNEEDKLKNKNNANGSNQINCLVKNIERKGYSPVSLSPNGNLKSGDNKTLS
FT                   FAKSTSIFIYGKEGYPTCVFTALSHNGIKDPVGTSTQSSNRSLSPTSIGGANYLGYSSF
FT                   DNYTSTSDHLDRACYKYNNYTYNNMNNPRGQILVHSEIDDIEETSPFPILSNVNLGEQI
FT                   FSTTVDF"
FT   CDS_pept        2380561..2382870
FT                   /locus_tag="PKH_145350"
FT                   /product="long-chain-fatty-acid--CoA ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145350"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145350"
FT                   /db_xref="GOA:A0A384L7Q0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L7Q0"
FT                   /protein_id="CAQ42308.1"
FT                   /translation="MEVTKFKRKVYNFLENENEYILKDDDAEESNDASEIKYFDEVKGT
FT                   AKENSSNIFRPKKYDLCQNLEKTKGFLGIEMSNKYEIFCFACKYYYNKEFLGERKKEVR
FT                   GNETILGEYSFKTYGEIKNEIEILASALYQFENIEPNIFTDNGEYDKMKILGIWSKNRI
FT                   EWLTTDFACSAIDFVTVPIYDTMGINSVKYIFQKTQMKICCIEAEKLECLIKLKSELTD
FT                   LHILIIYDEWSLKDDIKQRANKAGYKVYFYKDLIDKFKNQNIIPQYEYYDYDFNSKEKE
FT                   ANSSTKNMSDGKNQKDIKKGPESRSGTDGNNTSGNNGSGSNALMEKLKNNKGKVTDVCT
FT                   IIFTSGSSGMPKGAMLTHNTFITFMQSYIVDGNRLGLMKHDVVLSYLPLAHVYERLIEF
FT                   AVCFFGAKIGYFSGNIKELVSDINELKPTFLITVPRILQKIHDNVMEGLKNKSFIARTL
FT                   VKAALKNKKNAYLKNSKKFSHPVYDVILQPVRNRFGGRIRTQVMGSASMDKNKLVDLQM
FT                   LFSAPISEGWGMTEVGVGFLQHRYDSTKGTIGGMFSNVTMKVVEVENMKYDPKAYPNRG
FT                   ELCVKGSSLMVGYFRDEQLTKKSFDEDGFFYTGDVVEINENNAYVRIIDRAKNIFKLAQ
FT                   GEYVEPEKLENIYTNSIYIENIFVHGYNYENELVSIIVPNEIFVLDYAKKNNLNMPFEE
FT                   LLKCDAIKKLFYNEILTMSKTYNLNGIEKIHLFHLTPTPFSVENKQLTPTHKVVRNAIL
FT                   ADYKKIIDDLYESRKK"
FT   CDS_pept        complement(2386085..2387599)
FT                   /locus_tag="PKH_145340"
FT                   /product="serine/threonine protein, kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145340"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145340"
FT                   /db_xref="GOA:A0A384L1Q7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1Q7"
FT                   /protein_id="CAQ42309.1"
FT                   /translation="MEKRYHQLFKGKRIDFPLATGAASHVSLTYDEKKNPYLLCWTYMY
FT                   QENPEFTVPLKGCRIINNITEIGPCIHIITANEEYQFQCRSKEEFNEMSQFFNMLGFPI
FT                   LGFKNVYVLNKKIGKGSFSTAYIGTNILYGNRVVVKEVDKSKVKESNVYTEIEVLRKVM
FT                   HKYIIKLISAYEQEGFVYLVLEYLKGGELFEYLNNNGPYTEQVARKAIKRILIALEALH
FT                   SNGVVHRDLKMENLMLENVNDPSSLKIIDFGLASFLNSPSMNMRCGSPGYVAPEILKYA
FT                   SYGTKVDIFSLGVILFNILCGYPPFRGNNVKEIFKKNMRCHISFNTKHWLTKSENVKEI
FT                   ILWMCSKNPDDRCTAIQALGHPWFLPKITDMHMNANINELKNKENLIQKLREQEMRKKC
FT                   KHYNIVENGEKNKGEPEDRKNSKHNFNDYKNYFDTMLKIDDKYSENLIKDKSSIDSITL
FT                   NRKDYDAYMTNSNEYETVVLHGGCPAPNRSSSLISCKHFRKKSNES"
FT   CDS_pept        complement(2391687..2394107)
FT                   /locus_tag="PKH_145330"
FT                   /product="phosphohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145330"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145330"
FT                   /db_xref="GOA:A0A384LPP7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPP7"
FT                   /protein_id="CAQ42310.1"
FT                   /translation="MNMQYNNIGPGCEISSVKEFLRNICLDREDKIIQNLELRNVRTVY
FT                   DFLRYVSYLTVTSCTGMSNDENVDISSQSNVQFVNSHENNLQNDVNVNGKLTQRNGDLG
FT                   NLGDPELCNGHSPANGVKGDRCNGVQKNGQQAEVTPNGGVVPNGGIVPNGGIVPNGGIV
FT                   PNGGIVPNGGEVLNGRDNAATKNEVTYACKEIAAMQDYYERAKEKRNHAEKKGEYMYFD
FT                   MYIKSEVIKTFPTTDRDKERLINYIYKVMDVNDLLMMCIHFGLPHLWPKFEQSKIRNVD
FT                   LFKRIIIEGRKFERVKNEMGISFSEFVQILNFALSVKKKRIFCNNIFSQFDPCDCKNKK
FT                   KHTKTICDKIHQFIEFDNWTFKNIIDNPFFQRLRNLSQLGVCQFVYPGATHTRFEHSLG
FT                   VGYLSAKYFVHLCNRYNLSPYCGELNKMLRCVQIAGLCHDLGHGPFSHTFESFFMNYKK
FT                   EDTDIKWNHASTSLKIVEHIIENLIDQDDVLDSTDIEIIKKLIRGREHHKSLCGVDPVD
FT                   SLIEASYDIICNNMNGLDADKFDYLQRDATIAPPNGTLPSLNCNRIISQSSVINGHIAY
FT                   NVKEIHPVWTVYMNRFSLFKQVYTHRKVRVMELMLCDGFRLADDIFKWSESLQDLDTFL
FT                   DLTDSSIIYDIKNRAKKHKYDEKVQKSLNLINSVIHDRNSNHAYKYISEINLSEPQLIK
FT                   YLKDIANEERIARYAHGLSPDDIVIDWNYLNYGMGANDPLDSVYFYSSDNEDEAFIAHK
FT                   EYRGTHPRYFEECNVRLYCKNKMVAHLAKDAHNKFMSDVFSESSPLYRKKIVK"
FT   CDS_pept        join(2396526..2397164,2397479..2397652)
FT                   /locus_tag="PKH_145320"
FT                   /product="50S ribosomal protein L23, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145320"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145320"
FT                   /db_xref="GOA:A0A384KCV7"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KCV7"
FT                   /protein_id="CAQ42311.1"
FT                   /translation="MFLTFVRHTPPKTPRNVFFPWHNFSIHKSGSFLEKNRLALRVPIN
FT                   LTKFEIREYLRKIYNAKVIKVNTLIKVPERRRNLTDYRFNYYRNGPRYKKAIITLEHEV
FT                   PDSVKMIQSCKNIGRNPYITKKNVIYGVRSDVKITPTRSQLWHMGECRYSWRLPLTNLL
FT                   ADYKMNLNPDLRIDENLVQLAPDVTKPFMHSGISSETFKPNSVAEQTFPKIDLTPWRRQ
FT                   VKKIYESGTLAPPESFPKDAKRHQTIEYAGENKNFKRSSRSSQWKAPS"
FT   CDS_pept        2403790..2410848
FT                   /locus_tag="PKH_145310"
FT                   /product="AP2 family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145310"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145310"
FT                   /db_xref="GOA:A0A384LEK8"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR028078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LEK8"
FT                   /protein_id="CAQ42312.1"
FT                   /translation="MPMLRQMNDEMCAKEELSKVEKKIRRKCKGDKADNNDDGEHFTND
FT                   GNLPYSNYYAERNDDEGCNKSDDQSDDAPYNLGNAVSRNIRTDGVLNEGDVYHRKFNSG
FT                   HAYDEEYSNVNDNTRGGMYEENVRIGEAVNKGGTNLESNLKESFMTMLNMKCNMQEGKI
FT                   QDREISSYKEFLKNNSNADLSDPVTIYEENTNGKNGLDNVSNDDFVHQDKQHQCNEMSR
FT                   DDFVKEYNESSSAYQDRENRGVTHFVEHKKAYDDRSGQFEDPPREKKKHPPKRAMGGAP
FT                   SSGEYDSSEGNGDTLYCVKKENGSGGSNESVKGKELMTNEEEKYFSRDIAKKILNNMDL
FT                   MYKLSRGTHSREDADANDEEEGDKFKMRLLNKYNTVNYVSNVIQDLSKNRGEDEREEND
FT                   SGVDRIMGTSFGINMGAVAEGSDVNNKNGGNYKVINTNVNSGSDKHDLLIPSGGKVKAL
FT                   VNRRGKKKQTILTKSKENIVVGHDEEEEDYSKGMYIMHENNSSNASQNSNKISPGQDGI
FT                   QSGNKLSGSSNSNGPNLQKRVECMMKGSSSINNYDYSSYGVNSKGNPVELMKSKQKYSS
FT                   QAGEHKYVVGQNNNRSSSSTNPVYHISGNKMGKSKTESNGNINTYQNGEYSERESNLKN
FT                   LDRKEEEATAFSNYNISMGNKTSKVREIAPNEFPVNSTMNNFCGLIQGNNRKNNDTKKS
FT                   GANLVNINCEGRGVDHNQGSNNYKGMYTMDGDGTERANESVQYNCDENYSKEIPAKVNY
FT                   HSVFSSRIRNVKGEKYSYLKKSKKCSNLANVNSDAHVETDGDYGGSYQRKDESANSQMK
FT                   DPLRYKGGKSHKEESINGKNGKGENVFEEYDKGSDVSYPDEGHDRQGQENPSREFHQSC
FT                   QSAQSDKSHQSHQVDMLTNLPPEVFQAGCTSNNAPARYVHKRYSRNGEGEVEQFYKVEE
FT                   DEKSHVADHTHELNENEQKDEQNYCDQWNEHFLNALNDVKRKLKQASNKGDYSKSGSCS
FT                   VSAKDVMNVEHEMENFTKNKNSLYLNNYEEISKAIFNITDNPKIDDLTKKKLLSRIENS
FT                   FFTDKNDIMPLLHGEGEGDAMQGEMHQGDYMEVLAEQEEVVKGVSRCGSKCGSKCGSKC
FT                   GSKCGSKCGSRNEAMGGTRNSNKSLPKNGTRIVHQGDHQERLGYFNQGESVRRSKKNEF
FT                   KVQHTSYPIDGVRNRNSNECFGEHFDECFDENFGKRCSTLQQMMGPHEGQQSGGNADYA
FT                   YEESKAHLYDMNGKENTKNVRVKGRRNKRSKKSMNVTDERGREDEALQLVGEGMKEKYE
FT                   TCDGIRNGMSGADNGNAVSSENISVVSSGKNEGNYVDEMNINLTHKNLVQEGPVKAPLG
FT                   SRTLKRGKRPNNFKENNDHGELKKVAARKCERAKEVEKYGREVIDHADDRLFLYSNVGR
FT                   GSSLGSGYTAGGETNVNNEEFSSRKFHPEGKKHSTQYVSMKDEAYPSVETNKSVYPRKR
FT                   TEHEEEDLSLVSVRNEYDDGREMASTMSRYKSDDIFIKKYDLTNDEKKQKLYLADIMRS
FT                   NELKQMNDSYFKLSSNFPSNLLSTSTSSSYSNDNLRGSTNNYSFNELSSNTLTSKFHLD
FT                   ESMPSNMNLSSQMYRNNYSSYEKKKKKSDKRNLSSLYNNTPTTYATCMNDSSSTTMKLI
FT                   DHDISNDEIMNQKAKNYIMSVNGQNDKEGVKDNQNADMHMEYLTKEIIKGNKNIINLNK
FT                   KTGDNKMQGEKNDMLVIPEGTPLSDALSSNPNLPYGLIVDGVDDHIGSHTIHANRTNLT
FT                   NSNVGNDNVHVEASVKGYAERLNEKELAEDGKNHSENGKYLNFLKKKISSSHSDHKGSD
FT                   VSNHMRHNMLHQIDVKSENEFLLNRNNSLNLNFGELSQGMLDYDNMEDEHSGVNSSRNH
FT                   AYDGMVRVKDEKMCNSNFSDQVKMSESFGQQMVIDAMAPTDKEEQLGEDAANGTISETV
FT                   SGTIMGAIDGSPTDQAVGLPSDAPNEPSNPSGSSPKNEIDISICTLANCPTHNPQVYTK
FT                   NGSRKGDGQGEGGMMQEENDELKRIPGVYYDKNSQRWFGEHKINGVKCAQSFAVKKHGC
FT                   EEAKRLAIEWKKARIRGEVWDRFINKKKKSSNSPNCVNKTAKTSRPSVEELRIKYLSMS
FT                   KNMPKVRGVWFNSTPQRMGWVGQAYKKCKRIERIFSVNKYGFEGARKLAIAFRNSQKPS
FT                   NEDSDEDSWSKNDKMAIEGGEENLNNYEYKNEYSGSNELTIKNNNSSSSSSNEINHTKI
FT                   ETKDTRINLCRDAILFILHDLETILELNIPMLHKNVNIYKICIKHHLNYLTLIKSEEQI
FT                   IPYLNIFGDYIQRCILPTDLPYAELYVLIDSLVHNDILPSFDHKENFSEYAMAEDPGII
FT                   TPSMLL"
FT   CDS_pept        2413216..2413842
FT                   /locus_tag="PKH_145300"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145300"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145300"
FT                   /db_xref="GOA:A0A384LE51"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LE51"
FT                   /protein_id="CAQ42313.1"
FT                   /translation="MGRSDNYFRLSGDIQTKEHKHYKTKRNKGEDEKAELFCFICLEEN
FT                   LENSYLISCCSVCTACVHKRCWYSWRKTQKLSSLRSKILGLNKLDPLLCTICKTGTAKI
FT                   EDEKDFKWVASDNINKEYLQDELLRTIASILNNEGNDNNIPILHFRYIFSINLIFLIIT
FT                   FVVIIIFTVVFHFTATYVLLIALFVLYEIIVLQIVLYLYVRIRSS"
FT   CDS_pept        join(2414657..2414872,2415171..2416009,2416459..2416603,
FT                   2416766..2417648,2417825..2417931,2418920..>2419458)
FT                   /locus_tag="PKH_145290"
FT                   /product="SICA antigen (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145290"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145290"
FT                   /db_xref="InterPro:IPR024290"
FT                   /db_xref="UniProtKB/TrEMBL:B3LD05"
FT                   /protein_id="CAQ42314.1"
FT                   /translation="MVDGVGGPASADACSGGQSDAERKASEDTRTKLKDAWDDKLKELR
FT                   EKWQKEQSLNALSQGGSGTPVPVGFIPPDVKSKADEMLEDLGTYLDLLNHSQTAADACA
FT                   ELTGRYKGETSDVKKVCTVLVKVVNWMGGLTANGVEKKNKISEQNWVQYLRCVIGYEVI
FT                   LRTLTKKCKAQRMLKIISDTMEKGGSKPTGPNVSSICPWVKLEDIGDNEGSIGNEVQKW
FT                   LNKAKGGSSGGGIRGFDNIVAWYRCTEKEEEEEKAKQKAQTCQSDRIMDLMKGGMSHQL
FT                   NVLVDPIAAANDCIEKAENNGKDRALCNRLKCIEEYLQETTTTPATTAAATEQSGKRET
FT                   EHIEDDDDGKKFGGAVGGSGTGSGGGAGGTKPMWQAWLEKWLQQNGATVTNGVVSGKSI
FT                   TEKLWEDLKSTYDAFVEEVGTQESFEISKLCETTGKFAPQGGYESGVKTLCQAILKIRY
FT                   FMSGVKTKRRGQTHDKRLIDHPVRIEGNMPPGETFKRCIVGMVGLWDIYQDHCKLGDVI
FT                   QKVQADVDKKLVDHLKGQYRANLNMCRSITPEGLTIGRTVLGDRIKQWARHDRGEAEEH
FT                   NTVGKLVGRQSRANRWVGGALYLGEAMCPKEEDARREAREDNMKVMAQFISLPSTTQDG
FT                   GNSSKHSVLDVLMNDNIRIPDSTLENVLPGIMDTTTGKVDLDKLNKAIEKIEKDAGTAL
FT                   KGGQCKDIEGLCGRAQCAGNQWFKDRGKDGTVDKEKNNNIWPGVLTTFRGEKNNLFFFS
FT                   IGFLGEERERRFLKGEEGNKKEGLLREKKKEALRGRERRFSKGKKKKVLKGKEKKKEGL
FT                   KQKKKKIQGGEEKEGFHREEEKEGFLKEEGKKKVFRGKEKKKVFEGGRERRFLKEEKKK
FT                   EGLLKEEEKEDFLRDKKERRFLRGGKKKKVLFPRSLEQ"
FT   CDS_pept        join(<2422199..2422345,2422490..>2423357)
FT                   /locus_tag="PKH_145260"
FT                   /product="SICA antigen (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145260"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145260"
FT                   /db_xref="InterPro:IPR024290"
FT                   /db_xref="UniProtKB/TrEMBL:B3LD06"
FT                   /protein_id="CAQ42315.1"
FT                   /translation="FFGGRHTTMAKPAGSGSDLFKAWLRERMSAARAAQGGAAGAPLAA
FT                   DGITEELRKSLEAAWNELKDSLTNAGVQEIKDLCGVQFAKGVEEVEGDGERRFRNEYVK
FT                   DLCAGLMGIRYFMSGITELGGGSRNVKVEKNLTQGQWFARCTVGMMALSEIYGDHCKLD
FT                   IVLRQMGNKVEGNLRSQLNGSSEGMISKCEGEVDPTALMIGRTVLGNKIKDWVHSNRGG
FT                   GGNSPWRVRNLWKNKWKFVCPHERGQITPEERRQKLNENKNTMAQFMSLGNTQSSASQE
FT                   STIADILGDPDNKYTFKEETLKKVFMDTMQNDGTSGPNSFDVDRALQKIEDVSQTTV"
FT   gap             2423980..2427979
FT                   /estimated_length=4000
FT   CDS_pept        complement(2431108..2434170)
FT                   /locus_tag="PKH_145370"
FT                   /product="vacuolar-type H+-translocating inorganic
FT                   pyrophosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145370"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145370"
FT                   /db_xref="GOA:B3LD07"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:B3LD07"
FT                   /protein_id="CAQ42316.1"
FT                   /translation="MLPFHGNGKRKRFPNVMSFFGGVYSKGSFQSRKVGDVPKTQKGEN
FT                   LPYMRNAQGWSLPMGEVQYEQCGDYEDDVTSFGCLKWYINRSRKQRILINAGVLLAFAT
FT                   ATYGTYQTVDNVKTVCLVGLSLYSAFFLLFALHMLSSVLKDEYDSYSSVPGSDGWMGNG
FT                   RKDGVTTYQIRVTPEQIGLPHRNSQTMEPNNGDKRGEGRTEVVHETGDQTLGAPNDGYE
FT                   VLSLEDIAKPIKEGSEGFFAVQYNSIFKISVAFTILLMFLYMLRGDNTKFPREKNTMME
FT                   GITEEYIEISPFAYSIITSISFLLGATCSSIAAYNGIYVAVRANVRVAKASTYSYRKAL
FT                   MTCFRSGAISAIVNVALAIFGICSLLVLINILYPSLSFTKYPLLIVGYGFGASLVAMLY
FT                   QLAGGIYTKAADIGADLVGKVEKHIPEDDARNPAVIADLVGDNVGDCAGQCADLFESIS
FT                   AEIIASMILGGTLCENGIISEKRANYFVLFPLFVHSMDLLVSTIGVYLVRTRSDYASNP
FT                   VGRKARVNSKQHVGEDKYIHLSSASYNAAMENGANVNIHSANGDTALSSISRDHYNDNE
FT                   LEMIGEHLENPLKVMLRAYIVTCLLAMGFFFFFCKMLFVMGENRPNDYSWVYLSLCGLV
FT                   GMVCSYLFVILTRYYTDYSYPKVRKIAHASLSGPATNIITGLYVGMESTFLPTIVISVS
FT                   LLASYYLGLASNLTGDGRAINGLYGTSVATMGMLSTAVFILSMSNFGPIADNAGGIVEM
FT                   SNQPESVRFITDKLDAVGNVTKANTKGYSVGSAALACFLLFSAFLSEVSLHAKTPFTTV
FT                   DIALPEVFIGGILGSVVVFLFASWSLDAVGNTAEEVLKEVRRQFNEHPGILTYDEKPDY
FT                   HTCVSIISRKALIETIKPGLLALCAPIIIGLLFKQIGKFRNNDLLGAQVIASFIMFSTS
FT                   TGILMALFLNNAGGAWDNAKKYIESGFYGGKNSPAHVSSVIGDTVGDPCKDTAGPSIHV
FT                   LIKLISTITMVSSVHRRDAAVRMGSVKSVSH"
FT   CDS_pept        2437296..2441846
FT                   /locus_tag="PKH_145380"
FT                   /product="hypothetical protein, conserved in Apicomplexan
FT                   species"
FT                   /db_xref="EnsemblGenomes-Gn:PKH_145380"
FT                   /db_xref="EnsemblGenomes-Tr:PKH_145380"
FT                   /db_xref="GOA:A0A384KHX1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR034261"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039515"
FT                   /db_xref="InterPro:IPR039780"
FT                   /db_xref="UniProtKB/TrEMBL: