(data stored in SCRATCH zone)

EMBL: AM920428

ID   AM920428; SV 1; linear; genomic DNA; STD; FUN; 3889175 BP.
XX
AC   AM920428;
XX
PR   Project:PRJEA27927;
XX
DT   01-NOV-2008 (Rel. 97, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Penicillium chrysogenum Wisconsin 54-1255 complete genome, contig Pc00c13
XX
KW   .
XX
OS   Penicillium rubens Wisconsin 54-1255
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium;
OC   Penicillium chrysogenum species complex.
XX
RN   [1]
RP   1-3889175
RA   van den Berg M.A.;
RT   ;
RL   Submitted (22-NOV-2007) to the INSDC.
RL   van den Berg M.A., DAI/INNO (624-0270), DSM Anti-Infectives, Alexander
RL   Fleminglaan 1, Delftn, 2613 AX, NETHERLANDS.
XX
RN   [2]
RP   1-3889175
RX   DOI; 10.1038/nbt.1498.
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.M.,
RA   Driessen A.J., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.H.,
RA   Joardar V., Kiel J.A., Kovalchuk A., Martin J.F., Nierman W.C.,
RA   Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.N.,
RA   Veenhuis M., von Dohren H., Wagner C., Wortman J., Bovenberg R.A.;
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum";
RL   Nat. Biotechnol. 26(10):1161-1168(2008).
XX
RN   [3]
RX   DOI; 10.1111/j.1600-0854.2006.00479.x.
RX   PUBMED; 16978390.
RA   Kiel J.A., Veenhuis M., van der Klei I.J.;
RT   "PEX genes in fungal genomes: common, rare or redundant";
RL   Traffic 10:1291-1303(2006).
XX
DR   MD5; 66fc579b9ff54dc0d0ba4ccb1aa7e4ac.
DR   BioSample; SAMEA2272345.
DR   EnsemblGenomes-Gn; ENSRNA049573942.
DR   EnsemblGenomes-Gn; ENSRNA049574042.
DR   EnsemblGenomes-Gn; ENSRNA049574097.
DR   EnsemblGenomes-Gn; ENSRNA049574142.
DR   EnsemblGenomes-Gn; ENSRNA049574182.
DR   EnsemblGenomes-Gn; ENSRNA049574226.
DR   EnsemblGenomes-Gn; ENSRNA049574271.
DR   EnsemblGenomes-Gn; ENSRNA049574494.
DR   EnsemblGenomes-Gn; ENSRNA049574537.
DR   EnsemblGenomes-Gn; ENSRNA049574582.
DR   EnsemblGenomes-Gn; ENSRNA049574625.
DR   EnsemblGenomes-Gn; ENSRNA049574710.
DR   EnsemblGenomes-Gn; ENSRNA049574747.
DR   EnsemblGenomes-Gn; ENSRNA049574824.
DR   EnsemblGenomes-Gn; ENSRNA049574882.
DR   EnsemblGenomes-Gn; ENSRNA049641314.
DR   EnsemblGenomes-Gn; ENSRNA049641342.
DR   EnsemblGenomes-Gn; ENSRNA049641397.
DR   EnsemblGenomes-Gn; ENSRNA049641427.
DR   EnsemblGenomes-Gn; ENSRNA049641457.
DR   EnsemblGenomes-Gn; ENSRNA049641477.
DR   EnsemblGenomes-Gn; ENSRNA049641509.
DR   EnsemblGenomes-Gn; PCH_Pc13g00020.
DR   EnsemblGenomes-Gn; PCH_Pc13g00080.
DR   EnsemblGenomes-Gn; PCH_Pc13g00160.
DR   EnsemblGenomes-Gn; PCH_Pc13g00210.
DR   EnsemblGenomes-Gn; PCH_Pc13g00240.
DR   EnsemblGenomes-Gn; PCH_Pc13g00290.
DR   EnsemblGenomes-Gn; PCH_Pc13g00310.
DR   EnsemblGenomes-Gn; PCH_Pc13g00330.
DR   EnsemblGenomes-Gn; PCH_Pc13g00610.
DR   EnsemblGenomes-Gn; PCH_Pc13g00630.
DR   EnsemblGenomes-Gn; PCH_Pc13g01080.
DR   EnsemblGenomes-Gn; PCH_Pc13g01290.
DR   EnsemblGenomes-Gn; PCH_Pc13g01580.
DR   EnsemblGenomes-Gn; PCH_Pc13g01610.
DR   EnsemblGenomes-Gn; PCH_Pc13g01810.
DR   EnsemblGenomes-Gn; PCH_Pc13g01930.
DR   EnsemblGenomes-Gn; PCH_Pc13g02090.
DR   EnsemblGenomes-Gn; PCH_Pc13g02100.
DR   EnsemblGenomes-Gn; PCH_Pc13g02140.
DR   EnsemblGenomes-Gn; PCH_Pc13g02150.
DR   EnsemblGenomes-Gn; PCH_Pc13g02160.
DR   EnsemblGenomes-Gn; PCH_Pc13g02340.
DR   EnsemblGenomes-Gn; PCH_Pc13g02580.
DR   EnsemblGenomes-Gn; PCH_Pc13g02640.
DR   EnsemblGenomes-Gn; PCH_Pc13g02870.
DR   EnsemblGenomes-Gn; PCH_Pc13g03100.
DR   EnsemblGenomes-Gn; PCH_Pc13g03390.
DR   EnsemblGenomes-Gn; PCH_Pc13g03570.
DR   EnsemblGenomes-Gn; PCH_Pc13g03810.
DR   EnsemblGenomes-Gn; PCH_Pc13g04340.
DR   EnsemblGenomes-Gn; PCH_Pc13g05170.
DR   EnsemblGenomes-Gn; PCH_Pc13g05420.
DR   EnsemblGenomes-Gn; PCH_Pc13g05720.
DR   EnsemblGenomes-Gn; PCH_Pc13g05870.
DR   EnsemblGenomes-Gn; PCH_Pc13g05880.
DR   EnsemblGenomes-Gn; PCH_Pc13g05980.
DR   EnsemblGenomes-Gn; PCH_Pc13g06050.
DR   EnsemblGenomes-Gn; PCH_Pc13g06560.
DR   EnsemblGenomes-Gn; PCH_Pc13g06940.
DR   EnsemblGenomes-Gn; PCH_Pc13g07090.
DR   EnsemblGenomes-Gn; PCH_Pc13g07100.
DR   EnsemblGenomes-Gn; PCH_Pc13g07330.
DR   EnsemblGenomes-Gn; PCH_Pc13g07620.
DR   EnsemblGenomes-Gn; PCH_Pc13g07850.
DR   EnsemblGenomes-Gn; PCH_Pc13g07860.
DR   EnsemblGenomes-Gn; PCH_Pc13g07900.
DR   EnsemblGenomes-Gn; PCH_Pc13g08060.
DR   EnsemblGenomes-Gn; PCH_Pc13g09220.
DR   EnsemblGenomes-Gn; PCH_Pc13g09390.
DR   EnsemblGenomes-Gn; PCH_Pc13g09850.
DR   EnsemblGenomes-Gn; PCH_Pc13g10410.
DR   EnsemblGenomes-Gn; PCH_Pc13g10460.
DR   EnsemblGenomes-Gn; PCH_Pc13g10990.
DR   EnsemblGenomes-Gn; PCH_Pc13g11070.
DR   EnsemblGenomes-Gn; PCH_Pc13g11430.
DR   EnsemblGenomes-Gn; PCH_Pc13g11510.
DR   EnsemblGenomes-Gn; PCH_Pc13g11540.
DR   EnsemblGenomes-Gn; PCH_Pc13g12070.
DR   EnsemblGenomes-Gn; PCH_Pc13g12680.
DR   EnsemblGenomes-Gn; PCH_Pc13g12900.
DR   EnsemblGenomes-Gn; PCH_Pc13g13680.
DR   EnsemblGenomes-Gn; PCH_Pc13g13690.
DR   EnsemblGenomes-Gn; PCH_Pc13g13700.
DR   EnsemblGenomes-Gn; PCH_Pc13g13830.
DR   EnsemblGenomes-Gn; PCH_Pc13g13840.
DR   EnsemblGenomes-Gn; PCH_Pc13g13900.
DR   EnsemblGenomes-Gn; PCH_Pc13g14320.
DR   EnsemblGenomes-Gn; PCH_Pc13g14350.
DR   EnsemblGenomes-Gn; PCH_Pc13g14590.
DR   EnsemblGenomes-Gn; PCH_Pc13g14710.
DR   EnsemblGenomes-Gn; PCH_Pc13g14860.
DR   EnsemblGenomes-Gn; PCH_Pc13g14890.
DR   EnsemblGenomes-Gn; PCH_Pc13g14900.
DR   EnsemblGenomes-Gn; PCH_Pc13g15020.
DR   EnsemblGenomes-Gn; PCH_Pc13g15060.
DR   EnsemblGenomes-Gn; PCH_Pc13g15070.
DR   EnsemblGenomes-Gn; PCH_Pc13g15080.
DR   EnsemblGenomes-Gn; PCH_Pc13g15090.
DR   EnsemblGenomes-Gn; PCH_Pc13g15100.
DR   EnsemblGenomes-Gn; PCH_Pc13g15210.
DR   EnsemblGenomes-Gn; PCH_Pc13g15870.
DR   EnsemblGenomes-Tr; CAP91085.
DR   EnsemblGenomes-Tr; CAP91227.
DR   EnsemblGenomes-Tr; CAP91230.
DR   EnsemblGenomes-Tr; CAP91262.
DR   EnsemblGenomes-Tr; CAP91279.
DR   EnsemblGenomes-Tr; CAP91283.
DR   EnsemblGenomes-Tr; CAP91303.
DR   EnsemblGenomes-Tr; CAP91379.
DR   EnsemblGenomes-Tr; CAP91426.
DR   EnsemblGenomes-Tr; CAP91611.
DR   EnsemblGenomes-Tr; CAP91641.
DR   EnsemblGenomes-Tr; CAP91656.
DR   EnsemblGenomes-Tr; CAP91657.
DR   EnsemblGenomes-Tr; CAP91667.
DR   EnsemblGenomes-Tr; CAP91674.
DR   EnsemblGenomes-Tr; CAP91779.
DR   EnsemblGenomes-Tr; CAP92220.
DR   EnsemblGenomes-Tr; CAP92223.
DR   EnsemblGenomes-Tr; CAP92501.
DR   EnsemblGenomes-Tr; EFT00001517150.
DR   EnsemblGenomes-Tr; EFT00001517151.
DR   EnsemblGenomes-Tr; EFT00001517152.
DR   EnsemblGenomes-Tr; EFT00001517153.
DR   EnsemblGenomes-Tr; EFT00001517154.
DR   EnsemblGenomes-Tr; EFT00001517155.
DR   EnsemblGenomes-Tr; EFT00001517156.
DR   EnsemblGenomes-Tr; EFT00001517157.
DR   EnsemblGenomes-Tr; EFT00001517158.
DR   EnsemblGenomes-Tr; EFT00001517159.
DR   EnsemblGenomes-Tr; EFT00001517160.
DR   EnsemblGenomes-Tr; EFT00001517161.
DR   EnsemblGenomes-Tr; EFT00001517162.
DR   EnsemblGenomes-Tr; EFT00001517163.
DR   EnsemblGenomes-Tr; EFT00001517164.
DR   EnsemblGenomes-Tr; EFT00001517165.
DR   EnsemblGenomes-Tr; EFT00001517166.
DR   EnsemblGenomes-Tr; EFT00001517167.
DR   EnsemblGenomes-Tr; EFT00001517168.
DR   EnsemblGenomes-Tr; EFT00001517169.
DR   EnsemblGenomes-Tr; PCH_Pc13g00020.
DR   EnsemblGenomes-Tr; PCH_Pc13g00080.
DR   EnsemblGenomes-Tr; PCH_Pc13g00210.
DR   EnsemblGenomes-Tr; PCH_Pc13g00240.
DR   EnsemblGenomes-Tr; PCH_Pc13g00290.
DR   EnsemblGenomes-Tr; PCH_Pc13g00310.
DR   EnsemblGenomes-Tr; PCH_Pc13g00330.
DR   EnsemblGenomes-Tr; PCH_Pc13g00610.
DR   EnsemblGenomes-Tr; PCH_Pc13g00630.
DR   EnsemblGenomes-Tr; PCH_Pc13g01080.
DR   EnsemblGenomes-Tr; PCH_Pc13g01290.
DR   EnsemblGenomes-Tr; PCH_Pc13g01810.
DR   EnsemblGenomes-Tr; PCH_Pc13g02090.
DR   EnsemblGenomes-Tr; PCH_Pc13g02150.
DR   EnsemblGenomes-Tr; PCH_Pc13g02160.
DR   EnsemblGenomes-Tr; PCH_Pc13g02580.
DR   EnsemblGenomes-Tr; PCH_Pc13g02640.
DR   EnsemblGenomes-Tr; PCH_Pc13g02870.
DR   EnsemblGenomes-Tr; PCH_Pc13g03390.
DR   EnsemblGenomes-Tr; PCH_Pc13g03810.
DR   EnsemblGenomes-Tr; PCH_Pc13g04340.
DR   EnsemblGenomes-Tr; PCH_Pc13g05170.
DR   EnsemblGenomes-Tr; PCH_Pc13g06560.
DR   EnsemblGenomes-Tr; PCH_Pc13g06940.
DR   EnsemblGenomes-Tr; PCH_Pc13g07090.
DR   EnsemblGenomes-Tr; PCH_Pc13g07330.
DR   EnsemblGenomes-Tr; PCH_Pc13g07620.
DR   EnsemblGenomes-Tr; PCH_Pc13g07850.
DR   EnsemblGenomes-Tr; PCH_Pc13g07860.
DR   EnsemblGenomes-Tr; PCH_Pc13g07900.
DR   EnsemblGenomes-Tr; PCH_Pc13g08060.
DR   EnsemblGenomes-Tr; PCH_Pc13g09220.
DR   EnsemblGenomes-Tr; PCH_Pc13g09390.
DR   EnsemblGenomes-Tr; PCH_Pc13g09850.
DR   EnsemblGenomes-Tr; PCH_Pc13g10410.
DR   EnsemblGenomes-Tr; PCH_Pc13g10460.
DR   EnsemblGenomes-Tr; PCH_Pc13g10990.
DR   EnsemblGenomes-Tr; PCH_Pc13g11070.
DR   EnsemblGenomes-Tr; PCH_Pc13g11430.
DR   EnsemblGenomes-Tr; PCH_Pc13g12070.
DR   EnsemblGenomes-Tr; PCH_Pc13g12680.
DR   EnsemblGenomes-Tr; PCH_Pc13g12900.
DR   EnsemblGenomes-Tr; PCH_Pc13g13680.
DR   EnsemblGenomes-Tr; PCH_Pc13g13690.
DR   EnsemblGenomes-Tr; PCH_Pc13g13700.
DR   EnsemblGenomes-Tr; PCH_Pc13g13830.
DR   EnsemblGenomes-Tr; PCH_Pc13g13840.
DR   EnsemblGenomes-Tr; PCH_Pc13g13900.
DR   EnsemblGenomes-Tr; PCH_Pc13g14350.
DR   EnsemblGenomes-Tr; PCH_Pc13g14590.
DR   EnsemblGenomes-Tr; PCH_Pc13g14710.
DR   EnsemblGenomes-Tr; PCH_Pc13g14860.
DR   EnsemblGenomes-Tr; PCH_Pc13g14890.
DR   EnsemblGenomes-Tr; PCH_Pc13g14900.
DR   EnsemblGenomes-Tr; PCH_Pc13g15020.
DR   EnsemblGenomes-Tr; PCH_Pc13g15060.
DR   EnsemblGenomes-Tr; PCH_Pc13g15070.
DR   EnsemblGenomes-Tr; PCH_Pc13g15080.
DR   EnsemblGenomes-Tr; PCH_Pc13g15090.
DR   EnsemblGenomes-Tr; PCH_Pc13g15100.
DR   EnsemblGenomes-Tr; PCH_Pc13g15210.
DR   EnsemblGenomes-Tr; PCH_Pc13g15870.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00026; U6.
DR   RFAM; RF00335; snoZ13_snr52.
DR   RFAM; RF01247; snR32.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3889175
FT                   /organism="Penicillium rubens Wisconsin 54-1255"
FT                   /strain="Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /clone="Pc00c13"
FT                   /db_xref="taxon:500485"
FT                   /citation=[1]
FT   mRNA            join(<1739..1792,1871..>2392)
FT                   /gene="Pc13g00010"
FT                   /locus_tag="PCH_Pc13g00010"
FT   CDS_pept        join(1739..1792,1871..2392)
FT                   /gene="Pc13g00010"
FT                   /locus_tag="PCH_Pc13g00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91070"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G9"
FT                   /protein_id="CAP91070.1"
FT                   /translation="MALGASVAIPGASTLAFKRPWSQRFQTHHLIIESYTTSSPSEKTK
FT                   CLHKEDQWHCRGPPRYKKKFTEVSRWGGSIIMVLTNIGSDRQHPTQRVEGIINSIYAEM
FT                   SRMQHNYILMLQNRDNMLRAYANDRRAYANENASLEEQNRSLLEHVKSLQRENCSLELK
FT                   HNQQMSEWAKERLQCPEKPDGKRPEGPV"
FT   sig_peptide     1739..1786
FT                   /gene="Pc13g00010"
FT                   /locus_tag="PCH_Pc13g00010"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            1739..1792
FT                   /gene="Pc13g00010"
FT                   /locus_tag="PCH_Pc13g00010"
FT                   /number=1
FT   mat_peptide     join(1787..1792,1871..2389)
FT                   /gene="Pc13g00010"
FT                   /locus_tag="PCH_Pc13g00010"
FT   intron          1793..1870
FT                   /gene="Pc13g00010"
FT                   /locus_tag="PCH_Pc13g00010"
FT                   /number=1
FT   exon            1871..2392
FT                   /gene="Pc13g00010"
FT                   /locus_tag="PCH_Pc13g00010"
FT                   /number=2
FT   mRNA            <3006..>4047
FT                   /pseudo
FT                   /gene="Pc13g00020"
FT                   /locus_tag="PCH_Pc13g00020"
FT                   /note="submitted as non-pseudo"
FT   CDS_pept        3006..4047
FT                   /pseudo
FT                   /gene="Pc13g00020"
FT                   /locus_tag="PCH_Pc13g00020"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: weak similarity to metalloreductase freA
FT                   -Aspergillus nidulans"
FT                   /inference="similar to AA sequence:TREMBL:AF515629.1"
FT   sig_peptide     3006..3128
FT                   /gene="Pc13g00020"
FT                   /locus_tag="PCH_Pc13g00020"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            3006..4047
FT                   /gene="Pc13g00020"
FT                   /locus_tag="PCH_Pc13g00020"
FT                   /number=1
FT   mat_peptide     3129..4044
FT                   /gene="Pc13g00020"
FT                   /locus_tag="PCH_Pc13g00020"
FT   gap             5862..5961
FT                   /estimated_length=unknown
FT   mRNA            complement(join(<7363..7974,8020..8923,8974..9371,
FT                   9423..>9470))
FT                   /gene="Pc13g00030"
FT                   /locus_tag="PCH_Pc13g00030"
FT   CDS_pept        complement(join(7363..7974,8020..8923,8974..9371,
FT                   9423..9470))
FT                   /gene="Pc13g00030"
FT                   /locus_tag="PCH_Pc13g00030"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An01g07930 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91072"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H0"
FT                   /protein_id="CAP91072.1"
FT                   /translation="MLETLPCEILMLIADWLPVTTLRVLSRASSRLYAVLVPRIYRTVS
FT                   FCAASEWALNVLDVDPFFRHLGPSRAADYLQHTRHLQIRAPFHLVRFNRCAYYNIFRAA
FT                   GLPESPAPLGASDDATAHQQFLDDVKDQLQLIFTHLEPNRLSIFEWRLGTCVPVGVLDQ
FT                   EGYLSQYQQRLTRLSLVTDGTCPETSHRLEGMSRLTCLTAFEWEGLQHPSEVDLLRRCI
FT                   RQNWSCLDQLSIGFVPSAFARALCWQSLGLQRPELEDGGRGTGVTTNEDTGIANPTALS
FT                   ALSTLSLSKVTLPLDISSGHNAIFYSLRSLTLRDCPNQLHLVQLLSWSQKPLRLTHFEF
FT                   SFDYLLHEPGEGCGLSAVVRFLCSFRGLQHLHLRLSNFPSSKSHIQDTIQHHQTTLKSL
FT                   VYHERQLAPIDADGLFEDDRDVSPAWVTNLSTGVDLGQVCALALCASPSAARRCLRPTA
FT                   KHSQLQILHLRFSGLERFHRDIPREITTYLNGIRKGYSWHPRSCWSSVNRDVSNDSHNY
FT                   PPIVDEYFDRSPLEFVDSQEAVLMSSAAIAEAEDFVSFADWAFGPDGLPALQVLAFGDF
FT                   SHGDRYRSQQFLMRRVYPSSEGGGKELAGLACDDTTRLPFCSADMSDPSIWDGAMVDGA
FT                   RFLSACPGGGLMESPYEL"
FT   exon            complement(7363..7974)
FT                   /gene="Pc13g00030"
FT                   /locus_tag="PCH_Pc13g00030"
FT                   /number=1
FT   intron          complement(7975..8019)
FT                   /gene="Pc13g00030"
FT                   /locus_tag="PCH_Pc13g00030"
FT                   /number=1
FT   exon            complement(8020..8923)
FT                   /gene="Pc13g00030"
FT                   /locus_tag="PCH_Pc13g00030"
FT                   /number=2
FT   intron          complement(8924..8973)
FT                   /gene="Pc13g00030"
FT                   /locus_tag="PCH_Pc13g00030"
FT                   /number=2
FT   exon            complement(8974..9371)
FT                   /gene="Pc13g00030"
FT                   /locus_tag="PCH_Pc13g00030"
FT                   /number=3
FT   intron          complement(9372..9422)
FT                   /gene="Pc13g00030"
FT                   /locus_tag="PCH_Pc13g00030"
FT                   /number=3
FT   exon            complement(9423..9470)
FT                   /gene="Pc13g00030"
FT                   /locus_tag="PCH_Pc13g00030"
FT                   /number=4
FT   mRNA            <12098..>13576
FT                   /gene="Pc13g00040"
FT                   /locus_tag="PCH_Pc13g00040"
FT   CDS_pept        12098..13576
FT                   /gene="Pc13g00040"
FT                   /locus_tag="PCH_Pc13g00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91073"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H1"
FT                   /protein_id="CAP91073.1"
FT                   /translation="MAESGSGVSQPKAAAADAQASYIQPDSSKGTGAHITNQSQSIQSQ
FT                   SKPPYNTQEEQPSPDGTRETVPGEPNDQPMGDAGSEREPSGSPVAGPRSGHMAENATES
FT                   GSPASVGANDPSDSSDEVLTDLKKLSIGSDRDGEPDAWSRLGRSNVLLVRYGPYKAAKY
FT                   RVQPGNGYNTQGLQKVSKKKTRISCVMYEGEDGEEHYRYSRDNIVGFVGVAFYERKADP
FT                   DKDYKIAPPAFVKVKWQGIDAAHQGLLTRGNSWITKQDLVRLTDLATAEQKISEAWDKQ
FT                   EERHIQWQGQIGRDSPDRSPTPCPLDLFKAQKQERIKRELTIKRELTREPSIPSAQGME
FT                   VDPEGWRLGSRQPAANNTQRLDSVSVKQELDSEDDEDNDLFVDDSSPNARNASDQNTSD
FT                   QNTSGQNTSGQDGNGPNNNGLNNDIRSGSGQNRPPPKLSKFYKRWLRRARIPETDFNNL
FT                   DDAYIGRFEAAAYAYMDELRKQGYVVEDDLGMDI"
FT   exon            12098..13576
FT                   /gene="Pc13g00040"
FT                   /locus_tag="PCH_Pc13g00040"
FT                   /number=1
FT   mRNA            complement(<14290..>16698)
FT                   /gene="Pc13g00050"
FT                   /locus_tag="PCH_Pc13g00050"
FT   CDS_pept        complement(14290..16698)
FT                   /gene="Pc13g00050"
FT                   /locus_tag="PCH_Pc13g00050"
FT                   /note="Title: strong similarity to LTR-containing
FT                   retrotransposable elements MARS1 - Ascobolus immersus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91074"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H2"
FT                   /inference="similar to AA sequence:PIR:S71892"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="CAP91074.1"
FT                   /translation="MEEVERQLLATKSWKAPGEDGLPAIVWKMTWPVVKHGVLELFQAS
FT                   VDEGTLPKQWRHAKIIPLKKPNKENYTIAKAWRPISLLATLGKVLESVIAERISHAVET
FT                   YGLLPTSHFGARKQRSAEQALLLLQEQIYAAWRGRRVLSLISFDVRGAYNGVCKERLLQ
FT                   RMKARGIPEVLLRWVEAFCSERTATIQINGQASEAQSLPQAGLPQGSPLSPILFLFFNA
FT                   DLVQRQIDGQGGAIAFVDDFTAWVTGPTAQSNRHGIETIINEALDWERRSGATFEADKT
FT                   AIIHFAPKASKLDSEPFTIKGETVEPRDHVKVLGVIMDTRLKYKEHMARAASKGLEAAM
FT                   ELRRLRGQSPATARQLFTSTVAPVVDYASSVWMHAFKNKNIGPINRVQRVGAQAIVGTF
FT                   LTVATSVAEAEAHIATVQHRLWRRAAKTWTDIHTLPATNPLRRSTAQIKKFRRYHRSPL
FT                   YQVADALKSIDMETLETISPFTLAPWEERVQGDGQNVPETQTETGGIMRIAVSSSARNG
FT                   MVGFGVAIEKQPPRYRKPRLKTFSVTLGARIEQNPYSGELAAMAYALGTLRVTLLTSNK
FT                   AAALTLKDPRQQSGQEHICQAYKLIKRLRKHENRINNCWVPTSEDNQLLGLAKEQARTA
FT                   TQEDSTPQAQVPRVKSTTLNISRSQAVPKNCLPENVGKHSKRVDAALPGKHTRQLYDRL
FT                   SWKEASVLAQLRTGMARLNGYLYRINVAESDQCACGQARETVEHFLFRCQRWTTHRTEM
FT                   LQCTHTHRGNISFFLGGKSPLDDQNWKPNLEAVRATIRFAIATGRLDAA"
FT   exon            complement(14290..16698)
FT                   /gene="Pc13g00050"
FT                   /locus_tag="PCH_Pc13g00050"
FT                   /number=1
FT   mRNA            complement(<17001..>17153)
FT                   /gene="Pc13g00060"
FT                   /locus_tag="PCH_Pc13g00060"
FT   CDS_pept        complement(17001..17153)
FT                   /gene="Pc13g00060"
FT                   /locus_tag="PCH_Pc13g00060"
FT                   /note="Title: similarity to hypothetical protein An04g07740
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91075"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H3"
FT                   /protein_id="CAP91075.1"
FT                   /translation="MDWRYNVTVSIADWALLAGYLVIPGTFTSLKESSQVEEILKTNNA
FT                   GRAVL"
FT   exon            complement(17001..17153)
FT                   /gene="Pc13g00060"
FT                   /locus_tag="PCH_Pc13g00060"
FT                   /number=1
FT   mRNA            join(<17804..18803,18859..19389,19499..19871,20018..>20933)
FT                   /gene="Pc13g00070"
FT                   /locus_tag="PCH_Pc13g00070"
FT   CDS_pept        join(17804..18803,18859..19389,19499..19871,20018..20933)
FT                   /gene="Pc13g00070"
FT                   /locus_tag="PCH_Pc13g00070"
FT                   /note="unknown EC_number=3.1.1.4"
FT                   /note="Title: weak similarity to calcium-independent
FT                   phospholipase A2 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91076"
FT                   /db_xref="GOA:B6H5F7"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5F7"
FT                   /inference="similar to AA sequence:PIR:JC7284"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /inference="protein motif:COGS:COG3621"
FT                   /protein_id="CAP91076.1"
FT                   /translation="MAAWLDILSDTTGSSLVDTGRFEEIIQGMSHPNSQYPSLVYFAGN
FT                   GNRIKALQALFPHNNVTRKGPAGLIRAHLSTATAHTEHPVIFAESNPFSQAGVGDSCLL
FT                   RWSGDRHRRYPLALGKSQPLADLQQEVIRHKILPWTQVLCFFVDTASDMRNVQQLLDAP
FT                   TGTLSIGASHIHGMMRVVIVLSGNPQTEAHDADDDFELPSAWLGQHRITVLNIRDRSGL
FT                   SPSVAFDPLRSLVLEQIQETQSLQKEKCLSFSAVHLSALWGRGLQLRMGSSNPANLDCL
FT                   LVAREGYKRKPAMVSCFVELKSQFASSACPENELYNFIASALLLDAYPPGMHLFEPKMV
FT                   FNALYRAYCRNAWEGVDAEIVCNKVLHRFIEGFVQLKSKVSADIRHEALVQFHRRWGGL
FT                   HSTTTCFACMCGPPEHMLPCRHTICDNCVVIYGTKSPRTEYHIDLPKCPICDEAVNLTV
FT                   RQLPPTKGPIVLSLDGGGVRGIVQLGLLRALERRIGGISIAQVADLFAGTSVEESCAKF
FT                   PAFARMIFGSPPKHAPKSPISRCATWIKSLACFLADCQYDSERLEDALQRVVDPQRRMF
FT                   DVTTTSSTGCRVAIITSRTSDGKACVLANYRGMGQREASAAYEFLVPKTADENPHVWKV
FT                   FFRSKSLPGFGALQDGGVRANNPLAIALKESVVIWPSAKTHDLLLSVGTGSFSSVAKPI
FT                   EGASRILQDSAIPRMIRATMSSPCMDGEQGFHEALNFVPDVERSNIFRLNHELPEPLPR
FT                   LDDVSKLEGMSKMHFTVPTELVRTILATAFFFFELDELPIKSQGVFFCKGSVLCSRSYS
FT                   RDLVKLVMVEFPGARFEMARGQRLGDVDDDDGCRVCGYYRKKVGFSINGLHEMTSIGIA
FT                   GSSFFQRIGGFPKSVQELLDDQQANSHFGRADHLVNSWPPKRNCYCSPRVKRHIKFLEP
FT                   ALTHKKRRL"
FT   exon            17804..18803
FT                   /gene="Pc13g00070"
FT                   /locus_tag="PCH_Pc13g00070"
FT                   /number=1
FT   intron          18804..18858
FT                   /gene="Pc13g00070"
FT                   /locus_tag="PCH_Pc13g00070"
FT                   /number=1
FT   exon            18859..19389
FT                   /gene="Pc13g00070"
FT                   /locus_tag="PCH_Pc13g00070"
FT                   /number=2
FT   intron          19390..19498
FT                   /gene="Pc13g00070"
FT                   /locus_tag="PCH_Pc13g00070"
FT                   /number=2
FT   exon            19499..19871
FT                   /gene="Pc13g00070"
FT                   /locus_tag="PCH_Pc13g00070"
FT                   /number=3
FT   intron          19872..20017
FT                   /gene="Pc13g00070"
FT                   /locus_tag="PCH_Pc13g00070"
FT                   /number=3
FT   exon            20018..20933
FT                   /gene="Pc13g00070"
FT                   /locus_tag="PCH_Pc13g00070"
FT                   /number=4
FT   mRNA            <22770..>23135
FT                   /gene="Pc13g00080"
FT                   /locus_tag="PCH_Pc13g00080"
FT   CDS_pept        22770..23135
FT                   /pseudo
FT                   /gene="Pc13g00080"
FT                   /locus_tag="PCH_Pc13g00080"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1323_scaffold_5.tfa_770wg - Fusarium graminearum"
FT   exon            22770..23135
FT                   /gene="Pc13g00080"
FT                   /locus_tag="PCH_Pc13g00080"
FT                   /number=1
FT   mRNA            complement(<23386..>23775)
FT                   /gene="Pc13g00090"
FT                   /locus_tag="PCH_Pc13g00090"
FT   CDS_pept        complement(23386..23775)
FT                   /gene="Pc13g00090"
FT                   /locus_tag="PCH_Pc13g00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91078"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5F8"
FT                   /protein_id="CAP91078.1"
FT                   /translation="MTPTTMMNTNFTQPVECYNSRDAVPATMPSNIQYYNQVPLYQTKS
FT                   PNRDMKAVLQSCCSNVVWIYEDPDPCTAVCDSHTAAEAKKTMYCLNAQMVVYGTKTEKG
FT                   SAVARRPMGWLSLMVGGLRLSGMFI"
FT   exon            complement(23386..23775)
FT                   /gene="Pc13g00090"
FT                   /locus_tag="PCH_Pc13g00090"
FT                   /number=1
FT   mRNA            <25313..>25708
FT                   /gene="Pc13g00100"
FT                   /locus_tag="PCH_Pc13g00100"
FT   CDS_pept        25313..25708
FT                   /gene="Pc13g00100"
FT                   /locus_tag="PCH_Pc13g00100"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   CAA21103.1 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00100"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91079"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5F9"
FT                   /inference="similar to AA sequence:PIR:T40023"
FT                   /protein_id="CAP91079.1"
FT                   /translation="MMRSLFEGYRPTFKPHSLGYEAESLLLLTPSQQMCYYDGKLFGGY
FT                   IALLMDRILADCCKHKHKHKPAFTAYLITSFIHSVPPSAPMLLRAWPEKVEGRKVFLKG
FT                   SVRIPGKSAHDWVDAVRIGALFIRPKP"
FT   exon            25313..25708
FT                   /gene="Pc13g00100"
FT                   /locus_tag="PCH_Pc13g00100"
FT                   /number=1
FT   mRNA            complement(join(<27279..27388,27558..27653,28951..>29113))
FT                   /gene="Pc13g00110"
FT                   /locus_tag="PCH_Pc13g00110"
FT   CDS_pept        complement(join(27279..27388,27558..27653,28951..29113))
FT                   /gene="Pc13g00110"
FT                   /locus_tag="PCH_Pc13g00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91080"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G0"
FT                   /protein_id="CAP91080.1"
FT                   /translation="MATTGWDRGLFMLETELCAGSGNEATLDNGEKSTGLRKEVTRLSS
FT                   MPQIGQQSGACPMTGAFADPIRETCLAPSPGNAFAVLAETLSQSPVEIVHANSLEKAKL
FT                   ASLATKHAMPRDQSTDNG"
FT   exon            complement(27279..27388)
FT                   /gene="Pc13g00110"
FT                   /locus_tag="PCH_Pc13g00110"
FT                   /number=1
FT   intron          complement(27389..27557)
FT                   /gene="Pc13g00110"
FT                   /locus_tag="PCH_Pc13g00110"
FT                   /number=1
FT   exon            complement(27558..27653)
FT                   /gene="Pc13g00110"
FT                   /locus_tag="PCH_Pc13g00110"
FT                   /number=2
FT   intron          complement(27654..28950)
FT                   /gene="Pc13g00110"
FT                   /locus_tag="PCH_Pc13g00110"
FT                   /number=2
FT   exon            complement(28951..29113)
FT                   /gene="Pc13g00110"
FT                   /locus_tag="PCH_Pc13g00110"
FT                   /number=3
FT   mRNA            join(<29153..29324,29378..>29922)
FT                   /gene="Pc13g00120"
FT                   /locus_tag="PCH_Pc13g00120"
FT   CDS_pept        join(29153..29324,29378..29922)
FT                   /gene="Pc13g00120"
FT                   /locus_tag="PCH_Pc13g00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91081"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G1"
FT                   /protein_id="CAP91081.1"
FT                   /translation="MRSFNYLLLIGNVVAGSYLAIIEDNDGENNCRVWSQNNHGCTGYS
FT                   ATFAKLKGKDCSGFIGAGSDDKSVKVDICGTENGEQVAWVTVNKNGTVSFLNRQGDTSS
FT                   CMLENGLKVPSGCSIGNTGSSQTTTPISTASQSSFSTAIGTSTSGTARVDQSPTPTSTS
FT                   TPTDSPSFISDGKSATETPRADQSPTPIFTSTPTDSPSLDLISAGKSATGISLADHSPT
FT                   LTSTPACKCSCESAAV"
FT   sig_peptide     29153..29209
FT                   /gene="Pc13g00120"
FT                   /locus_tag="PCH_Pc13g00120"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            29153..29324
FT                   /gene="Pc13g00120"
FT                   /locus_tag="PCH_Pc13g00120"
FT                   /number=1
FT   mat_peptide     join(29210..29324,29378..29919)
FT                   /gene="Pc13g00120"
FT                   /locus_tag="PCH_Pc13g00120"
FT   intron          29325..29377
FT                   /gene="Pc13g00120"
FT                   /locus_tag="PCH_Pc13g00120"
FT                   /number=1
FT   exon            29378..29922
FT                   /gene="Pc13g00120"
FT                   /locus_tag="PCH_Pc13g00120"
FT                   /number=2
FT   mRNA            complement(join(<30973..31077,31132..31667,31717..31900,
FT                   31944..32303,32363..>32506))
FT                   /gene="Pc13g00130"
FT                   /locus_tag="PCH_Pc13g00130"
FT   CDS_pept        complement(join(30973..31077,31132..31667,31717..31900,
FT                   31944..32303,32363..32506))
FT                   /gene="Pc13g00130"
FT                   /locus_tag="PCH_Pc13g00130"
FT                   /note="unknown EC_number=3.2.1.14"
FT                   /note="Title: strong similarity to chitinase 1 precursor
FT                   cts1 - Coccidioides immitis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91082"
FT                   /db_xref="GOA:B6H5G2"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G2"
FT                   /inference="similar to AA sequence:PIR:JC4565"
FT                   /inference="protein motif:PFAM:PF00704"
FT                   /inference="protein motif:COGS:COG3325"
FT                   /inference="protein motif:COGS:COG3858"
FT                   /protein_id="CAP91082.1"
FT                   /translation="MHFILFLILSLAWLANATYIPSLVKVNAADIATRGVNGYRSVAYF
FT                   VNWGIFQPQDIPAEKLTHVLYAFANVRASGEVILSDPWSDTDKHYPTDSWTDTGNNVYG
FT                   CIKKLFLLKKKNRKLKVLLSIGGWTYSSNLRLAFETEAGRQKFAGSSVELLKDLGFDGI
FT                   DVDFEKYPGNNNEADQFVDTLRRLREVFSCFFYLWVCKTKHIQALDVYSYANTGGYHFL
FT                   LTAASPAGPANYLKEHLAQMDRYLDFWNLMAYDYAGSWDTVAGHGANLFASNSNPASTP
FT                   FNTDQAIDYYTSHGVASSNIVLGMPLYGRAFTDTSGPGQPYNGLGVGGWRDGVWDYKAL
FT                   PQTGCKVTNLDQEAASYCYSSGSRLFISYDTPEVARKKGEYIKSKGLGGGMWWELSGDK
FT                   QGDDSLITTVVSTLGGTGALDKTDNQLSYPISKYDNLKACFEP"
FT   exon            complement(30973..31077)
FT                   /gene="Pc13g00130"
FT                   /locus_tag="PCH_Pc13g00130"
FT                   /number=1
FT   mat_peptide     complement(join(30976..31077,31132..31667,31717..31900,
FT                   31944..32303,32363..32455))
FT                   /gene="Pc13g00130"
FT                   /locus_tag="PCH_Pc13g00130"
FT   intron          complement(31078..31131)
FT                   /gene="Pc13g00130"
FT                   /locus_tag="PCH_Pc13g00130"
FT                   /number=1
FT   exon            complement(31132..31667)
FT                   /gene="Pc13g00130"
FT                   /locus_tag="PCH_Pc13g00130"
FT                   /number=2
FT   intron          complement(31668..31716)
FT                   /gene="Pc13g00130"
FT                   /locus_tag="PCH_Pc13g00130"
FT                   /number=2
FT   exon            complement(31717..31900)
FT                   /gene="Pc13g00130"
FT                   /locus_tag="PCH_Pc13g00130"
FT                   /number=3
FT   intron          complement(31901..31943)
FT                   /gene="Pc13g00130"
FT                   /locus_tag="PCH_Pc13g00130"
FT                   /number=3
FT   exon            complement(31944..32303)
FT                   /gene="Pc13g00130"
FT                   /locus_tag="PCH_Pc13g00130"
FT                   /number=4
FT   intron          complement(32304..32362)
FT                   /gene="Pc13g00130"
FT                   /locus_tag="PCH_Pc13g00130"
FT                   /number=4
FT   exon            complement(32363..32506)
FT                   /gene="Pc13g00130"
FT                   /locus_tag="PCH_Pc13g00130"
FT                   /number=5
FT   sig_peptide     complement(32456..32506)
FT                   /gene="Pc13g00130"
FT                   /locus_tag="PCH_Pc13g00130"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(<33503..>33940)
FT                   /gene="Pc13g00140"
FT                   /locus_tag="PCH_Pc13g00140"
FT   CDS_pept        complement(33503..33940)
FT                   /gene="Pc13g00140"
FT                   /locus_tag="PCH_Pc13g00140"
FT                   /note="Title: similarity to proline-rich early nodulin like
FT                   protein - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91083"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G3"
FT                   /protein_id="CAP91083.1"
FT                   /translation="MWLIEEQLIEEQLIEERLIEEWLIEEWLIEEWLIEEWLIEEQLIE
FT                   EWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLI
FT                   EEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIEEWLIE"
FT   exon            complement(33503..33940)
FT                   /gene="Pc13g00140"
FT                   /locus_tag="PCH_Pc13g00140"
FT                   /number=1
FT   mRNA            join(<34416..34608,34783..>34985)
FT                   /gene="Pc13g00150"
FT                   /locus_tag="PCH_Pc13g00150"
FT   CDS_pept        join(34416..34608,34783..34985)
FT                   /gene="Pc13g00150"
FT                   /locus_tag="PCH_Pc13g00150"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g11290 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91084"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G4"
FT                   /protein_id="CAP91084.1"
FT                   /translation="MPPFILSKMPLKAVEHPSADDASSIYSRSPESPKDMLSSMPMMLP
FT                   PRHDLPEINSLDHQIALARVIDVSQELTLQYHFEPEARPLDNERVFQAVRKLRVALEQS
FT                   RIREAQAEQIWKRQWKVSRINHTTRWI"
FT   exon            34416..34608
FT                   /gene="Pc13g00150"
FT                   /locus_tag="PCH_Pc13g00150"
FT                   /number=1
FT   intron          34609..34782
FT                   /gene="Pc13g00150"
FT                   /locus_tag="PCH_Pc13g00150"
FT                   /number=1
FT   exon            34783..34985
FT                   /gene="Pc13g00150"
FT                   /locus_tag="PCH_Pc13g00150"
FT                   /number=2
FT   mRNA            complement(join(<35597..36573,36595..>37270))
FT                   /gene="Pc13g00160"
FT                   /locus_tag="PCH_Pc13g00160"
FT   CDS_pept        complement(join(35597..36573,36595..37270))
FT                   /exception="reasons given in citation"
FT                   /gene="Pc13g00160"
FT                   /locus_tag="PCH_Pc13g00160"
FT                   /note="putative sequencing error"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An03g00970 - Aspergillus niger [putative sequencing error]"
FT                   /db_xref="GOA:B6H5G5"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G5"
FT                   /protein_id="CAP91085.1"
FT                   /translation="MQQPKFLFPSILVLSVTIFYSWITKGIPSRLDANHAPKSRFELVR
FT                   VDSYDFPARAGGIDIIFVHGLGSNPDTTWGARRPQNPLNQTEPTPLNYEQYVNWVKEFL
FT                   PNDLPLEIRKDALYTRLPTIGNNLLEHIDRQIHRSKDEQSRCLIFVGHSYGGLVVKEGW
FT                   LLAYALQPLGSNPLILANLEYDAIQLRDLHEQFIASVRDDLQVVNYYEQRPIRLLKLWL
FT                   FQWQEFTVPESSATYDGKKVSKMGLPVNHYGLNKFESRSESYNSILSKLVKLVTPLLKP
FT                   AKHYYDVLVEIVQTFIQRDQVWEELEEKLQIRYDKASVLYAVTLHGLGGAGKSQLALKY
FT                   AESNTDRYNPILWIDITSEQTGIKKVIPKGTRGRIVITSRDDQSQKLVDRGCEQVRVNI
FT                   MSLREARMVLLRYLSDNIDLVLKTVQKDCDKVAKKLRYLPLAIDLADGLSSRADPYGEN
FT                   ASLGMPAIHNGLGEEDFTKLLILISDTEGEWDDFKYRQSIDVLVRYSLTQRVHGEWPGT
FT                   VMHSLVKWRITKEHYQPEFRQYLILYLPDARDINMTYISRMKIGDIFISTILARVLYDE
FT                   GRWQQAEQLLVQVIETRKAELGEEYPDTLNSIGSLASTFXNQGRWEEAEQLLVXVIETR
FT                   KAKLGEDHPDTLNSMSNLASTYLKQGRLEEAVQLGVQVIGTCKTKLGEDHPDTVYSMGN
FT                   LASTYRNQGWWEEAEXLKVQVMEIRKIKLGDDHPDTLNSMGNLASTFXNQGRXEEAEQL
FT                   LVQVIETRKAKLGEDYPDTLNSIRNLAATYLRQGRXEEAEELLVQVIETRKARLGEDHP
FT                   DTLNSISNLASTYLKGPLRGGRVGVQVIGTCKTKLGEDHPDTLTSISNLASIYRNQGRL
FT                   EEAEQLEIQVMEASKAKLGEDHPDTLSSVSNLAATYLTQGRWEEAEELRVQVIETRKAR
FT                   LGEDHPDTLNSMSNLAFTYRNQGRLEEAEQLEVQVMEASKAKLGADYPDTLNSMSNLAA
FT                   TYLTQGRWEEAEELGVQVIETRKAKLGEDHPDTLNSMGNLAATYLKQGRWEQVEQLLVQ
FT                   VMETHRAKLGEDHPDTLNSMANVASTWKFLGHDAKAIDLLRDCLTKQKQTFGQNHLTTL
FT                   SNSRTLLSWEMESPDYSKRYSKAIDLSTSVGIAAKRMRQAVVNERPGACKYYLQSHYK"
FT   exon            complement(35597..36573)
FT                   /gene="Pc13g00160"
FT                   /locus_tag="PCH_Pc13g00160"
FT                   /number=1
FT   intron          complement(36574..36594)
FT                   /gene="Pc13g00160"
FT                   /locus_tag="PCH_Pc13g00160"
FT                   /number=1
FT   exon            complement(36595..37270)
FT                   /gene="Pc13g00160"
FT                   /locus_tag="PCH_Pc13g00160"
FT                   /number=2
FT   mRNA            complement(join(<37398..38068,38276..>38306))
FT                   /gene="Pc13g00170"
FT                   /locus_tag="PCH_Pc13g00170"
FT   CDS_pept        complement(join(37398..38068,38276..38306))
FT                   /gene="Pc13g00170"
FT                   /locus_tag="PCH_Pc13g00170"
FT                   /note="Title: similarity to hypothetical protein An18g02770
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00170"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91086"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G6"
FT                   /protein_id="CAP91086.1"
FT                   /translation="MNAVKIGATTRGVSTFRESVPKKVPFRAQHLVLEAVQKMLEQSGF
FT                   RFVQRWLPQACRSAEWVCAESMELHRLFPLLNQNRKYASSKDFHQILAKLHSLRHTVSN
FT                   IRHAAVHRIVQDSESLLEMLQAAVAFASCIGDKECTQQLEFLCSTLNNLLFQMNERLHH
FT                   LQQRVLVQIRICHSRPAELMQRRALLPEAVRRLTEQSEDMFDLQVQGILRKNLLLCWYE
FT                   ASNQPSALQVS"
FT   exon            complement(37398..38068)
FT                   /gene="Pc13g00170"
FT                   /locus_tag="PCH_Pc13g00170"
FT                   /number=1
FT   intron          complement(38069..38275)
FT                   /gene="Pc13g00170"
FT                   /locus_tag="PCH_Pc13g00170"
FT                   /number=1
FT   exon            complement(38276..38306)
FT                   /gene="Pc13g00170"
FT                   /locus_tag="PCH_Pc13g00170"
FT                   /number=2
FT   mRNA            join(<38747..39148,39205..40218,40283..>40510)
FT                   /gene="Pc13g00180"
FT                   /locus_tag="PCH_Pc13g00180"
FT   CDS_pept        join(38747..39148,39205..40218,40283..40510)
FT                   /gene="Pc13g00180"
FT                   /locus_tag="PCH_Pc13g00180"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   contig_1_149_scaffold_12.tfa_40cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91087"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G7"
FT                   /protein_id="CAP91087.1"
FT                   /translation="MASGLEVVGLALAVFPILVEGLKFYADKKGRVRDFIHYRHLLKRI
FT                   VRDLSREQISFQNSSQLFLENISMHYGLSSNDIQEMMQNPQDARWRKGIPFQSDYLIEK
FT                   SVAIYLETVEDMNEVLIKIQDTVGTREGAHPALLDKSTFRRQWRKITLVLGEEDIKKHL
FT                   ERARGLNTFLSQLTEQNKPTSLADSVLQRSTLHYERIRRHAIELFEIFQANLSTSVICK
FT                   CVLGHTVNMKLEFRSARITAKRLFFRTLFTFDRAEPNLTPPYNWREVEIEPLLSARLCH
FT                   ETISHKAVNLFADSSTVQTADSTSSELPNICTVIKGPIQSGWLGYLANSQGCRHRIRVL
FT                   ALDQISAALETIQTISLAAVLDHREFRLVHRYRLGLKLASSVMQLHTTQWLPDYWNKSD
FT                   ISFPCFSDGKIDFNNPLIKRGFGSEEKQNSMAFTSGLSNCGSVPCLFSLGVVLLELIER
FT                   QSIETMKNNSYDDSNTGQVTVELTKRLANSTDCSPNYKKVMKRCIGGLDAAFESLEDGD
FT                   FRDEVEQKIILPLEEDLKFYCDKGYIEDCV"
FT   sig_peptide     38747..38809
FT                   /gene="Pc13g00180"
FT                   /locus_tag="PCH_Pc13g00180"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            38747..39148
FT                   /gene="Pc13g00180"
FT                   /locus_tag="PCH_Pc13g00180"
FT                   /number=1
FT   mat_peptide     join(38810..39148,39205..40218,40283..40507)
FT                   /gene="Pc13g00180"
FT                   /locus_tag="PCH_Pc13g00180"
FT   intron          39149..39204
FT                   /gene="Pc13g00180"
FT                   /locus_tag="PCH_Pc13g00180"
FT                   /number=1
FT   exon            39205..40218
FT                   /gene="Pc13g00180"
FT                   /locus_tag="PCH_Pc13g00180"
FT                   /number=2
FT   intron          40219..40282
FT                   /gene="Pc13g00180"
FT                   /locus_tag="PCH_Pc13g00180"
FT                   /number=2
FT   exon            40283..40510
FT                   /gene="Pc13g00180"
FT                   /locus_tag="PCH_Pc13g00180"
FT                   /number=3
FT   mRNA            complement(join(<42151..42560,42617..42845,42899..43189,
FT                   43242..43301,43361..43586,43648..>44000))
FT                   /gene="Pc13g00190"
FT                   /locus_tag="PCH_Pc13g00190"
FT   CDS_pept        complement(join(42151..42560,42617..42845,42899..43189,
FT                   43242..43301,43361..43586,43648..44000))
FT                   /gene="Pc13g00190"
FT                   /locus_tag="PCH_Pc13g00190"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   BAB55393.1 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91088"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G8"
FT                   /inference="similar to AA sequence:TREMBLNEW:AK027823.1"
FT                   /inference="protein motif:COGS:COG0616"
FT                   /protein_id="CAP91088.1"
FT                   /translation="MASKRSHVFRVTGLSRELLDEDLKTTLQETIADKFADDERSHIKA
FT                   EITIVPSCYESDTQRVALVQFRGGVPQFLRELRVDQLGDWQIEMGDDDINFDCHFFGFT
FT                   QLYTPDKNEPVIADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTMIYGYN
FT                   SKLSSPGVNTILDYGRELMEDIKKVRTTKQLQQRPLIFIAHSFGGIILAHCLVRAIQTL
FT                   EEDHPAITSLHRATYGIILFAIPHKGLVMDDIQQMLGGDGHHPRETLLRQISSQSDVLI
FT                   HQLADFKNLIRDRKVVSFYETEQTKRLVLDSESGRWKRTGDFMTTVDADSALLQLPDHV
FT                   EDKVPLHADHSMIVKFDMRNAVGYRTALDKLRQFSKKAPSVVAARFNASNAPTTLLHES
FT                   SVRKRNIMDDDSETPKAKRARLHDSASSSNSEESDTAHYEDDNISDDISQVKVYNINEP
FT                   SEESHNGFSESLIARDATSEIGSSFRYGSSSWEGSFSENGLADGSDILEPDELSSSGES
FT                   ISSGC"
FT   exon            complement(42151..42560)
FT                   /gene="Pc13g00190"
FT                   /locus_tag="PCH_Pc13g00190"
FT                   /number=1
FT   intron          complement(42561..42616)
FT                   /gene="Pc13g00190"
FT                   /locus_tag="PCH_Pc13g00190"
FT                   /number=1
FT   exon            complement(42617..42845)
FT                   /gene="Pc13g00190"
FT                   /locus_tag="PCH_Pc13g00190"
FT                   /number=2
FT   intron          complement(42846..42898)
FT                   /gene="Pc13g00190"
FT                   /locus_tag="PCH_Pc13g00190"
FT                   /number=2
FT   exon            complement(42899..43189)
FT                   /gene="Pc13g00190"
FT                   /locus_tag="PCH_Pc13g00190"
FT                   /number=3
FT   intron          complement(43190..43241)
FT                   /gene="Pc13g00190"
FT                   /locus_tag="PCH_Pc13g00190"
FT                   /number=3
FT   exon            complement(43242..43301)
FT                   /gene="Pc13g00190"
FT                   /locus_tag="PCH_Pc13g00190"
FT                   /number=4
FT   intron          complement(43302..43360)
FT                   /gene="Pc13g00190"
FT                   /locus_tag="PCH_Pc13g00190"
FT                   /number=4
FT   exon            complement(43361..43586)
FT                   /gene="Pc13g00190"
FT                   /locus_tag="PCH_Pc13g00190"
FT                   /number=5
FT   intron          complement(43587..43647)
FT                   /gene="Pc13g00190"
FT                   /locus_tag="PCH_Pc13g00190"
FT                   /number=5
FT   exon            complement(43648..44000)
FT                   /gene="Pc13g00190"
FT                   /locus_tag="PCH_Pc13g00190"
FT                   /number=6
FT   mRNA            complement(join(<44937..45033,45190..>46061))
FT                   /gene="Pc13g00200"
FT                   /locus_tag="PCH_Pc13g00200"
FT   CDS_pept        complement(join(44937..45033,45190..46061))
FT                   /gene="Pc13g00200"
FT                   /locus_tag="PCH_Pc13g00200"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   ncu00832.1 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00200"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91089"
FT                   /db_xref="GOA:B6H5H4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H4"
FT                   /protein_id="CAP91089.1"
FT                   /translation="MSAQTETSSMPCPFHKDDQLNGDLDTSLDYLPGHPRIRLGDEKGL
FT                   FEFIRREVWSEDLESISGRLWWMSKQDSSNISPLHRQRVKGRQIIVTEDPRLHLVWIDD
FT                   RIFLKPLPQYITSFVFWDTFMSDPSKLGAAVKLRKAALGYLRTYFYLIQYESDLRIAQD
FT                   PALCLVPKEVTWHRFCQFTARLNDITENEISGRYHYGEIRLTRLNYYAPVLLGKSHYQR
FT                   ENYQYRAYFARIQGPLISAFAFFSIALNCMQVSLAASTSDERYSSALLFAACYWLSTLI
FT                   GFVTGVLMLMLVLKSFLTGDLTEVFSNIDSSVTDFANSTKC"
FT   exon            complement(44937..45033)
FT                   /gene="Pc13g00200"
FT                   /locus_tag="PCH_Pc13g00200"
FT                   /number=1
FT   intron          complement(45034..45189)
FT                   /gene="Pc13g00200"
FT                   /locus_tag="PCH_Pc13g00200"
FT                   /number=1
FT   exon            complement(45190..46061)
FT                   /gene="Pc13g00200"
FT                   /locus_tag="PCH_Pc13g00200"
FT                   /number=2
FT   mRNA            complement(<46711..>48122)
FT                   /gene="Pc13g00210"
FT                   /locus_tag="PCH_Pc13g00210"
FT   CDS_pept        complement(46711..48122)
FT                   /pseudo
FT                   /gene="Pc13g00210"
FT                   /locus_tag="PCH_Pc13g00210"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to transposase Tan1
FT                   -Aspergillus niger [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT                   /inference="protein motif:PFAM:PF03184"
FT   exon            complement(46711..48122)
FT                   /gene="Pc13g00210"
FT                   /locus_tag="PCH_Pc13g00210"
FT                   /number=1
FT   mRNA            join(<49646..50001,50063..50288,50464..50754,50811..51039,
FT                   51092..51251,51314..>55217)
FT                   /gene="Pc13g00220"
FT                   /locus_tag="PCH_Pc13g00220"
FT   CDS_pept        join(49646..50001,50063..50288,50464..50754,50811..51039,
FT                   51092..51251,51314..55217)
FT                   /gene="Pc13g00220"
FT                   /locus_tag="PCH_Pc13g00220"
FT                   /note="Title: strong similarity to cDNA kinesin light like
FT                   protein An03g03030 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91091"
FT                   /db_xref="GOA:B6H5H5"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H5"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /inference="protein motif:COGS:COG4172"
FT                   /inference="protein motif:COGS:COG0457"
FT                   /protein_id="CAP91091.1"
FT                   /translation="MASQRKSHVFRVTGLSRELPDRDLKTAVQRALNDNFTDDERSHIT
FT                   AEVTIVPSCYESDTERAALVQFRGGVPQFLYELRVDPLGDWQVEMGDNDINFDCHFFGF
FT                   TQLYAPDDNEPVVADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTMIYGY
FT                   NSKLSSHGVDTILDYGRELMEEIKKIRNTKECLVRAIQTMEEDHPAITSLHRATYGMVL
FT                   FAIPHKGLVMDDIQQMLVGDKSHPRERLLQQISSKSDLLIHQLADFKNLIRDRKVVSFY
FT                   ETEQTRQLVLDSESGRWKRTGDFVTTVGADSALLQLPDHVEDKVPLHADHSMVVKFDTR
FT                   NAAGYRTAVDKLRQFLKDAPSVVAARFTQTRPKPQPCSTVPFKKDPMFVGRESVISAIN
FT                   ERHRAIGQRHERVALVGLAGVGKTQAAIEYSYRVRESTPDTWVFWIHASNTARLEQGYQ
FT                   QIATVAEIPGRDDPKINILQLVYQWLCDARNGRWLMVLDNADDDGIFFGDNTFNERGPL
FT                   VSFLPQAAHGSMLITSRNGLAARNLVGSDSHVITVQPMNEAESLALLRLRIPAPQSGES
FT                   GESGGDERALVQALECIPLAITQAAAYIANRLPLVTVSAYLRLFHESESKRTRLLQNED
FT                   SADLRRDPSIRYAVMTTWQLSFEQIRQERPAATDLLALMSMFDRQGIPEDLVRHHEQDI
FT                   LDFHDALAPLLSYSLIRLELNERLFDMHRLVQLSVRAWLDMHQQLYGWQAKSRGIMARV
FT                   FPDGEYESWSQCRSLLAHANSVLQSICDVDDKDRLNAAALLSNCGWFLDLQGVYEEAEA
FT                   MHRRALEAREKVLGREHPDTLTSVSNLGLVLSSQGKYDEAEAMHRRALEGYEEVLGREH
FT                   PNTLTSVNNLGSVLSRQGKYDEAEAMHRRDLEGSEKVLGREHPDTLTSVNNLGNVLSSQ
FT                   GKYDEAEAMHRRALEGCEEVLGREHPNTLTSVNNLGSVLSRQGKYDEAEAMHRRDLEGS
FT                   EKVLGREHPHTLASVNNLGNVLSSQGKYDEAEAMHRRALEGYEEVLGREHPNTLTSVNN
FT                   LGNVLSSQGKYDEAEAMHRRDLEGSEKVLGREHPDTLTSVSKLGNVLSSQGKYDEAEAM
FT                   HRRDLEGSEKVLGREHPDTFTSVSNLGLVLSSQGKYDEAEAMHRRALEGYEEVLGREHP
FT                   DTLTSVNNLGLVLSSQGKYDEAEAMHRRDLEGSEKVLGREHPDTFTSVNNLGDVLSRQG
FT                   KYDEAEAMHRRALEAREKVLGREHPDTLTSVSNLGGVLFSQGKYDEAEAMHRRALEARE
FT                   NVLGREHPNTLTSLSNLGNVLSSQGKYDEAEAMHRRALEARENVLGREHPDTLTSVNNL
FT                   GYILSSQGKYDEAEAMHRRALEGYEEVLGREHPNTLTSVNNLGDVLSRQGKYDEAEAMH
FT                   RRALEAREKVLGREHPDTLTSVSNLGDVLSSQGKYDEAEAMHRWALEAREKVLGREHPN
FT                   TLTSVSNFGDVLSSQGKYDEAEAMHRRALEAREKVLGREHPDTLTSVSKLGNVLSSQGK
FT                   YDEAEAMHRRALEAREKVLGREHPDTLTSVSKLGNVLSSQGKYDEAEAMHRRDLEGSEK
FT                   VLGREHPDTFTSVSNLANVLSNQGKYDEAEAIHLQDMEGSEKVLGREHPDTLTSVSKLG
FT                   NVLSNQGKYDEAEAIHLQDMEGSEKVLGREHPDTLTSVSKLGNVLSNQGKYDEAKAIHL
FT                   QDMEGSEKVLGCEHPRILASLNIR"
FT   exon            49646..50001
FT                   /gene="Pc13g00220"
FT                   /locus_tag="PCH_Pc13g00220"
FT                   /number=1
FT   intron          50002..50062
FT                   /gene="Pc13g00220"
FT                   /locus_tag="PCH_Pc13g00220"
FT                   /number=1
FT   exon            50063..50288
FT                   /gene="Pc13g00220"
FT                   /locus_tag="PCH_Pc13g00220"
FT                   /number=2
FT   intron          50289..50463
FT                   /gene="Pc13g00220"
FT                   /locus_tag="PCH_Pc13g00220"
FT                   /number=2
FT   exon            50464..50754
FT                   /gene="Pc13g00220"
FT                   /locus_tag="PCH_Pc13g00220"
FT                   /number=3
FT   intron          50755..50810
FT                   /gene="Pc13g00220"
FT                   /locus_tag="PCH_Pc13g00220"
FT                   /number=3
FT   exon            50811..51039
FT                   /gene="Pc13g00220"
FT                   /locus_tag="PCH_Pc13g00220"
FT                   /number=4
FT   intron          51040..51091
FT                   /gene="Pc13g00220"
FT                   /locus_tag="PCH_Pc13g00220"
FT                   /number=4
FT   exon            51092..51251
FT                   /gene="Pc13g00220"
FT                   /locus_tag="PCH_Pc13g00220"
FT                   /number=5
FT   intron          51252..51313
FT                   /gene="Pc13g00220"
FT                   /locus_tag="PCH_Pc13g00220"
FT                   /number=5
FT   exon            51314..55217
FT                   /gene="Pc13g00220"
FT                   /locus_tag="PCH_Pc13g00220"
FT                   /number=6
FT   mRNA            join(<56357..57123,57198..>57969)
FT                   /gene="Pc13g00230"
FT                   /locus_tag="PCH_Pc13g00230"
FT   CDS_pept        join(56357..57123,57198..57969)
FT                   /gene="Pc13g00230"
FT                   /locus_tag="PCH_Pc13g00230"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An18g00170 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91092"
FT                   /db_xref="InterPro:IPR031348"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H6"
FT                   /protein_id="CAP91092.1"
FT                   /translation="MIASGELIPFDTQTSDSETETSKSGLGKVREETQYEDGDDIELDE
FT                   YIIDIRHIVTSLSVFHFLDYSGVFNRGSYRFVSTLENPAGNDKSFTDYNGPSLSETGCF
FT                   PRHPSTRTRVNKILAEPIGLASGLQALAKFAFQCSTTLHETVNSFRSHYKPVRGLLEEL
FT                   EALSAVLGPLAEFVTSTADIDMSALDLPLLRCGSACKGFQQEILQLSSRSDKGQPNFQD
FT                   WARLKYMDDDIDGFQTMLAGYKATFNIALADANLRQSSVNTEILDDYKRLIQNTEVDLE
FT                   DRLKIIDSKLECIVEKSVTQSEPGAAELQYMKEERLSTEKCLQICAQLSDHIDHIQLMS
FT                   DGGGASHHPDTLGIPPETVTNESLQECKNNLSLTAARLEKHMQDTMNRQLSRPNTATSS
FT                   KIDEEDLTRLQDGCITAQQCLDICSKADSHLKDNDNVIEDYGPGDGSKFKVSTYGDVLH
FT                   AKTRAHGWRTQQLGGYRSEDTVQRLSRDIATINMSHLDGGEPHSTDRRPLDECD"
FT   exon            56357..57123
FT                   /gene="Pc13g00230"
FT                   /locus_tag="PCH_Pc13g00230"
FT                   /number=1
FT   intron          57124..57197
FT                   /gene="Pc13g00230"
FT                   /locus_tag="PCH_Pc13g00230"
FT                   /number=1
FT   exon            57198..57969
FT                   /gene="Pc13g00230"
FT                   /locus_tag="PCH_Pc13g00230"
FT                   /number=2
FT   mRNA            <58754..>59734
FT                   /gene="Pc13g00240"
FT                   /locus_tag="PCH_Pc13g00240"
FT   CDS_pept        58754..59734
FT                   /pseudo
FT                   /gene="Pc13g00240"
FT                   /locus_tag="PCH_Pc13g00240"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to protein encoded by ORF1
FT                   of transposon Ant1 - Aspergillus niger [putative
FT                   pseudogene]"
FT                   /db_xref="PSEUDO:CAP91093.1"
FT                   /inference="similar to AA sequence:TREMBL:S80872.1"
FT                   /inference="protein motif:COGS:COG3335"
FT   exon            58754..59734
FT                   /gene="Pc13g00240"
FT                   /locus_tag="PCH_Pc13g00240"
FT                   /number=1
FT   mRNA            complement(<59920..>61287)
FT                   /gene="Pc13g00250"
FT                   /locus_tag="PCH_Pc13g00250"
FT   CDS_pept        complement(59920..61287)
FT                   /gene="Pc13g00250"
FT                   /locus_tag="PCH_Pc13g00250"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An05g02110 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91094"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H8"
FT                   /protein_id="CAP91094.1"
FT                   /translation="MINHSFSNCDESQAQDLDPSDQDSQYAPTPGYYVHTPPSEYGFSP
FT                   SPNRCPHDGAEPLLSTPAETSKLLQLSEWEANRPDDELPASFIRYTIEWKVKVNNRSIS
FT                   EDTEQDVALTPSAYWPLILRDKLYKVIEEKVARKRRVRSDDTSIVVSINDRKQRDLKKR
FT                   FNGLNIDWSAVEKQILVWGKFHASGKELRLKIIFSYIEDDHSPRSATGRNDKRGKSSVT
FT                   KRMLNERDEQLDAEQHATGEQSIWRAVYTLMRCPSPSCHLGPHCWQDPHGKKHYQLRTH
FT                   HLKRLITYVEGGGILECQDDVPDAVREELFLEEQQKVERLRSKGNKMLAAGNCPPISIN
FT                   FMGGQHHLQSPAANSIVTSANSPPQHGQTADPLIIDGPRDLAVREYSAWQETNVVDDNL
FT                   KAQFRQACDVTLANGLDLEQIHEDHDAGFFIEKGVAVGIARRFVSDISRWVRHVRN"
FT   exon            complement(59920..61287)
FT                   /gene="Pc13g00250"
FT                   /locus_tag="PCH_Pc13g00250"
FT                   /number=1
FT   mRNA            join(<62431..62649,62706..>62858)
FT                   /gene="Pc13g00260"
FT                   /locus_tag="PCH_Pc13g00260"
FT   CDS_pept        join(62431..62649,62706..62858)
FT                   /gene="Pc13g00260"
FT                   /locus_tag="PCH_Pc13g00260"
FT                   /note="Title: similarity to hypothetical protein An04g07730
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91095"
FT                   /db_xref="GOA:B6H5H9"
FT                   /db_xref="InterPro:IPR036879"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H9"
FT                   /protein_id="CAP91095.1"
FT                   /translation="MAPVESPIKQEQLRKRRIKQEQLRKRRNNLLRRHNDFWRLYSIKS
FT                   WVVMEMPNGRLYTYYSHPDVAVPTKQEIAQRPQPAVHKSPPDYGPHESANEAIPKLPAI
FT                   TVLGRCNELWSTLSHYITR"
FT   exon            62431..62649
FT                   /gene="Pc13g00260"
FT                   /locus_tag="PCH_Pc13g00260"
FT                   /number=1
FT   intron          62650..62705
FT                   /gene="Pc13g00260"
FT                   /locus_tag="PCH_Pc13g00260"
FT                   /number=1
FT   exon            62706..62858
FT                   /gene="Pc13g00260"
FT                   /locus_tag="PCH_Pc13g00260"
FT                   /number=2
FT   mRNA            join(<64208..64216,64262..64361,64411..64622,64681..64765,
FT                   64978..65000,65070..65122,65198..65267,65476..65773,
FT                   65850..>66010)
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT   CDS_pept        join(64208..64216,64262..64361,64411..64622,64681..64765,
FT                   64978..65000,65070..65122,65198..65267,65476..65773,
FT                   65850..66010)
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /note="Title: similarity to hypothetical protein mg06815.1
FT                   - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91096"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H175"
FT                   /protein_id="CAP91096.1"
FT                   /translation="MSQILDGLCYLSSFGLTHQSLSCGGILLGTNGRVKIACLDQCSEC
FT                   SPTETYTIYANTIPRITMALMQKHEKDVGIAGVNDLNQWPVDSDAFGFLSAASTEPIES
FT                   LRKHPLVAARNQPTEDLVMLARAVLCAWVSKMHITLAIIPSGHEYVYIHCVPPVAIFLF
FT                   RDYHVRLAVHYLGSLEQSHYIVNKWNRTINDLCTQVTKWSLVKANNTVLEEILRRDRIL
FT                   RRNPEQSQRSAGSPFPLESAEEPAISTPPQVDAGSLDGMAIETQRTDAQASASKRGAGT
FT                   RNFLKHKAWPAEVLKRLPLWFEDQVRKNQSQEELMQSVAPSMLSVVSIRLVDGKR"
FT   exon            64208..64216
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=1
FT   intron          64217..64261
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=1
FT   exon            64262..64361
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=2
FT   intron          64362..64410
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=2
FT   exon            64411..64622
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=3
FT   intron          64623..64680
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=3
FT   exon            64681..64765
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=4
FT   intron          64766..64977
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=4
FT   exon            64978..65000
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=5
FT   intron          65001..65069
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=5
FT   exon            65070..65122
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=6
FT   intron          65123..65197
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=6
FT   exon            65198..65267
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=7
FT   intron          65268..65475
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=7
FT   exon            65476..65773
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=8
FT   intron          65774..65849
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=8
FT   exon            65850..66010
FT                   /gene="Pc13g00270"
FT                   /locus_tag="PCH_Pc13g00270"
FT                   /number=9
FT   mRNA            complement(join(<67232..67398,67448..67856,68009..>68143))
FT                   /gene="Pc13g00280"
FT                   /locus_tag="PCH_Pc13g00280"
FT   CDS_pept        complement(join(67232..67398,67448..67856,68009..68143))
FT                   /gene="Pc13g00280"
FT                   /locus_tag="PCH_Pc13g00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91097"
FT                   /db_xref="GOA:B6H176"
FT                   /db_xref="UniProtKB/TrEMBL:B6H176"
FT                   /protein_id="CAP91097.1"
FT                   /translation="MDHTDKRKASFYDLSQEILESIAIFTFLITYISVRFAVGHGLCSA
FT                   VENLVQLGASLKHIPCGDMVERAARSHNYKKLLSWLIDHGASFREVQGGIDRLCCEAYE
FT                   QGDFERFRWLFSKGASLDVLAGVVFDFSGCHRPRSREACRYHLLPLKRALREGAKPSGS
FT                   HEALTAELRLRRHKGLGDGEAWHSASKHVILPSDRVVEELCCQASRSSRARIQFYHLAD
FT                   IGKKGPSRRFMINP"
FT   exon            complement(67232..67398)
FT                   /gene="Pc13g00280"
FT                   /locus_tag="PCH_Pc13g00280"
FT                   /number=1
FT   intron          complement(67399..67447)
FT                   /gene="Pc13g00280"
FT                   /locus_tag="PCH_Pc13g00280"
FT                   /number=1
FT   exon            complement(67448..67856)
FT                   /gene="Pc13g00280"
FT                   /locus_tag="PCH_Pc13g00280"
FT                   /number=2
FT   intron          complement(67857..68008)
FT                   /gene="Pc13g00280"
FT                   /locus_tag="PCH_Pc13g00280"
FT                   /number=2
FT   exon            complement(68009..68143)
FT                   /gene="Pc13g00280"
FT                   /locus_tag="PCH_Pc13g00280"
FT                   /number=3
FT   mRNA            complement(<68187..>68587)
FT                   /gene="Pc13g00290"
FT                   /locus_tag="PCH_Pc13g00290"
FT   CDS_pept        complement(68187..68587)
FT                   /pseudo
FT                   /gene="Pc13g00290"
FT                   /locus_tag="PCH_Pc13g00290"
FT                   /note="putative pseudogene"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An08g11620 - Aspergillus niger [putative pseudogene]"
FT   exon            complement(68187..68587)
FT                   /gene="Pc13g00290"
FT                   /locus_tag="PCH_Pc13g00290"
FT                   /number=1
FT   mRNA            join(<69321..69528,69596..>69822)
FT                   /gene="Pc13g00300"
FT                   /locus_tag="PCH_Pc13g00300"
FT   CDS_pept        join(69321..69528,69596..69822)
FT                   /gene="Pc13g00300"
FT                   /locus_tag="PCH_Pc13g00300"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig127.tfa_340wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00300"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91099"
FT                   /db_xref="GOA:B6H177"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B6H177"
FT                   /inference="protein motif:PFAM:PF00636"
FT                   /inference="protein motif:COGS:COG0571"
FT                   /protein_id="CAP91099.1"
FT                   /translation="MSTYLSAESIRAIESILNYEFHDKSLLDKAFEAPGATEARGGHQR
FT                   QALIGDAALKLVLTELGYEGNASTGEITISRGSRVSNENLKRLGESLGLNAYFRLNPAS
FT                   QGVVPRSMMATTMEAIIGAVYLDSGKDMATTRALVNRLGI"
FT   exon            69321..69528
FT                   /gene="Pc13g00300"
FT                   /locus_tag="PCH_Pc13g00300"
FT                   /number=1
FT   intron          69529..69595
FT                   /gene="Pc13g00300"
FT                   /locus_tag="PCH_Pc13g00300"
FT                   /number=1
FT   exon            69596..69822
FT                   /gene="Pc13g00300"
FT                   /locus_tag="PCH_Pc13g00300"
FT                   /number=2
FT   mRNA            <70798..>72890
FT                   /gene="Pc13g00310"
FT                   /locus_tag="PCH_Pc13g00310"
FT   CDS_pept        70798..72890
FT                   /pseudo
FT                   /gene="Pc13g00310"
FT                   /locus_tag="PCH_Pc13g00310"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to LTR-containing
FT                   retrotransposable elements MARS1 - Ascobolus immersus
FT                   [putative pseudogene]"
FT                   /inference="similar to AA sequence:PIR:S71892"
FT                   /inference="protein motif:PFAM:PF00075"
FT   exon            70798..72890
FT                   /gene="Pc13g00310"
FT                   /locus_tag="PCH_Pc13g00310"
FT                   /number=1
FT   mRNA            <73662..>74771
FT                   /gene="Pc13g00320"
FT                   /locus_tag="PCH_Pc13g00320"
FT   CDS_pept        73662..74771
FT                   /gene="Pc13g00320"
FT                   /locus_tag="PCH_Pc13g00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00320"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91101"
FT                   /db_xref="GOA:B6H178"
FT                   /db_xref="UniProtKB/TrEMBL:B6H178"
FT                   /protein_id="CAP91101.1"
FT                   /translation="MVCLARFERAWLLRSLYSQSQRTLSNTVTTSDVKAPKATSFLQST
FT                   TLYPSSPTAQSWTSPLRSFPPETDIDTPTLTYPGTHTTTSEKENGIIEYLKVDDELGGS
FT                   GLIVEEQSSRTLLPFSLVEDEFAKAANGGARLSQYTVSSVDSDHDFTGSSEFVVYVPSD
FT                   QATLHQPAEVTSMKSSSSTGVFQSLSGQTSVGFSNRGTLPGTLGAVSRSKQKEIGSYVT
FT                   VNLEYSSHLFGNSRHHQPTQTTRNPPKFDDLDLSTLNPITKSQPMDSTKTVPATTTATK
FT                   NTVEQLGTDGSDASRVLSSHGVAVILGSISGASLLFAIIFYLHRFYFRRISTSSRGTGS
FT                   VTQPKADNPAATCPDMSEILEISRFSADS"
FT   exon            73662..74771
FT                   /gene="Pc13g00320"
FT                   /locus_tag="PCH_Pc13g00320"
FT                   /number=1
FT   mRNA            complement(join(<75794..78262,78419..79654,79993..>80830))
FT                   /gene="Pc13g00330"
FT                   /locus_tag="PCH_Pc13g00330"
FT   CDS_pept        complement(join(75794..78262,78419..79654,79993..80830))
FT                   /pseudo
FT                   /gene="Pc13g00330"
FT                   /locus_tag="PCH_Pc13g00330"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to LTR-containing
FT                   retrotransposable elements MARS1 - Ascobolus immersus
FT                   [putative pseudogene]"
FT                   /inference="similar to AA sequence:PIR:S71892"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /inference="protein motif:PFAM:PF00075"
FT   exon            complement(75794..78262)
FT                   /gene="Pc13g00330"
FT                   /locus_tag="PCH_Pc13g00330"
FT                   /number=1
FT   intron          complement(78263..78418)
FT                   /gene="Pc13g00330"
FT                   /locus_tag="PCH_Pc13g00330"
FT                   /number=1
FT   exon            complement(78419..79654)
FT                   /gene="Pc13g00330"
FT                   /locus_tag="PCH_Pc13g00330"
FT                   /number=2
FT   intron          complement(79655..79992)
FT                   /gene="Pc13g00330"
FT                   /locus_tag="PCH_Pc13g00330"
FT                   /number=2
FT   exon            complement(79993..80830)
FT                   /gene="Pc13g00330"
FT                   /locus_tag="PCH_Pc13g00330"
FT                   /number=3
FT   mRNA            complement(join(<81382..81401,81557..81660,81729..>81949))
FT                   /gene="Pc13g00340"
FT                   /locus_tag="PCH_Pc13g00340"
FT   CDS_pept        complement(join(81382..81401,81557..81660,81729..81949))
FT                   /gene="Pc13g00340"
FT                   /locus_tag="PCH_Pc13g00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91103"
FT                   /db_xref="InterPro:IPR011058"
FT                   /db_xref="InterPro:IPR036673"
FT                   /db_xref="UniProtKB/TrEMBL:B6H179"
FT                   /protein_id="CAP91103.1"
FT                   /translation="MRLGFLLSLFLNVVIARAGLSPVRTVCEFDWSLCQASNNGEMTCF
FT                   CDSDKQNQSTIDLNDCFVNLDGDLSPRQNGGFMDSCGELSFMPALPTLRATCKPNNQIT
FT                   SINMGPDLKL"
FT   exon            complement(81382..81401)
FT                   /gene="Pc13g00340"
FT                   /locus_tag="PCH_Pc13g00340"
FT                   /number=1
FT   mat_peptide     complement(join(81385..81401,81557..81660,81729..81895))
FT                   /gene="Pc13g00340"
FT                   /locus_tag="PCH_Pc13g00340"
FT   intron          complement(81402..81556)
FT                   /gene="Pc13g00340"
FT                   /locus_tag="PCH_Pc13g00340"
FT                   /number=1
FT   exon            complement(81557..81660)
FT                   /gene="Pc13g00340"
FT                   /locus_tag="PCH_Pc13g00340"
FT                   /number=2
FT   intron          complement(81661..81728)
FT                   /gene="Pc13g00340"
FT                   /locus_tag="PCH_Pc13g00340"
FT                   /number=2
FT   exon            complement(81729..81949)
FT                   /gene="Pc13g00340"
FT                   /locus_tag="PCH_Pc13g00340"
FT                   /number=3
FT   sig_peptide     complement(81896..81949)
FT                   /gene="Pc13g00340"
FT                   /locus_tag="PCH_Pc13g00340"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<82534..82708,82894..>83639)
FT                   /gene="Pc13g00350"
FT                   /locus_tag="PCH_Pc13g00350"
FT   CDS_pept        join(82534..82708,82894..83639)
FT                   /gene="Pc13g00350"
FT                   /locus_tag="PCH_Pc13g00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91104"
FT                   /db_xref="UniProtKB/TrEMBL:B6H180"
FT                   /protein_id="CAP91104.1"
FT                   /translation="MMKPQDNYCQLLMPQNYLYTIKHGIPQGGLAVIATFIFWSTARRV
FT                   ANAHRTSQYYRAKILLKTFPWKPVTPYRAPKQNPMDSVTPRKKDNEDHSVFLSSVAPIE
FT                   LSLTTSLQLPKEASNVGIPELDARGLSKQNNLETTFPQWQTKRAVHSKRENESTLHRTS
FT                   EKRTENSCRRNRVRKSSLGQHGSKASQCISSASFKNRTLSKAMKLGPITYRGALKMTGK
FT                   LCKAQLPLLKNHFRDRSDLFSDGEALLHEIATVHPKYNQIIQTLPILLNFIPGELKEKL
FT                   MIEENAEWLKMGAYLVNKWISRSQA"
FT   exon            82534..82708
FT                   /gene="Pc13g00350"
FT                   /locus_tag="PCH_Pc13g00350"
FT                   /number=1
FT   intron          82709..82893
FT                   /gene="Pc13g00350"
FT                   /locus_tag="PCH_Pc13g00350"
FT                   /number=1
FT   exon            82894..83639
FT                   /gene="Pc13g00350"
FT                   /locus_tag="PCH_Pc13g00350"
FT                   /number=2
FT   mRNA            complement(join(<84895..86421,86467..86771,86825..>87239))
FT                   /gene="Pc13g00360"
FT                   /locus_tag="PCH_Pc13g00360"
FT   CDS_pept        complement(join(84895..86421,86467..86771,86825..87239))
FT                   /gene="Pc13g00360"
FT                   /locus_tag="PCH_Pc13g00360"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig36.tfa_290wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00360"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91105"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniProtKB/TrEMBL:B6H181"
FT                   /protein_id="CAP91105.1"
FT                   /translation="MTRLTQAQVEEAEYKVFTYREEHFKMAARVDISRLVFDKNFKRQM
FT                   SNRQNIARLERILDTQGCQRLMEECHVPVLIPESDWQRRVRPRLVDGQFHQLDVDIDYQ
FT                   LRGQDHENLIIAARKKLSSSNSWWIVDVYVTGQTAGEEPLQEEFVRSLRERFPNDQRPP
FT                   DGLIYERIRYYEGYLDGPVNRIAANHWWAALERVPGSKKGKYLRAFLKHPTLPQAFDEL
FT                   LPIAGIWEGMRIGLLHKLFSKPHDQKAKWTYQPLLCYLNHIKSTFFGLMGDRRDLLAQL
FT                   DGVTIQLLKSRVPKVSARDLRFLENRMSKEELFPDIEGVQDRTEIWERLKEIQYPIPTL
FT                   ETFFKDRISLEVGRSVLQQLYIPDPHRKMTVDEELGERYYTSVPVMTSNRQQGIRGDLY
FT                   DFWRFSFQYGFEMTDHKRRTRTKPGTQLAPTPMEELHERQKLWQHLFWLVREKGFSTPL
FT                   VDGLPAHPVELSPITPCDYPASVEEDLPVERRNGTPYKDSMEADHFALSREVLERPWSS
FT                   PRVTAGFARRSVFLAYFRYLKVENGSQSIPEVETNEAVPQEPSLWNPSFDDLIQNTIIP
FT                   PEENEATVFPVFSTPQFDPTSLAPAGDIQPPSRFSMKFIIPGEPDKVVLLPNIQSALNK
FT                   FFEGFSRYHFHIYSGDNPTRGIYGRDCYSLYLGNPFLLLHAEYIGADLSETVFHGSTDQ
FT                   QETRTTKKRRLNENEQGELISAKEWLNASLDELTQEIPENRVDMDLPGGEDSIT"
FT   exon            complement(84895..86421)
FT                   /gene="Pc13g00360"
FT                   /locus_tag="PCH_Pc13g00360"
FT                   /number=1
FT   intron          complement(86422..86466)
FT                   /gene="Pc13g00360"
FT                   /locus_tag="PCH_Pc13g00360"
FT                   /number=1
FT   exon            complement(86467..86771)
FT                   /gene="Pc13g00360"
FT                   /locus_tag="PCH_Pc13g00360"
FT                   /number=2
FT   intron          complement(86772..86824)
FT                   /gene="Pc13g00360"
FT                   /locus_tag="PCH_Pc13g00360"
FT                   /number=2
FT   exon            complement(86825..87239)
FT                   /gene="Pc13g00360"
FT                   /locus_tag="PCH_Pc13g00360"
FT                   /number=3
FT   mRNA            <88107..>88580
FT                   /gene="Pc13g00370"
FT                   /locus_tag="PCH_Pc13g00370"
FT   CDS_pept        88107..>88580
FT                   /gene="Pc13g00370"
FT                   /locus_tag="PCH_Pc13g00370"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   SPAC15A10.09c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91106"
FT                   /db_xref="GOA:B6H182"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:B6H182"
FT                   /inference="similar to AA sequence:PIR:T37709"
FT                   /protein_id="CAP91106.1"
FT                   /translation="MDGIDVANKASSEANSVMNSASTAVIYASGAAETAASQVTDKIQS
FT                   LSDEINSHLPGFYSVGLWGYCQGQKETSSYSNCSQPSTSFSFDLLSILGSASPVIDGIL
FT                   PDGNNKVLAGYHGVSRWSISAYILGFVSTFVAVVFGVTTMFFSWGKILLIISSL"
FT   exon            88107..88580
FT                   /gene="Pc13g00370"
FT                   /locus_tag="PCH_Pc13g00370"
FT                   /number=1
FT   mRNA            complement(<90182..>90601)
FT                   /gene="Pc13g00380"
FT                   /locus_tag="PCH_Pc13g00380"
FT   CDS_pept        complement(90182..90601)
FT                   /gene="Pc13g00380"
FT                   /locus_tag="PCH_Pc13g00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91107"
FT                   /db_xref="UniProtKB/TrEMBL:B6H183"
FT                   /protein_id="CAP91107.1"
FT                   /translation="MEEIVDIVRQIGRQQGENVYFRTCYALFKHLQDKAEQASQDLLHL
FT                   HQSGAFGSSDDEFYPVYQVAQELQVSVHELAEQALKAQLACEEFCQLDPSYSAREAFKF
FT                   TDTVHTAGKTEADASQGVCDSPRSMRFIMLPVNDL"
FT   exon            complement(90182..90601)
FT                   /gene="Pc13g00380"
FT                   /locus_tag="PCH_Pc13g00380"
FT                   /number=1
FT   mRNA            join(<93499..93546,93598..93995,94046..94949,94995..>95606)
FT                   /gene="Pc13g00390"
FT                   /locus_tag="PCH_Pc13g00390"
FT   CDS_pept        join(93499..93546,93598..93995,94046..94949,94995..95606)
FT                   /gene="Pc13g00390"
FT                   /locus_tag="PCH_Pc13g00390"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An01g07930 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00390"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91108"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniProtKB/TrEMBL:B6H184"
FT                   /protein_id="CAP91108.1"
FT                   /translation="MLETLPCEILMLIADWLPVTTLRVLSRASSRLYAVLVPRIYRTVS
FT                   FCAASEWALNVLDVDPFFRHLGPSRAADYLQHTRHLQIRAPFHLVRFNRCAYYNIFRAA
FT                   GLPESPAPLGASDDATAHQQFLDDVKDQLQLIFTHLEPNRLSIFEWRLGTCVPVGVLDQ
FT                   EGYLSQYQQRLTRLSLVTDGTCPETSHRLEGMSRLTCLTAFEWEGLQHPSEVDLLRRCI
FT                   RQNWSCLDQLSIGFVPSAFARALCWQSLGLQRPELEDGGRGTGVTTNEDTGIANPTALS
FT                   ALSTLSLSKVTLPLDISSGHNAIFYSLRSLTLRDCPNQLHLVQLLSWSQKPLRLTHFEF
FT                   SFDYLLHEPGEGCGLSAVVRFLCSFRGLQHLHLRLSNFPSSKSHIQDTIQHHQTTLKSL
FT                   VYHERQLAPIDADGLFEDDRDVSPAWVTNLSTGVDLGQVCALALCASPSAARRCLRPTA
FT                   KHSQLQILHLRFSGLERFHRDIPREITTYLNGIRKGYSWHPRSCWSSVNRDVSNDSHNY
FT                   PPIVDEYFDRSPLEFVDSQEAVLMSSAAIAEAEDFVSFADWVFGPDGLPALQVLAFGDF
FT                   SHGDRYRSQQFLMRRVYPSSEGGGKELAGLAFDDTTRLPFCSADMSDPSIWDGAMVDGA
FT                   RFLSACPGGGLMESPYEL"
FT   exon            93499..93546
FT                   /gene="Pc13g00390"
FT                   /locus_tag="PCH_Pc13g00390"
FT                   /number=1
FT   intron          93547..93597
FT                   /gene="Pc13g00390"
FT                   /locus_tag="PCH_Pc13g00390"
FT                   /number=1
FT   exon            93598..93995
FT                   /gene="Pc13g00390"
FT                   /locus_tag="PCH_Pc13g00390"
FT                   /number=2
FT   intron          93996..94045
FT                   /gene="Pc13g00390"
FT                   /locus_tag="PCH_Pc13g00390"
FT                   /number=2
FT   exon            94046..94949
FT                   /gene="Pc13g00390"
FT                   /locus_tag="PCH_Pc13g00390"
FT                   /number=3
FT   intron          94950..94994
FT                   /gene="Pc13g00390"
FT                   /locus_tag="PCH_Pc13g00390"
FT                   /number=3
FT   exon            94995..95606
FT                   /gene="Pc13g00390"
FT                   /locus_tag="PCH_Pc13g00390"
FT                   /number=4
FT   mRNA            complement(join(<99639..100003,100088..100213,
FT                   100436..100619,100869..101129,101204..>101767))
FT                   /gene="Pc13g00400"
FT                   /locus_tag="PCH_Pc13g00400"
FT   CDS_pept        complement(join(99639..100003,100088..100213,
FT                   100436..100619,100869..101129,101204..101767))
FT                   /gene="Pc13g00400"
FT                   /locus_tag="PCH_Pc13g00400"
FT                   /note="Title: weak similarity to metalloreductase freA
FT                   -Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91109"
FT                   /db_xref="GOA:B6H168"
FT                   /db_xref="UniProtKB/TrEMBL:B6H168"
FT                   /protein_id="CAP91109.1"
FT                   /translation="MPPTGSKWYRWIADTSLPNLYAISAAIILAICLIYWLARDVSLWM
FT                   WTRHHVVFLFPFRSRMLGSWRRLAFVHLPKCLHWLDIPNYREALILAVMLAANIVGLRL
FT                   RAHSWAEAQKRAGSLAVINLVPLCTGISFGLPADLLHVDRQMLAWFHRWIGRICVLHSL
FT                   FHCSLLVAAARTMNLVTPRHIFPIAALVLVIPVTCAAVQRRYLQFAMKCHYLLAATAIG
FT                   TLIYHLVERRSLYRWYLVGAICLWFFISAVVCIMAAWNQKPWGSSQKEVVMNSILGPYG
FT                   HPLDFYRFGTILFVVEDIGFFRALSYIEMLVEASCRREVMVRKLEVLWKRQVGKDGPQN
FT                   NISYEYAERICYFYGSIKIEEEVERYLNNHQCGAVAVAVCAGPSIREAVTKTIRLRTGR
FT                   NLQLMVFDPDMCPAPDGLVDSLSSDETPAGSQDPPHQLLGVGEDRHTHQVRRFLADSSK
FT                   LQYPSPKEIYTEAGNVEMNNHSKWVESRLAQGRRKPTTTKP"
FT   exon            complement(99639..100003)
FT                   /gene="Pc13g00400"
FT                   /locus_tag="PCH_Pc13g00400"
FT                   /number=1
FT   intron          complement(100004..100087)
FT                   /gene="Pc13g00400"
FT                   /locus_tag="PCH_Pc13g00400"
FT                   /number=1
FT   exon            complement(100088..100213)
FT                   /gene="Pc13g00400"
FT                   /locus_tag="PCH_Pc13g00400"
FT                   /number=2
FT   intron          complement(100214..100435)
FT                   /gene="Pc13g00400"
FT                   /locus_tag="PCH_Pc13g00400"
FT                   /number=2
FT   exon            complement(100436..100619)
FT                   /gene="Pc13g00400"
FT                   /locus_tag="PCH_Pc13g00400"
FT                   /number=3
FT   intron          complement(100620..100868)
FT                   /gene="Pc13g00400"
FT                   /locus_tag="PCH_Pc13g00400"
FT                   /number=3
FT   exon            complement(100869..101129)
FT                   /gene="Pc13g00400"
FT                   /locus_tag="PCH_Pc13g00400"
FT                   /number=4
FT   intron          complement(101130..101203)
FT                   /gene="Pc13g00400"
FT                   /locus_tag="PCH_Pc13g00400"
FT                   /number=4
FT   exon            complement(101204..101767)
FT                   /gene="Pc13g00400"
FT                   /locus_tag="PCH_Pc13g00400"
FT                   /number=5
FT   mRNA            complement(join(<102107..102396,102673..102769,
FT                   102944..103065,103100..103160,103238..103373,
FT                   103532..>104103))
FT                   /gene="Pc13g00410"
FT                   /locus_tag="PCH_Pc13g00410"
FT   CDS_pept        complement(join(102107..102396,102673..102769,
FT                   102944..103065,103100..103160,103238..103373,
FT                   103532..104103))
FT                   /gene="Pc13g00410"
FT                   /locus_tag="PCH_Pc13g00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91110"
FT                   /db_xref="UniProtKB/TrEMBL:B6H169"
FT                   /protein_id="CAP91110.1"
FT                   /translation="MSQCQKGISLLFRHEGYYEIACSIMEQLTASDVGALLASLRITPA
FT                   QHTVETFLQPLRDFDPTMRQFESWFQDKCQILIIGPDTIRLSDRIFNADEYYKGKRPSQ
FT                   TQLEVWIFAIPANFEKGAKEVQCLRHCSHASSLFSIQERAEALIAGQELLENNLIRQIS
FT                   YTDAEPSKVPGEYLDVKVFDLFSTTTHRRERPSASSKTPKPGILPRVPGLGSTVNGFYP
FT                   YQLVLNSCGALSQQRKYLGLDDADPTAVDVEPETSHQVASWRPLQFHAPPSHRSQSYRS
FT                   LMVQALIHAFRTNYSAHSSSNNSICFILSLTGPRSKCRDPGSQCLDIQNKRHPTQRFEF
FT                   IIMSLQAEVSRMQHEYILMLQNGDNMLRAYANENAKLEEQNRSLLEHVKLLQQENCSLE
FT                   LDHNRLESELAKERLQCPEQADGKRL"
FT   exon            complement(102107..102396)
FT                   /gene="Pc13g00410"
FT                   /locus_tag="PCH_Pc13g00410"
FT                   /number=1
FT   intron          complement(102397..102672)
FT                   /gene="Pc13g00410"
FT                   /locus_tag="PCH_Pc13g00410"
FT                   /number=1
FT   exon            complement(102673..102769)
FT                   /gene="Pc13g00410"
FT                   /locus_tag="PCH_Pc13g00410"
FT                   /number=2
FT   intron          complement(102770..102943)
FT                   /gene="Pc13g00410"
FT                   /locus_tag="PCH_Pc13g00410"
FT                   /number=2
FT   exon            complement(102944..103065)
FT                   /gene="Pc13g00410"
FT                   /locus_tag="PCH_Pc13g00410"
FT                   /number=3
FT   intron          complement(103066..103099)
FT                   /gene="Pc13g00410"
FT                   /locus_tag="PCH_Pc13g00410"
FT                   /number=3
FT   exon            complement(103100..103160)
FT                   /gene="Pc13g00410"
FT                   /locus_tag="PCH_Pc13g00410"
FT                   /number=4
FT   intron          complement(103161..103237)
FT                   /gene="Pc13g00410"
FT                   /locus_tag="PCH_Pc13g00410"
FT                   /number=4
FT   exon            complement(103238..103373)
FT                   /gene="Pc13g00410"
FT                   /locus_tag="PCH_Pc13g00410"
FT                   /number=5
FT   intron          complement(103374..103531)
FT                   /gene="Pc13g00410"
FT                   /locus_tag="PCH_Pc13g00410"
FT                   /number=5
FT   exon            complement(103532..104103)
FT                   /gene="Pc13g00410"
FT                   /locus_tag="PCH_Pc13g00410"
FT                   /number=6
FT   mRNA            join(<104179..104213,104329..104391,104641..104771,
FT                   104827..105072,105124..105165,105326..105564,
FT                   105615..>105734)
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT   CDS_pept        join(104179..104213,104329..104391,104641..104771,
FT                   104827..105072,105124..105165,105326..105564,
FT                   105615..105734)
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91111"
FT                   /db_xref="GOA:B6H170"
FT                   /db_xref="UniProtKB/TrEMBL:B6H170"
FT                   /protein_id="CAP91111.1"
FT                   /translation="MKLLPKMSRDNNSLLGESLSLPEYLACWCEDLTCSVPGSGKLVPG
FT                   IQVCVPGGFWAPRNTRPVPRDIHSAPRRRLGVHDITSNPVARNPAYKFNPVPVHLHVAR
FT                   TAAIMQVSPKVHTALATVLLIVSLVRLELSRRAARGISHLALDLAVSVPKDVLLGNTWD
FT                   IQRLSVLTRATLVGIYVYLPLQHAVLFLHFVDYLSLAYLLWSLDEYTTAGSRTGLQLRC
FT                   ALHWTMGLAAVLLLIAVFGVVLYCWLLSLELQLCILTIWMILSYYSVRSAGSSVDEQST
FT                   CSATVVVREV"
FT   exon            104179..104213
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /number=1
FT   intron          104214..104328
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /number=1
FT   exon            104329..104391
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /number=2
FT   intron          104392..104640
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /number=2
FT   exon            104641..104771
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /number=3
FT   intron          104772..104826
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /number=3
FT   exon            104827..105072
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /number=4
FT   intron          105073..105123
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /number=4
FT   exon            105124..105165
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /number=5
FT   intron          105166..105325
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /number=5
FT   exon            105326..105564
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /number=6
FT   intron          105565..105614
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /number=6
FT   exon            105615..105734
FT                   /gene="Pc13g00420"
FT                   /locus_tag="PCH_Pc13g00420"
FT                   /number=7
FT   mRNA            complement(join(<105856..106257,106302..>106418))
FT                   /gene="Pc13g00430"
FT                   /locus_tag="PCH_Pc13g00430"
FT   CDS_pept        complement(join(105856..106257,106302..106418))
FT                   /gene="Pc13g00430"
FT                   /locus_tag="PCH_Pc13g00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91112"
FT                   /db_xref="UniProtKB/TrEMBL:B6H171"
FT                   /protein_id="CAP91112.1"
FT                   /translation="MESPSKTSEGTGTQAEAPLYTQSSPTEEPPLPDVATPLPTLNHDI
FT                   ERQTLAVEPFRPILEVLKQIEEEDTELAFRAAHLVGYIRCLWESCVSKHTDIQQLEEEN
FT                   EKLRTGNIQLCNEGNRLKRYQDEQVSRLHAIDDALDEVRGRLIGVLKVWNDRSVGDLAI
FT                   LPEDGFPRC"
FT   exon            complement(105856..106257)
FT                   /gene="Pc13g00430"
FT                   /locus_tag="PCH_Pc13g00430"
FT                   /number=1
FT   intron          complement(106258..106301)
FT                   /gene="Pc13g00430"
FT                   /locus_tag="PCH_Pc13g00430"
FT                   /number=1
FT   exon            complement(106302..106418)
FT                   /gene="Pc13g00430"
FT                   /locus_tag="PCH_Pc13g00430"
FT                   /number=2
FT   mRNA            complement(join(<107234..107304,107391..>107694))
FT                   /gene="Pc13g00440"
FT                   /locus_tag="PCH_Pc13g00440"
FT   CDS_pept        complement(join(107234..107304,107391..107694))
FT                   /gene="Pc13g00440"
FT                   /locus_tag="PCH_Pc13g00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91113"
FT                   /db_xref="UniProtKB/TrEMBL:B6H172"
FT                   /protein_id="CAP91113.1"
FT                   /translation="MPLISRQPTHPAGDELDTMPLLVRRPNTRPSRKSKGANSPAQSTL
FT                   QRDQPTLRLRLQQRCMTPEAWWTSLTAFGAHDNISKHMLEHEKAIATEEIRQEWMRLSA
FT                   GETMFQGNEPSITRELSCLS"
FT   exon            complement(107234..107304)
FT                   /gene="Pc13g00440"
FT                   /locus_tag="PCH_Pc13g00440"
FT                   /number=1
FT   intron          complement(107305..107390)
FT                   /gene="Pc13g00440"
FT                   /locus_tag="PCH_Pc13g00440"
FT                   /number=1
FT   exon            complement(107391..107694)
FT                   /gene="Pc13g00440"
FT                   /locus_tag="PCH_Pc13g00440"
FT                   /number=2
FT   mRNA            join(<108837..108909,108956..109194,109254..>109637)
FT                   /gene="Pc13g00450"
FT                   /locus_tag="PCH_Pc13g00450"
FT   CDS_pept        join(108837..108909,108956..109194,109254..109637)
FT                   /gene="Pc13g00450"
FT                   /locus_tag="PCH_Pc13g00450"
FT                   /note="Title: similarity to hypothetical protein An12g06780
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91114"
FT                   /db_xref="UniProtKB/TrEMBL:B6H173"
FT                   /protein_id="CAP91114.1"
FT                   /translation="MVLTSNERRAFFRQQCREALAAHIYDRLGLVVAPSDVRLQPSVGD
FT                   KYAWSVTESKKSLLQTNLSSGSVGLYRSICEELGRSLEAVTPQTLQFARLERDHLPKEE
FT                   SGPARSDEEGNGSFTAKIRELECANHEIKNELGRTSIHLQESLGENRTLHAKIRQLQDE
FT                   LDSISSRETQLEDELVRISGGITKAMQVLQEYEAHERGMLYGGRQREYCDSTDSMALGI
FT                   PAPIRDEVF"
FT   exon            108837..108909
FT                   /gene="Pc13g00450"
FT                   /locus_tag="PCH_Pc13g00450"
FT                   /number=1
FT   intron          108910..108955
FT                   /gene="Pc13g00450"
FT                   /locus_tag="PCH_Pc13g00450"
FT                   /number=1
FT   exon            108956..109194
FT                   /gene="Pc13g00450"
FT                   /locus_tag="PCH_Pc13g00450"
FT                   /number=2
FT   intron          109195..109253
FT                   /gene="Pc13g00450"
FT                   /locus_tag="PCH_Pc13g00450"
FT                   /number=2
FT   exon            109254..109637
FT                   /gene="Pc13g00450"
FT                   /locus_tag="PCH_Pc13g00450"
FT                   /number=3
FT   mRNA            join(<110609..110643,110855..110961,111059..>111771)
FT                   /gene="Pc13g00460"
FT                   /locus_tag="PCH_Pc13g00460"
FT   CDS_pept        join(110609..110643,110855..110961,111059..111771)
FT                   /gene="Pc13g00460"
FT                   /locus_tag="PCH_Pc13g00460"
FT                   /note="Title: similarity to ankyrin Ank2 - Drosophila
FT                   melanogaster"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91115"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B6H174"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /inference="protein motif:COGS:COG0666"
FT                   /protein_id="CAP91115.1"
FT                   /translation="MHKYRRISILASYITFIPIYCRHLGTDKHHLSSTLSPFPLNSVAQ
FT                   NHASTLEGGDISALARTHSTFYPKLRLALIKYNIRHQNSSALHWAAKNNNRAFAKTLLS
FT                   YQADVNALHDGFSPLMTAAKYGSELITNLLLRKKNLHVNRRNADGESALWYSVAKESSA
FT                   VVNQLLQHPRTKIDLPNREGQTVLWLAVFRGNRDLVSLLLSRGANPNTMDRYGMSPWIQ
FT                   SCVRRGESIKYLLLDHMKAVSPEIFSVDGVFAENGKSICEDSSSYGQSQVQLRAKRVRY
FT                   AHV"
FT   exon            110609..110643
FT                   /gene="Pc13g00460"
FT                   /locus_tag="PCH_Pc13g00460"
FT                   /number=1
FT   intron          110644..110854
FT                   /gene="Pc13g00460"
FT                   /locus_tag="PCH_Pc13g00460"
FT                   /number=1
FT   exon            110855..110961
FT                   /gene="Pc13g00460"
FT                   /locus_tag="PCH_Pc13g00460"
FT                   /number=2
FT   intron          110962..111058
FT                   /gene="Pc13g00460"
FT                   /locus_tag="PCH_Pc13g00460"
FT                   /number=2
FT   exon            111059..111771
FT                   /gene="Pc13g00460"
FT                   /locus_tag="PCH_Pc13g00460"
FT                   /number=3
FT   mRNA            complement(join(<112000..112104,112155..112342,
FT                   112413..112512,112570..>113088))
FT                   /gene="Pc13g00470"
FT                   /locus_tag="PCH_Pc13g00470"
FT   CDS_pept        complement(join(112000..112104,112155..112342,
FT                   112413..112512,112570..113088))
FT                   /gene="Pc13g00470"
FT                   /locus_tag="PCH_Pc13g00470"
FT                   /note="Title: weak similarity to serine/threonine protein
FT                   kinase homolog - Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91116"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H185"
FT                   /inference="similar to AA sequence:PIR:T18259"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP91116.1"
FT                   /translation="MDPIKRQPSRPEPEWRDGTPDWAALERTSRPSVPSSRPQPGPVII
FT                   PPTLSLPHPALQKGQIEQTIQPVFENPWLTYEAIVVISQGQSVFLARHRKDKATLVDIH
FT                   LLKQQFSSVKPLLDTISQTSHPSFLGLVGCYCWEEQVFLVREPVELSVSHILASRCTIT
FT                   EDEIAAIVRPVLGGIQYLRCHGRALAALSADTILLTELGGVRIAGVEHSCQINAAEMDA
FT                   ATMKLFALAEMVERLLMKNPSQYPWSAEIKNLPEELKRCDSPEKLLRSKLFEQLGDEGE
FT                   LKMLVNAANKTAYHNLESYKRI"
FT   exon            complement(112000..112104)
FT                   /gene="Pc13g00470"
FT                   /locus_tag="PCH_Pc13g00470"
FT                   /number=1
FT   intron          complement(112105..112154)
FT                   /gene="Pc13g00470"
FT                   /locus_tag="PCH_Pc13g00470"
FT                   /number=1
FT   exon            complement(112155..112342)
FT                   /gene="Pc13g00470"
FT                   /locus_tag="PCH_Pc13g00470"
FT                   /number=2
FT   intron          complement(112343..112412)
FT                   /gene="Pc13g00470"
FT                   /locus_tag="PCH_Pc13g00470"
FT                   /number=2
FT   exon            complement(112413..112512)
FT                   /gene="Pc13g00470"
FT                   /locus_tag="PCH_Pc13g00470"
FT                   /number=3
FT   intron          complement(112513..112569)
FT                   /gene="Pc13g00470"
FT                   /locus_tag="PCH_Pc13g00470"
FT                   /number=3
FT   exon            complement(112570..113088)
FT                   /gene="Pc13g00470"
FT                   /locus_tag="PCH_Pc13g00470"
FT                   /number=4
FT   mRNA            complement(join(<113532..113784,113839..>114623))
FT                   /gene="Pc13g00480"
FT                   /locus_tag="PCH_Pc13g00480"
FT   CDS_pept        complement(join(113532..113784,113839..114623))
FT                   /gene="Pc13g00480"
FT                   /locus_tag="PCH_Pc13g00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91117"
FT                   /db_xref="GOA:B6H186"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:B6H186"
FT                   /inference="protein motif:PFAM:PF00097"
FT                   /protein_id="CAP91117.1"
FT                   /translation="MSDPQWLWDPLSICEMGPIRETKTCCGITKKGDACKLIVKKDTLK
FT                   EGRHKLNNLARGPFNLSTLDSQLSDLVSFFLCKQWHRERQHNDVKQRWFDAAVRNQADV
FT                   QESPRQRFPHIIAEEIDGPQQEPASTALETDGFAPIWGVDAAFPRLPSPTWLEVTRPPG
FT                   RDVTPGMLTMNRVPWNVSRDNPAILSIHNEYGGLHSLQIHTVRQESCPDGERCPICFEG
FT                   DSDDLVMLQCGICKGVVHLGCMEGWLAHRLPGNNTSCPIHRCNGSFRALLRSSAVGNAT
FT                   GNSTAETPLEDTYTPVEETSVPTAPPQRRSTQTTRRSDRPRVFSSSSIIRRSPRSRRVP
FT                   DRFLP"
FT   exon            complement(113532..113784)
FT                   /gene="Pc13g00480"
FT                   /locus_tag="PCH_Pc13g00480"
FT                   /number=1
FT   intron          complement(113785..113838)
FT                   /gene="Pc13g00480"
FT                   /locus_tag="PCH_Pc13g00480"
FT                   /number=1
FT   exon            complement(113839..114623)
FT                   /gene="Pc13g00480"
FT                   /locus_tag="PCH_Pc13g00480"
FT                   /number=2
FT   mRNA            join(<114755..114975,115059..>115185)
FT                   /gene="Pc13g00490"
FT                   /locus_tag="PCH_Pc13g00490"
FT   CDS_pept        join(114755..114975,115059..115185)
FT                   /gene="Pc13g00490"
FT                   /locus_tag="PCH_Pc13g00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91118"
FT                   /db_xref="UniProtKB/TrEMBL:B6H187"
FT                   /protein_id="CAP91118.1"
FT                   /translation="MGGDNLDALCFAGQTVELPEALGLLEPEYVFLETGRVLPGNDTGI
FT                   PGSPCSPRSPYLSPKEPDFRSQEPSSLQPGPRVPRNLYCFPRRREKRHVQHRSFDCRVI
FT                   NQGPLGLFSFI"
FT   exon            114755..114975
FT                   /gene="Pc13g00490"
FT                   /locus_tag="PCH_Pc13g00490"
FT                   /number=1
FT   intron          114976..115058
FT                   /gene="Pc13g00490"
FT                   /locus_tag="PCH_Pc13g00490"
FT                   /number=1
FT   exon            115059..115185
FT                   /gene="Pc13g00490"
FT                   /locus_tag="PCH_Pc13g00490"
FT                   /number=2
FT   mRNA            join(<115315..115574,115660..>115756)
FT                   /gene="Pc13g00500"
FT                   /locus_tag="PCH_Pc13g00500"
FT   CDS_pept        join(115315..115574,115660..115756)
FT                   /gene="Pc13g00500"
FT                   /locus_tag="PCH_Pc13g00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91119"
FT                   /db_xref="UniProtKB/TrEMBL:B6H188"
FT                   /protein_id="CAP91119.1"
FT                   /translation="MSIVPTAHPSVLSTNMHWSSDNLESLLGQIIGDPTHHLKCRWAED
FT                   NGVRCQNLVSKDSRIDGAICLKMFQDLPTGHSPAMGLSKAARPVKQRKLLKLSKMGTIS
FT                   LFYRHTAGRLACPT"
FT   exon            115315..115574
FT                   /gene="Pc13g00500"
FT                   /locus_tag="PCH_Pc13g00500"
FT                   /number=1
FT   intron          115575..115659
FT                   /gene="Pc13g00500"
FT                   /locus_tag="PCH_Pc13g00500"
FT                   /number=1
FT   exon            115660..115756
FT                   /gene="Pc13g00500"
FT                   /locus_tag="PCH_Pc13g00500"
FT                   /number=2
FT   mRNA            complement(join(<116626..116985,117129..117162,
FT                   117225..>117313))
FT                   /gene="Pc13g00510"
FT                   /locus_tag="PCH_Pc13g00510"
FT   CDS_pept        complement(join(116626..116985,117129..117162,
FT                   117225..117313))
FT                   /gene="Pc13g00510"
FT                   /locus_tag="PCH_Pc13g00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91120"
FT                   /db_xref="UniProtKB/TrEMBL:B6H189"
FT                   /protein_id="CAP91120.1"
FT                   /translation="MQTSGSRTVSNLDRLTVYGPKELKRTVHDPAIYTSPTSVAREYLR
FT                   LLARLDSRAVRAERAQSKLEQELSASRAAENQATEELGHVSRLADIFFELSQILGGVVD
FT                   HWLKERGTKEPGQEPESTKVMLDVLLKQLEAQEFANSGEKSGDDSESGTEAAAQRS"
FT   exon            complement(116626..116985)
FT                   /gene="Pc13g00510"
FT                   /locus_tag="PCH_Pc13g00510"
FT                   /number=1
FT   intron          complement(116986..117128)
FT                   /gene="Pc13g00510"
FT                   /locus_tag="PCH_Pc13g00510"
FT                   /number=1
FT   exon            complement(117129..117162)
FT                   /gene="Pc13g00510"
FT                   /locus_tag="PCH_Pc13g00510"
FT                   /number=2
FT   intron          complement(117163..117224)
FT                   /gene="Pc13g00510"
FT                   /locus_tag="PCH_Pc13g00510"
FT                   /number=2
FT   exon            complement(117225..117313)
FT                   /gene="Pc13g00510"
FT                   /locus_tag="PCH_Pc13g00510"
FT                   /number=3
FT   mRNA            join(<118628..118783,118963..>119412)
FT                   /gene="Pc13g00520"
FT                   /locus_tag="PCH_Pc13g00520"
FT   CDS_pept        join(118628..118783,118963..119412)
FT                   /gene="Pc13g00520"
FT                   /locus_tag="PCH_Pc13g00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91121"
FT                   /db_xref="UniProtKB/TrEMBL:B6H190"
FT                   /protein_id="CAP91121.1"
FT                   /translation="MPSRRTTSEAPADAGHGSSESDAAPKRTRRPPSTGHGGPPSGTQG
FT                   ASLHTPLRLEADKTQATAKIRQLSDTNDQNLARIQTLEFQISSLKQQQLDAVQVGNTAS
FT                   DNLLPILLEVSGNFQYAQSQLEKKIEAEKTAEKNKLTFAGFPASDVLQPSWPVYNGQMG
FT                   SLGTNSLQSYSLPLTNQQAPTQANHQPLPTASQYIPQF"
FT   exon            118628..118783
FT                   /gene="Pc13g00520"
FT                   /locus_tag="PCH_Pc13g00520"
FT                   /number=1
FT   intron          118784..118962
FT                   /gene="Pc13g00520"
FT                   /locus_tag="PCH_Pc13g00520"
FT                   /number=1
FT   exon            118963..119412
FT                   /gene="Pc13g00520"
FT                   /locus_tag="PCH_Pc13g00520"
FT                   /number=2
FT   mRNA            join(<124917..126780,126842..127294,127657..127882,
FT                   127928..>128045)
FT                   /gene="Pc13g00530"
FT                   /locus_tag="PCH_Pc13g00530"
FT   CDS_pept        join(124917..126780,126842..127294,127657..127882,
FT                   127928..128045)
FT                   /gene="Pc13g00530"
FT                   /locus_tag="PCH_Pc13g00530"
FT                   /note="Title: similarity to helicase Pif1 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91122"
FT                   /db_xref="GOA:B6H191"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6H191"
FT                   /inference="similar to AA sequence:TREMBL:SC9745.12"
FT                   /inference="protein motif:COGS:COG0507"
FT                   /protein_id="CAP91122.1"
FT                   /translation="MPGGHPTTTAIQNDLAEILLGLFIPWQNLQSLFHQTRTGSATTVD
FT                   LHHIWMSIEPTLSSYVRTFAQNIELLRKSKTDCQADAILRDRSAQNTSSVDQDLTSPPY
FT                   PISDSENESIRFSQHVDDSISKETLLAAFFAIGRGWSNEANDAQRRIPTLTSTSLPSSP
FT                   LQFDNFGPIPISNSTLYESTGLQFFPLFTLQEWKTRLQNITKAVNQDTQPGMPTTTASD
FT                   LDDFNLGMADDVLVPILTEPDLSLDLQHRRSEIGQNPTGASLTSLVRDIIPLNEKQRLV
FT                   VERVISNLLACVNHPYDSSMRQQTLLYVGGEGGVGKSQIIKAIVAVMDLIHRKDEVILM
FT                   APTGAAADVIGGSTYHTSLGISLNRYRRGGVAPRVRSLWSRKTVMIIDEVSMIDLSALS
FT                   IINTHCKIARSLDRSSPHLFGGLPVVILMGDFHQFPPVQGQALWKLPRNDTEQDGKLIW
FT                   NQFQQVIILHEQMRQAEDIPYQNLLGRARSGTLTSDDLSTLNSKAITSLTDPHLQPATV
FT                   IVKLNSLRHVINRLQIERFARARHQNIFVFPALHTRTRSSGPTSLQLRADDLLGLPEQG
FT                   AKVPFPGLILYTLSMPTMVLTNICTPAGLVNGATGQAMGIAIDPQAEFLKLDDLYIFCT
FT                   KPPVCLLFKPARTQSNLFQSLDSGILPIFPLEMSITVKGYSVRRKQIPICPAFCLTDYK
FT                   IQGATLDSVILDLKDDTKSRRQESHRKYCSTYVQLSRLRSLHGLHLLQSISMSDLEHRP
FT                   DPQLLEEMRRLQTLQEQTLGLSLQLRVSLNIPSQDIHSDDVEQNEIPTLIRFFNEGNRP
FT                   DLYQPNAFVYSSGSFPTTSSEDEGFHIVLHAHNLDRHPGNQEDTASYFMHCPGAAQPIV
FT                   TFLGVAASFLSGVVT"
FT   exon            124917..126780
FT                   /gene="Pc13g00530"
FT                   /locus_tag="PCH_Pc13g00530"
FT                   /number=1
FT   intron          126781..126841
FT                   /gene="Pc13g00530"
FT                   /locus_tag="PCH_Pc13g00530"
FT                   /number=1
FT   exon            126842..127294
FT                   /gene="Pc13g00530"
FT                   /locus_tag="PCH_Pc13g00530"
FT                   /number=2
FT   intron          127295..127656
FT                   /gene="Pc13g00530"
FT                   /locus_tag="PCH_Pc13g00530"
FT                   /number=2
FT   exon            127657..127882
FT                   /gene="Pc13g00530"
FT                   /locus_tag="PCH_Pc13g00530"
FT                   /number=3
FT   intron          127883..127927
FT                   /gene="Pc13g00530"
FT                   /locus_tag="PCH_Pc13g00530"
FT                   /number=3
FT   exon            127928..128045
FT                   /gene="Pc13g00530"
FT                   /locus_tag="PCH_Pc13g00530"
FT                   /number=4
FT   mRNA            complement(join(<128133..128534,128600..>128878))
FT                   /gene="Pc13g00540"
FT                   /locus_tag="PCH_Pc13g00540"
FT   CDS_pept        complement(join(128133..128534,128600..128878))
FT                   /gene="Pc13g00540"
FT                   /locus_tag="PCH_Pc13g00540"
FT                   /note="Title: strong similarity to arsenic resistance
FT                   protein ArsH - Yersinia enterocolitica"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91123"
FT                   /db_xref="GOA:B6H192"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B6H192"
FT                   /inference="similar to AA sequence:TREMBL:AF102990.64"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /inference="protein motif:COGS:COG0431"
FT                   /inference="protein motif:COGS:COG0655"
FT                   /protein_id="CAP91123.1"
FT                   /translation="MDMAELDLQLTNKRLRVLVLYGSLRRRSYSRLVALEACRILFRLG
FT                   CDVRIFDPEGLPVKNDSDTDHPKVQELRELSVWSDGHVWVSPEQHGNLTAVFKNQIDWI
FT                   PLTTGSVRPTQGRTLAIAQVCGGSQSFNAVNSLRILGRWMRMFTIPNQSSIPRAYTQFP
FT                   DEGQPEDQRLMPSGNRDRLVDCMEEFIKYTILMRPHIGLFGDRFSEREEKKAKEEKMNA
FT                   AAAR"
FT   exon            complement(128133..128534)
FT                   /gene="Pc13g00540"
FT                   /locus_tag="PCH_Pc13g00540"
FT                   /number=1
FT   intron          complement(128535..128599)
FT                   /gene="Pc13g00540"
FT                   /locus_tag="PCH_Pc13g00540"
FT                   /number=1
FT   exon            complement(128600..128878)
FT                   /gene="Pc13g00540"
FT                   /locus_tag="PCH_Pc13g00540"
FT                   /number=2
FT   mRNA            join(<129330..129452,129547..>130191)
FT                   /gene="Pc13g00550"
FT                   /locus_tag="PCH_Pc13g00550"
FT   CDS_pept        join(129330..129452,129547..130191)
FT                   /gene="Pc13g00550"
FT                   /locus_tag="PCH_Pc13g00550"
FT                   /note="Title: similarity to hypothetical protein ncu01851.1
FT                   - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00550"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91124"
FT                   /db_xref="UniProtKB/TrEMBL:B6H193"
FT                   /protein_id="CAP91124.1"
FT                   /translation="MTKYRHWVPFQLGRMFRLLYEFNYTPQIRAFITLIPIPRTREYIQ
FT                   QLEQQLRSFQRLGVAATQDVQKAGRKVAAENASLRSLLMIHGVTKIQIEEYLESQRQTA
FT                   SSIQSQYPSVVSLPSTNLHRPTADGQPSVDHHHSLSSQEVNSTSHPPKTLEVRSSPPRS
FT                   DPKISMNISNRQESSAGRAVELGSVTAETVPDSQHFGGVQDTGQFTSCVTAASLIESIR
FT                   NHSDFRDVRSELGCDSEPNCMVKNMSIFDILDR"
FT   exon            129330..129452
FT                   /gene="Pc13g00550"
FT                   /locus_tag="PCH_Pc13g00550"
FT                   /number=1
FT   intron          129453..129546
FT                   /gene="Pc13g00550"
FT                   /locus_tag="PCH_Pc13g00550"
FT                   /number=1
FT   exon            129547..130191
FT                   /gene="Pc13g00550"
FT                   /locus_tag="PCH_Pc13g00550"
FT                   /number=2
FT   mRNA            complement(<130867..>131547)
FT                   /gene="Pc13g00560"
FT                   /locus_tag="PCH_Pc13g00560"
FT   CDS_pept        complement(130867..131547)
FT                   /gene="Pc13g00560"
FT                   /locus_tag="PCH_Pc13g00560"
FT                   /note="Title: strong similarity to phosphorus acquisition
FT                   transcriptional activator NUC-1 negative regulator PREG
FT                   -Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00560"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91125"
FT                   /db_xref="GOA:B6H137"
FT                   /db_xref="InterPro:IPR012389"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:B6H137"
FT                   /inference="similar to AA sequence:PIR:S52974"
FT                   /protein_id="CAP91125.1"
FT                   /translation="MSNNFQRKSQDDAHSPNGPLVYRLYSKLNISQLGQRWHPRSDVKL
FT                   LPAKYELTEPSDLVVLISSMLMQLIRINDKMPLQQGQQTRFHSRTAPQIPVFNYLQRLA
FT                   THAKLPSAILLSMVYYIDRLCMLYPAFTVSSLTIHRFLIVSAAVASKGLSDSFWTNKTY
FT                   AQIGGISTMELAMLELDFLFRMEWQIVPQPEVLTDYYRHLVDRCESFKINEPNSNISTV
FT                   SVLR"
FT   exon            complement(130867..131547)
FT                   /gene="Pc13g00560"
FT                   /locus_tag="PCH_Pc13g00560"
FT                   /number=1
FT   mRNA            complement(join(<132590..133246,133311..133397,
FT                   133446..133588,133640..>133922))
FT                   /gene="Pc13g00570"
FT                   /locus_tag="PCH_Pc13g00570"
FT   CDS_pept        complement(join(132590..133246,133311..133397,
FT                   133446..133588,133640..133922))
FT                   /gene="Pc13g00570"
FT                   /locus_tag="PCH_Pc13g00570"
FT                   /note="Title: strong similarity to membrane protein
FT                   involved in arsenite transport like protein An18g03550
FT                   -Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00570"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91126"
FT                   /db_xref="GOA:B6H138"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B6H138"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /inference="protein motif:COGS:COG0798"
FT                   /inference="protein motif:COGS:COG0385"
FT                   /protein_id="CAP91126.1"
FT                   /translation="MAAPTGRHPTKESEYHNSILHSQPPTPTAEDVEKQESEESTAKQS
FT                   AFKGLGWLDRFLALWIFLAMAVGIILGNFVENTGPALQKGKFVGVSIPIAIGLLVMMYP
FT                   ILCKVRYESLHHVFRERGVWIQIGFSIFINWIIAPLLMLALAWAFLPDEPELREGLILV
FT                   GLARCIAMVLIWTGLAGGDNEYCAILVAVNSLLQMVLFAPLAILFIKVIGHSGSQVTLS
FT                   YSTAAKSVAVFLGIPLGAAIITRIVLRKITSPRWYDQVFLKWAGPWSLIGLLFTILVLF
FT                   ASQGRQVVHQIVSVVRVAAPLIVYFIVVFFITLLVTYKLGFGYKLSATQSFTAASNNFE
FT                   LAIAVAVATFGANSNQALAATVGPLIEVPVLLGLVYVAKFIAKRAGWKD"
FT   exon            complement(132590..133246)
FT                   /gene="Pc13g00570"
FT                   /locus_tag="PCH_Pc13g00570"
FT                   /number=1
FT   intron          complement(133247..133310)
FT                   /gene="Pc13g00570"
FT                   /locus_tag="PCH_Pc13g00570"
FT                   /number=1
FT   exon            complement(133311..133397)
FT                   /gene="Pc13g00570"
FT                   /locus_tag="PCH_Pc13g00570"
FT                   /number=2
FT   intron          complement(133398..133445)
FT                   /gene="Pc13g00570"
FT                   /locus_tag="PCH_Pc13g00570"
FT                   /number=2
FT   exon            complement(133446..133588)
FT                   /gene="Pc13g00570"
FT                   /locus_tag="PCH_Pc13g00570"
FT                   /number=3
FT   intron          complement(133589..133639)
FT                   /gene="Pc13g00570"
FT                   /locus_tag="PCH_Pc13g00570"
FT                   /number=3
FT   exon            complement(133640..133922)
FT                   /gene="Pc13g00570"
FT                   /locus_tag="PCH_Pc13g00570"
FT                   /number=4
FT   mRNA            join(<134893..135215,135356..135408,135572..>135603)
FT                   /gene="Pc13g00580"
FT                   /locus_tag="PCH_Pc13g00580"
FT   CDS_pept        join(134893..135215,135356..135408,135572..135603)
FT                   /gene="Pc13g00580"
FT                   /locus_tag="PCH_Pc13g00580"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig46_part_ii.tfa_2030cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00580"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91127"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B6H139"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /inference="protein motif:COGS:COG0394"
FT                   /protein_id="CAP91127.1"
FT                   /translation="MAKPSVLFVCVHNAGRSQMAAGYLMHLAGDTIEVRSAGSAPADSI
FT                   NPVVVEAMREEGIDLSNQKPKILTADAVQDSDVVITMGCGDVCPFFAGKRYLDWQLNDP
FT                   AGQGVLGEQPLCGGWPLVALLTSVCPYKDAG"
FT   sig_peptide     134893..134943
FT                   /gene="Pc13g00580"
FT                   /locus_tag="PCH_Pc13g00580"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            134893..135215
FT                   /gene="Pc13g00580"
FT                   /locus_tag="PCH_Pc13g00580"
FT                   /number=1
FT   mat_peptide     join(134944..135215,135356..135408,135572..135600)
FT                   /gene="Pc13g00580"
FT                   /locus_tag="PCH_Pc13g00580"
FT   intron          135216..135355
FT                   /gene="Pc13g00580"
FT                   /locus_tag="PCH_Pc13g00580"
FT                   /number=1
FT   exon            135356..135408
FT                   /gene="Pc13g00580"
FT                   /locus_tag="PCH_Pc13g00580"
FT                   /number=2
FT   intron          135409..135571
FT                   /gene="Pc13g00580"
FT                   /locus_tag="PCH_Pc13g00580"
FT                   /number=2
FT   exon            135572..135603
FT                   /gene="Pc13g00580"
FT                   /locus_tag="PCH_Pc13g00580"
FT                   /number=3
FT   mRNA            join(<136113..136426,136472..>137147)
FT                   /gene="Pc13g00590"
FT                   /locus_tag="PCH_Pc13g00590"
FT   CDS_pept        join(136113..136426,136472..137147)
FT                   /gene="Pc13g00590"
FT                   /locus_tag="PCH_Pc13g00590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00590"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91128"
FT                   /db_xref="UniProtKB/TrEMBL:B6H140"
FT                   /protein_id="CAP91128.1"
FT                   /translation="MPSNSTFPAIIHIRDFVEHVEPDPTRPGKGLSLQLRVSLNLPWKD
FT                   IQSDDVEQDEILTLVRFFNEGNQSDLYKPNTFVYSSGSFLTTSSDDEEFHIVLHAHNLD
FT                   RHPGNEEDIESYFMHCPEAAQPIVTFLGVVIERGGQLNGGPTLLHYRLQTTVYNSSTRT
FT                   NHTFPITAYFKNGQRWANFPPLSMNTHVFLTGRVFGLTKEHRQLAVVTDDIHFLPTPNN
FT                   QLPATPPSTGKRKRVDRWSQRAGPQTPTKSAARPQTESLHITYQSQDPTQMIAPGEDDE
FT                   EDAQITWPDTPEEIKASSRTTTPVPERRSQRPRKTSYADILAQSKYDT"
FT   exon            136113..136426
FT                   /gene="Pc13g00590"
FT                   /locus_tag="PCH_Pc13g00590"
FT                   /number=1
FT   intron          136427..136471
FT                   /gene="Pc13g00590"
FT                   /locus_tag="PCH_Pc13g00590"
FT                   /number=1
FT   exon            136472..137147
FT                   /gene="Pc13g00590"
FT                   /locus_tag="PCH_Pc13g00590"
FT                   /number=2
FT   mRNA            complement(join(<138607..140872,140929..141088,
FT                   141141..141369,141426..141716,141771..141830,
FT                   141890..142115,142177..>142532))
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT   CDS_pept        complement(join(138607..140872,140929..141088,
FT                   141141..141369,141426..141716,141771..141830,
FT                   141890..142115,142177..142532))
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   BAB75479.1 - Nostoc sp."
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00600"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91129"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H141"
FT                   /inference="protein motif:COGS:COG0457"
FT                   /inference="protein motif:COGS:COG2909"
FT                   /protein_id="CAP91129.1"
FT                   /translation="MASQKKWYVFRVTGLSRERPDGDLETTLQEAIDDNFADDETSHIK
FT                   PEIKIVPSCYESDTERAALVQFRGGVPQFLAELRVNPLGDWQIEMGDDDISFDCHFFGF
FT                   TQLYMPDGNKPVIADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTMIYGY
FT                   NSKLSSHGVDTILDYGRELIEEIKKIRNTKELQQRPLIFIAHSFGGIIVAHCLVKAIQT
FT                   MEGDHPAITSLYQATYGMILFAIPHKGLMMDDIQQMLAGDQSHPRERLLQQISSKSDLL
FT                   IHQLADFKNLIRDRKVVSFYETEQTRQLVLDSESGRWKRTGDFVTTVGADSALLQLPDH
FT                   VEDKVPLHADHSMVVKFNTRNAAGYRTAVDKLRQFLKDAPSMVAARFTQTRPKPQPCST
FT                   VPFKKDPMFVGREVVISAINERYRAIGQRHERVGLVGLAGVGKTQTAIEYSYRVRESTP
FT                   DTWVFWIHASNTARLEQGYQQIATVAEIPGRDDPKINILQLVYQWLCDARNGRWLVVLD
FT                   NADDDGIFFSDNTFNERGPLVSFLPQAAHGSMLITSRNGLAARNLVGSESHVIRVQPMN
FT                   EAESLSLLRARIPAPQSGESGESGGNERALVQALECIPLAITQAAAYIANRLPLVTVTE
FT                   YLRLFHESESKRTRLLQNEDSADLRRDPSIRYAVITTWQLSFEQIRQERPTATDLLALM
FT                   SMFDRQGIPEDLVRDHNQDILDFHDALAPLLSYSLIRLEINERLFDMHRLVQLSVRAWL
FT                   DMHQQLYGWQAKSRQIMARVFPGGEYESWSQCRSLLAHANSVLQSICDVDDEDRLNAAT
FT                   LLSNCGWFLHLQGVYEEAELMHRRALEARENALGREHPDTLTSVSDLGLVLSSQGKYDE
FT                   AEAMHRRALEARENALGREHPDTLTSVSNLGDVLSSQGVYEEAEAMHRRALEARENVLG
FT                   REHPDTLTSVSDLGNVLSSQGVYEEAEAMHRRALEARENALGREHPDTLTSVSNLGDVL
FT                   SSQGVYEEAEAMHRRALEARENVLGREHPDTLTSVSDLGNVLSSQGKYDEAEAMHRRAL
FT                   EARENVLGREHPSTLTSVNNLGLVLSSQGKYDEAEAIYLHDMEGSEKVLGCEHPNTVTS
FT                   INNLGLVLSSQGNYDEGEAMHRRALEAREKVLRREHPDTLTSVSTLGNVLSSQGKYDEA
FT                   EAIYLHDMEGSENVLGCEHPGILASLNIR"
FT   exon            complement(138607..140872)
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /number=1
FT   intron          complement(140873..140928)
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /number=1
FT   exon            complement(140929..141088)
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /number=2
FT   intron          complement(141089..141140)
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /number=2
FT   exon            complement(141141..141369)
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /number=3
FT   intron          complement(141370..141425)
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /number=3
FT   exon            complement(141426..141716)
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /number=4
FT   intron          complement(141717..141770)
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /number=4
FT   exon            complement(141771..141830)
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /number=5
FT   intron          complement(141831..141889)
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /number=5
FT   exon            complement(141890..142115)
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /number=6
FT   intron          complement(142116..142176)
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /number=6
FT   exon            complement(142177..142532)
FT                   /gene="Pc13g00600"
FT                   /locus_tag="PCH_Pc13g00600"
FT                   /number=7
FT   mRNA            complement(join(<144001..145063,145190..145250,
FT                   145447..146602,146658..146795,147170..150642,
FT                   150675..>151884))
FT                   /gene="Pc13g00610"
FT                   /locus_tag="PCH_Pc13g00610"
FT   CDS_pept        complement(join(144001..145063,145190..145250,
FT                   145447..146602,146658..146795,147170..150642,
FT                   150675..151884))
FT                   /pseudo
FT                   /gene="Pc13g00610"
FT                   /locus_tag="PCH_Pc13g00610"
FT                   /note="putative pseudogene"
FT                   /note="Title: weak similarity to retrotransposon Tto1
FT                   -Nicotiana tabacum [putative pseudogene]"
FT                   /db_xref="PSEUDO:CAP91130.1"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /inference="protein motif:PFAM:PF03184"
FT   exon            complement(144001..145063)
FT                   /gene="Pc13g00610"
FT                   /locus_tag="PCH_Pc13g00610"
FT                   /number=1
FT   intron          complement(145064..145189)
FT                   /gene="Pc13g00610"
FT                   /locus_tag="PCH_Pc13g00610"
FT                   /number=1
FT   exon            complement(145190..145250)
FT                   /gene="Pc13g00610"
FT                   /locus_tag="PCH_Pc13g00610"
FT                   /number=2
FT   intron          complement(145251..145446)
FT                   /gene="Pc13g00610"
FT                   /locus_tag="PCH_Pc13g00610"
FT                   /number=2
FT   exon            complement(145447..146602)
FT                   /gene="Pc13g00610"
FT                   /locus_tag="PCH_Pc13g00610"
FT                   /number=3
FT   intron          complement(146603..146657)
FT                   /gene="Pc13g00610"
FT                   /locus_tag="PCH_Pc13g00610"
FT                   /number=3
FT   exon            complement(146658..146795)
FT                   /gene="Pc13g00610"
FT                   /locus_tag="PCH_Pc13g00610"
FT                   /number=4
FT   intron          complement(146796..147169)
FT                   /gene="Pc13g00610"
FT                   /locus_tag="PCH_Pc13g00610"
FT                   /number=4
FT   exon            complement(147170..150642)
FT                   /gene="Pc13g00610"
FT                   /locus_tag="PCH_Pc13g00610"
FT                   /number=5
FT   intron          complement(150643..150674)
FT                   /gene="Pc13g00610"
FT                   /locus_tag="PCH_Pc13g00610"
FT                   /number=5
FT   exon            complement(150675..151884)
FT                   /gene="Pc13g00610"
FT                   /locus_tag="PCH_Pc13g00610"
FT                   /number=6
FT   mRNA            complement(join(<152801..155387,155446..155605,
FT                   155670..155898,155952..156242,156419..156644,
FT                   156706..>157073))
FT                   /gene="Pc13g00620"
FT                   /locus_tag="PCH_Pc13g00620"
FT   CDS_pept        complement(join(152801..155387,155446..155605,
FT                   155670..155898,155952..156242,156419..156644,
FT                   156706..157073))
FT                   /gene="Pc13g00620"
FT                   /locus_tag="PCH_Pc13g00620"
FT                   /note="Title: strong similarity to cDNA kinesin light like
FT                   protein An03g03030 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91131"
FT                   /db_xref="GOA:B6H150"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6H150"
FT                   /inference="protein motif:PFAM:PF05729"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /inference="protein motif:COGS:COG0457"
FT                   /inference="protein motif:COGS:COG3903"
FT                   /protein_id="CAP91131.1"
FT                   /translation="MANQRKSHVFRVTGLSIKLPDGDLKTDEDFRTALYGTLNDNFIDD
FT                   ENSQIKSDITIVPSCYESDTQRVALVQFRGGMPQFLRDHDPLGDWQVEIGDDDISFDCH
FT                   FFGFTQLYTLDENKPVDADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTM
FT                   IYGYNSKLSSPGVNTILDYGRELMEEIKKIRNTKECLVRAIQTLEEDHPAITSLHRATY
FT                   GMILFAIPHKGLVMDDIQQMLGGDGHHPREKLLRQISSQSDVLIHQLADFKNLIRDRKV
FT                   VSFYETEQTKRLVLDLESGCWKRTGDFMTTVDADSALLQLPDHIEDKVPLHADHSMIVK
FT                   FDTRNAAGYRTALDKLRQLSKDAPAVVAARFAQTRQKPQPCSTVPFERDPVFVGRKYEI
FT                   NAIEKKHGTIGQRHERVALVGLAGVGKTQTAIEYSYCVRESTPDMWVFWIHASNLERLE
FT                   QGYRQIAAVTEIPGRDDPKINILQLVYQWLCDARNGRWLIVLDNADDDSIFFRENESKE
FT                   RGPLVNFLPQAAHGSMLITSRNGRAARNLVGRNSHVIEVQPMNEEESVALLRRWIPAPQ
FT                   SGDFGESGEDEKALVQALEYIPLAITQAGSYIANRLPLITVTAYLRLFHESESKRTRLL
FT                   KNEDSTDLRRDPSIRYAVITTWQISFEQIRQERPVASDLLALMSMFDRQGIPVDLVRES
FT                   EQDELDFHDALVPLLNYSLIRLEINERLFDMHRLVQLSVRAWLEMHQQLYSWQAKSREI
FT                   MARVFPDGEYESWTQCRSLLAHAKSVLNSIYDVEGEDRLNTATLLSNCGWFLNLQGAYE
FT                   EAELMHRRALEAREKVLGREHPSTLISVNNLGLVLSKQGQYDEAEAMHRRALEAREKVL
FT                   GREHPDTLTSVNNLGLVLSNQGKYEEAGAMHQRALEAREKVLGREHPSTLGSVSNLGNV
FT                   LGRQGKYEEAEAMYRRALKAREKVLGREHPDTLIGVSNLGVVLFKQGQYEEAEAIYRRA
FT                   LKAREKVLGREHPDTLTSVNNLGDVLSKQGKYEEAEAMHRGALEVKEKVLGREHPSTLI
FT                   SVNNLGLVLTKQGQYEEAEAMYRRALEARQKVLGREHPDTLTSVNNLGLVLKSQGKYKE
FT                   AEAMYRRALEARQKVLGQEHPDTLGSVNNFASVLSKQGQYKEAEAMYRRALDGYEKVLG
FT                   REHPDTLMSVNNLGSVLFKQGQYEEAEAMYRRALEARQKVLGREHPDTLTSVNNLGDVL
FT                   SKQGRHEEAEAMHRWAQTVDSSTLMQQGILLKNIFSTPHPLLQLSLRHHRSLEEKHDRD
FT                   VD"
FT   exon            complement(152801..155387)
FT                   /gene="Pc13g00620"
FT                   /locus_tag="PCH_Pc13g00620"
FT                   /number=1
FT   intron          complement(155388..155445)
FT                   /gene="Pc13g00620"
FT                   /locus_tag="PCH_Pc13g00620"
FT                   /number=1
FT   exon            complement(155446..155605)
FT                   /gene="Pc13g00620"
FT                   /locus_tag="PCH_Pc13g00620"
FT                   /number=2
FT   intron          complement(155606..155669)
FT                   /gene="Pc13g00620"
FT                   /locus_tag="PCH_Pc13g00620"
FT                   /number=2
FT   exon            complement(155670..155898)
FT                   /gene="Pc13g00620"
FT                   /locus_tag="PCH_Pc13g00620"
FT                   /number=3
FT   intron          complement(155899..155951)
FT                   /gene="Pc13g00620"
FT                   /locus_tag="PCH_Pc13g00620"
FT                   /number=3
FT   exon            complement(155952..156242)
FT                   /gene="Pc13g00620"
FT                   /locus_tag="PCH_Pc13g00620"
FT                   /number=4
FT   intron          complement(156243..156418)
FT                   /gene="Pc13g00620"
FT                   /locus_tag="PCH_Pc13g00620"
FT                   /number=4
FT   exon            complement(156419..156644)
FT                   /gene="Pc13g00620"
FT                   /locus_tag="PCH_Pc13g00620"
FT                   /number=5
FT   intron          complement(156645..156705)
FT                   /gene="Pc13g00620"
FT                   /locus_tag="PCH_Pc13g00620"
FT                   /number=5
FT   exon            complement(156706..157073)
FT                   /gene="Pc13g00620"
FT                   /locus_tag="PCH_Pc13g00620"
FT                   /number=6
FT   mRNA            complement(<158328..>159968)
FT                   /gene="Pc13g00630"
FT                   /locus_tag="PCH_Pc13g00630"
FT   CDS_pept        complement(158328..159968)
FT                   /pseudo
FT                   /gene="Pc13g00630"
FT                   /locus_tag="PCH_Pc13g00630"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to transposase Tan1
FT                   -Aspergillus niger"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT                   /inference="protein motif:PFAM:PF05225"
FT                   /inference="protein motif:PFAM:PF03184"
FT   exon            complement(158328..159968)
FT                   /gene="Pc13g00630"
FT                   /locus_tag="PCH_Pc13g00630"
FT                   /number=1
FT   mRNA            complement(<160324..>161142)
FT                   /gene="Pc13g00640"
FT                   /locus_tag="PCH_Pc13g00640"
FT   CDS_pept        complement(<160324..>161142)
FT                   /gene="Pc13g00640"
FT                   /locus_tag="PCH_Pc13g00640"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   ncu00832.1 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00640"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91133"
FT                   /db_xref="GOA:B6H151"
FT                   /db_xref="UniProtKB/TrEMBL:B6H151"
FT                   /protein_id="CAP91133.1"
FT                   /translation="DLDTSLDYLPGHPRIKLGDEKGLFDFIRREVWSEDLESISGRLWW
FT                   MSKQDGSNISPLHRQRVKGRQIIVTEDPRLHLVWIDDRIFLKTLPQYIMSYVFWDTFLS
FT                   DPSKYGAEVKLRMAALGYLRTYFYLIQHESDLRIAKDPALSLVPKEVTWPQFCQFTACF
FT                   HNITDHEVSERYHYGEIRLTRLNYYAPVLLGKGHYQRVNHQYRAYFARIQGPVISAFAF
FT                   FSILLNCMQVSLAASASDERYSSAPLFASCYWFSTVIGLLTGVLLLMLVLL"
FT   exon            complement(160324..161142)
FT                   /gene="Pc13g00640"
FT                   /locus_tag="PCH_Pc13g00640"
FT                   /number=1
FT   mRNA            complement(<161665..>163221)
FT                   /gene="Pc13g00650"
FT                   /locus_tag="PCH_Pc13g00650"
FT   CDS_pept        complement(161665..>163221)
FT                   /gene="Pc13g00650"
FT                   /locus_tag="PCH_Pc13g00650"
FT                   /note="Title: strong similarity to transposase Tan1
FT                   -Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00650"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91134"
FT                   /db_xref="GOA:B6H152"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="UniProtKB/TrEMBL:B6H152"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT                   /inference="protein motif:PFAM:PF03184"
FT                   /protein_id="CAP91134.1"
FT                   /translation="HTYAIQSISTGIPASTLWRRANNRPSIADKAANQQYLTPQEEQAL
FT                   VEYVLRLADNGYPLSVKFLRSLALIIVRQRSSNFQITDPSLKVRTPGKNWPQGFYRRHP
FT                   QLKARRLRAIDWKRDGRHIEDKVRHWFDIIGRELANPAILLEVYNMDETGVLLSVLNSL
FT                   KVLVSKDDLRKHRGTTMKRTLVMAIECISADGRFLHPLIIWPAATHRSSWTTHPTPGWH
FT                   FSCSKTGYTNTEISLYWVEHVFDPQTRDRAGGRPRLLICDGFGTHESLEVMKFCFANRI
FT                   ILCRLPSHTSHKLQPCDVGVFSPLKTAYRAQIEQACRAGVSTIGKPHFTYLYDSARKEA
FT                   FTPRNIRSAWSRSGLFPFDPSRVLRECQASSEIQTTTPVEAPTVSSNICHTPNTSDSFA
FT                   LLRSEVEQDTQNLDGVCKRRLQTLSCATERVFAERALLLEENRILFEQNNEKTCRQSSG
FT                   LTVLGHAKVMSYEDIVEAQKKRDMTVTEQATREKRSKLGASCFRNRRRSARRSRRFKHG
FT                   I"
FT   exon            complement(161665..163221)
FT                   /gene="Pc13g00650"
FT                   /locus_tag="PCH_Pc13g00650"
FT                   /number=1
FT   mRNA            join(<164634..164989,165051..165276,165453..165743,
FT                   165800..166028,166086..>166495)
FT                   /gene="Pc13g00660"
FT                   /locus_tag="PCH_Pc13g00660"
FT   CDS_pept        join(164634..164989,165051..165276,165453..165743,
FT                   165800..166028,166086..166495)
FT                   /gene="Pc13g00660"
FT                   /locus_tag="PCH_Pc13g00660"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   BAB55393.1 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91135"
FT                   /db_xref="UniProtKB/TrEMBL:B6H143"
FT                   /inference="similar to AA sequence:TREMBLNEW:AK027823.1"
FT                   /protein_id="CAP91135.1"
FT                   /translation="MASQRKSHVLRVTGLSRELTDGDLTTALQEAINDNFTDDEKSHSK
FT                   VDISIVPSCYEDNTQRVALVQFRGGVPQFLDELRVDPLGEWQVEIGDTDINFDCHFFGF
FT                   TQLYTLDENKPVDADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPRCRTMIYGY
FT                   NSKLSSHGVDTILDYGRELMEEIKKIRNTKECLVRAIQTMEEDHPAITSLHRATYGMIL
FT                   FAIPHKGLVMDDIQQMLAGDKSHPREQLLRQISSKSDVLIHQVADFRNLIRDRKVVSLY
FT                   EMKQTRRLVLDSESGRWKRTGDFMTTVGADSALLQLPDHAEDKVPLHADHSIIVKFDKR
FT                   DAPGYRTALDRLRQFSKDAPSVVAARFNASNAPAALLQGSAVRKRNIIDNDSETPKAKR
FT                   ARLYDSASSPNSEESDTTHYEDDNIFDDISQEKVYNMGEPWEESHKSFSGSLTARDATS
FT                   EIGSPFRYGSSSREGSSSEYELADESDILEPDELSMSEESISSAC"
FT   exon            164634..164989
FT                   /gene="Pc13g00660"
FT                   /locus_tag="PCH_Pc13g00660"
FT                   /number=1
FT   intron          164990..165050
FT                   /gene="Pc13g00660"
FT                   /locus_tag="PCH_Pc13g00660"
FT                   /number=1
FT   exon            165051..165276
FT                   /gene="Pc13g00660"
FT                   /locus_tag="PCH_Pc13g00660"
FT                   /number=2
FT   intron          165277..165452
FT                   /gene="Pc13g00660"
FT                   /locus_tag="PCH_Pc13g00660"
FT                   /number=2
FT   exon            165453..165743
FT                   /gene="Pc13g00660"
FT                   /locus_tag="PCH_Pc13g00660"
FT                   /number=3
FT   intron          165744..165799
FT                   /gene="Pc13g00660"
FT                   /locus_tag="PCH_Pc13g00660"
FT                   /number=3
FT   exon            165800..166028
FT                   /gene="Pc13g00660"
FT                   /locus_tag="PCH_Pc13g00660"
FT                   /number=4
FT   intron          166029..166085
FT                   /gene="Pc13g00660"
FT                   /locus_tag="PCH_Pc13g00660"
FT                   /number=4
FT   exon            166086..166495
FT                   /gene="Pc13g00660"
FT                   /locus_tag="PCH_Pc13g00660"
FT                   /number=5
FT   mRNA            join(<168263..168304,168493..>168861)
FT                   /gene="Pc13g00670"
FT                   /locus_tag="PCH_Pc13g00670"
FT   CDS_pept        join(168263..168304,168493..168861)
FT                   /gene="Pc13g00670"
FT                   /locus_tag="PCH_Pc13g00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91136"
FT                   /db_xref="UniProtKB/TrEMBL:B6H144"
FT                   /protein_id="CAP91136.1"
FT                   /translation="MFSSRQVAFSSLGAFLTAPKTKRSKPGRSPAPVGTERELLTSHGM
FT                   HSAQSMRHDLLDLPLIYSLRPSRLPALRAVSKRNGDYNIDCANGFGIQPLPSAETSARM
FT                   AMANFDANADPLANADRVIINGWDXSMAGTIL"
FT   sig_peptide     join(168263..168304,168493..168522)
FT                   /gene="Pc13g00670"
FT                   /locus_tag="PCH_Pc13g00670"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            168263..168304
FT                   /gene="Pc13g00670"
FT                   /locus_tag="PCH_Pc13g00670"
FT                   /number=1
FT   intron          168305..168492
FT                   /gene="Pc13g00670"
FT                   /locus_tag="PCH_Pc13g00670"
FT                   /number=1
FT   exon            168493..168861
FT                   /gene="Pc13g00670"
FT                   /locus_tag="PCH_Pc13g00670"
FT                   /number=2
FT   mat_peptide     168523..168858
FT                   /gene="Pc13g00670"
FT                   /locus_tag="PCH_Pc13g00670"
FT   mRNA            complement(join(<169552..169744,169794..169811,
FT                   169867..170134,170170..>170323))
FT                   /gene="Pc13g00680"
FT                   /locus_tag="PCH_Pc13g00680"
FT   CDS_pept        complement(join(169552..169744,169794..169811,
FT                   169867..170134,170170..170323))
FT                   /gene="Pc13g00680"
FT                   /locus_tag="PCH_Pc13g00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00680"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91137"
FT                   /db_xref="UniProtKB/TrEMBL:B6H145"
FT                   /protein_id="CAP91137.1"
FT                   /translation="MFGYGHFSLRIFKGSNSPHFLLPSIPYFTVSPRTPCLTSRQLQWV
FT                   TKEIRSGSPEPNDIWSPRTSIAGSVDDDCHSQQTDVSDEEGKATSMDGCSDEEETQGQW
FT                   AKEHTKERALDGARSVKFLKPEDSTESMVKMIECMAELDGRVQSDAKSLEGQDRWNQGM
FT                   QRKYIDMIGAIDTLSKDVATLRKQVEALSSRDAAKTREVVGSKRQKQ"
FT   exon            complement(169552..169744)
FT                   /gene="Pc13g00680"
FT                   /locus_tag="PCH_Pc13g00680"
FT                   /number=1
FT   intron          complement(169745..169793)
FT                   /gene="Pc13g00680"
FT                   /locus_tag="PCH_Pc13g00680"
FT                   /number=1
FT   exon            complement(169794..169811)
FT                   /gene="Pc13g00680"
FT                   /locus_tag="PCH_Pc13g00680"
FT                   /number=2
FT   intron          complement(169812..169866)
FT                   /gene="Pc13g00680"
FT                   /locus_tag="PCH_Pc13g00680"
FT                   /number=2
FT   exon            complement(169867..170134)
FT                   /gene="Pc13g00680"
FT                   /locus_tag="PCH_Pc13g00680"
FT                   /number=3
FT   intron          complement(170135..170169)
FT                   /gene="Pc13g00680"
FT                   /locus_tag="PCH_Pc13g00680"
FT                   /number=3
FT   exon            complement(170170..170323)
FT                   /gene="Pc13g00680"
FT                   /locus_tag="PCH_Pc13g00680"
FT                   /number=4
FT   mRNA            join(<171241..171568,171623..>171747)
FT                   /gene="Pc13g00690"
FT                   /locus_tag="PCH_Pc13g00690"
FT   CDS_pept        join(171241..171568,171623..171747)
FT                   /gene="Pc13g00690"
FT                   /locus_tag="PCH_Pc13g00690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00690"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91138"
FT                   /db_xref="UniProtKB/TrEMBL:B6H146"
FT                   /protein_id="CAP91138.1"
FT                   /translation="MSWKERSRAYLRQFGVKRTGEALRCKQNYLLREYRSIQKSLPETT
FT                   SSGAVPLRVQREEARMSCLPSLPIYAPRGSRTKTRLLIHALEQLAVSERRHLTNDSDSA
FT                   NERLPGYTIRPPHTLRSAPSRHISYLWKFVHPMAAATRASRNAEIL"
FT   exon            171241..171568
FT                   /gene="Pc13g00690"
FT                   /locus_tag="PCH_Pc13g00690"
FT                   /number=1
FT   intron          171569..171622
FT                   /gene="Pc13g00690"
FT                   /locus_tag="PCH_Pc13g00690"
FT                   /number=1
FT   exon            171623..171747
FT                   /gene="Pc13g00690"
FT                   /locus_tag="PCH_Pc13g00690"
FT                   /number=2
FT   mRNA            complement(join(<172326..172551,172662..172770,
FT                   172843..>173005))
FT                   /gene="Pc13g00700"
FT                   /locus_tag="PCH_Pc13g00700"
FT   CDS_pept        complement(join(172326..172551,172662..172770,
FT                   172843..173005))
FT                   /gene="Pc13g00700"
FT                   /locus_tag="PCH_Pc13g00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00700"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91139"
FT                   /db_xref="UniProtKB/TrEMBL:B6H147"
FT                   /protein_id="CAP91139.1"
FT                   /translation="MSYAQILRSSRQPGGYEAQIASLMPPEEEQQQTRITPFHLKGNPD
FT                   LASRAKDEKAIFAVNPAKPRVSSYRTLQWLAFCADFEIDSLHKRVKKIEHFINGITQNG
FT                   FADVLTENATLLSETTALKDKIQELEETLENMQARVDELCKERQVSTVQNNPARKKRAM
FT                   PQ"
FT   exon            complement(172326..172551)
FT                   /gene="Pc13g00700"
FT                   /locus_tag="PCH_Pc13g00700"
FT                   /number=1
FT   intron          complement(172552..172661)
FT                   /gene="Pc13g00700"
FT                   /locus_tag="PCH_Pc13g00700"
FT                   /number=1
FT   exon            complement(172662..172770)
FT                   /gene="Pc13g00700"
FT                   /locus_tag="PCH_Pc13g00700"
FT                   /number=2
FT   intron          complement(172771..172842)
FT                   /gene="Pc13g00700"
FT                   /locus_tag="PCH_Pc13g00700"
FT                   /number=2
FT   exon            complement(172843..173005)
FT                   /gene="Pc13g00700"
FT                   /locus_tag="PCH_Pc13g00700"
FT                   /number=3
FT   mRNA            complement(join(<173650..174437,174520..>174541))
FT                   /gene="Pc13g00710"
FT                   /locus_tag="PCH_Pc13g00710"
FT   CDS_pept        complement(join(173650..174437,174520..174541))
FT                   /gene="Pc13g00710"
FT                   /locus_tag="PCH_Pc13g00710"
FT                   /note="Title: similarity to erythrocyte membrane protein 3
FT                   - Plasmodium falciparum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00710"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91140"
FT                   /db_xref="UniProtKB/TrEMBL:B6H148"
FT                   /protein_id="CAP91140.1"
FT                   /translation="MSKTRLVASSISTYDDRVLVPGTTERCCTPPEGAQNLPHGAQGSE
FT                   GAQNLPHGAQGNEGAQNLPHGAQGNEGAQNLPHGAQGSEGAQNLPHGAHGSEGAQNLPH
FT                   GAQGNEGAQNLPHGAQGSEGAQNLPHGAHGSEGAQNLPHGAQGNEGAQNLPHGAQGSEG
FT                   AQNLPHGAQGNEGAQNLPHGAQGSEGAQNLPHGAQGNEGAQNLPHGAQGSEGAQNLPHG
FT                   AHGSEGAQNLPHGAHGSEGGQEACSYSPKWARRAFLSVPTTRLDKYH"
FT   exon            complement(173650..174437)
FT                   /gene="Pc13g00710"
FT                   /locus_tag="PCH_Pc13g00710"
FT                   /number=1
FT   intron          complement(174438..174519)
FT                   /gene="Pc13g00710"
FT                   /locus_tag="PCH_Pc13g00710"
FT                   /number=1
FT   exon            complement(174520..174541)
FT                   /gene="Pc13g00710"
FT                   /locus_tag="PCH_Pc13g00710"
FT                   /number=2
FT   mRNA            join(<176999..177032,177089..177328,177465..179262,
FT                   179303..179318,179494..>180063)
FT                   /gene="Pc13g00720"
FT                   /locus_tag="PCH_Pc13g00720"
FT   CDS_pept        join(176999..177032,177089..177328,177465..179262,
FT                   179303..179318,179494..180063)
FT                   /gene="Pc13g00720"
FT                   /locus_tag="PCH_Pc13g00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00720"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91141"
FT                   /db_xref="UniProtKB/TrEMBL:B6H149"
FT                   /protein_id="CAP91141.1"
FT                   /translation="MASRVNQLASDVIKANNTVLEEILRRDRILRRNPQPSRRSAGSPF
FT                   PLESAEEPANFMQVQIDVDPPDGMAIETQRTDAQASASKRGAGTRNYKVRKNQSQEEIA
FT                   QNFHGTFTQKRTFHAIEAKVYFLTGKSHFRKRNKKTSRKRPVSLTPRSSPPPSQFSGSV
FT                   DSTQQLISRSSIEVHDLRLAPNLLPYLNSEDCEDGDSYGLHGVQPVDPERETSDLHAVP
FT                   EQDTANQMLSCQRAPQEREPQSGTSQNESPVRGSRQAEESPKAHPGFSDLVGESQPRNG
FT                   NPTNVFAAISKMGDACLPRSSPLEPPRISEPIQSPIRHPPEDDITLEWLGQTLSCCAET
FT                   STMHMEQADTAHGNQSLETLSPQSSSRENSLTRGSENEGFNDESHTESVPRSPTPFQVP
FT                   EPSSTGNSTEHHPQNCGMDEPTIDASESAFIDKKLIIRCLHEKSKSQAARSHPNWNHKD
FT                   LNRLLGWHMKRKNLPKERLEVEFLRDFGHYRSSSAIVTACRRKRKADSRHKDVTSAPTP
FT                   GRLTPLAPVLNTKPVSRPPNAIIGSDTPSLHSSHTAAVPSNENTTLKPPPLERSRSRHL
FT                   TQPQILGNIDRFSRDMAPPLHESDETVDQSSPAAVAPESASGQMVCWTPDSAEDTPTLG
FT                   NRRHRVEITPKPPSRFTAINGGNVHPADPNSTAQPETNKRDAVPNGQGGQRASKEKKKG
FT                   SRLTPEHELAGSNNSKRSAGTSEGAENQRSLPIDVSDANIAQLGMRTDLQNTSQSQERD
FT                   VDIPPKNNSQLTYIQNPDPNCPPNSQVANTRPSHFCRPNSQSGASQTSGVSGSAHTGGL
FT                   FTPHTSGPAYPDMRPEAIVPISVSASFLSSPTCLPHYPLHVLQGGGAERYQGPPLPSLA
FT                   QQMYYHRTGEPLHK"
FT   exon            176999..177032
FT                   /gene="Pc13g00720"
FT                   /locus_tag="PCH_Pc13g00720"
FT                   /number=1
FT   intron          177033..177088
FT                   /gene="Pc13g00720"
FT                   /locus_tag="PCH_Pc13g00720"
FT                   /number=1
FT   exon            177089..177328
FT                   /gene="Pc13g00720"
FT                   /locus_tag="PCH_Pc13g00720"
FT                   /number=2
FT   intron          177329..177464
FT                   /gene="Pc13g00720"
FT                   /locus_tag="PCH_Pc13g00720"
FT                   /number=2
FT   exon            177465..179262
FT                   /gene="Pc13g00720"
FT                   /locus_tag="PCH_Pc13g00720"
FT                   /number=3
FT   intron          179263..179302
FT                   /gene="Pc13g00720"
FT                   /locus_tag="PCH_Pc13g00720"
FT                   /number=3
FT   exon            179303..179318
FT                   /gene="Pc13g00720"
FT                   /locus_tag="PCH_Pc13g00720"
FT                   /number=4
FT   intron          179319..179493
FT                   /gene="Pc13g00720"
FT                   /locus_tag="PCH_Pc13g00720"
FT                   /number=4
FT   exon            179494..180063
FT                   /gene="Pc13g00720"
FT                   /locus_tag="PCH_Pc13g00720"
FT                   /number=5
FT   mRNA            complement(join(<181317..181367,181507..182633,
FT                   182691..182888,182961..>182994))
FT                   /gene="Pc13g00730"
FT                   /locus_tag="PCH_Pc13g00730"
FT   CDS_pept        complement(join(181317..181367,181507..182633,
FT                   182691..182888,182961..182994))
FT                   /gene="Pc13g00730"
FT                   /locus_tag="PCH_Pc13g00730"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig5_part_ii.tfa_1400wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00730"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91142"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B6H153"
FT                   /protein_id="CAP91142.1"
FT                   /translation="MGSRSLSSEFQECERKCQWLEQSRAPSTVHLPSDRWWGLITLHLN
FT                   LLHEHEQFFVMCQHPSVSLDVKNVPEKYEMSDRSLKYMLCFIETVSSILKRLILSNSEL
FT                   GDSLFEQLGDVARYGMFAEKLNREYWNVISRCWYQKAADRNPDSGRIQHHLGDLSQPDP
FT                   LQTLFFLTKALISAQPFPGSRVTVGRFFNDWPNLALQENSMATYFIAAHYVLLRGDSTG
FT                   RFMTFINGFLSLLPSYMEHHGHQGQHTVYVMSCNFASVFGYHNPAFMAVGSSQSQSGHT
FT                   PQTNELGPANQKQACVSNCSINQPAYPTKQALQGVHLTFRTLSVLLQYSNGHNSVPAIH
FT                   ISLAFLWGLTCHHPFMESLEARVPWRAITRFLNSLITPNDDFPKIEDASFPAADDGAAL
FT                   QLPEDFLIRGQTWSQLYYPKGFFNGSGDSISIEVDSEVKIRRYRCLWLGVQLAMTVIAT
FT                   TKHPEAEIKAN"
FT   exon            complement(181317..181367)
FT                   /gene="Pc13g00730"
FT                   /locus_tag="PCH_Pc13g00730"
FT                   /number=1
FT   intron          complement(181368..181506)
FT                   /gene="Pc13g00730"
FT                   /locus_tag="PCH_Pc13g00730"
FT                   /number=1
FT   exon            complement(181507..182633)
FT                   /gene="Pc13g00730"
FT                   /locus_tag="PCH_Pc13g00730"
FT                   /number=2
FT   intron          complement(182634..182690)
FT                   /gene="Pc13g00730"
FT                   /locus_tag="PCH_Pc13g00730"
FT                   /number=2
FT   exon            complement(182691..182888)
FT                   /gene="Pc13g00730"
FT                   /locus_tag="PCH_Pc13g00730"
FT                   /number=3
FT   intron          complement(182889..182960)
FT                   /gene="Pc13g00730"
FT                   /locus_tag="PCH_Pc13g00730"
FT                   /number=3
FT   exon            complement(182961..182994)
FT                   /gene="Pc13g00730"
FT                   /locus_tag="PCH_Pc13g00730"
FT                   /number=4
FT   mRNA            complement(join(<184001..184451,184521..>184918))
FT                   /gene="Pc13g00740"
FT                   /locus_tag="PCH_Pc13g00740"
FT   CDS_pept        complement(join(184001..184451,184521..184918))
FT                   /gene="Pc13g00740"
FT                   /locus_tag="PCH_Pc13g00740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91143"
FT                   /db_xref="UniProtKB/TrEMBL:B6H155"
FT                   /protein_id="CAP91143.1"
FT                   /translation="MSTRDLFSFEHMSYTSSPQYPSGSPVGMVDSFETGSENNVVDGGP
FT                   PPAPVALSTYSTPPLPPKYRTIKPRFSDGGLMPKPPDDTLGVKPRRHRSSGTRRNRQRQ
FT                   PQEKIGEPNPVQPEADSSMVSFTRPRSESFVPVTQYTDSDLFSRSQGPSLAPFLFSYSN
FT                   DLTSPAEIRSPLFPNIASAALAVDRPAYHHDVPSSLDSSDIQVSRPNPFFELSQDRDSM
FT                   RAASLQFSEHLEKTQVLQSLSILQDYMAKYPSVFEKQAPEMVQKWMLDIEGVKPPGSLS
FT                   E"
FT   exon            complement(184001..184451)
FT                   /gene="Pc13g00740"
FT                   /locus_tag="PCH_Pc13g00740"
FT                   /number=1
FT   intron          complement(184452..184520)
FT                   /gene="Pc13g00740"
FT                   /locus_tag="PCH_Pc13g00740"
FT                   /number=1
FT   exon            complement(184521..184918)
FT                   /gene="Pc13g00740"
FT                   /locus_tag="PCH_Pc13g00740"
FT                   /number=2
FT   mRNA            join(<185578..185720,185803..185849,185902..>186137)
FT                   /gene="Pc13g00750"
FT                   /locus_tag="PCH_Pc13g00750"
FT   CDS_pept        join(185578..185720,185803..185849,185902..186137)
FT                   /gene="Pc13g00750"
FT                   /locus_tag="PCH_Pc13g00750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00750"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91144"
FT                   /db_xref="UniProtKB/TrEMBL:B6H156"
FT                   /protein_id="CAP91144.1"
FT                   /translation="MTINGMIPSYLELFPKDSCCTFLLINIQGPFQVNPMPISTSRGIL
FT                   RASTKPHLLSGSDELRHLDIIGCREKRKAVDRKPQTTYTFKNCTFSGTSMFLVGSAGPT
FT                   SETVVYRDYGSRRPFLVNGDKGEATFLRDFCGRREYG"
FT   exon            185578..185720
FT                   /gene="Pc13g00750"
FT                   /locus_tag="PCH_Pc13g00750"
FT                   /number=1
FT   intron          185721..185802
FT                   /gene="Pc13g00750"
FT                   /locus_tag="PCH_Pc13g00750"
FT                   /number=1
FT   exon            185803..185849
FT                   /gene="Pc13g00750"
FT                   /locus_tag="PCH_Pc13g00750"
FT                   /number=2
FT   intron          185850..185901
FT                   /gene="Pc13g00750"
FT                   /locus_tag="PCH_Pc13g00750"
FT                   /number=2
FT   exon            185902..186137
FT                   /gene="Pc13g00750"
FT                   /locus_tag="PCH_Pc13g00750"
FT                   /number=3
FT   mRNA            complement(join(<186585..187008,187069..187259,
FT                   187390..>187503))
FT                   /gene="Pc13g00760"
FT                   /locus_tag="PCH_Pc13g00760"
FT   CDS_pept        complement(join(186585..187008,187069..187259,
FT                   187390..187503))
FT                   /gene="Pc13g00760"
FT                   /locus_tag="PCH_Pc13g00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00760"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91145"
FT                   /db_xref="UniProtKB/TrEMBL:B6H157"
FT                   /protein_id="CAP91145.1"
FT                   /translation="MXTGFPAWXHNLPTPLPLDQVPRHIRLVGVSLNIPSGQPASPQAE
FT                   AHVGFHSHGKAIISXNIDEYALINHTIGFHGQEAFRXMQKSYKRVAMPSQAVHQSLKTQ
FT                   KHNGPNSCVPLQFSSLPANDNTARGLLSTKSPLPSTHCKRIFPVESDFSLIDQFVARNN
FT                   PALENILSNLKRCDAALLESFYRSAFEGLDPDTCEAILHLWMRALSPKALVGIQNTYSR
FT                   ELTYPGLCFQEPITLTRTDH"
FT   exon            complement(186585..187008)
FT                   /gene="Pc13g00760"
FT                   /locus_tag="PCH_Pc13g00760"
FT                   /number=1
FT   intron          complement(187009..187068)
FT                   /gene="Pc13g00760"
FT                   /locus_tag="PCH_Pc13g00760"
FT                   /number=1
FT   exon            complement(187069..187259)
FT                   /gene="Pc13g00760"
FT                   /locus_tag="PCH_Pc13g00760"
FT                   /number=2
FT   intron          complement(187260..187389)
FT                   /gene="Pc13g00760"
FT                   /locus_tag="PCH_Pc13g00760"
FT                   /number=2
FT   exon            complement(187390..187503)
FT                   /gene="Pc13g00760"
FT                   /locus_tag="PCH_Pc13g00760"
FT                   /number=3
FT   mRNA            join(<188099..188101,188165..>188704)
FT                   /gene="Pc13g00770"
FT                   /locus_tag="PCH_Pc13g00770"
FT   CDS_pept        join(188099..188101,188165..188704)
FT                   /gene="Pc13g00770"
FT                   /locus_tag="PCH_Pc13g00770"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An06g02320 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00770"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91146"
FT                   /db_xref="UniProtKB/TrEMBL:B6H158"
FT                   /protein_id="CAP91146.1"
FT                   /translation="MISEADLKISAQTSLKALQIWSLGTPDLANAXKWQHDLDPEIASL
FT                   VVACQHLRKNGYRKGRRRLAQNSILNRLVQAMVEDLTDDSLKIFALLTWHFNADFSVPL
FT                   PRQLLLFFDEPSKIFEDVCTDIHRRYTTMAKPGSVKSFKRRFIRLLGLVEHYVFEGKWS
FT                   CIFKSSDYVIIVAAICQ"
FT   exon            188099..188101
FT                   /gene="Pc13g00770"
FT                   /locus_tag="PCH_Pc13g00770"
FT                   /number=1
FT   intron          188102..188164
FT                   /gene="Pc13g00770"
FT                   /locus_tag="PCH_Pc13g00770"
FT                   /number=1
FT   exon            188165..188704
FT                   /gene="Pc13g00770"
FT                   /locus_tag="PCH_Pc13g00770"
FT                   /number=2
FT   mRNA            join(<190282..190458,190506..>191009)
FT                   /gene="Pc13g00780"
FT                   /locus_tag="PCH_Pc13g00780"
FT   CDS_pept        join(190282..190458,190506..191009)
FT                   /gene="Pc13g00780"
FT                   /locus_tag="PCH_Pc13g00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00780"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91147"
FT                   /db_xref="UniProtKB/TrEMBL:B6H159"
FT                   /protein_id="CAP91147.1"
FT                   /translation="MSHPGNNLSLFVRNLDQGTREHLGHNTNTGPAHLTPEPCSSIPTE
FT                   SQAPAIMSLVEDFYFPFPRTSFRAAETTLIVQQAWFLGSKYLKRAIKRQHKLNDRTTFL
FT                   ISSCQALRKYRYLPWGKRRALAKNRRLRNYAHRMAGELADCDLAMLSLLAWHFSSKMVP
FT                   LPQGLLQFFANFDEQFDTVCRSIHLSYTKMCEPDTLANFKERLRGLLRLXERHVIIGDG
FT                   VLYT"
FT   exon            190282..190458
FT                   /gene="Pc13g00780"
FT                   /locus_tag="PCH_Pc13g00780"
FT                   /number=1
FT   intron          190459..190505
FT                   /gene="Pc13g00780"
FT                   /locus_tag="PCH_Pc13g00780"
FT                   /number=1
FT   exon            190506..191009
FT                   /gene="Pc13g00780"
FT                   /locus_tag="PCH_Pc13g00780"
FT                   /number=2
FT   mRNA            complement(join(<192100..192387,192437..>192469))
FT                   /gene="Pc13g00790"
FT                   /locus_tag="PCH_Pc13g00790"
FT   CDS_pept        complement(join(192100..192387,192437..192469))
FT                   /gene="Pc13g00790"
FT                   /locus_tag="PCH_Pc13g00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00790"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91148"
FT                   /db_xref="UniProtKB/TrEMBL:B6H160"
FT                   /protein_id="CAP91148.1"
FT                   /translation="MISAEELDELAKQQSSSNFNVGNLRIRILGQLVDSRSTNVYHMQR
FT                   EIRKTEEIPGTKDIMQELWFEHYWASQTELIKSSIGRDLLQDDASKGVSEPLPEDHAFD
FT                   YS"
FT   exon            complement(192100..192387)
FT                   /gene="Pc13g00790"
FT                   /locus_tag="PCH_Pc13g00790"
FT                   /number=1
FT   intron          complement(192388..192436)
FT                   /gene="Pc13g00790"
FT                   /locus_tag="PCH_Pc13g00790"
FT                   /number=1
FT   exon            complement(192437..192469)
FT                   /gene="Pc13g00790"
FT                   /locus_tag="PCH_Pc13g00790"
FT                   /number=2
FT   mRNA            complement(join(<193886..194151,194220..195308,
FT                   195482..195616,195666..>195726))
FT                   /gene="Pc13g00800"
FT                   /locus_tag="PCH_Pc13g00800"
FT   CDS_pept        complement(join(193886..194151,194220..195308,
FT                   195482..195616,195666..195726))
FT                   /gene="Pc13g00800"
FT                   /locus_tag="PCH_Pc13g00800"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   -Plasmodium falciparum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00800"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91149"
FT                   /db_xref="GOA:B6H161"
FT                   /db_xref="InterPro:IPR030456"
FT                   /db_xref="UniProtKB/TrEMBL:B6H161"
FT                   /protein_id="CAP91149.1"
FT                   /translation="MWARLPTLVPLGICSGCRPLDAAVSTSESEESSRTCWSDDGAQPE
FT                   AARAGTRRPLVTGDPAGDDEVWSQHRQQFQDINQAIRREPRFILRVHRVHRVHRVHRVH
FT                   RVHRVHRVHRVHSVHSVHRVHRVHRVHRVHRVHRVHRVHRVHRVHRVHSVHKLIAANMN
FT                   KFAPIYQKHKDIGAEQTIPEADISLFEERLVIVCTVDETQNHRRVRIPNRVKLIRSRER
FT                   KAQRLYLKILEKFPGIFLAFILSVSPRASIDFDLSAFCEQHIEQPIVLCDNAESLLWRS
FT                   AIRHGIEKSKAFGKLMSLLFTLPRPATEAEGEEICSLSLSRLSVIRIAFGDIICEAVEC
FT                   SPTHLPMNADSDYAEITQCVRTTVFYSHQDTIIHIEVGCAVKLADMLFPSASGRINSAL
FT                   SQSNASIQARNPEAALPPGTQSESLVQDYDFAYFTLRGASVAGIRSVFSASICEAIEES
FT                   ELRRWEKHHLLTEVTDCITMQLWRAESQRGLIKLRVGHYTGVNLANNLYAEPRSCIAS"
FT   exon            complement(193886..194151)
FT                   /gene="Pc13g00800"
FT                   /locus_tag="PCH_Pc13g00800"
FT                   /number=1
FT   mat_peptide     complement(join(193889..194151,194220..195308,
FT                   195482..195611))
FT                   /gene="Pc13g00800"
FT                   /locus_tag="PCH_Pc13g00800"
FT   intron          complement(194152..194219)
FT                   /gene="Pc13g00800"
FT                   /locus_tag="PCH_Pc13g00800"
FT                   /number=1
FT   exon            complement(194220..195308)
FT                   /gene="Pc13g00800"
FT                   /locus_tag="PCH_Pc13g00800"
FT                   /number=2
FT   intron          complement(195309..195481)
FT                   /gene="Pc13g00800"
FT                   /locus_tag="PCH_Pc13g00800"
FT                   /number=2
FT   exon            complement(195482..195616)
FT                   /gene="Pc13g00800"
FT                   /locus_tag="PCH_Pc13g00800"
FT                   /number=3
FT   sig_peptide     complement(join(195612..195616,195666..195726))
FT                   /gene="Pc13g00800"
FT                   /locus_tag="PCH_Pc13g00800"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(195617..195665)
FT                   /gene="Pc13g00800"
FT                   /locus_tag="PCH_Pc13g00800"
FT                   /number=3
FT   exon            complement(195666..195726)
FT                   /gene="Pc13g00800"
FT                   /locus_tag="PCH_Pc13g00800"
FT                   /number=4
FT   mRNA            join(<196199..196377,196430..196543,196731..197117,
FT                   197178..197536,197631..197675,198036..>198874)
FT                   /gene="Pc13g00810"
FT                   /locus_tag="PCH_Pc13g00810"
FT   CDS_pept        join(196199..196377,196430..196543,196731..197117,
FT                   197178..197536,197631..197675,198036..198874)
FT                   /gene="Pc13g00810"
FT                   /locus_tag="PCH_Pc13g00810"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An04g07610 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00810"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91150"
FT                   /db_xref="InterPro:IPR021842"
FT                   /db_xref="UniProtKB/TrEMBL:B6H154"
FT                   /protein_id="CAP91150.1"
FT                   /translation="MAPPPWPPAQPGEHQFWTDPILCEETRARLEHFRSLGWLPPNFKP
FT                   KTLEGLAVVERYWRKYCIQLNEDYVEYLLLEDQAIYMNFFDWMSKTSRKKLLQRTKNKN
FT                   TLDVDVFCVTYRHHWVYSKHFRHGSMIIQFATIQLWSAITGTRPGVLLPQKASLAGMPL
FT                   GKRKGDKAFQSDLPKYVSTDDLPASVCYRDIELFYLKDPDSKRDVLCAIIEFRNLKGRP
FT                   EGADGTKYFMHGDYQLAYCPINQIVSLAFRDGAFLNTALTPELIWRLRVPKRSQSLPLR
FT                   WKPEKLDTPLLRRLERTTYGYELHKSLSMTYDSSRQALQELGRDARFEDDIGHYNYRRW
FT                   TANEVNRNFTSQERQRVLGQSARKEYFHTAPVLEVDRQIKQLLGQSDVDQSDAGSSEDE
FT                   DWELPAPDYVFPERVRLVENFYGPEAENFDEERLLARRIQVTKDMVALSQLCEPNRRGN
FT                   RINWDVEDDEIEKSEEPLPAEEESLECPTDICIICCGQSRLSSSNPPPHKFPAKRQDSV
FT                   RRHLIDSHLAHAHDGISCTWPACHGIAKFTKVTEFLAHAVTVHAYDINIKLHHLPIKPC
FT                   LTCSDTSSVDSTVESVESGGRSGTDTPASSVGPEMANIDPRLLEPDKPQVTDPLLRRSK
FT                   RLRLR"
FT   exon            196199..196377
FT                   /gene="Pc13g00810"
FT                   /locus_tag="PCH_Pc13g00810"
FT                   /number=1
FT   intron          196378..196429
FT                   /gene="Pc13g00810"
FT                   /locus_tag="PCH_Pc13g00810"
FT                   /number=1
FT   exon            196430..196543
FT                   /gene="Pc13g00810"
FT                   /locus_tag="PCH_Pc13g00810"
FT                   /number=2
FT   intron          196544..196730
FT                   /gene="Pc13g00810"
FT                   /locus_tag="PCH_Pc13g00810"
FT                   /number=2
FT   exon            196731..197117
FT                   /gene="Pc13g00810"
FT                   /locus_tag="PCH_Pc13g00810"
FT                   /number=3
FT   intron          197118..197177
FT                   /gene="Pc13g00810"
FT                   /locus_tag="PCH_Pc13g00810"
FT                   /number=3
FT   exon            197178..197536
FT                   /gene="Pc13g00810"
FT                   /locus_tag="PCH_Pc13g00810"
FT                   /number=4
FT   intron          197537..197630
FT                   /gene="Pc13g00810"
FT                   /locus_tag="PCH_Pc13g00810"
FT                   /number=4
FT   exon            197631..197675
FT                   /gene="Pc13g00810"
FT                   /locus_tag="PCH_Pc13g00810"
FT                   /number=5
FT   intron          197676..198035
FT                   /gene="Pc13g00810"
FT                   /locus_tag="PCH_Pc13g00810"
FT                   /number=5
FT   exon            198036..198874
FT                   /gene="Pc13g00810"
FT                   /locus_tag="PCH_Pc13g00810"
FT                   /number=6
FT   mRNA            complement(join(<199764..199892,199955..200448,
FT                   200533..>200803))
FT                   /gene="Pc13g00820"
FT                   /locus_tag="PCH_Pc13g00820"
FT   CDS_pept        complement(join(199764..199892,199955..200448,
FT                   200533..200803))
FT                   /gene="Pc13g00820"
FT                   /locus_tag="PCH_Pc13g00820"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_153_scaffold_12.tfa_240wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00820"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91151"
FT                   /db_xref="UniProtKB/TrEMBL:B6H162"
FT                   /protein_id="CAP91151.1"
FT                   /translation="MSFPPNAKPDPLEIERKLLRQHLGLGPNPGDPPADSPPQIQPLFF
FT                   IEMAPDSRRGAKCKLPTCDENIMPGELRLAMNPAMIYGGWSKSSASLYHIHCFEKLADF
FT                   THADFLDQIQPLTRQTWKLRGINAGSVLDGNYLVPGGVERLVLEWKVTHGKWIDKRDGV
FT                   CDESEEEKRVYADFLALLRKAGSSKYKQHMKPTGLPHDKYHNLLVTLAPYESDGPDDTE
FT                   EWNLFDTYLDSTVKAFNDPHDLSTMLQRWHEDVALVSKDVDGLDERGRAAKARLGAKAI
FT                   RALKRLSVIPMPSLAA"
FT   exon            complement(199764..199892)
FT                   /gene="Pc13g00820"
FT                   /locus_tag="PCH_Pc13g00820"
FT                   /number=1
FT   intron          complement(199893..199954)
FT                   /gene="Pc13g00820"
FT                   /locus_tag="PCH_Pc13g00820"
FT                   /number=1
FT   exon            complement(199955..200448)
FT                   /gene="Pc13g00820"
FT                   /locus_tag="PCH_Pc13g00820"
FT                   /number=2
FT   intron          complement(200449..200532)
FT                   /gene="Pc13g00820"
FT                   /locus_tag="PCH_Pc13g00820"
FT                   /number=2
FT   exon            complement(200533..200803)
FT                   /gene="Pc13g00820"
FT                   /locus_tag="PCH_Pc13g00820"
FT                   /number=3
FT   mRNA            join(<201893..201901,201937..201953,202017..>202326)
FT                   /gene="Pc13g00830"
FT                   /locus_tag="PCH_Pc13g00830"
FT   CDS_pept        join(201893..201901,201937..201953,202017..202326)
FT                   /gene="Pc13g00830"
FT                   /locus_tag="PCH_Pc13g00830"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig1492_0.tfa_2370cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00830"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91152"
FT                   /db_xref="GOA:B6H163"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="InterPro:IPR036879"
FT                   /db_xref="UniProtKB/TrEMBL:B6H163"
FT                   /protein_id="CAP91152.1"
FT                   /translation="MVHFKEENRGTIVLLKIEVEGVRPNIAYSTMPRKYSWVKKRRSET
FT                   AKAASQQKNRRKNTIYKRAAEYSLECKADTLVAIQIRKTGEIYVFDSTGGRWLGTLSRL
FT                   VFCTEVW"
FT   exon            201893..201901
FT                   /gene="Pc13g00830"
FT                   /locus_tag="PCH_Pc13g00830"
FT                   /number=1
FT   intron          201902..201936
FT                   /gene="Pc13g00830"
FT                   /locus_tag="PCH_Pc13g00830"
FT                   /number=1
FT   exon            201937..201953
FT                   /gene="Pc13g00830"
FT                   /locus_tag="PCH_Pc13g00830"
FT                   /number=2
FT   intron          201954..202016
FT                   /gene="Pc13g00830"
FT                   /locus_tag="PCH_Pc13g00830"
FT                   /number=2
FT   exon            202017..202326
FT                   /gene="Pc13g00830"
FT                   /locus_tag="PCH_Pc13g00830"
FT                   /number=3
FT   mRNA            join(<203152..203246,203302..>203626)
FT                   /gene="Pc13g00840"
FT                   /locus_tag="PCH_Pc13g00840"
FT   CDS_pept        join(203152..203246,203302..203626)
FT                   /gene="Pc13g00840"
FT                   /locus_tag="PCH_Pc13g00840"
FT                   /note="Title: weak similarity to hemolysin Asp-HS
FT                   -Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00840"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91153"
FT                   /db_xref="GOA:B6H164"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniProtKB/TrEMBL:B6H164"
FT                   /inference="similar to AA sequence:PIR:S47523"
FT                   /inference="protein motif:PFAM:PF06355"
FT                   /protein_id="CAP91153.1"
FT                   /translation="MDDHITQRLSIIIKNNLHQSGAIAVRNTLVTRGAPYNRCRKPTLM
FT                   APEDVNKLVICHGEEGTASFCGSAVYGLGVEGSLDLYHGDARIASLHWNGPWARTGNQF
FT                   EATNVNSAKYLVNISGIPSHGILGDVSVIVTEVAC"
FT   exon            203152..203246
FT                   /gene="Pc13g00840"
FT                   /locus_tag="PCH_Pc13g00840"
FT                   /number=1
FT   intron          203247..203301
FT                   /gene="Pc13g00840"
FT                   /locus_tag="PCH_Pc13g00840"
FT                   /number=1
FT   exon            203302..203626
FT                   /gene="Pc13g00840"
FT                   /locus_tag="PCH_Pc13g00840"
FT                   /number=2
FT   mRNA            complement(<204013..>207624)
FT                   /gene="Pc13g00850"
FT                   /locus_tag="PCH_Pc13g00850"
FT   CDS_pept        complement(204013..207624)
FT                   /gene="Pc13g00850"
FT                   /locus_tag="PCH_Pc13g00850"
FT                   /note="Title: strong similarity to copper
FT                   resistance-associated P-type ATPase CRP1 - Candida
FT                   albicans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00850"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91154"
FT                   /db_xref="GOA:B6H165"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B6H165"
FT                   /inference="similar to AA sequence:TREMBL:AF193508.1"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /inference="protein motif:PFAM:PF00122"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /inference="protein motif:COGS:COG2217"
FT                   /protein_id="CAP91154.1"
FT                   /translation="MASTEQRLLSESRFSTILVNNLHCPSCVSTVNDTLFSLNPPPFSV
FT                   SVSIVLHEIKVAHPIDLSTSQIVHALEDAAFDIDSVVESGDSTNGGPESESLRTWRSTR
FT                   PSVVWRASDPDPHHESEQHIRQCDACSAQLATQSSRTGDDPPVIQKNLSPLVVESDSPR
FT                   DNDLVSVVDDHLTGTRTRITLSISGMSCSSCVGKITNALNDQPWVQSADVNLLTSSAVI
FT                   VLLDRSRVNEVLETITGSGYSAQLIDCEDLLPERQSKPSASTDIWRASYVIGGMTCSSC
FT                   VGTVTDTLNRYEWVTKVDVNLVSGSATVELQGKEHLEEVIAIISELGYAAALGEAERSA
FT                   PSEQRALNRSVTIQVEGMHCPNCPQRILDALSVFSNCLQVTDPLRKGRPRLTIAYTPDS
FT                   PNFTIRHILHAIAQADKAFTVSIYHPPSLEERSQMMQRRHMWRIARRLLLAVLTAIPAF
FT                   IIGIVYMSLVPGDNSGVMYLEQPIWAGRVSRMEWALFIMATPVYFFAADLFHRRMLSEL
FT                   VVLWWPGSKTPILRRFYRFGSMDMLMSLGTTVAYFSSIAILGINATQPADGLRVTHVES
FT                   FFDSVVFLTMFLMIGRLLEAYSKAKAGDAVSLLGKLRPTTAVLVASKEAEPSSPSVTPH
FT                   TVPIDQLELNDVVSVANGASPPYDGIVVEGTSRFDESSLTGESKPVPKSIGDEVFSGTT
FT                   NRANPVLVRITHLSGDSMLDQIISAVREGQVRRAPIERTADLITGYFVPLITLIAVLDW
FT                   IIWLSLGVSGRLPLSWLEGGAGGWEFWSLQFAISVFVVACPCGIGLAGPTALFVGGGLA
FT                   AQYGILVKGGGEAFQEASQLDCIVFDKTGTITEGVQPSVTDHKTTHEENIDEVWGAVLT
FT                   LEQKSSHPIAQAMVSFAGSRRPPALTASAVDEIPGKGMKGSFPLGHRPSSILDVIVGNE
FT                   ALMLDHGITILSANAAILTAWKREAKSVVLVGTRVREGAGDIEKVHWVLSMMLAVADPV
FT                   RPEAKEVLHALRNRGISVWMISGDNPTTAHAVGKIVGISPENIIAGILPEQKAEKIRYL
FT                   QKTVPRPSKRRWFNWGKGSRRTRPLVAMVGDGINDSPALTVADVGIAIGSGSEIAISSA
FT                   EFVLISSGLTSLLTLIDLSRIVFNRVKYNFGWALVYNCIAIPVAAGVFYPIVSNGNHIR
FT                   LDPVWASLAMALSSVSVVCSSLLMRTRLPLVGFRSAK"
FT   exon            complement(204013..207624)
FT                   /gene="Pc13g00850"
FT                   /locus_tag="PCH_Pc13g00850"
FT                   /number=1
FT   mRNA            complement(join(<209609..210462,210496..>210685))
FT                   /gene="Pc13g00860"
FT                   /locus_tag="PCH_Pc13g00860"
FT   CDS_pept        complement(join(209609..210462,210496..210685))
FT                   /gene="Pc13g00860"
FT                   /locus_tag="PCH_Pc13g00860"
FT                   /note="Title: strong similarity to high-affinity zinc
FT                   transport protein Zrt1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00860"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91155"
FT                   /db_xref="GOA:B6H166"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniProtKB/TrEMBL:B6H166"
FT                   /inference="similar to AA sequence:PIR:S33654"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="CAP91155.1"
FT                   /translation="MDTELLRSLQRDTGDNTDTCEAGNEYDGRLGLRVSSIFVIMAGSM
FT                   IAAVFPVLVKRSSTVGAKSKYFGSGVIIATAFIHLLAPAEEALRDDCLAGPISEYPWVE
FT                   GIILMTIVAMFLVELMIMRHSYFGTSQQSDMVDDGGRCLGGVDNFGGRNQAKRHLPMDD
FT                   NLSREHKDAEVARGNFAFVDDYAAQLIGVFILEFGIIFHSIFIGLTLAVAGSEFTALYI
FT                   VLTFHQTFEGLGLGSRLAMIPWPTSRRWTPYVLGTVYGLTTPIAIAVGLGVRNTYPPSG
FT                   RTTLIVNGVFDAISAGILIYTGLIELIAREFLFNPFMRRTPLRTVWSAFLLLCLGAGLM
FT                   ALLGRWA"
FT   exon            complement(209609..210462)
FT                   /gene="Pc13g00860"
FT                   /locus_tag="PCH_Pc13g00860"
FT                   /number=1
FT   intron          complement(210463..210495)
FT                   /gene="Pc13g00860"
FT                   /locus_tag="PCH_Pc13g00860"
FT                   /number=1
FT   exon            complement(210496..210685)
FT                   /gene="Pc13g00860"
FT                   /locus_tag="PCH_Pc13g00860"
FT                   /number=2
FT   mRNA            join(<211811..211844,211897..211949,212006..212358,
FT                   212590..212884,212938..213081,213137..213481,
FT                   213538..213707,213768..>213957)
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT   CDS_pept        join(<211811..211844,211897..211949,212006..212358,
FT                   212590..212884,212938..213081,213137..213481,
FT                   213538..213707,213768..213957)
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /note="unknown EC_number=1.10.3.-"
FT                   /note="Title: strong similarity to brown 2 protein abr2
FT                   -Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00870"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91156"
FT                   /db_xref="GOA:B6H167"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:B6H167"
FT                   /inference="similar to AA sequence:TREMBL:AF104823.1"
FT                   /inference="protein motif:PFAM:PF00394"
FT                   /inference="protein motif:COGS:COG2132"
FT                   /protein_id="CAP91156.1"
FT                   /translation="ELPVGTTIHWHGILQRGTPDMDGVPGVTQYQIPPGGNFTYRFSVK
FT                   DEYGFYWYHSHFRAYYNDAIRGPLMVRPAPSRRRPFEDMAASTVEREQLLQAERDAVSI
FT                   LLNDWTHDLSDTIFSRYFETGAFPSCVDSILANGLGRVECLPSSDTMGESDTMGESMRL
FT                   GPRGCMPPMMFRPGYDINSLPAETCVNTTSQQLVVNANASQGWLALNLVNSGAVSNLKV
FT                   SLDSHSMHVYAADGLYVTPQEVKVLEIALGQRYSVMIELDQSPGNYYLRFATYPNGDMQ
FT                   QVLEGQAIVSYSTTGNDTQDILVDPMSVWMLTNGSATQDANELVESRLAPFEGNRPPTT
FT                   AADVTRFFNINQTDIVTWVVDQYPYAEPTIPIIYGNMSDGWNANTTLHSPTNSTVDIVM
FT                   NVANGSLDTMGHPMHLHGHKFWVLGSGSGSFPYQSVAEAPPSLINLDNPPYRDTANLPP
FT                   SGWLAIRYITDNPGAWILHCHIQWHIVVCQLPFFTLAIGGKTLTVGYTVWNGGGLSRGR
FT                   RSARCPNSAR"
FT   exon            211811..211844
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=1
FT   intron          211845..211896
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=1
FT   exon            211897..211949
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=2
FT   intron          211950..212005
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=2
FT   exon            212006..212358
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=3
FT   intron          212359..212589
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=3
FT   exon            212590..212884
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=4
FT   intron          212885..212937
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=4
FT   exon            212938..213081
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=5
FT   intron          213082..213136
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=5
FT   exon            213137..213481
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=6
FT   intron          213482..213537
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=6
FT   exon            213538..213707
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=7
FT   intron          213708..213767
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=7
FT   exon            213768..213957
FT                   /gene="Pc13g00870"
FT                   /locus_tag="PCH_Pc13g00870"
FT                   /number=8
FT   mRNA            join(<215509..215645,215698..215854,215915..216125,
FT                   216182..216579,216627..216710,216765..>216902)
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT   CDS_pept        join(215509..215645,215698..215854,215915..216125,
FT                   216182..216579,216627..216710,216765..216902)
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT                   /note="Title: strong similarity to ceruloplasmin - Danio
FT                   rerio"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00880"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91157"
FT                   /db_xref="GOA:B6H195"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:B6H195"
FT                   /inference="protein motif:COGS:COG2132"
FT                   /protein_id="CAP91157.1"
FT                   /translation="MLFPVPWGLAVSTFFMLQFTFSAALNGTIRTYYVGAVEEDWDYMP
FT                   TGIDLINGVEIDQSPQAAAVAAHNGQRIGHVYTKAMFREFTDDTFAVQARRPQWLGMLG
FT                   PVIRAEVGDTVEVIFKNMASNNHSMHPHGLRYSKPNEGVAMAGQEFSGNSVPPGETWTY
FT                   TWEVPERAGPGPLDPPSLAWTYHSDVSGAQDIYSGLVGAIIIYRPGELAKHTLDVPAPR
FT                   GSDLTEEVLTLFMIVDENLSFYIDGNTLNRTNIPRGELQVNRLDPGFQESNLKHAINGR
FT                   LFGNLEGLTLTVGRKARWHVQSLGNVQNAHTPHWHGNTLTWAGQRLDVLSVLPAQTRSL
FT                   TMTVDNPGVWVHHCQVLNHRSKGMIVKYHAVDQD"
FT   sig_peptide     215509..215580
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            215509..215645
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT                   /number=1
FT   mat_peptide     join(215581..215645,215698..215854,215915..216125,
FT                   216182..216579,216627..216710,216765..216899)
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT   intron          215646..215697
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT                   /number=1
FT   exon            215698..215854
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT                   /number=2
FT   intron          215855..215914
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT                   /number=2
FT   exon            215915..216125
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT                   /number=3
FT   intron          216126..216181
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT                   /number=3
FT   exon            216182..216579
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT                   /number=4
FT   intron          216580..216626
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT                   /number=4
FT   exon            216627..216710
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT                   /number=5
FT   intron          216711..216764
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT                   /number=5
FT   exon            216765..216902
FT                   /gene="Pc13g00880"
FT                   /locus_tag="PCH_Pc13g00880"
FT                   /number=6
FT   mRNA            complement(join(<217400..218019,218077..218217,
FT                   218269..>218344))
FT                   /gene="Pc13g00890"
FT                   /locus_tag="PCH_Pc13g00890"
FT   CDS_pept        complement(join(217400..218019,218077..218217,
FT                   218269..218344))
FT                   /gene="Pc13g00890"
FT                   /locus_tag="PCH_Pc13g00890"
FT                   /note="Title: similarity to transcriptional activator Haa1
FT                   - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00890"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91158"
FT                   /db_xref="GOA:B6H194"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="InterPro:IPR036395"
FT                   /db_xref="UniProtKB/TrEMBL:B6H194"
FT                   /inference="similar to AA sequence:PIR:S59753"
FT                   /inference="protein motif:PFAM:PF00649"
FT                   /protein_id="CAP91158.1"
FT                   /translation="MLIDREKWACAACIRGHRAASCSHSERPLTIINKKGRPVSQCLHC
FT                   RSLRESRSAHVKCGCGNTNRARNDSGTQDSYPQCNCARGERCVCALKKDPFPDLVPKPS
FT                   WPHSPVHEEGRNTLAQPESVVAALHEDYSRYPGRFNSIQISPSESAPEFQISDQHTRLQ
FT                   SNSAEDSLPANSVISPTDLSSFTNLSSTMEPDYSAPTALDNFSVQQTMAENLDLDMSSF
FT                   PTVDFPIITTSAGSINDINSEYLYREDMFTSTYTQSTPGLTGADSYTADWEGLYPD"
FT   exon            complement(217400..218019)
FT                   /gene="Pc13g00890"
FT                   /locus_tag="PCH_Pc13g00890"
FT                   /number=1
FT   intron          complement(218020..218076)
FT                   /gene="Pc13g00890"
FT                   /locus_tag="PCH_Pc13g00890"
FT                   /number=1
FT   exon            complement(218077..218217)
FT                   /gene="Pc13g00890"
FT                   /locus_tag="PCH_Pc13g00890"
FT                   /number=2
FT   intron          complement(218218..218268)
FT                   /gene="Pc13g00890"
FT                   /locus_tag="PCH_Pc13g00890"
FT                   /number=2
FT   exon            complement(218269..218344)
FT                   /gene="Pc13g00890"
FT                   /locus_tag="PCH_Pc13g00890"
FT                   /number=3
FT   mRNA            complement(<218767..>218922)
FT                   /gene="Pc13g00900"
FT                   /locus_tag="PCH_Pc13g00900"
FT   CDS_pept        complement(218767..218922)
FT                   /gene="Pc13g00900"
FT                   /locus_tag="PCH_Pc13g00900"
FT                   /note="Title: weak similarity to the transcription factor
FT                   Pip2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00900"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91159"
FT                   /db_xref="GOA:B6H196"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H196"
FT                   /inference="similar to AA sequence:PIR:S70646"
FT                   /protein_id="CAP91159.1"
FT                   /translation="MRCRACQSKGVKRDLPRPRCSNCLDEQILCFYVAPLRLTMARSKK
FT                   QRSACT"
FT   exon            complement(218767..218922)
FT                   /gene="Pc13g00900"
FT                   /locus_tag="PCH_Pc13g00900"
FT                   /number=1
FT   mRNA            complement(join(<220889..221697,221746..>222025))
FT                   /gene="Pc13g00910"
FT                   /locus_tag="PCH_Pc13g00910"
FT   CDS_pept        complement(join(220889..221697,221746..222025))
FT                   /gene="Pc13g00910"
FT                   /locus_tag="PCH_Pc13g00910"
FT                   /note="Title: weak similarity to protein involved in SCF
FT                   dependent protein degradation Grr1 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00910"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91160"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:B6H197"
FT                   /inference="similar to AA sequence:PIR:A41529"
FT                   /inference="protein motif:PFAM:PF00646"
FT                   /protein_id="CAP91160.1"
FT                   /translation="MSAGGIMDGRIPDLQALPTEILHLILTSLESWEIKAFSLVNRRLR
FT                   DVCLPYLFYRVRFNFSEAGLDGLQQLRHSVVRLHVKSLNYTVPELIKPDILSFETFKSE
FT                   MLTPKSYVEEAKELYDCGYPADECPPYMVIYETLRTICENQQEILENHKNIDVLSSVLA
FT                   ALPRLRELELDFCPSIDEPQWVDSYLSLGMTAKEVSNTYHIQAVTKALQRRPECIAPLV
FT                   TIELSSLDLPHYSSWELPKFPSLSGALELLLEHCTTLRITGDSAPLELLSRSTVKLRKL
FT                   ILGHVNISYTAWREFLETNRQTIISIGFYDTHLIRGLAEIQELSPKLLPAVLPGFAFST
FT                   KKSTDYWKMPYWETGWIIQLGS"
FT   exon            complement(220889..221697)
FT                   /gene="Pc13g00910"
FT                   /locus_tag="PCH_Pc13g00910"
FT                   /number=1
FT   intron          complement(221698..221745)
FT                   /gene="Pc13g00910"
FT                   /locus_tag="PCH_Pc13g00910"
FT                   /number=1
FT   exon            complement(221746..222025)
FT                   /gene="Pc13g00910"
FT                   /locus_tag="PCH_Pc13g00910"
FT                   /number=2
FT   mRNA            complement(<223238..>226462)
FT                   /gene="Pc13g00920"
FT                   /locus_tag="PCH_Pc13g00920"
FT   CDS_pept        complement(223238..226462)
FT                   /gene="Pc13g00920"
FT                   /locus_tag="PCH_Pc13g00920"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig36.tfa_290wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00920"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91161"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniProtKB/TrEMBL:B6H198"
FT                   /protein_id="CAP91161.1"
FT                   /translation="MARIDLHTVDTLQLYAPRASTVDRKTVKGKILSGEAFSDFSRTER
FT                   ATIWKNLRSQAACDGIIPSLHTFFRDINYLELCANAVKRLVVLNKQRPTVRSALVHGFR
FT                   SRRADHGCLIQTSDTTFRRQPGSSDEGLTSGYRQIWMYAMRHYPEMAKDVQGGPKANPT
FT                   RAKARAKADESVIHAMAALAKKLGFRTPPVKTIIRQSPDHQIARAALLKARKPDHYHYD
FT                   SGAFESLIEQIAGCFALAIPNEAAPVAHITSRVIKLKDRCGIPQEQTQQLDSPHIFLDT
FT                   LHSATVLQRNLSSLEVRRSVYYAFFGKSSATTSQSVPLGQSSSNDPLSPLFVPTDVPRL
FT                   QSESAHDHMSRSSFDEGSSNGRRDRSEIPEEQHRRQERQHAVEHGPLLVQEPSIQSSIG
FT                   ETSTISEVMDMYWDSSGAEDQPRPENVEQQPAASRGMDSDSEERECTEIDEEDLLRRAA
FT                   DGGPVLEDAAAVNHLTLGAPRDTDMSSILDEGAGGVDMDEDMNSSAQNQSVQDRLGMPT
FT                   TLSRQSSTTPPASRKKSRDTTWKPYDATQKGNRKATTKPLAAQGQSIAEGGMTNSEPSA
FT                   EQRSGLGPLQPIAEHAEQEITRPVNEPEYPEHISGGPLPAEAQEGIAGEQMVDGTELIA
FT                   EAGEEVHQGDRVARERADALTQLQTSGAREDHAPRPVTELPADLPSLITRLREEGSQLG
FT                   DEGVIPDNIGMQELPELKPATVDNLDGVGGGTAVGVVKPGLSQQETERHRADLPNPEQA
FT                   QRQAIERQEGEDLLFDVPVLEEPTDQAVEEDPGRPTLEVPDPLRPGSMPAGLSSDVPPE
FT                   RRVTVTFYVYERQAWKKMDMVTVSPTQLADAQIIAERYARDPSQYARFYDGRLRKVAVN
FT                   ECIRAAIDDGSFTVLMSFGKDLMVTRHLVASVAEIFKSTGSEWHNPYHPEKRLKANTGA
FT                   PSAGPVQTRKDASSRKTERRGRKITPRIADGPPQDVRPSRARSEADSQPVTIVFRVRDE
FT                   NGRWRVAYEVRVDDRSNPSQVEQLARKEARDRQATFYDKNLRKLTPTQCFEAAIEDDTN
FT                   TIFMNFGGELRMDEDTIRSIAREVEL"
FT   exon            complement(223238..226462)
FT                   /gene="Pc13g00920"
FT                   /locus_tag="PCH_Pc13g00920"
FT                   /number=1
FT   mRNA            complement(join(<226532..226871,226959..>227338))
FT                   /gene="Pc13g00930"
FT                   /locus_tag="PCH_Pc13g00930"
FT   CDS_pept        complement(join(226532..226871,226959..227338))
FT                   /gene="Pc13g00930"
FT                   /locus_tag="PCH_Pc13g00930"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig36.tfa_290wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00930"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91162"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniProtKB/TrEMBL:B6H199"
FT                   /protein_id="CAP91162.1"
FT                   /translation="MDLLTDTERQLTAERLFKYQGTAKIDLDQISLQPLMSREIDQKNV
FT                   ERLHNIFAKDGCQRFDIRNHVTAVVSRRHLERACRGAGLTPEELKTYQREYPHLSFRGH
FT                   QVQCLHGQHRLTAAEETLAPSDRPDLRTALVDEYANEKAPTDGEVYRKIRQYQHESNAL
FT                   FQNRWWCRLSPNKAKRLRQLTSKDNTYLCAAFDALLAIPGLWNGLSLGSLNTVMALKCD
FT                   EVGSTPRSLKAIPDSSS"
FT   exon            complement(226532..226871)
FT                   /gene="Pc13g00930"
FT                   /locus_tag="PCH_Pc13g00930"
FT                   /number=1
FT   intron          complement(226872..226958)
FT                   /gene="Pc13g00930"
FT                   /locus_tag="PCH_Pc13g00930"
FT                   /number=1
FT   exon            complement(226959..227338)
FT                   /gene="Pc13g00930"
FT                   /locus_tag="PCH_Pc13g00930"
FT                   /number=2
FT   mRNA            join(<227642..228199,228352..228600,228648..>228758)
FT                   /gene="Pc13g00940"
FT                   /locus_tag="PCH_Pc13g00940"
FT   CDS_pept        join(227642..228199,228352..228600,228648..228758)
FT                   /gene="Pc13g00940"
FT                   /locus_tag="PCH_Pc13g00940"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig46_part_ii.tfa_2020cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00940"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91163"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A0"
FT                   /protein_id="CAP91163.1"
FT                   /translation="MDDRHLTQLYAESFKAQRPLSPTPTTVSAHKEFQGQSNHKLTKGR
FT                   KQQEKPEKSKNPLFGPAQDVRQSSSQSERQTAQAPVIRRGSPWHILKDLFTCDLAGPVS
FT                   IAVHKKGPSEVIAVRAFSKEKADVWLQVIQQTQHPNVISATEIFKDLGMTYFIVDDLPL
FT                   TLEHLVACDIFPSELQLASILVQVIPIPLFHLLTNMTAGLEHCIGRQPTQSQAQTLRAL
FT                   TNVTMFLMQKYLKPDGVIGIDGTRWRSDPLEFLSATASVATIQELRKHPLLTKHRWSAG
FT                   TLVGLARLCLITTRTFITKPWVQN"
FT   exon            227642..228199
FT                   /gene="Pc13g00940"
FT                   /locus_tag="PCH_Pc13g00940"
FT                   /number=1
FT   intron          228200..228351
FT                   /gene="Pc13g00940"
FT                   /locus_tag="PCH_Pc13g00940"
FT                   /number=1
FT   exon            228352..228600
FT                   /gene="Pc13g00940"
FT                   /locus_tag="PCH_Pc13g00940"
FT                   /number=2
FT   intron          228601..228647
FT                   /gene="Pc13g00940"
FT                   /locus_tag="PCH_Pc13g00940"
FT                   /number=2
FT   exon            228648..228758
FT                   /gene="Pc13g00940"
FT                   /locus_tag="PCH_Pc13g00940"
FT                   /number=3
FT   mRNA            complement(join(<228977..230163,230434..230518,
FT                   230610..230657,230709..>230723))
FT                   /gene="Pc13g00950"
FT                   /locus_tag="PCH_Pc13g00950"
FT   CDS_pept        complement(join(228977..230163,230434..230518,
FT                   230610..230657,230709..230723))
FT                   /gene="Pc13g00950"
FT                   /locus_tag="PCH_Pc13g00950"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig46_part_ii.tfa_2010wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00950"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91164"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A1"
FT                   /protein_id="CAP91164.1"
FT                   /translation="MSSLPIHPRDVLSLNEDTCADLLQEAQMIESFEVQENRSNAEVDP
FT                   LESLGAVTSPKSDAAYPTPPLSVASPPLTSSNGRITQHQPIGTPLSTDSPYASLETTPT
FT                   GPATPFGSDAIYSSYPTPSTSYVNSPPAEESCTLQGLRIPSQSRFRYLQSGRAGKNGTD
FT                   FLEQIKIEKILSAEDSLLAQEPSRLLQPLLECSEAGILPSLKALRLPVEWKGKGGAVKY
FT                   YRLLEAVKEKTLVLSPLAKRIAQILFYLNCTWLEKHGQLGATVATFILNACPEEPNTPE
FT                   RMKSRRDNITGCHKRPGKRCWMLVACLGAGVLLHGADAIDTVYVPQRRLRSPQLTRTCS
FT                   INSNFTIPQLNIFITFVLRTRPGTVHLLRSLDTVVEAIMLGASIADLRGVFRGITDATV
FT                   RQAQLASASAADQEAWTEQMTEDIWQAMDAESIAKKKIPDIIRDF"
FT   exon            complement(228977..230163)
FT                   /gene="Pc13g00950"
FT                   /locus_tag="PCH_Pc13g00950"
FT                   /number=1
FT   intron          complement(230164..230433)
FT                   /gene="Pc13g00950"
FT                   /locus_tag="PCH_Pc13g00950"
FT                   /number=1
FT   exon            complement(230434..230518)
FT                   /gene="Pc13g00950"
FT                   /locus_tag="PCH_Pc13g00950"
FT                   /number=2
FT   intron          complement(230519..230609)
FT                   /gene="Pc13g00950"
FT                   /locus_tag="PCH_Pc13g00950"
FT                   /number=2
FT   exon            complement(230610..230657)
FT                   /gene="Pc13g00950"
FT                   /locus_tag="PCH_Pc13g00950"
FT                   /number=3
FT   intron          complement(230658..230708)
FT                   /gene="Pc13g00950"
FT                   /locus_tag="PCH_Pc13g00950"
FT                   /number=3
FT   exon            complement(230709..230723)
FT                   /gene="Pc13g00950"
FT                   /locus_tag="PCH_Pc13g00950"
FT                   /number=4
FT   mRNA            complement(join(<231575..231814,231875..232675,
FT                   232723..>233298))
FT                   /gene="Pc13g00960"
FT                   /locus_tag="PCH_Pc13g00960"
FT   CDS_pept        complement(join(231575..231814,231875..232675,
FT                   232723..233298))
FT                   /gene="Pc13g00960"
FT                   /locus_tag="PCH_Pc13g00960"
FT                   /note="unknown EC_number=1.6.99.-"
FT                   /note="Title: similarity to ferric/cupric reductase Fre2
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00960"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91165"
FT                   /db_xref="GOA:B6H1A2"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A2"
FT                   /inference="similar to AA sequence:PIR:S38063"
FT                   /inference="protein motif:PFAM:PF01794"
FT                   /protein_id="CAP91165.1"
FT                   /translation="MDYKGCLCCMSSYPYSCCLVPLTVSPFRRMDPLVIYAITAGGIFA
FT                   VLLLIRTISLLAGCGHLFSLIVSQHLTLPFVIRRHRFLGPWTRAGVFLHLSYAAINIFL
FT                   LFFRIKSLTGAGRRAGELALVNLIFPLSTIHLAYLADLLGIKWNSCRKIHRATGWMAVA
FT                   LLSFHIIAAVQGQGFTFPLREQQNLFTMLAAISLGALALHSIPWFRQWSYEVFLRGHQI
FT                   LAGLFVYGTWQHLPLQSASSKIYLFVAVGTFVLTFLLELITLLYNNGLFAGNGTPRAIV
FT                   SFSAMESKEGLVVNAVHIRVLLPRRVKVQAGQYINLWMPSVSLCSWMQTHPFTVTSWSK
FT                   GKQDTVELLVKPCSGFTADLLRHAPAAAGSSVSFLALFTGPHGVSEKVSNYESILLLAS
FT                   GSGIAVAIPYLKKMIYGYNTCTSQVRRLHLVWQVESVDKMTPALSLINNLLKDDIMDDG
FT                   YILHISIYVSDGIEQNGLPFGRHKRVYIYQEVPDWQSIISLEASGNQVERLPNTWDEQG
FT                   RTLVMGEVPNFPRRIRANRPG"
FT   exon            complement(231575..231814)
FT                   /gene="Pc13g00960"
FT                   /locus_tag="PCH_Pc13g00960"
FT                   /number=1
FT   intron          complement(231815..231874)
FT                   /gene="Pc13g00960"
FT                   /locus_tag="PCH_Pc13g00960"
FT                   /number=1
FT   exon            complement(231875..232675)
FT                   /gene="Pc13g00960"
FT                   /locus_tag="PCH_Pc13g00960"
FT                   /number=2
FT   intron          complement(232676..232722)
FT                   /gene="Pc13g00960"
FT                   /locus_tag="PCH_Pc13g00960"
FT                   /number=2
FT   exon            complement(232723..233298)
FT                   /gene="Pc13g00960"
FT                   /locus_tag="PCH_Pc13g00960"
FT                   /number=3
FT   mRNA            <233495..>233746
FT                   /gene="Pc13g00970"
FT                   /locus_tag="PCH_Pc13g00970"
FT   CDS_pept        233495..233746
FT                   /gene="Pc13g00970"
FT                   /locus_tag="PCH_Pc13g00970"
FT                   /note="Title: similarity to hypothetical protein An04g07890
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00970"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91166"
FT                   /db_xref="GOA:B6H1A3"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="InterPro:IPR036879"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A3"
FT                   /inference="protein motif:COGS:COG5068"
FT                   /protein_id="CAP91166.1"
FT                   /translation="MSKTEQKSSWVKKRRSESSRAKSQQRQRRKSGLFKKAAEFSLECE
FT                   SDVVVAIRIRRTGQTYIFDSSSQEEWLEALPRLVLYPP"
FT   exon            233495..233746
FT                   /gene="Pc13g00970"
FT                   /locus_tag="PCH_Pc13g00970"
FT                   /number=1
FT   mRNA            join(<234510..234512,234567..234625,234676..234922,
FT                   234975..235034,235086..235138,235188..235386,
FT                   235433..235552,235681..>235785)
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT   CDS_pept        join(234510..234512,234567..234625,234676..234922,
FT                   234975..235034,235086..235138,235188..235386,
FT                   235433..235552,235681..235785)
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   BAB55393.1 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00980"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91167"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A4"
FT                   /inference="similar to AA sequence:TREMBLNEW:AK027823.1"
FT                   /protein_id="CAP91167.1"
FT                   /translation="MSLRQIYPPFGENPSGQATIDIIAVHGLDFIDMSGRCSVSSWREP
FT                   LDESGEFWPVAFIRAHGLRARLLLYEFDSVMTFGAAPESVSREADGLLHQISTIRPTDH
FT                   PDAPIIFLSHGLGGILVKQALVNASQGDRYCGINNATRGLAFFGTPHQAPSHRSPGVIE
FT                   TVFSLVSPRIPIRSPYSPELPIVQGFRDQVEDYQFISFYGDSDEAVPFSSAVMNLAGNR
FT                   ETQVRLSSNHEDLCRFYQGSDNYRKIANFSDLWTASPANFASTGEYSPDQSVSVLPNRL
FT                   "
FT   exon            234510..234512
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=1
FT   intron          234513..234566
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=1
FT   exon            234567..234625
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=2
FT   intron          234626..234675
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=2
FT   exon            234676..234922
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=3
FT   intron          234923..234974
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=3
FT   exon            234975..235034
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=4
FT   intron          235035..235085
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=4
FT   exon            235086..235138
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=5
FT   intron          235139..235187
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=5
FT   exon            235188..235386
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=6
FT   intron          235387..235432
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=6
FT   exon            235433..235552
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=7
FT   intron          235553..235680
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=7
FT   exon            235681..235785
FT                   /gene="Pc13g00980"
FT                   /locus_tag="PCH_Pc13g00980"
FT                   /number=8
FT   mRNA            complement(join(<236000..236089,236187..236336,
FT                   236457..>236555))
FT                   /gene="Pc13g00990"
FT                   /locus_tag="PCH_Pc13g00990"
FT   CDS_pept        complement(join(236000..236089,236187..236336,
FT                   236457..236555))
FT                   /gene="Pc13g00990"
FT                   /locus_tag="PCH_Pc13g00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g00990"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91168"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L2"
FT                   /protein_id="CAP91168.1"
FT                   /translation="MAETHLESWQNCSAEALKWGTDFERKPISVNLVCPVGTVYPGNTP
FT                   QYERTRGRKACQVLRGWEDGRTRTREANLFENYKRKANYMHPLNLRRYSRTIMTTWMVL
FT                   SGIEREAE"
FT   exon            complement(236000..236089)
FT                   /gene="Pc13g00990"
FT                   /locus_tag="PCH_Pc13g00990"
FT                   /number=1
FT   intron          complement(236090..236186)
FT                   /gene="Pc13g00990"
FT                   /locus_tag="PCH_Pc13g00990"
FT                   /number=1
FT   exon            complement(236187..236336)
FT                   /gene="Pc13g00990"
FT                   /locus_tag="PCH_Pc13g00990"
FT                   /number=2
FT   intron          complement(236337..236456)
FT                   /gene="Pc13g00990"
FT                   /locus_tag="PCH_Pc13g00990"
FT                   /number=2
FT   exon            complement(236457..236555)
FT                   /gene="Pc13g00990"
FT                   /locus_tag="PCH_Pc13g00990"
FT                   /number=3
FT   mRNA            complement(join(<237791..238525,238624..239274,
FT                   239321..239474,239567..239697,239760..239792,
FT                   240205..240402,240459..>240590))
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT   CDS_pept        complement(join(237791..238525,238624..239274,
FT                   239321..239474,239567..239697,239760..239792,
FT                   240205..240402,240459..240590))
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01000"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91169"
FT                   /db_xref="GOA:B6H1L3"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L3"
FT                   /protein_id="CAP91169.1"
FT                   /translation="MSWFGNIFPCWGARKQGVHDLSAVPREMKPSRGSERNVKRSPWKD
FT                   RSSCYVNTVEGEAAENQHIGVEPDSMNFKADALSHTELDQGQVPSLSEIGRPFASIPKN
FT                   PALPPSQDPQAKLLYAVKIGPECLSEASRALIYKGATASYRWKGLNPISRSFFMFTLLV
FT                   AWDTGVDIWSASSEAQQRRNRSAEQRRRYRELEKQGGLGRGQTTMKCFPVMLEMPEEEM
FT                   KRDARTALYSIWTSSGPTVYSALKQMPMLEDMFLGLETEEKLILAFCDRAFRRADNLDI
FT                   ENSGFVRVSSVLASEFSSYATKRKTISSKLVSYYHPFLETVRKAADSLLSNQSGGELQL
FT                   TSASLSHMVDEIITIANDMNETGHVRDYYAPTDDIVDNRLKEIAREFIRQHKPRVESID
FT                   RDRIEQYTLRGVWKGEFLETAHAFVLRDWGLIFLFYTPLIRQPDTLRITWEQHELGELG
FT                   QNYASAIFQAPYPASYFDIKGHLSGYPANPAGAVASMLQSIPPDEVFINNVPAPRISQS
FT                   KDIVAINREPSSIRASLLVVSCFGLLLVRRSWGENQDELVIPSGEVFAGEKPSDGGKRV
FT                   LEEKTGLKGELSLIDFDKHTGTMDDRSWYQPNYRVKLNHEWSEIPLSDKDQNFEWVQDE
FT                   KDLESFPGQGKLKLAPEWREIAQKGLQLWKETYDPGIKRKSQ"
FT   exon            complement(237791..238525)
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /number=1
FT   intron          complement(238526..238623)
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /number=1
FT   exon            complement(238624..239274)
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /number=2
FT   intron          complement(239275..239320)
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /number=2
FT   exon            complement(239321..239474)
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /number=3
FT   intron          complement(239475..239566)
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /number=3
FT   exon            complement(239567..239697)
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /number=4
FT   intron          complement(239698..239759)
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /number=4
FT   exon            complement(239760..239792)
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /number=5
FT   intron          complement(239793..240204)
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /number=5
FT   exon            complement(240205..240402)
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /number=6
FT   intron          complement(240403..240458)
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /number=6
FT   exon            complement(240459..240590)
FT                   /gene="Pc13g01000"
FT                   /locus_tag="PCH_Pc13g01000"
FT                   /number=7
FT   mRNA            complement(join(<242717..242967,243017..>243449))
FT                   /gene="Pc13g01010"
FT                   /locus_tag="PCH_Pc13g01010"
FT   CDS_pept        complement(join(242717..242967,243017..243449))
FT                   /gene="Pc13g01010"
FT                   /locus_tag="PCH_Pc13g01010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91170"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L4"
FT                   /protein_id="CAP91170.1"
FT                   /translation="MALGIIRDKVISLKNHGLSIEDRKVLKEDRRLLFAWVDEAPNDRE
FT                   TPVTKWRKARSRKAYRTIQDASEQLFLAAILSITPTQCARKSFDRVLESLMRLNHEEFY
FT                   FTLGPETKSFLEAIAAEQGFAGNRQYLAFMKSLFPRIEPRQIQFAYSLVRRNDIPSFLG
FT                   KMLEGITSSQEWAKEESQGGNTTGCVTIIIPTNEHEDGSCNIRVNRTLLMQAIHDFRIT
FT                   SLKLE"
FT   exon            complement(242717..242967)
FT                   /gene="Pc13g01010"
FT                   /locus_tag="PCH_Pc13g01010"
FT                   /number=1
FT   intron          complement(242968..243016)
FT                   /gene="Pc13g01010"
FT                   /locus_tag="PCH_Pc13g01010"
FT                   /number=1
FT   exon            complement(243017..243449)
FT                   /gene="Pc13g01010"
FT                   /locus_tag="PCH_Pc13g01010"
FT                   /number=2
FT   mRNA            <244929..>245282
FT                   /gene="Pc13g01020"
FT                   /locus_tag="PCH_Pc13g01020"
FT   CDS_pept        244929..245282
FT                   /gene="Pc13g01020"
FT                   /locus_tag="PCH_Pc13g01020"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An14g02490 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91171"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L5"
FT                   /protein_id="CAP91171.1"
FT                   /translation="MPSKTQKSLEALMAYIKQSKSRRTTILRGQGEPGHRAAPARGGNH
FT                   DARIGSRIDIGEIVKKTGKEYRRYKFQLNSNAEDSTLKRKAAQDSHKVYSTADVEIKES
FT                   RTQEEEEQAMRDF"
FT   exon            244929..245282
FT                   /gene="Pc13g01020"
FT                   /locus_tag="PCH_Pc13g01020"
FT                   /number=1
FT   mRNA            join(<246066..246090,246141..246436,246495..246873,
FT                   246953..>247830)
FT                   /gene="Pc13g01030"
FT                   /locus_tag="PCH_Pc13g01030"
FT   CDS_pept        join(246066..246090,246141..246436,246495..246873,
FT                   246953..247830)
FT                   /gene="Pc13g01030"
FT                   /locus_tag="PCH_Pc13g01030"
FT                   /note="Title: similarity to hypothetical protein YER080w
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91172"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L6"
FT                   /inference="similar to AA sequence:PIR:S50583"
FT                   /inference="protein motif:COGS:COG3173"
FT                   /inference="protein motif:COGS:COG2334"
FT                   /inference="protein motif:COGS:COG3178"
FT                   /protein_id="CAP91172.1"
FT                   /translation="MDIASSQTDWNSNDEFFKFTRGRFIVNEAENLRKREIRFDLNSLA
FT                   RVAADSVGAGRCIAIKKYPDGMFNKAYLMCMDDGQEVIAKVPNPNAGVPHFTTASEVAT
FT                   MDFARKILDTPAPRVYTWNSQAKSHPVGAEFIIMDKIKGVPLSQVWSTMKLPQKLQVLL
FT                   AMTRLQKQWLSVTFSHYGSLYYTEDVRPPAGNHFVKDGKVVKDSEFAIGPATGRDWCDA
FT                   GRSNLDVEKGPFGAREVKATQSLEPPKPIALFCGPKLYRPDTEKKITALAWYRQVVGAL
FT                   IPKDTAITRSCLWHNDLHDDNVFVDPDNPAKITGIIDWQSCHISPLFNHNPDPAFLSWD
FT                   GLEPETLDLAPQPKLSGLSPEERSAAVHEYTLQNVFIGWRKLMHAKNPDLYRVVEFRRT
FT                   AAYGLIFLAHRMFEYGEAHFQSLLVDLKDTWTDLPAISSDTPFPFDFSEADFERIKLDS
FT                   NGAVAGTDLVAEVKERMGDLWPDKGFIEHERYDDCKAALHEVKGLILEQLAENDQEKAE
FT                   YERFWPFE"
FT   exon            246066..246090
FT                   /gene="Pc13g01030"
FT                   /locus_tag="PCH_Pc13g01030"
FT                   /number=1
FT   intron          246091..246140
FT                   /gene="Pc13g01030"
FT                   /locus_tag="PCH_Pc13g01030"
FT                   /number=1
FT   exon            246141..246436
FT                   /gene="Pc13g01030"
FT                   /locus_tag="PCH_Pc13g01030"
FT                   /number=2
FT   intron          246437..246494
FT                   /gene="Pc13g01030"
FT                   /locus_tag="PCH_Pc13g01030"
FT                   /number=2
FT   exon            246495..246873
FT                   /gene="Pc13g01030"
FT                   /locus_tag="PCH_Pc13g01030"
FT                   /number=3
FT   intron          246874..246952
FT                   /gene="Pc13g01030"
FT                   /locus_tag="PCH_Pc13g01030"
FT                   /number=3
FT   exon            246953..247830
FT                   /gene="Pc13g01030"
FT                   /locus_tag="PCH_Pc13g01030"
FT                   /number=4
FT   mRNA            complement(<247993..>248463)
FT                   /gene="Pc13g01040"
FT                   /locus_tag="PCH_Pc13g01040"
FT   CDS_pept        complement(247993..248463)
FT                   /gene="Pc13g01040"
FT                   /locus_tag="PCH_Pc13g01040"
FT                   /note="unknown EC_number=2.7.1.-"
FT                   /note="Title: strong similarity to SR-protein-specific
FT                   serine kinase like protein An15g05650 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91173"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L7"
FT                   /protein_id="CAP91173.1"
FT                   /translation="MASIFRLPSRISRQTFSWRSSFLRSVSPVREFSQSSFPLLDPTQK
FT                   FEEETLSGYSPDGFYPVKIGEVFQSRYQVVGKSWRHGSRGESCNIPFNGKDVIPTLPGI
FT                   RHGGFKGTPYMIQNFHEVFQDQPGPPRGLTEWLESWEAGQELEDVPDDDLQE"
FT   exon            complement(247993..248463)
FT                   /gene="Pc13g01040"
FT                   /locus_tag="PCH_Pc13g01040"
FT                   /number=1
FT   mRNA            complement(join(<249173..249939,250004..>250298))
FT                   /gene="Pc13g01050"
FT                   /locus_tag="PCH_Pc13g01050"
FT   CDS_pept        complement(join(249173..249939,250004..250298))
FT                   /gene="Pc13g01050"
FT                   /locus_tag="PCH_Pc13g01050"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig46_part_ii.tfa_1980wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91174"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N2"
FT                   /protein_id="CAP91174.1"
FT                   /translation="MERQVSYNSPLSAAPPPPINHPLPPKPPISMHFHAYTPHSLKPVT
FT                   PICEMAAQYVNQGQTISVNNEPKGPSLRRHTTVSSVGVTSSLDMESVIRPFGADTSLRL
FT                   ENDDSGATGSINGDDFPHPDTLWSSVANSRVSSDGPRCADDGSCPDEASATASEDHGTG
FT                   SWSCGSYTCDTDDVGQYDNDQTKHLTDGRKDGSSDTLGPDTLAASGLLVEESQPSLSGN
FT                   ENTHRVTEISICSTPQIPQPTFRSQKKPACIVSRDTEGAAPGGPRTRARARAEASLFSV
FT                   RRRGRPFSAVEDALLRELVGRKLAWERIEQEFGRTFAERGLKSLQGRWSRKLKFLACPA
FT                   KRTPDALGRRSSS"
FT   exon            complement(249173..249939)
FT                   /gene="Pc13g01050"
FT                   /locus_tag="PCH_Pc13g01050"
FT                   /number=1
FT   intron          complement(249940..250003)
FT                   /gene="Pc13g01050"
FT                   /locus_tag="PCH_Pc13g01050"
FT                   /number=1
FT   exon            complement(250004..250298)
FT                   /gene="Pc13g01050"
FT                   /locus_tag="PCH_Pc13g01050"
FT                   /number=2
FT   mRNA            <251592..>252110
FT                   /gene="Pc13g01060"
FT                   /locus_tag="PCH_Pc13g01060"
FT   CDS_pept        251592..252110
FT                   /gene="Pc13g01060"
FT                   /locus_tag="PCH_Pc13g01060"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g12110 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91175"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N3"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP91175.1"
FT                   /translation="MELHMLSGSEDRHPIGASDLVTKLKWQLDQDLDHNCTPLGPCGSY
FT                   DAPFKITCATFGYTVVGKGTTSRLWGEVSREAEVYRVLQRTQGSAVRVFLGAIDMAQIY
FT                   FLHGAGKICHMLLMGWGGLSVSHMTLDKTIQHASVKEIRSLGICHQDLRPENILWNAEL
FT                   ERALIIDFH"
FT   exon            251592..252110
FT                   /gene="Pc13g01060"
FT                   /locus_tag="PCH_Pc13g01060"
FT                   /number=1
FT   mRNA            complement(join(<252423..252599,252644..252708,
FT                   252793..252844,252897..>253019))
FT                   /gene="Pc13g01070"
FT                   /locus_tag="PCH_Pc13g01070"
FT   CDS_pept        complement(join(252423..252599,252644..252708,
FT                   252793..252844,252897..253019))
FT                   /gene="Pc13g01070"
FT                   /locus_tag="PCH_Pc13g01070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91176"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N4"
FT                   /protein_id="CAP91176.1"
FT                   /translation="MQDITEVPPGSKPYLSYQETPPKGIGLDNLVDDISHACLSQARQC
FT                   DISFGALSRGAGPSFPSWHLGISEISVLAPNAELKGLRSHRGPMASIMRAACRYLSPAD
FT                   KNLLADADLPLSIAEKDNMARHGYQIRRWRRSVS"
FT   exon            complement(252423..252599)
FT                   /gene="Pc13g01070"
FT                   /locus_tag="PCH_Pc13g01070"
FT                   /number=1
FT   intron          complement(252600..252643)
FT                   /gene="Pc13g01070"
FT                   /locus_tag="PCH_Pc13g01070"
FT                   /number=1
FT   exon            complement(252644..252708)
FT                   /gene="Pc13g01070"
FT                   /locus_tag="PCH_Pc13g01070"
FT                   /number=2
FT   intron          complement(252709..252792)
FT                   /gene="Pc13g01070"
FT                   /locus_tag="PCH_Pc13g01070"
FT                   /number=2
FT   exon            complement(252793..252844)
FT                   /gene="Pc13g01070"
FT                   /locus_tag="PCH_Pc13g01070"
FT                   /number=3
FT   intron          complement(252845..252896)
FT                   /gene="Pc13g01070"
FT                   /locus_tag="PCH_Pc13g01070"
FT                   /number=3
FT   exon            complement(252897..253019)
FT                   /gene="Pc13g01070"
FT                   /locus_tag="PCH_Pc13g01070"
FT                   /number=4
FT   mRNA            <254332..>254996
FT                   /pseudo
FT                   /gene="Pc13g01080"
FT                   /locus_tag="PCH_Pc13g01080"
FT                   /note="submitted as non-pseudo"
FT   CDS_pept        254332..254996
FT                   /pseudo
FT                   /gene="Pc13g01080"
FT                   /locus_tag="PCH_Pc13g01080"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g01470 - Aspergillus niger"
FT   exon            254332..254996
FT                   /gene="Pc13g01080"
FT                   /locus_tag="PCH_Pc13g01080"
FT                   /number=1
FT   mRNA            join(<255884..255979,256035..256323,256361..256399,
FT                   256530..256721,256783..257028,257482..>257639)
FT                   /gene="Pc13g01090"
FT                   /locus_tag="PCH_Pc13g01090"
FT   CDS_pept        join(255884..255979,256035..256323,256361..256399,
FT                   256530..256721,256783..257028,257482..257639)
FT                   /gene="Pc13g01090"
FT                   /locus_tag="PCH_Pc13g01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91178"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N5"
FT                   /protein_id="CAP91178.1"
FT                   /translation="MAGDFGLQRQCQTCLAIFPTNDALRYHLEVYRLRERTLTLEIEKC
FT                   RAHAAPIYDPNKLCESCQVNAALTVASSNVSYQSDGEKDNGKDSISETTATLRSLGRRV
FT                   SKCPYYGCGKPFGSRKGLLKHFELPNRGFGTRRRLQRTIMKLDQMIETLESSSNDADLK
FT                   TPKRTLGETDLGQNSCPLRRVRARCKNGEALLDTTSEKAPQHVELQDKPFTSFELQPAY
FT                   EAVDMFAPLLFHDCPPPPTDNFDPPFFEASSSVGYRTQLGDGDPVGFCADITDPIPETE
FT                   FRFAWDENNFRPTTPQFHDQNMPARLLTPTSELKDVPWITVEFPVPGKTARRKKGLED"
FT   exon            255884..255979
FT                   /gene="Pc13g01090"
FT                   /locus_tag="PCH_Pc13g01090"
FT                   /number=1
FT   intron          255980..256034
FT                   /gene="Pc13g01090"
FT                   /locus_tag="PCH_Pc13g01090"
FT                   /number=1
FT   exon            256035..256323
FT                   /gene="Pc13g01090"
FT                   /locus_tag="PCH_Pc13g01090"
FT                   /number=2
FT   intron          256324..256360
FT                   /gene="Pc13g01090"
FT                   /locus_tag="PCH_Pc13g01090"
FT                   /number=2
FT   exon            256361..256399
FT                   /gene="Pc13g01090"
FT                   /locus_tag="PCH_Pc13g01090"
FT                   /number=3
FT   intron          256400..256529
FT                   /gene="Pc13g01090"
FT                   /locus_tag="PCH_Pc13g01090"
FT                   /number=3
FT   exon            256530..256721
FT                   /gene="Pc13g01090"
FT                   /locus_tag="PCH_Pc13g01090"
FT                   /number=4
FT   intron          256722..256782
FT                   /gene="Pc13g01090"
FT                   /locus_tag="PCH_Pc13g01090"
FT                   /number=4
FT   exon            256783..257028
FT                   /gene="Pc13g01090"
FT                   /locus_tag="PCH_Pc13g01090"
FT                   /number=5
FT   intron          257029..257481
FT                   /gene="Pc13g01090"
FT                   /locus_tag="PCH_Pc13g01090"
FT                   /number=5
FT   exon            257482..257639
FT                   /gene="Pc13g01090"
FT                   /locus_tag="PCH_Pc13g01090"
FT                   /number=6
FT   mRNA            complement(join(<259323..259344,259558..259783,
FT                   259844..>260168))
FT                   /gene="Pc13g01100"
FT                   /locus_tag="PCH_Pc13g01100"
FT   CDS_pept        complement(join(259323..259344,259558..259783,
FT                   259844..260168))
FT                   /gene="Pc13g01100"
FT                   /locus_tag="PCH_Pc13g01100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01100"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91179"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L8"
FT                   /protein_id="CAP91179.1"
FT                   /translation="MPRLQLPSNRSPGLSLIFKDYAMNQMKGTFDSSTTPNNLRLSWLT
FT                   KALRYTQEEAEESLERLHISTIERLGSLDDMIMGGLVDQPLTEIDIKNETILMVSWHWD
FT                   KCCDGSCPYSNRVTPLIRKSKRSLSKRPCAPIFQRKRSHRRRNIAQRKAIMKEKRRCRR
FT                   LRSIRLTLYTGRLLARRYWFYYSNILP"
FT   exon            complement(259323..259344)
FT                   /gene="Pc13g01100"
FT                   /locus_tag="PCH_Pc13g01100"
FT                   /number=1
FT   intron          complement(259345..259557)
FT                   /gene="Pc13g01100"
FT                   /locus_tag="PCH_Pc13g01100"
FT                   /number=1
FT   exon            complement(259558..259783)
FT                   /gene="Pc13g01100"
FT                   /locus_tag="PCH_Pc13g01100"
FT                   /number=2
FT   intron          complement(259784..259843)
FT                   /gene="Pc13g01100"
FT                   /locus_tag="PCH_Pc13g01100"
FT                   /number=2
FT   exon            complement(259844..260168)
FT                   /gene="Pc13g01100"
FT                   /locus_tag="PCH_Pc13g01100"
FT                   /number=3
FT   mRNA            join(<260191..260266,260355..260428,260513..260644,
FT                   260928..>261041)
FT                   /gene="Pc13g01110"
FT                   /locus_tag="PCH_Pc13g01110"
FT   CDS_pept        join(260191..260266,260355..260428,260513..260644,
FT                   260928..261041)
FT                   /gene="Pc13g01110"
FT                   /locus_tag="PCH_Pc13g01110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91180"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L9"
FT                   /protein_id="CAP91180.1"
FT                   /translation="MTAERRKLACICYVADDWRKLESTAVRTISFHRLGEMPCCEPIMS
FT                   GHGLPDQPLTRIFVPDPGRFGLKRKGSVTPIGYRLKHLARCCISDKGPQPVYVRPAILA
FT                   SPHIYGRDRASPMENTGIFDHRDASTY"
FT   exon            260191..260266
FT                   /gene="Pc13g01110"
FT                   /locus_tag="PCH_Pc13g01110"
FT                   /number=1
FT   intron          260267..260354
FT                   /gene="Pc13g01110"
FT                   /locus_tag="PCH_Pc13g01110"
FT                   /number=1
FT   exon            260355..260428
FT                   /gene="Pc13g01110"
FT                   /locus_tag="PCH_Pc13g01110"
FT                   /number=2
FT   intron          260429..260512
FT                   /gene="Pc13g01110"
FT                   /locus_tag="PCH_Pc13g01110"
FT                   /number=2
FT   exon            260513..260644
FT                   /gene="Pc13g01110"
FT                   /locus_tag="PCH_Pc13g01110"
FT                   /number=3
FT   intron          260645..260927
FT                   /gene="Pc13g01110"
FT                   /locus_tag="PCH_Pc13g01110"
FT                   /number=3
FT   exon            260928..261041
FT                   /gene="Pc13g01110"
FT                   /locus_tag="PCH_Pc13g01110"
FT                   /number=4
FT   mRNA            complement(join(<261640..262418,262476..262544,
FT                   262609..>262753))
FT                   /gene="Pc13g01120"
FT                   /locus_tag="PCH_Pc13g01120"
FT   CDS_pept        complement(join(261640..262418,262476..262544,
FT                   262609..262753))
FT                   /gene="Pc13g01120"
FT                   /locus_tag="PCH_Pc13g01120"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   AAG38543.1 - Pneumocystis carinii"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91181"
FT                   /db_xref="InterPro:IPR021264"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M0"
FT                   /inference="similar to AA sequence:TREMBL:AF309805.4"
FT                   /protein_id="CAP91181.1"
FT                   /translation="MNILDTLDTLDTLDTLDTLDTLDTLDTLDTLDTLDTLDTLDIYRA
FT                   SEAEKTRPEWWPLGVMHKEPDHLRKEYRIGLLLHIIRKLGPYGITANKLKDVAGDTERS
FT                   LKHPSDVEIIYEILQVRKMEERLERGEADANMIVYITSRGPSREDDKEDGSAISVATEE
FT                   PEHINLELMNPIPSFEQASTSLNTPTDSIPSACSLPGRFSKAEPLNFQNPAYDPPSYAK
FT                   PQQYSDSSSEPMLSTPMAAEIISPHNASALAFDYSAQTYPNSTSGVTGHYDNWTPYFRQ
FT                   NIFSPIDYATPVSSQGMPHVNELPVSHRRAHLPNMDTIHQRSLFLRTEP"
FT   exon            complement(261640..262418)
FT                   /gene="Pc13g01120"
FT                   /locus_tag="PCH_Pc13g01120"
FT                   /number=1
FT   intron          complement(262419..262475)
FT                   /gene="Pc13g01120"
FT                   /locus_tag="PCH_Pc13g01120"
FT                   /number=1
FT   exon            complement(262476..262544)
FT                   /gene="Pc13g01120"
FT                   /locus_tag="PCH_Pc13g01120"
FT                   /number=2
FT   intron          complement(262545..262608)
FT                   /gene="Pc13g01120"
FT                   /locus_tag="PCH_Pc13g01120"
FT                   /number=2
FT   exon            complement(262609..262753)
FT                   /gene="Pc13g01120"
FT                   /locus_tag="PCH_Pc13g01120"
FT                   /number=3
FT   mRNA            complement(join(<263108..263661,263715..264172,
FT                   264238..264463,264516..265047,265081..265284,
FT                   265326..>265400))
FT                   /gene="Pc13g01130"
FT                   /locus_tag="PCH_Pc13g01130"
FT   CDS_pept        complement(join(263108..263661,263715..264172,
FT                   264238..264463,264516..265047,265081..265284,
FT                   265326..265400))
FT                   /gene="Pc13g01130"
FT                   /locus_tag="PCH_Pc13g01130"
FT                   /note="unknown EC_number=3.2.1.-"
FT                   /note="Title: strong similarity to mutanase mutA
FT                   -Penicillium purporogenum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91182"
FT                   /db_xref="GOA:B6H1M1"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M1"
FT                   /inference="similar to AA sequence:TREMBL:AF214481.1"
FT                   /inference="protein motif:PFAM:PF03659"
FT                   /protein_id="CAP91182.1"
FT                   /translation="MPMIKLRRSAARSSDHLEIKRGYLKKAEDLTRGELRELTTHDEYT
FT                   VYFGCHYFTIHDSPCTVYGESWHTPCQKTVDRPTGLCTLYGKYALNFLIGIVSNRNSTS
FT                   DYDDDMKRAKSLGIDAFALNIGTDPYTDQQLQLAYDSAADNDMKVFLSLDFNWWHIEQA
FT                   AEVGQKVAQYASKPAQLLVDDKVFVSSFAGDGMNVAEMRVAVGKSVFFAPNFHPSTGID
FT                   ITPVDGLLNWMAWPNNGNNKASTAEHSISVADGDKEYVDALGGKAYIAPVSPWFFTHFG
FT                   PEVSYSKNWNFPSDLLWFNRWNEILELKPRFIEIVTWNDYGESHYIGPLSSPHTDDGAS
FT                   KWVNDMPHEGWLDISKPYIAAFKAGQSSPDSHISSDELVYWYRPAPRGVNCDSTDTCMV
FT                   PANNDSGNYFMGRPDGWESMADSVFIVSLLTAPATVQVNSGGTVHNYEAPAGASAKEVP
FT                   MGVGAQSFEVNRDGETILSGTSLKEVIDGCVCGLYNFNAYVGTLPPGSNDVLQPEGLSA
FT                   FTQGLRVQTCQPTPSLGTVPPPAPSLSKSTILPSSPPGVTKAPEPCSAILSTVVTVTVT
FT                   EAMAPPNSPPTRTCGGGGGEGGGGRNRACIAGTGANNYSGLCSFCCSYGYCPSGPCTCT
FT                   NYGTPIPLPPSTGARGAPLIGEDDSYLGLCSFACDHGYCPPTACRIA"
FT   exon            complement(263108..263661)
FT                   /gene="Pc13g01130"
FT                   /locus_tag="PCH_Pc13g01130"
FT                   /number=1
FT   intron          complement(263662..263714)
FT                   /gene="Pc13g01130"
FT                   /locus_tag="PCH_Pc13g01130"
FT                   /number=1
FT   exon            complement(263715..264172)
FT                   /gene="Pc13g01130"
FT                   /locus_tag="PCH_Pc13g01130"
FT                   /number=2
FT   intron          complement(264173..264237)
FT                   /gene="Pc13g01130"
FT                   /locus_tag="PCH_Pc13g01130"
FT                   /number=2
FT   exon            complement(264238..264463)
FT                   /gene="Pc13g01130"
FT                   /locus_tag="PCH_Pc13g01130"
FT                   /number=3
FT   intron          complement(264464..264515)
FT                   /gene="Pc13g01130"
FT                   /locus_tag="PCH_Pc13g01130"
FT                   /number=3
FT   exon            complement(264516..265047)
FT                   /gene="Pc13g01130"
FT                   /locus_tag="PCH_Pc13g01130"
FT                   /number=4
FT   intron          complement(265048..265080)
FT                   /gene="Pc13g01130"
FT                   /locus_tag="PCH_Pc13g01130"
FT                   /number=4
FT   exon            complement(265081..265284)
FT                   /gene="Pc13g01130"
FT                   /locus_tag="PCH_Pc13g01130"
FT                   /number=5
FT   intron          complement(265285..265325)
FT                   /gene="Pc13g01130"
FT                   /locus_tag="PCH_Pc13g01130"
FT                   /number=5
FT   exon            complement(265326..265400)
FT                   /gene="Pc13g01130"
FT                   /locus_tag="PCH_Pc13g01130"
FT                   /number=6
FT   mRNA            complement(join(<266287..266487,266620..>266739))
FT                   /gene="Pc13g01140"
FT                   /locus_tag="PCH_Pc13g01140"
FT   CDS_pept        complement(join(266287..266487,266620..266739))
FT                   /gene="Pc13g01140"
FT                   /locus_tag="PCH_Pc13g01140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91183"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M2"
FT                   /protein_id="CAP91183.1"
FT                   /translation="MTSVGKTIANVSHERNRVREQEAKPSGSFIPTPKRAIQEQGPDHD
FT                   YDFGTAHKAKTVLPVFVLRQHGKRPDWVLIRWPQGDEPLGAQLADLHNALPRPNAPIRK
FT                   EI"
FT   exon            complement(266287..266487)
FT                   /gene="Pc13g01140"
FT                   /locus_tag="PCH_Pc13g01140"
FT                   /number=1
FT   intron          complement(266488..266619)
FT                   /gene="Pc13g01140"
FT                   /locus_tag="PCH_Pc13g01140"
FT                   /number=1
FT   exon            complement(266620..266739)
FT                   /gene="Pc13g01140"
FT                   /locus_tag="PCH_Pc13g01140"
FT                   /number=2
FT   mRNA            join(<266741..267477,267712..267882,267933..268036,
FT                   268088..>268113)
FT                   /gene="Pc13g01150"
FT                   /locus_tag="PCH_Pc13g01150"
FT   CDS_pept        join(266741..267477,267712..267882,267933..268036,
FT                   268088..268113)
FT                   /gene="Pc13g01150"
FT                   /locus_tag="PCH_Pc13g01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91184"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M3"
FT                   /protein_id="CAP91184.1"
FT                   /translation="MAPQIPEEDHCGHYFETFTQEITSDCGCLETPRENVKGNASCIIS
FT                   KFKFAQTPTCLSLGLIMIGIVGARLFVNCMSQDESHYHHLEGENGGLEDAVTVIENIFA
FT                   ADRQSMEECGLQPGEFKILDKAIISQYSDKDEQILRAETVVYCHIEKVSEKFNNSPNAI
FT                   IEKLFASGWVELEKVDSPLESRCELNREKLGMPETRIASIYKAFILVKCLVEGKHLYYT
FT                   GGSRADSRFANPQAFGVKPALGFSPSLMYLDKEEKRDPYIQSSGLYCDKSLDFGERVST
FT                   PDDFKSFVKWATVPRSKTVVETWNKRESKYKIVEPIDTSDELDDDAGYVFVARKRVDRA
FT                   PSERR"
FT   exon            266741..267477
FT                   /gene="Pc13g01150"
FT                   /locus_tag="PCH_Pc13g01150"
FT                   /number=1
FT   intron          267478..267711
FT                   /gene="Pc13g01150"
FT                   /locus_tag="PCH_Pc13g01150"
FT                   /number=1
FT   exon            267712..267882
FT                   /gene="Pc13g01150"
FT                   /locus_tag="PCH_Pc13g01150"
FT                   /number=2
FT   intron          267883..267932
FT                   /gene="Pc13g01150"
FT                   /locus_tag="PCH_Pc13g01150"
FT                   /number=2
FT   exon            267933..268036
FT                   /gene="Pc13g01150"
FT                   /locus_tag="PCH_Pc13g01150"
FT                   /number=3
FT   intron          268037..268087
FT                   /gene="Pc13g01150"
FT                   /locus_tag="PCH_Pc13g01150"
FT                   /number=3
FT   exon            268088..268113
FT                   /gene="Pc13g01150"
FT                   /locus_tag="PCH_Pc13g01150"
FT                   /number=4
FT   mRNA            join(<270126..270150,270180..>271450)
FT                   /gene="Pc13g01160"
FT                   /locus_tag="PCH_Pc13g01160"
FT   CDS_pept        join(270126..270150,270180..271450)
FT                   /gene="Pc13g01160"
FT                   /locus_tag="PCH_Pc13g01160"
FT                   /note="Title: weak similarity to
FT                   Prion-like-(q/n-rich)-domain-bearing protein protein 66
FT                   -Caenorhabditis elegans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01160"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91185"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M4"
FT                   /inference="protein motif:COGS:COG3468"
FT                   /inference="protein motif:COGS:COG3264"
FT                   /inference="protein motif:COGS:COG0532"
FT                   /inference="protein motif:COGS:COG5281"
FT                   /protein_id="CAP91185.1"
FT                   /translation="MKRVVRKIVKILSSRRFHVTYHLLCRWQTGLEFFLYQLCKTTAPG
FT                   LIDDCHWSCAEAAELTRLSEKVTEFFCFHHKPIFKDCGISEQERESFCSDLQEIRQIRH
FT                   CAVHRVDINAATINKYAKCALHVLGTIKRLGGQGFRKDHGEAVCPVPFPSHYNNRSPRH
FT                   ELQLDRFVNSFWETERHLILQASSHISPSQHEEQNPGHNSKKAEGARLREAQQDDAQPT
FT                   KAKEAEHSQKHHDDAQPTKAKKAEHSQKQQDDAQLKKAKKAEHSQQQQDDAQLKKAKKT
FT                   EHSQKQQDDAQLKKAKKAEHSQQQQDDAQPTKAKEAEHSQKHHDDAQPTKAKKAEHSQQ
FT                   QQDDAQLKKAKKAEHSQKQQDDAQLKKAKKAEHNQQQQDDAQLKKAKKAEHSQKQQGDA
FT                   RPKKYMRTVNIQKICASSNMCKGKSTICTHTT"
FT   exon            270126..270150
FT                   /gene="Pc13g01160"
FT                   /locus_tag="PCH_Pc13g01160"
FT                   /number=1
FT   intron          270151..270179
FT                   /gene="Pc13g01160"
FT                   /locus_tag="PCH_Pc13g01160"
FT                   /number=1
FT   exon            270180..271450
FT                   /gene="Pc13g01160"
FT                   /locus_tag="PCH_Pc13g01160"
FT                   /number=2
FT   mRNA            complement(join(<272976..273100,273155..>273482))
FT                   /gene="Pc13g01170"
FT                   /locus_tag="PCH_Pc13g01170"
FT   CDS_pept        complement(join(272976..273100,273155..273482))
FT                   /gene="Pc13g01170"
FT                   /locus_tag="PCH_Pc13g01170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01170"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91186"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M5"
FT                   /protein_id="CAP91186.1"
FT                   /translation="MSWKERSRAYLRQFGVKRTGEALRCKRNYLLREYRSMQESLSETT
FT                   SSGAVPLRAQRDEARMSCLPSLPIYAPRGSRTKTRILIHALEQLAVSERRHLTNDSDNA
FT                   NERLPGYTIQPPHTLRPAPSRHISYHWKFVHRMAAATRASRNAEIL"
FT   exon            complement(272976..273100)
FT                   /gene="Pc13g01170"
FT                   /locus_tag="PCH_Pc13g01170"
FT                   /number=1
FT   intron          complement(273101..273154)
FT                   /gene="Pc13g01170"
FT                   /locus_tag="PCH_Pc13g01170"
FT                   /number=1
FT   exon            complement(273155..273482)
FT                   /gene="Pc13g01170"
FT                   /locus_tag="PCH_Pc13g01170"
FT                   /number=2
FT   mRNA            join(<274537..274865,274922..274939,274989..>275181)
FT                   /gene="Pc13g01180"
FT                   /locus_tag="PCH_Pc13g01180"
FT   CDS_pept        join(274537..274865,274922..274939,274989..275181)
FT                   /gene="Pc13g01180"
FT                   /locus_tag="PCH_Pc13g01180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91187"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M6"
FT                   /protein_id="CAP91187.1"
FT                   /translation="MGDQRNSQRYVDRMSQLLSSGSPEPNNIWSPPTSIAGSVDDDCHS
FT                   QQTDVSDEEGKATSMDGCSDEEGTRGQRAKEHTKERALDGARSVKFLKPEDSTESMVQM
FT                   IECMAELDERVQSDAKSLEGQDRWNQGMQRKYIDMIGAIDTLSKDVATLRKQVEALSSR
FT                   DAAKTREVVGSKRQKQ"
FT   exon            274537..274865
FT                   /gene="Pc13g01180"
FT                   /locus_tag="PCH_Pc13g01180"
FT                   /number=1
FT   intron          274866..274921
FT                   /gene="Pc13g01180"
FT                   /locus_tag="PCH_Pc13g01180"
FT                   /number=1
FT   exon            274922..274939
FT                   /gene="Pc13g01180"
FT                   /locus_tag="PCH_Pc13g01180"
FT                   /number=2
FT   intron          274940..274988
FT                   /gene="Pc13g01180"
FT                   /locus_tag="PCH_Pc13g01180"
FT                   /number=2
FT   exon            274989..275181
FT                   /gene="Pc13g01180"
FT                   /locus_tag="PCH_Pc13g01180"
FT                   /number=3
FT   mRNA            complement(join(<275222..275383,275486..275533,
FT                   275920..276064,276433..276515,276595..276690,
FT                   276753..>276851))
FT                   /gene="Pc13g01190"
FT                   /locus_tag="PCH_Pc13g01190"
FT   CDS_pept        complement(join(275222..275383,275486..275533,
FT                   275920..276064,276433..276515,276595..276690,
FT                   276753..276851))
FT                   /gene="Pc13g01190"
FT                   /locus_tag="PCH_Pc13g01190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91188"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M7"
FT                   /protein_id="CAP91188.1"
FT                   /translation="MAGCWRACVESSRLRDATRWDYGHLLRDNDMNMYVPARYRTIDAI
FT                   LAVGFRGTLRNPNQGPIRSMPGDLHATVVQTGLNTAVFIRPGSLQFPGAVSKRNGDYNI
FT                   DCANGFGIQPLPSAETSARMAMANFDANADPLANADRGTVDMPRKAGQFDSIRRSTTVL
FT                   SPTHGDKSLSWYVTNCGSGAELDRRRHVTSVTARRRPKDYFTWKQSS"
FT   exon            complement(275222..275383)
FT                   /gene="Pc13g01190"
FT                   /locus_tag="PCH_Pc13g01190"
FT                   /number=1
FT   intron          complement(275384..275485)
FT                   /gene="Pc13g01190"
FT                   /locus_tag="PCH_Pc13g01190"
FT                   /number=1
FT   exon            complement(275486..275533)
FT                   /gene="Pc13g01190"
FT                   /locus_tag="PCH_Pc13g01190"
FT                   /number=2
FT   intron          complement(275534..275919)
FT                   /gene="Pc13g01190"
FT                   /locus_tag="PCH_Pc13g01190"
FT                   /number=2
FT   exon            complement(275920..276064)
FT                   /gene="Pc13g01190"
FT                   /locus_tag="PCH_Pc13g01190"
FT                   /number=3
FT   intron          complement(276065..276432)
FT                   /gene="Pc13g01190"
FT                   /locus_tag="PCH_Pc13g01190"
FT                   /number=3
FT   exon            complement(276433..276515)
FT                   /gene="Pc13g01190"
FT                   /locus_tag="PCH_Pc13g01190"
FT                   /number=4
FT   intron          complement(276516..276594)
FT                   /gene="Pc13g01190"
FT                   /locus_tag="PCH_Pc13g01190"
FT                   /number=4
FT   exon            complement(276595..276690)
FT                   /gene="Pc13g01190"
FT                   /locus_tag="PCH_Pc13g01190"
FT                   /number=5
FT   intron          complement(276691..276752)
FT                   /gene="Pc13g01190"
FT                   /locus_tag="PCH_Pc13g01190"
FT                   /number=5
FT   exon            complement(276753..276851)
FT                   /gene="Pc13g01190"
FT                   /locus_tag="PCH_Pc13g01190"
FT                   /number=6
FT   mRNA            complement(join(<277592..278041,278221..>278376))
FT                   /gene="Pc13g01200"
FT                   /locus_tag="PCH_Pc13g01200"
FT   CDS_pept        complement(join(277592..278041,278221..278376))
FT                   /gene="Pc13g01200"
FT                   /locus_tag="PCH_Pc13g01200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01200"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91189"
FT                   /db_xref="UniProtKB/TrEMBL:B6H190"
FT                   /protein_id="CAP91189.1"
FT                   /translation="MPSRRTTSEAPADAGHGSSESDAAPKRTRRPPSTGHGGPPSGTQG
FT                   ASLHTPLRLEADKTQATAKIRQLSDTNDQNLARIQTLEFQISSLKQQQLDAVQVGNTAS
FT                   DNLLPILLEVSGNFQYAQSQLEKKIEAEKTAEKNKLTFAGFPASDVLQPSWPVYNGQMG
FT                   SLGTNSLQSYSLPLTNQQAPTQANHQPLPTASQYIPQF"
FT   exon            complement(277592..278041)
FT                   /gene="Pc13g01200"
FT                   /locus_tag="PCH_Pc13g01200"
FT                   /number=1
FT   intron          complement(278042..278220)
FT                   /gene="Pc13g01200"
FT                   /locus_tag="PCH_Pc13g01200"
FT                   /number=1
FT   exon            complement(278221..278376)
FT                   /gene="Pc13g01200"
FT                   /locus_tag="PCH_Pc13g01200"
FT                   /number=2
FT   mRNA            join(<281390..281521,281569..>281826)
FT                   /gene="Pc13g01210"
FT                   /locus_tag="PCH_Pc13g01210"
FT   CDS_pept        join(281390..281521,281569..281826)
FT                   /gene="Pc13g01210"
FT                   /locus_tag="PCH_Pc13g01210"
FT                   /note="Title: similarity to transcription activator thi1p
FT                   -Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91190"
FT                   /db_xref="GOA:B6H1M9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M9"
FT                   /inference="similar to AA sequence:PIR:S41962"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /protein_id="CAP91190.1"
FT                   /translation="MTENTPLWAIEEGSSSQSQIPRPPVEKRRNVSLACIECRQKRIKC
FT                   SGTTPCANCTAKGCQCFYGSDRRRKAHSIESSMLHQALLYTVVKLRSGNPDTVRSFVLQ
FT                   IRALQSARDGTSFLLSESRQDDQAV"
FT   exon            281390..281521
FT                   /gene="Pc13g01210"
FT                   /locus_tag="PCH_Pc13g01210"
FT                   /number=1
FT   intron          281522..281568
FT                   /gene="Pc13g01210"
FT                   /locus_tag="PCH_Pc13g01210"
FT                   /number=1
FT   exon            281569..281826
FT                   /gene="Pc13g01210"
FT                   /locus_tag="PCH_Pc13g01210"
FT                   /number=2
FT   mRNA            join(<282432..283111,283167..>284121)
FT                   /gene="Pc13g01220"
FT                   /locus_tag="PCH_Pc13g01220"
FT   CDS_pept        join(282432..283111,283167..284121)
FT                   /gene="Pc13g01220"
FT                   /locus_tag="PCH_Pc13g01220"
FT                   /note="Title: similarity to hypothetical protein ncu09467.1
FT                   - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91191"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N0"
FT                   /inference="protein motif:COGS:COG1196"
FT                   /inference="protein motif:COGS:COG5022"
FT                   /inference="protein motif:COGS:COG3264"
FT                   /protein_id="CAP91191.1"
FT                   /translation="MSPSTQSPSNASQCVAPSSVDSDGLKKFLKLVSMLASSPESQTMS
FT                   AILGEIAYQREQVHARDKELKKAQDQVLDLEERKRVTIEEMFAANEGEKAKQKDALDRV
FT                   ESLRASVNQKDKRLAEYSKEVQGLRQQVDSIKSSYSLELDKVSQSAKDISTLQQNLEEK
FT                   DKTIDRMKAAGSSLKSMFSSAQKKIEELEAEKACLDQALQASQGQLQTLQSFTVQQLEL
FT                   DENSIMASFSDLWVFASSEVFAILREDLDEEVLKVCLCLNPNPLYNHIHSSFDQKDKSI
FT                   WDKLRKENTKIAENNIPLVPSNSLEAKGMRLAMTMAFLSRELCKYIFQPNYLFPDDSEI
FT                   RGVLSHLAENNTEKESFCRRVLLSIDHSAEEKIRQTRIQTVIRNVSSYLWALLSQTQHD
FT                   SIRISIEKIVQKAAGFWLPIQRAQQRYETEFELADFEIADCEPFHFPGDSALPDRQDQG
FT                   ARDMNVLTVFPCITLVKDGDRDPLTHLIQLRSSQKLFVAAEHEASQMTTSFVVPRRSST
FT                   RSRRKSIAHNTDRPNGASFLGGKSPQP"
FT   exon            282432..283111
FT                   /gene="Pc13g01220"
FT                   /locus_tag="PCH_Pc13g01220"
FT                   /number=1
FT   intron          283112..283166
FT                   /gene="Pc13g01220"
FT                   /locus_tag="PCH_Pc13g01220"
FT                   /number=1
FT   exon            283167..284121
FT                   /gene="Pc13g01220"
FT                   /locus_tag="PCH_Pc13g01220"
FT                   /number=2
FT   mRNA            join(<285772..285774,285991..286290,286337..>286798)
FT                   /gene="Pc13g01230"
FT                   /locus_tag="PCH_Pc13g01230"
FT   CDS_pept        join(285772..285774,285991..286290,286337..286798)
FT                   /gene="Pc13g01230"
FT                   /locus_tag="PCH_Pc13g01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91192"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N1"
FT                   /protein_id="CAP91192.1"
FT                   /translation="MRVSKSFNSAFSSSVFGLGSGYSCFRRFLDHPGAFRRVLRCGAVV
FT                   TGPLVFQYFAKQYVDDVEIDILVSYDQSHTVTQHLQQSEGYEMVDEECSPFTETLKVSR
FT                   FKKERKTVRVSAIRNLTPLAFFLTHERTTACFNFLTEDYGYCLFPMSMRRKLDYRVCPV
FT                   LEEIEYGWLPEPQDGWTFYADFPHDGVTVSDHYAMVPVDMEIRTDRWIGDRFTWKVKLF
FT                   TDSPAEGVEKREYAFFVKSQSVHLGSWNETEQ"
FT   sig_peptide     join(285772..285774,285991..286050)
FT                   /gene="Pc13g01230"
FT                   /locus_tag="PCH_Pc13g01230"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            285772..285774
FT                   /gene="Pc13g01230"
FT                   /locus_tag="PCH_Pc13g01230"
FT                   /number=1
FT   intron          285775..285990
FT                   /gene="Pc13g01230"
FT                   /locus_tag="PCH_Pc13g01230"
FT                   /number=1
FT   exon            285991..286290
FT                   /gene="Pc13g01230"
FT                   /locus_tag="PCH_Pc13g01230"
FT                   /number=2
FT   mat_peptide     join(286051..286290,286337..286795)
FT                   /gene="Pc13g01230"
FT                   /locus_tag="PCH_Pc13g01230"
FT   intron          286291..286336
FT                   /gene="Pc13g01230"
FT                   /locus_tag="PCH_Pc13g01230"
FT                   /number=2
FT   exon            286337..286798
FT                   /gene="Pc13g01230"
FT                   /locus_tag="PCH_Pc13g01230"
FT                   /number=3
FT   mRNA            complement(join(<286905..286993,287100..287316,
FT                   287421..>287570))
FT                   /gene="Pc13g01240"
FT                   /locus_tag="PCH_Pc13g01240"
FT   CDS_pept        complement(join(286905..286993,287100..287316,
FT                   287421..287570))
FT                   /gene="Pc13g01240"
FT                   /locus_tag="PCH_Pc13g01240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91193"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N6"
FT                   /protein_id="CAP91193.1"
FT                   /translation="MDLPWFYCADRCSDEEGTRGQSENEQTKERISGGGRSIKFLDPEY
FT                   SAESMVSPEDRTRIPTLIRFRLDAKSLKDQDLWNQGMQRKYIEMIGTIEALSKEAAALR
FT                   KQVEVLPSGDAVKTRETVGLISHGAPGYSNNDKRTPPTGKFKVHVNV"
FT   exon            complement(286905..286993)
FT                   /gene="Pc13g01240"
FT                   /locus_tag="PCH_Pc13g01240"
FT                   /number=1
FT   intron          complement(286994..287099)
FT                   /gene="Pc13g01240"
FT                   /locus_tag="PCH_Pc13g01240"
FT                   /number=1
FT   exon            complement(287100..287316)
FT                   /gene="Pc13g01240"
FT                   /locus_tag="PCH_Pc13g01240"
FT                   /number=2
FT   intron          complement(287317..287420)
FT                   /gene="Pc13g01240"
FT                   /locus_tag="PCH_Pc13g01240"
FT                   /number=2
FT   exon            complement(287421..287570)
FT                   /gene="Pc13g01240"
FT                   /locus_tag="PCH_Pc13g01240"
FT                   /number=3
FT   mRNA            join(<287709..287763,287853..288094,288187..>288414)
FT                   /gene="Pc13g01250"
FT                   /locus_tag="PCH_Pc13g01250"
FT   CDS_pept        join(287709..287763,287853..288094,288187..288414)
FT                   /gene="Pc13g01250"
FT                   /locus_tag="PCH_Pc13g01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91194"
FT                   /db_xref="GOA:B6H1N7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N7"
FT                   /protein_id="CAP91194.1"
FT                   /translation="MYCMGSKETRHMYTRTCIVPHVWQARPRVHGCSGIPAGREGIMHI
FT                   IFVPLLAFTSLACYIIGSKLLILYHVPTSEYMYDAFVASLLFTHRPGLFHNLWQLIFVS
FT                   VPGAIVVGHREIQLLLSLKCTVQPETTGNREIRDIECKNGIVEYGETPPSSLTVRSNPG
FT                   LDFERRGKFLE"
FT   exon            287709..287763
FT                   /gene="Pc13g01250"
FT                   /locus_tag="PCH_Pc13g01250"
FT                   /number=1
FT   intron          287764..287852
FT                   /gene="Pc13g01250"
FT                   /locus_tag="PCH_Pc13g01250"
FT                   /number=1
FT   exon            287853..288094
FT                   /gene="Pc13g01250"
FT                   /locus_tag="PCH_Pc13g01250"
FT                   /number=2
FT   intron          288095..288186
FT                   /gene="Pc13g01250"
FT                   /locus_tag="PCH_Pc13g01250"
FT                   /number=2
FT   exon            288187..288414
FT                   /gene="Pc13g01250"
FT                   /locus_tag="PCH_Pc13g01250"
FT                   /number=3
FT   mRNA            join(<289563..289610,289937..290024,290128..290312,
FT                   290405..>290779)
FT                   /gene="Pc13g01260"
FT                   /locus_tag="PCH_Pc13g01260"
FT   CDS_pept        join(289563..289610,289937..290024,290128..290312,
FT                   290405..290779)
FT                   /gene="Pc13g01260"
FT                   /locus_tag="PCH_Pc13g01260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91195"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N8"
FT                   /protein_id="CAP91195.1"
FT                   /translation="MRPGTPFVLGLPPSASGVFNRKYKDIQPSQGIHLLSLVVNEAVHA
FT                   VYPSLFSPIPVFYNLDSDELWNPNKSMDSPPSPSQSGRANKRKRASPDQFVIPVGMPGR
FT                   SEQTIPAGAACSLTRNMSQILQSHPSLKSSSAVDLLDLYLCLWECYTIKSAGRIRLEEE
FT                   RRFLQDSNKWLVRENEKLQEYCNHQELLLWDHRQAFVSVHQGVLGTLQNSDRPSRQISE
FT                   LQWDRAGAN"
FT   sig_peptide     join(289563..289610,289937..289939)
FT                   /gene="Pc13g01260"
FT                   /locus_tag="PCH_Pc13g01260"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            289563..289610
FT                   /gene="Pc13g01260"
FT                   /locus_tag="PCH_Pc13g01260"
FT                   /number=1
FT   intron          289611..289936
FT                   /gene="Pc13g01260"
FT                   /locus_tag="PCH_Pc13g01260"
FT                   /number=1
FT   exon            289937..290024
FT                   /gene="Pc13g01260"
FT                   /locus_tag="PCH_Pc13g01260"
FT                   /number=2
FT   mat_peptide     join(289940..290024,290128..290312,290405..290776)
FT                   /gene="Pc13g01260"
FT                   /locus_tag="PCH_Pc13g01260"
FT   intron          290025..290127
FT                   /gene="Pc13g01260"
FT                   /locus_tag="PCH_Pc13g01260"
FT                   /number=2
FT   exon            290128..290312
FT                   /gene="Pc13g01260"
FT                   /locus_tag="PCH_Pc13g01260"
FT                   /number=3
FT   intron          290313..290404
FT                   /gene="Pc13g01260"
FT                   /locus_tag="PCH_Pc13g01260"
FT                   /number=3
FT   exon            290405..290779
FT                   /gene="Pc13g01260"
FT                   /locus_tag="PCH_Pc13g01260"
FT                   /number=4
FT   mRNA            join(<291831..292588,292691..>292769)
FT                   /gene="Pc13g01270"
FT                   /locus_tag="PCH_Pc13g01270"
FT   CDS_pept        join(291831..292588,292691..292769)
FT                   /gene="Pc13g01270"
FT                   /locus_tag="PCH_Pc13g01270"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An03g04950 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91196"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N9"
FT                   /protein_id="CAP91196.1"
FT                   /translation="MSVQLDNHQSIINYCRSCPEDQLTGGLRSGNQVVKLPDCDLVVKF
FT                   GPFVSSYEAKNQQKAYGIINPDIVIVPSVHKFFVDDEGWGYIISDFIQGKIIEPLSDSH
FT                   IHRLAHILEYFRSITANRAGSLCGGPSVGLLFPDTNDLTISNVQQVEEWFNSRLFPGDG
FT                   KVHFDPTPLVLCHLDIAPRNVIWLDDGRVCLLDWASAGFYPRLLEFASLFFQEYRFSEM
FT                   LLKAVGFDYGRDKEEQQRICQALYNNERYSFWLHLSSSITSGTAKTSDLTRRKWYW"
FT   exon            291831..292588
FT                   /gene="Pc13g01270"
FT                   /locus_tag="PCH_Pc13g01270"
FT                   /number=1
FT   intron          292589..292690
FT                   /gene="Pc13g01270"
FT                   /locus_tag="PCH_Pc13g01270"
FT                   /number=1
FT   exon            292691..292769
FT                   /gene="Pc13g01270"
FT                   /locus_tag="PCH_Pc13g01270"
FT                   /number=2
FT   mRNA            complement(<295236..>296234)
FT                   /gene="Pc13g01280"
FT                   /locus_tag="PCH_Pc13g01280"
FT   CDS_pept        complement(295236..296234)
FT                   /gene="Pc13g01280"
FT                   /locus_tag="PCH_Pc13g01280"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g12210 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91197"
FT                   /db_xref="GOA:B6H1P0"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P0"
FT                   /protein_id="CAP91197.1"
FT                   /translation="MERIASGFGRYLPIAEANNLIRTALLNVPFTQDVQVAGIGTTKTG
FT                   YVIRFKDTASAEAARENNEWLRELGNETELVKPRFGAVVHHVPTEDWTSSETKKELFKR
FT                   SWKRTTSRNGGFRIEYIGSYARLPLAEALKTMSLERLQELEMIDPTPLPPWRTEAFSAI
FT                   EIEPDRETAIEQAKAAGSKSDVILYSDASGHNGHLGAAAIGFNKNSPEATESLQIQVGP
FT                   MDRWAVHAAEPLGVLQAITLINNIALKHRRSMDTRVKSATTLSDSMSDLQAIQNPGNKS
FT                   GQQIIHTILRAVTNTKTHGIAVRLQWVPVLYISRICTYIVSHFLKTNLEPR"
FT   exon            complement(295236..296234)
FT                   /gene="Pc13g01280"
FT                   /locus_tag="PCH_Pc13g01280"
FT                   /number=1
FT   mRNA            complement(join(<296847..298504,298633..>300722))
FT                   /gene="Pc13g01290"
FT                   /locus_tag="PCH_Pc13g01290"
FT   CDS_pept        complement(join(296847..298504,298633..300722))
FT                   /pseudo
FT                   /gene="Pc13g01290"
FT                   /locus_tag="PCH_Pc13g01290"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to LTR-containing
FT                   retrotransposable elements MARS1 - Ascobolus immersus
FT                   [putative pseudogene]"
FT                   /inference="similar to AA sequence:PIR:S71892"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /inference="protein motif:PFAM:PF00075"
FT   exon            complement(296847..298504)
FT                   /gene="Pc13g01290"
FT                   /locus_tag="PCH_Pc13g01290"
FT                   /number=1
FT   intron          complement(298505..298632)
FT                   /gene="Pc13g01290"
FT                   /locus_tag="PCH_Pc13g01290"
FT                   /number=1
FT   exon            complement(298633..300722)
FT                   /gene="Pc13g01290"
FT                   /locus_tag="PCH_Pc13g01290"
FT                   /number=2
FT   mRNA            complement(<300926..>301906)
FT                   /gene="Pc13g01300"
FT                   /locus_tag="PCH_Pc13g01300"
FT   CDS_pept        complement(<300926..>301906)
FT                   /gene="Pc13g01300"
FT                   /locus_tag="PCH_Pc13g01300"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1497_4.tfa_370wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01300"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91199"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P5"
FT                   /protein_id="CAP91199.1"
FT                   /translation="PAGAPEPLPTNTQESTSSFSIEDFQPRVTASSLGSLPDSRKRTRS
FT                   GDAFTPSESTGRATTREVWRLIDSLKTIIHHQTTLIESTEAELQEVKHDQNVLRDQNEN
FT                   LHEEVRALRTQIEILPQAAPTRSWATVAASGGVRPPQLTHQRPDKDQNCVRISTQRLLV
FT                   DPTDNHNGDRNTFGRYLPTDSANTHIRMALLSAPSTQYAEVAGIGTTKTGYVIRFKNPT
FT                   SAEAARNNTDWLNELGNSTKLVKPRFGVVVHRTPTEDFDLQNASQQAIEKIMDEDELTE
FT                   RGFRIEEVAWLKKKDKELGKFASLGIWFDSAEGAEWLLVNGLLVGQ"
FT   exon            complement(300926..301906)
FT                   /gene="Pc13g01300"
FT                   /locus_tag="PCH_Pc13g01300"
FT                   /number=1
FT   mRNA            complement(<304368..>305837)
FT                   /gene="Pc13g01310"
FT                   /locus_tag="PCH_Pc13g01310"
FT   CDS_pept        complement(304368..305837)
FT                   /gene="Pc13g01310"
FT                   /locus_tag="PCH_Pc13g01310"
FT                   /note="Title: similarity to ankyrin ANK1 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01310"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91200"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P6"
FT                   /inference="similar to AA sequence:TREMBL:HSANK.1"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /inference="protein motif:COGS:COG0666"
FT                   /protein_id="CAP91200.1"
FT                   /translation="MPLLGLPLEILLWVGKFTDEKGLRTLCLTSREFNVIFRKSLFDCI
FT                   DFQDSPPIHWAIEHRSLGILQHSLGWEKADINEMYSGFTPLMLATQLRYADAVDLLLSH
FT                   HSVKVIQCNTLGESAFSIAVLHGSVKIVERLLNVQNVDLNNQSLDGIAPISVALTCRQT
FT                   YVFQLLLSDERTNVNICDHHGQTPLHLATEIGDYGAIQMLVRNPRVDVNCFNHRQETPL
FT                   LLAVKGHGRFLPIHKRLLIIEALLLSPCLNLNYQDENGRTAIWYAVSNSDLKLVELLLQ
FT                   QTNLDLNCADKLGQTPLAKAAANGSLDLIKVLFRQPGLHKSPSPQFTDAFPPLWSACRA
FT                   GQFAAVEFLLQNSADINQISPSGTSPLEVAIIMEHVDIVHLLVSSEKSLLINDQNHCSS
FT                   FTALMFASALGKVEIVKILLEHPNINVNAVDDQGRTSFWWAAAGGHYEVVQLLANRRGV
FT                   KKRLKDSNGQTAYAIAEQRKHGHVMVYLRSL"
FT   exon            complement(304368..305837)
FT                   /gene="Pc13g01310"
FT                   /locus_tag="PCH_Pc13g01310"
FT                   /number=1
FT   mat_peptide     complement(304371..305783)
FT                   /gene="Pc13g01310"
FT                   /locus_tag="PCH_Pc13g01310"
FT   sig_peptide     complement(305784..305837)
FT                   /gene="Pc13g01310"
FT                   /locus_tag="PCH_Pc13g01310"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<308505..309505,309564..>309759))
FT                   /gene="Pc13g01320"
FT                   /locus_tag="PCH_Pc13g01320"
FT   CDS_pept        complement(join(308505..309505,309564..309759))
FT                   /gene="Pc13g01320"
FT                   /locus_tag="PCH_Pc13g01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01320"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91201"
FT                   /db_xref="GOA:B6H1P7"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P7"
FT                   /inference="protein motif:PFAM:PF00249"
FT                   /protein_id="CAP91201.1"
FT                   /translation="MVTLNHQSFWQPPTTKSPQRCSSICSETQTVVITEELNASGESCE
FT                   GGYCNLENNVPQEEHRAEDVASEIGRLSPSISPNVYQSDASAAKNYPDYPQEVALYPSS
FT                   RVSSTPSVTGLDGPGTARVFDVFEDDDNRNLTANGSKCAWEDLNSSYPKRPRCLNSTAM
FT                   NATKSRRRRTSQPKAEGSSFESEESYADNLAGLGNAIRYLKRFYSLATAEAKFSDDLAD
FT                   ADILKENLAVLQVATKTLQHAYGIIATSATVIGDPVQQATTVQARHTITRRKWSVEDDS
FT                   RLLKLRDSQKLPWSRIRDLFPGRTLSAVKQRYVRETSKQIETPAGKDNHSNLSDQHVKR
FT                   TSNIRRSQRLCRPHQIKNTRSDAERHRRYPSRAVKHSGDSNAMKLDSIDPRLRNLGQT"
FT   exon            complement(308505..309505)
FT                   /gene="Pc13g01320"
FT                   /locus_tag="PCH_Pc13g01320"
FT                   /number=1
FT   intron          complement(309506..309563)
FT                   /gene="Pc13g01320"
FT                   /locus_tag="PCH_Pc13g01320"
FT                   /number=1
FT   exon            complement(309564..309759)
FT                   /gene="Pc13g01320"
FT                   /locus_tag="PCH_Pc13g01320"
FT                   /number=2
FT   mRNA            join(<309937..310111,310204..310327,310479..>310554)
FT                   /gene="Pc13g01330"
FT                   /locus_tag="PCH_Pc13g01330"
FT   CDS_pept        join(309937..310111,310204..310327,310479..310554)
FT                   /gene="Pc13g01330"
FT                   /locus_tag="PCH_Pc13g01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01330"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91202"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P8"
FT                   /protein_id="CAP91202.1"
FT                   /translation="MEMRPPTLSVQLLSPLLWPIKLVQSRCGSTEGSDPRNNSMVLTMW
FT                   RGGGLLVRNHTDTVYDGPGIEPAPDIENWDNKRIYVRVIEWTAGQSLRVEGKSGCADIV
FT                   GAFERTMMQVEIKQADQSEH"
FT   sig_peptide     309937..310011
FT                   /gene="Pc13g01330"
FT                   /locus_tag="PCH_Pc13g01330"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            309937..310111
FT                   /gene="Pc13g01330"
FT                   /locus_tag="PCH_Pc13g01330"
FT                   /number=1
FT   mat_peptide     join(310012..310111,310204..310327,310479..310551)
FT                   /gene="Pc13g01330"
FT                   /locus_tag="PCH_Pc13g01330"
FT   intron          310112..310203
FT                   /gene="Pc13g01330"
FT                   /locus_tag="PCH_Pc13g01330"
FT                   /number=1
FT   exon            310204..310327
FT                   /gene="Pc13g01330"
FT                   /locus_tag="PCH_Pc13g01330"
FT                   /number=2
FT   intron          310328..310478
FT                   /gene="Pc13g01330"
FT                   /locus_tag="PCH_Pc13g01330"
FT                   /number=2
FT   exon            310479..310554
FT                   /gene="Pc13g01330"
FT                   /locus_tag="PCH_Pc13g01330"
FT                   /number=3
FT   mRNA            join(<311236..311849,311904..>312720)
FT                   /gene="Pc13g01340"
FT                   /locus_tag="PCH_Pc13g01340"
FT   CDS_pept        join(311236..311849,311904..312720)
FT                   /gene="Pc13g01340"
FT                   /locus_tag="PCH_Pc13g01340"
FT                   /note="unknown EC_number=1.5.99.8"
FT                   /note="Title: strong similarity to proline dehydrogenase
FT                   slgA - Drosophila melanogaster"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91203"
FT                   /db_xref="GOA:B6H1P9"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P9"
FT                   /inference="similar to AA sequence:TREMBL:AE003568.31"
FT                   /inference="protein motif:PFAM:PF01619"
FT                   /inference="protein motif:COGS:COG0506"
FT                   /protein_id="CAP91203.1"
FT                   /translation="MGTLLPGKPLTALARCTRPTSNVNASMALRFTSTLQAHAQAKTAT
FT                   SPSLPPLSVLPARVLLRSLLVSTISSKRVLPIPALSLMSFLSKPNRIWLFDVDRNPVLH
FT                   GILKTTFYNQFCAGENGAECRSTIREMKDMGFRGMILTYAAETVFDHSTQAQSGQGVAA
FT                   LKSENGDVAVEASVHCPSIEAWREGTVETIYMTEAEDYIAVKLTGAGAKVTEAFTAGEL
FT                   PPHQMMDALHEVCTKAKDRKVRILIDAESQHFQKGISRVAVELMRKYNRDGYAAIYNTY
FT                   QAYLKNTPATLANHLALANEDGFTLGLKLVRGAYMATDERSLIHDTKEDTDNAYNMIAQ
FT                   GALRKNIGEFGDKGARDFPSVNLFLASHNKESVVTAHELHKNRVMSGLPTVPVRFAQLH
FT                   GMSDEVSFSLLQMNDGDGTPEVYKCSTWGGMGECLAYLLRRAIENRDAVLRTDNEYRAL
FT                   KKEVFRRVKSVLSLSPSS"
FT   exon            311236..311849
FT                   /gene="Pc13g01340"
FT                   /locus_tag="PCH_Pc13g01340"
FT                   /number=1
FT   intron          311850..311903
FT                   /gene="Pc13g01340"
FT                   /locus_tag="PCH_Pc13g01340"
FT                   /number=1
FT   exon            311904..312720
FT                   /gene="Pc13g01340"
FT                   /locus_tag="PCH_Pc13g01340"
FT                   /number=2
FT   mRNA            join(<313975..314170,314228..314410,314472..>315646)
FT                   /gene="Pc13g01350"
FT                   /locus_tag="PCH_Pc13g01350"
FT   CDS_pept        join(313975..314170,314228..314410,314472..315646)
FT                   /gene="Pc13g01350"
FT                   /locus_tag="PCH_Pc13g01350"
FT                   /note="Title: strong similarity to high-affinity glucose
FT                   transporter HGT1 - Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91204"
FT                   /db_xref="GOA:B6H1Q0"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q0"
FT                   /inference="similar to AA sequence:SWISSPROT:HGT1_KLULA"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP91204.1"
FT                   /translation="MAPKLKGKSLSLIIGLVGAVGFVLQGYDQAVANGLLTLGSFIAVF
FT                   PQIDTVHTSGSEKSHNSTIQGTTVAIYEVGCALGAGSCAFLGDRLGRRKTIFLAGCVAL
FT                   VGVAIQASPFSLGQLIAGRVITGLGVGGFTATIPMYVSESSGAEARGRMVLLEGWFAIG
FT                   GIVLATWLEFGLYYVSDNSASWRFPIAFQGLFALVVVGCIMLLPESPRWLARVGRLEEA
FT                   SEVLARMENAPVDSEHVLQELEIIRQSLVIDDSTELAGSSSPFALTKNRHLHRTVIAVG
FT                   VNILAQMTGVNIITFYSDTIFESNLGYSGTLSRIITGCLQIWQFLAAGVAGLLIDRVGR
FT                   RPLLIAAAAGMTLAQACLAGLSSHLENRSAAGASLLFYFVALFCFPIGLFLVPFMYAAE
FT                   IAPLRTRAKVTAMAAAANWLFNFVLAEVSPVGFATIHWRYYIVYACISAFACVSFYFFC
FT                   PETKGRTLEEIDDIFVQSKSAFDTVRIAREMPYQTEILAHVSDTEKGGLEAMQVENASK
FT                   "
FT   sig_peptide     313975..314049
FT                   /gene="Pc13g01350"
FT                   /locus_tag="PCH_Pc13g01350"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            313975..314170
FT                   /gene="Pc13g01350"
FT                   /locus_tag="PCH_Pc13g01350"
FT                   /number=1
FT   mat_peptide     join(314050..314170,314228..314410,314472..315643)
FT                   /gene="Pc13g01350"
FT                   /locus_tag="PCH_Pc13g01350"
FT   intron          314171..314227
FT                   /gene="Pc13g01350"
FT                   /locus_tag="PCH_Pc13g01350"
FT                   /number=1
FT   exon            314228..314410
FT                   /gene="Pc13g01350"
FT                   /locus_tag="PCH_Pc13g01350"
FT                   /number=2
FT   intron          314411..314471
FT                   /gene="Pc13g01350"
FT                   /locus_tag="PCH_Pc13g01350"
FT                   /number=2
FT   exon            314472..315646
FT                   /gene="Pc13g01350"
FT                   /locus_tag="PCH_Pc13g01350"
FT                   /number=3
FT   mRNA            complement(join(<316096..316819,316872..>316996))
FT                   /gene="Pc13g01360"
FT                   /locus_tag="PCH_Pc13g01360"
FT   CDS_pept        complement(join(316096..316819,316872..316996))
FT                   /gene="Pc13g01360"
FT                   /locus_tag="PCH_Pc13g01360"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPBC365.16 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01360"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91205"
FT                   /db_xref="InterPro:IPR038781"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q1"
FT                   /inference="similar to AA sequence:PIR:T40323"
FT                   /protein_id="CAP91205.1"
FT                   /translation="MQHQIQNEARWSNPQLGQLAGDLAAAAASASLVTPAVAIIDRALV
FT                   EQAAFKQPIFCGLRRHALGALRQPGLFVFQRPFGIVWALYAATYSVANVTDTISRKLEI
FT                   TAAGAITFATTMLANVPLALWKDLRFAQEYGTGRGPDAKTSKATTPIPVPLQNKSLART
FT                   AAAIFLVRDGFTIFGSFTLAPWLSDAIPDSLAAHPQAKPIITQLTVPVLTQLVATPLHL
FT                   LALDMYTRQYTMPFLERVKHSQQYLPSSTLLRCVRIIPAFGIGCLTNMELRSAFHAKAS
FT                   G"
FT   exon            complement(316096..316819)
FT                   /gene="Pc13g01360"
FT                   /locus_tag="PCH_Pc13g01360"
FT                   /number=1
FT   intron          complement(316820..316871)
FT                   /gene="Pc13g01360"
FT                   /locus_tag="PCH_Pc13g01360"
FT                   /number=1
FT   exon            complement(316872..316996)
FT                   /gene="Pc13g01360"
FT                   /locus_tag="PCH_Pc13g01360"
FT                   /number=2
FT   mRNA            join(<317309..317449,317500..317972,318029..318978,
FT                   319037..>319209)
FT                   /gene="Pc13g01370"
FT                   /locus_tag="PCH_Pc13g01370"
FT   CDS_pept        join(317309..317449,317500..317972,318029..318978,
FT                   319037..319209)
FT                   /gene="Pc13g01370"
FT                   /locus_tag="PCH_Pc13g01370"
FT                   /note="unknown EC_number=1.5.1.12"
FT                   /note="Title: strong similarity to
FT                   delta-1-pyrroline-5-carboxylate dehydrogenase p5cdh - Homo
FT                   sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91206"
FT                   /db_xref="GOA:B6H1Q2"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q2"
FT                   /inference="similar to AA sequence:SWISSPROT:PUT2_HUMAN"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /inference="protein motif:COGS:COG1012"
FT                   /protein_id="CAP91206.1"
FT                   /translation="MSTTLMRLRSARPTGSRLRSVPAGLSIQARAKATMPFRLPDGRNE
FT                   PNPLYKKGSPERAKVEEALTKLRSQLPVRSELFYDGKLQASSKSWDQPLPAEHATTFTN
FT                   YPFATDEQVRSAIELALEAKQSWQDTPFVDRASIFLKAAELVCTKYRYEIIAATMLGQG
FT                   KNIWQGEIDAAAELADFFRLNCNWAAEILEKQPTRGSDGMWSRIDYRPLEGFVYAVSPF
FT                   NFTAIGGNLICGPALMGNVVVWKPSASNVYASSLLYKILLEAGLPPNVIQFVTGDPEAI
FT                   TETVLSHRDFAGLNFIGSSDVFRSLYGKIGQGVAAKKYREFPRFVAETSGKNFHLVHPS
FT                   ADITSAVNHTIRGSFEYQGQKCSATSRLYLPESRAEEFLTQLKAGIKEITIGNPDKDLS
FT                   AFMGPVIHRGSFEKIKSVIDASNKDPSLKLIAGGTYDGSVGYYVHPTVYQADSPDHRLF
FT                   NEEIFGPVLAVHIYKDADWASTLKSVDQNGGGFALTGAVFAKDRIAIRQAEDALRYSAG
FT                   NFYINCKTTAALIGQQSFGGARASGTNDKAGSSDPLRRFVSPRLIKEEFFGQEGFTYPS
FT                   ND"
FT   exon            317309..317449
FT                   /gene="Pc13g01370"
FT                   /locus_tag="PCH_Pc13g01370"
FT                   /number=1
FT   intron          317450..317499
FT                   /gene="Pc13g01370"
FT                   /locus_tag="PCH_Pc13g01370"
FT                   /number=1
FT   exon            317500..317972
FT                   /gene="Pc13g01370"
FT                   /locus_tag="PCH_Pc13g01370"
FT                   /number=2
FT   intron          317973..318028
FT                   /gene="Pc13g01370"
FT                   /locus_tag="PCH_Pc13g01370"
FT                   /number=2
FT   exon            318029..318978
FT                   /gene="Pc13g01370"
FT                   /locus_tag="PCH_Pc13g01370"
FT                   /number=3
FT   intron          318979..319036
FT                   /gene="Pc13g01370"
FT                   /locus_tag="PCH_Pc13g01370"
FT                   /number=3
FT   exon            319037..319209
FT                   /gene="Pc13g01370"
FT                   /locus_tag="PCH_Pc13g01370"
FT                   /number=4
FT   mRNA            join(<319798..320029,320083..>321173)
FT                   /gene="Pc13g01380"
FT                   /locus_tag="PCH_Pc13g01380"
FT   CDS_pept        join(319798..320029,320083..321173)
FT                   /gene="Pc13g01380"
FT                   /locus_tag="PCH_Pc13g01380"
FT                   /note="unknown EC_number=1.5.3.-"
FT                   /note="Title: strong similarity to fructosyl amine oxygen
FT                   oxidoreductase - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91207"
FT                   /db_xref="GOA:B6H1Q3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q3"
FT                   /inference="similar to AA sequence:TREMBL:AF035700.1"
FT                   /inference="protein motif:COGS:COG0665"
FT                   /protein_id="CAP91207.1"
FT                   /translation="MAIPKSEPIIIVGGGAFGLSSALHLTRSGFTNISVFERDEHIPPR
FT                   YSAANDLNKIVRAEYEDPFYTDLTIVSQPSMYTIAAWKTPLFAPHFHQTGFLHCVSGEA
FT                   PQKAIDTLNRFRASANGNDQLKSHVVPLRGEDDIRQACWQLDGPLSGWNGYLNRFDGYA
FT                   HSGNALAGVYRAAQAAGVRFYLGERGAVDEIVYVSTLQGEKSSGIRTKDGKFHPSSLVI
FT                   VAAGGAVSRLVPEIGKKVVAKSWSVAHVHLTDEETSALRGIPVTYARDLGFLFEPDPQT
FT                   NLLKICPMGGGYVNTDPVTGVSHAPRSLEESAFVPEHDERQMRKLLAQTLPALANRPLV
FT                   KKSLCWFADTDDSDFIIDFVPGTSSSVVLLSGDSGHGFKMFPIFGSWVSDFLQAGQQRE
FT                   ARWKWKHAGPNESKGNWGGDVSWRLGVSKELSEIRPVLSKL"
FT   sig_peptide     319798..319863
FT                   /gene="Pc13g01380"
FT                   /locus_tag="PCH_Pc13g01380"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            319798..320029
FT                   /gene="Pc13g01380"
FT                   /locus_tag="PCH_Pc13g01380"
FT                   /number=1
FT   mat_peptide     join(319864..320029,320083..321170)
FT                   /gene="Pc13g01380"
FT                   /locus_tag="PCH_Pc13g01380"
FT   intron          320030..320082
FT                   /gene="Pc13g01380"
FT                   /locus_tag="PCH_Pc13g01380"
FT                   /number=1
FT   exon            320083..321173
FT                   /gene="Pc13g01380"
FT                   /locus_tag="PCH_Pc13g01380"
FT                   /number=2
FT   mRNA            complement(join(<321349..321842,321895..322078,
FT                   322141..322313,322367..322637,322688..323226,
FT                   323273..323428,323481..323578,323629..>323840))
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT   CDS_pept        complement(join(321349..321842,321895..322078,
FT                   322141..322313,322367..322637,322688..323226,
FT                   323273..323428,323481..323578,323629..323840))
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /note="Title: strong similarity to transcription activator
FT                   Put3 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01390"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91208"
FT                   /db_xref="GOA:B6H1Q4"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q4"
FT                   /inference="similar to AA sequence:PIR:A39792"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP91208.1"
FT                   /translation="MHTNNLVVHDAGDKRSNVPGHSHAMDAASERLVKMLHVSCLSLIS
FT                   SAYPGLSAKLSCIFDDRDQKILVTKGYIMELQQKIARIEQKEKGQASPFSSNFDTQTID
FT                   PKDRERVPTLERTSTPDDHNEPRELDDLDSELANPLSSGPPAFMSAANGRTFYLGTSSN
FT                   WSFTRRVLSLAHQHLYQDVLPTESLIFDETTYELGWDGLRTTPSLDFPVVPTRDHTMYL
FT                   INAVKFRCGQLYHLFEEDVFMSSLQQFYSGDGQSMTNSLWYIHFLLILAFGKGFVQPKA
FT                   QGRKPPGVSYFVKALQLLPDPTALYRDPTLGTEILCCIALYYQCVDFRTSAHNYIGQAM
FT                   RIAMAQGMHTSMPVEALGHDMVQRSGKIWWTIYILDREMTSLMGLPQSINDRYVQTQLP
FT                   TFADPSETMSLGMHIKLSQIIAEVNSTIYVINGRINRTFLLSTKTALANIAGLADELRE
FT                   SFPLYLDPGSGISRISAYLHLQYHQCIILATRPLLFCFLKIRFESPESCLESLNASRNV
FT                   RNLMQMCLESAQNIISILSSLQGQGLLETFLPFDLESVFVSTIILLMGPAIDPRVLESH
FT                   PNWLEKAYAIFDEMIRDGNQVAKFRRSELQQLHETLLGCISGDQPRQLAVPDFFQQADV
FT                   LPNPASPSVTPIPGAMPQSIRYDDALLRPDTDLDAECDFSTMLTSAEIMAVADSIESYD
FT                   TEWVSNAMVEHSIW"
FT   exon            complement(321349..321842)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=1
FT   intron          complement(321843..321894)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=1
FT   exon            complement(321895..322078)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=2
FT   intron          complement(322079..322140)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=2
FT   exon            complement(322141..322313)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=3
FT   intron          complement(322314..322366)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=3
FT   exon            complement(322367..322637)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=4
FT   intron          complement(322638..322687)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=4
FT   exon            complement(322688..323226)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=5
FT   intron          complement(323227..323272)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=5
FT   exon            complement(323273..323428)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=6
FT   intron          complement(323429..323480)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=6
FT   exon            complement(323481..323578)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=7
FT   intron          complement(323579..323628)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=7
FT   exon            complement(323629..323840)
FT                   /gene="Pc13g01390"
FT                   /locus_tag="PCH_Pc13g01390"
FT                   /number=8
FT   mRNA            complement(join(<324242..324906,325024..>325753))
FT                   /gene="Pc13g01400"
FT                   /locus_tag="PCH_Pc13g01400"
FT   CDS_pept        complement(join(324242..324906,325024..325753))
FT                   /gene="Pc13g01400"
FT                   /locus_tag="PCH_Pc13g01400"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An07g07180 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91209"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q5"
FT                   /protein_id="CAP91209.1"
FT                   /translation="MSADLLAEFGQAPAPDNKSGQQPSQYQKNSFFGVDDNVDFFGSSG
FT                   SAQHNKPTHPNPGAVGQFATPAASCQRPSHQGFDLPLNPHSDVLFDAAFDTPASDDDWG
FT                   EFEGPDSNTQHEHSTALQHSMTATSQKPESWQDDPQGIKTIDLLDSLSVQDPVPVVKHP
FT                   SQIAKKEQQLEPTNSRAEPTWDDDSFDDWGDFADAPASQPLPKVSEKKTKPPTKPPTKP
FT                   LVKSNKPPASTWDDDAFDDWGAPAATVRPTNIPPPSVLLELFLDVFENLHKEAALAKSQ
FT                   LRSSAPPSSSSSNTVSTTALNIHNVLQSAARVIAGRSLRWKRDTILSQSMRIGPARSGK
FT                   AGGMKLNSVNKQENIKEEQDAVDVITTWRERAAVFNAVLQAAGLRPIPTVPDASALKVI
FT                   TARADQGALKASHPCALCSLKRDERVLRVDEQNVQDSFGEWWTEHWGHTACRQFWERNR
FT                   NLLGQR"
FT   exon            complement(324242..324906)
FT                   /gene="Pc13g01400"
FT                   /locus_tag="PCH_Pc13g01400"
FT                   /number=1
FT   intron          complement(324907..325023)
FT                   /gene="Pc13g01400"
FT                   /locus_tag="PCH_Pc13g01400"
FT                   /number=1
FT   exon            complement(325024..325753)
FT                   /gene="Pc13g01400"
FT                   /locus_tag="PCH_Pc13g01400"
FT                   /number=2
FT   mRNA            complement(join(<326589..327973,328039..328112,
FT                   328554..>328657))
FT                   /gene="Pc13g01410"
FT                   /locus_tag="PCH_Pc13g01410"
FT   CDS_pept        complement(join(326589..327973,328039..328112,
FT                   328554..328657))
FT                   /gene="Pc13g01410"
FT                   /locus_tag="PCH_Pc13g01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91210"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q6"
FT                   /protein_id="CAP91210.1"
FT                   /translation="MDLVGLYRKDGITPTTLPNFADLHPKSGTKDLLVIPSEDGWFVSD
FT                   FYLFHYLLSPKFPRPPNQIWLTCEDPSALVRKYHEYLHGNPKGDRRAVLDGERLPNILG
FT                   AGNVRVVPRIDLLERYLSTLREQAAEATRCEEHLVLLFFGHGTPAHGIEVGDSILHMKD
FT                   LRHLLQPMSSTTIFTTSCYSGGWLVCPDINQEQLNTTSITASGKDNESSSWTVSGSAGR
FT                   ASGSLAASAVLRCLIDAEDETQERTEHPTYLELSKSVYDCVKDMVTLGNSQQIYFSAEN
FT                   DEWETSYQPRLGLPLASYKDKWLSLRQVPPSPSPPSSTSSPELAKTGGRRLKRLKYLAE
FT                   EYFAAKPGPNEASPNIGLHNCLRSVLNGATYPKEKVDSLTETTTYRLGAMYEADYLREQ
FT                   IGLKFPSIFSMETPLAQIENESCNPELYTQTWSLLLKRKICTTPIGIRLHFPKPLQYLT
FT                   IALVESSTSWEMIQDQVEAMASKKKAWFRFIYRAWMGNRVAHDEGVMNSRRAFLEACKK
FT                   LKY"
FT   exon            complement(326589..327973)
FT                   /gene="Pc13g01410"
FT                   /locus_tag="PCH_Pc13g01410"
FT                   /number=1
FT   intron          complement(327974..328038)
FT                   /gene="Pc13g01410"
FT                   /locus_tag="PCH_Pc13g01410"
FT                   /number=1
FT   exon            complement(328039..328112)
FT                   /gene="Pc13g01410"
FT                   /locus_tag="PCH_Pc13g01410"
FT                   /number=2
FT   intron          complement(328113..328553)
FT                   /gene="Pc13g01410"
FT                   /locus_tag="PCH_Pc13g01410"
FT                   /number=2
FT   exon            complement(328554..328657)
FT                   /gene="Pc13g01410"
FT                   /locus_tag="PCH_Pc13g01410"
FT                   /number=3
FT   mRNA            join(<329148..329170,329222..329339,329395..329553,
FT                   329619..330136,330191..>331613)
FT                   /gene="Pc13g01420"
FT                   /locus_tag="PCH_Pc13g01420"
FT   CDS_pept        join(329148..329170,329222..329339,329395..329553,
FT                   329619..330136,330191..331613)
FT                   /gene="Pc13g01420"
FT                   /locus_tag="PCH_Pc13g01420"
FT                   /note="Title: strong similarity to polypeptide sequence
FT                   like protein An07g07190 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91211"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q7"
FT                   /inference="protein motif:PFAM:PF00566"
FT                   /inference="protein motif:COGS:COG5210"
FT                   /protein_id="CAP91211.1"
FT                   /translation="MRTIEETRKRWDILFSDNDTPSDLRAALQSEHGGNLCNDGLRSVC
FT                   WKAFLLFDGLDKSEWAPKLDESRDAYRALRDHFLKYIEHPDDLESTVDPLADDEQSPWQ
FT                   TLRHDETLRAEILQDVDRCLQENFFFQEPDTKSKLTDILFVYSKLNPDVGYRQGMHELL
FT                   APILWAVDRDSVKPNLEDLDANKDKSEGLMRKLLDAQFVEHDAFTLFLSVMQTARIYYE
FT                   HGETRSANGQMDVIPIVDRCHYLHKEALTIIDHELAEHLEAVDVLPQIFLTRWMRLLFG
FT                   REVPFDDVLTMWDLLFAHGLRSDLVDFTCIAMLLRIRWQCWSACSIFHRIFIADMHHLV
FT                   LTADYTTALTLLLRYPSPQPHTTQSFVHDALYLEQNPTADRGSFIISKYSGRPPDAKFR
FT                   QQPSTRPTRKAFLWEDFKKRSGSNSPTGSPARNSPNSLESLFQDVSQGIQRRTETWGVA
FT                   KAVRGAVTEARKNMQTMNFDPNMRPVSSRPISAASASDIQSKAPMASTVASARLETKIN
FT                   LLEKRNQALATMLREALDDLGSQLANIKDLGSDTNSAVKQALVKAESVQVCLGDSSIPV
FT                   DPPLDPRVDGELNQLDELQETVTSTMGKEDDNVVANEGQSRTINPVKADTTGPKAESGT
FT                   NPTLDTASRTNSDRKESARAIRSRPTVRPSMTDSGFSWMLGGGRNLSGFVSSTSPPPEQ
FT                   TRHLDQTRGKPKPNALFGLSGDDNLGPDSEHSELALYSLRGSRDPLSGTGPL"
FT   exon            329148..329170
FT                   /gene="Pc13g01420"
FT                   /locus_tag="PCH_Pc13g01420"
FT                   /number=1
FT   intron          329171..329221
FT                   /gene="Pc13g01420"
FT                   /locus_tag="PCH_Pc13g01420"
FT                   /number=1
FT   exon            329222..329339
FT                   /gene="Pc13g01420"
FT                   /locus_tag="PCH_Pc13g01420"
FT                   /number=2
FT   intron          329340..329394
FT                   /gene="Pc13g01420"
FT                   /locus_tag="PCH_Pc13g01420"
FT                   /number=2
FT   exon            329395..329553
FT                   /gene="Pc13g01420"
FT                   /locus_tag="PCH_Pc13g01420"
FT                   /number=3
FT   intron          329554..329618
FT                   /gene="Pc13g01420"
FT                   /locus_tag="PCH_Pc13g01420"
FT                   /number=3
FT   exon            329619..330136
FT                   /gene="Pc13g01420"
FT                   /locus_tag="PCH_Pc13g01420"
FT                   /number=4
FT   intron          330137..330190
FT                   /gene="Pc13g01420"
FT                   /locus_tag="PCH_Pc13g01420"
FT                   /number=4
FT   exon            330191..331613
FT                   /gene="Pc13g01420"
FT                   /locus_tag="PCH_Pc13g01420"
FT                   /number=5
FT   mRNA            join(<332793..333062,333092..333261,333323..336288,
FT                   336367..>336617)
FT                   /gene="Pc13g01430"
FT                   /locus_tag="PCH_Pc13g01430"
FT   CDS_pept        join(332793..333062,333092..333261,333323..336288,
FT                   336367..336617)
FT                   /gene="Pc13g01430"
FT                   /locus_tag="PCH_Pc13g01430"
FT                   /note="unknown EC_number=2.7.-.-"
FT                   /note="Title: strong similarity to peroxisome assembly
FT                   factor Pex15 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91212"
FT                   /db_xref="GOA:B6H1Q8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q8"
FT                   /inference="similar to AA sequence:TREMBL:SCYOL044W.2"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP91212.1"
FT                   /translation="MGLGELVEVRSKEPGHHLTRIELTTHRALRKEGLGEQPGRESIFS
FT                   QAITATRQHMPGYASDRRDQLLDHLEASHFLGRPVKWKPRDAPIEVNLADQNLGEPSPL
FT                   SSPLGPLSESPESESGLHHLSLQTDRLRSSAGSVSSGYDPLSRSPLFENDHGIGPSGLD
FT                   RIRHNQPSRVLTLPNMSTSSLSLGPIPSQRPVPSPRSRSSSRAHTGHLSNRSFTDLEDL
FT                   HRFPLESLHSFSFAQQSEEFLHSRQNILKRSIDFMRDRMGWAASNAAIANAQANASGDT
FT                   EMQGMMELLARANMLETQENQIQGRGPITGPAEINGDNIFEKAFSDADSSPVSTRGGVQ
FT                   DSIPSGSHPSDGSQLLSPVPSDSISNQRRDLVSAPTSRRVSLKRTYTDLCSVSVRSKLM
FT                   ETLAQPYTSSADPFASLNSSTAGLGFQIPAPHAHSNKWTPASQAVFRTEAKEPWTILAA
FT                   NDLSCLIFGVLQSEVRRLSILEVVQKEHREWLKAKLRDPSTDAAARMPLQPERANISAV
FT                   NPKFRGLGNGVTAQLLSKPSSREKSRRAQTDDGYGSSTRNTRNNNHPANKSRGVLLCGD
FT                   VVPIQKRNGSRGSASVWVMEKRGGLIWVLEEITENVASIQCDDSWNVVSAKGAVEKIWG
FT                   PSVVQKGQSITDLLPCLPSDSLETSLEKGLAKIVELKHFAARTAAGVCIPVAVGKGEGD
FT                   RTLQVSSFPHVAGMMVLSSSSLNVISSNSVFSSVLFGQQRPEGLHITQLVPDFDEILDV
FT                   LTEEDNVPLVDGIVIPEHSFRRARTLSILRDGKANAASVFTEPSGLLAKHRDGSTIVVD
FT                   IQLRVVKSGTLFSKDKAEKSSDRSSDSDDSDDTIAVTELVYALWITYSRQLHAAGPAAG
FT                   LSPSSVPSSKPTSPTHDPDSVRPSDASAATQTADNSKAYVEIQTPTSTLSQQLSEAASE
FT                   PLAARPAQPVPPVSAANAKNDPPAKRTINDYVILEEMGQGAYGQVKLARLKKQPNKKMV
FT                   LKFVTKKRILVDTWTRDRRLGTVPLEIHVLDFLRRDGLKHPNIVEMEGFFEDDINYYIE
FT                   MTPHGLPGMDLFDYIELKANMDESECQNIFKQVASAVNHLHTKALVVHRDIKDENVVLD
FT                   GEGRIKLIDFGSAAYIKNGPFDVFVGTIVLQGRSYRGKEQDIWALGILLYTIVYKENPF
FT                   YNVDEILDHPLRIPFLPFSEDCIDLIRTMLDRDVDNRLTITEVLEHPWMVGA"
FT   exon            332793..333062
FT                   /gene="Pc13g01430"
FT                   /locus_tag="PCH_Pc13g01430"
FT                   /number=1
FT   intron          333063..333091
FT                   /gene="Pc13g01430"
FT                   /locus_tag="PCH_Pc13g01430"
FT                   /number=1
FT   exon            333092..333261
FT                   /gene="Pc13g01430"
FT                   /locus_tag="PCH_Pc13g01430"
FT                   /number=2
FT   intron          333262..333322
FT                   /gene="Pc13g01430"
FT                   /locus_tag="PCH_Pc13g01430"
FT                   /number=2
FT   exon            333323..336288
FT                   /gene="Pc13g01430"
FT                   /locus_tag="PCH_Pc13g01430"
FT                   /number=3
FT   intron          336289..336366
FT                   /gene="Pc13g01430"
FT                   /locus_tag="PCH_Pc13g01430"
FT                   /number=3
FT   exon            336367..336617
FT                   /gene="Pc13g01430"
FT                   /locus_tag="PCH_Pc13g01430"
FT                   /number=4
FT   mRNA            complement(join(<337055..337160,337310..337431,
FT                   337523..>337609))
FT                   /gene="Pc13g01440"
FT                   /locus_tag="PCH_Pc13g01440"
FT   CDS_pept        complement(join(337055..337160,337310..337431,
FT                   337523..337609))
FT                   /gene="Pc13g01440"
FT                   /locus_tag="PCH_Pc13g01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91213"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Q9"
FT                   /protein_id="CAP91213.1"
FT                   /translation="MPFSWYFLSASWVTLEYIVQYTLVSVYETNPLKAPIQGHPRGQVP
FT                   ERQVRFIFASFGLPRCPGVFAGGGIIPNCIELERSGEAQLLNLAYKVELGPIVMQTKPH
FT                   "
FT   exon            complement(337055..337160)
FT                   /gene="Pc13g01440"
FT                   /locus_tag="PCH_Pc13g01440"
FT                   /number=1
FT   mat_peptide     complement(join(337058..337160,337310..337431,
FT                   337523..337564))
FT                   /gene="Pc13g01440"
FT                   /locus_tag="PCH_Pc13g01440"
FT   intron          complement(337161..337309)
FT                   /gene="Pc13g01440"
FT                   /locus_tag="PCH_Pc13g01440"
FT                   /number=1
FT   exon            complement(337310..337431)
FT                   /gene="Pc13g01440"
FT                   /locus_tag="PCH_Pc13g01440"
FT                   /number=2
FT   intron          complement(337432..337522)
FT                   /gene="Pc13g01440"
FT                   /locus_tag="PCH_Pc13g01440"
FT                   /number=2
FT   exon            complement(337523..337609)
FT                   /gene="Pc13g01440"
FT                   /locus_tag="PCH_Pc13g01440"
FT                   /number=3
FT   sig_peptide     complement(337565..337609)
FT                   /gene="Pc13g01440"
FT                   /locus_tag="PCH_Pc13g01440"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            <338243..>340456
FT                   /gene="Pc13g01450"
FT                   /locus_tag="PCH_Pc13g01450"
FT   CDS_pept        338243..340456
FT                   /gene="Pc13g01450"
FT                   /locus_tag="PCH_Pc13g01450"
FT                   /note="Title: strong similarity to SCF ubiquitin ligase
FT                   (E3) F-box subunit FBL3 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91214"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R0"
FT                   /inference="similar to AA sequence:TREMBL:AF186273.1"
FT                   /inference="protein motif:PFAM:PF00646"
FT                   /protein_id="CAP91214.1"
FT                   /translation="MASQVSDDILPSPGNISPNSPTNSAGQIPLEQPPKLKGRQKLLQS
FT                   LQRMSSSPTLTRRGRSSSTTSYRRDNKASLSCVSLSSTSYSPCLGNGSSSHLYGGLNPR
FT                   PATPGCSSSPYEPQGTNARIRLMDTDGPGFTTPRTVPLPFDVRPASRGSPRTATPVGVK
FT                   VEKEVITPESQPARSLDFWGDMPQELKIEIFQYLTPQEIVCCSSVSKTWNEMCYDGQLW
FT                   SKVDTTEYYSKIPSDVLVKLITSGGPFVRDLNLRGCVQMREKWSTDGERISDLCRNVVK
FT                   FSLEGCRIDKASIYSFLLRNSRLEYINLSGLTSVTNSAMKVIARSCPQLETLNVSWCNH
FT                   VDTTGLLRIVRSCERLKDLRASEIRGFEDEKFTLALFERNTLDRLIMSRTDLTDSSLKM
FT                   LMHGDNPSMDILTDRPIVPPRKFRHLDLHHCPDVSDDGLKSLAHNVPDLEGLQISQCSD
FT                   LTDESVMNVISTTPKLSHLELEDLENLTNITLVQLAESPCAQNLEHLNISYCESLSDTG
FT                   MLRVMKNCPKLRSVEMDNTRVSDLTLMEASFRIRRRGYSDELPKVGLRLMIFDCANVTW
FT                   AGVREVLSSNAYIPRASRKPVSTVVTVTQTSDAGSSPETSTFVTPASSPSPSPAPTYPN
FT                   EVIQLKCFYGWQMTVDEHTKRVLRGDLTAASRLDRKWAEYMIATEEAGAAGAGARRRRR
FT                   RAREAERLYNEDEDENDGYGVGSISALGGRRRRAQSGSSCIVM"
FT   exon            338243..340456
FT                   /gene="Pc13g01450"
FT                   /locus_tag="PCH_Pc13g01450"
FT                   /number=1
FT   mRNA            complement(join(<342185..343461,343512..343604,
FT                   343659..344660,344712..>345261))
FT                   /gene="Pc13g01460"
FT                   /locus_tag="PCH_Pc13g01460"
FT   CDS_pept        complement(join(342185..343461,343512..343604,
FT                   343659..344660,344712..345261))
FT                   /gene="Pc13g01460"
FT                   /locus_tag="PCH_Pc13g01460"
FT                   /note="Title: strong similarity to polypeptide sequence
FT                   like protein An07g07260 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91215"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031488"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037593"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R1"
FT                   /protein_id="CAP91215.1"
FT                   /translation="MESAIRWSPTSSATEQRFLSVDVTGKSFRLCKVTGFDGNYIRHEV
FT                   LSTLSNVPGFRAFDWSTSNENLIAVGQSSGEATILRLDGDAKESLSFPVRNQRYCNAVA
FT                   FSTHGLVASGLDRVRNDFCLNIWDVNQRLSPAGGSRGFTEPLRKLASSEPITSIKFFRD
FT                   QPDTIVTGVKGQFVRIYDLREGPGNPSLQFPTRCVHNLAIDWLDENYIASCIPSNESTI
FT                   CVWDRRVGSRLTSPSMGSSASVADSGQATPALELKNVFHPKSSIWSLRFSRTNRGSLAA
FT                   LSSNGHFKNYDIAKDYLPEEYRSSIDETLGQGSSRNYPESVYTKHVRDVCVPFDNPTRS
FT                   YKEKDRVVCFDSLNLSLSPQPSAIALDGNGQPQIITARPPCAPVDLSSRSVLACGISSS
FT                   DSDVRSIHPLSEHISPISDLIGNIRSRVCSTSQEHGANSNGQLFVSKNLGFEPVPSHEN
FT                   RERVMALGVMGVPLTAKEALTLCTINQSRCKEGYLFDEARNRKVASDDQALQDFWGWVE
FT                   RARVGSSGTSMVVNGLDLNYLGVNSVWNNDLGKGFEQRCISAKKDDAKTVADAVATLAT
FT                   QLNLPETKGCDTAYPDHRRLCLRLCGATQSYRELEESVKNLSSEDQHTKAAALAVFQDE
FT                   PKLAYLGLRSNNPTQAHKLLAMAIAGASKGDNGTDWEDTCAEIAKELTDPYARAILALV
FT                   SKGDWNAVIKETTLPLKYRVEVALRWLPDDELTEYLKDATSQAIRQGDIEGVVLTGLGH
FT                   LAMGLFQSYIGKFNDVQTPVLAMSHTVPRFISNEKHIVQFEAWRETYRRQMNSWKLQLE
FT                   RARFDVGSRRFAVTADGRKLMPPPPQQVSLTCNYCTSPLTQHDASSQISPSTKSAEHVH
FT                   PTTGNPLAPTVMSGTVCPRCGRHMPRCGVCTLWLGSPDPMSRASIAADAEAGSREPTET
FT                   EVMRRFVVFCIHCNHGFHANHASDWFKRHKICPVAECNCICDR"
FT   exon            complement(342185..343461)
FT                   /gene="Pc13g01460"
FT                   /locus_tag="PCH_Pc13g01460"
FT                   /number=1
FT   intron          complement(343462..343511)
FT                   /gene="Pc13g01460"
FT                   /locus_tag="PCH_Pc13g01460"
FT                   /number=1
FT   exon            complement(343512..343604)
FT                   /gene="Pc13g01460"
FT                   /locus_tag="PCH_Pc13g01460"
FT                   /number=2
FT   intron          complement(343605..343658)
FT                   /gene="Pc13g01460"
FT                   /locus_tag="PCH_Pc13g01460"
FT                   /number=2
FT   exon            complement(343659..344660)
FT                   /gene="Pc13g01460"
FT                   /locus_tag="PCH_Pc13g01460"
FT                   /number=3
FT   intron          complement(344661..344711)
FT                   /gene="Pc13g01460"
FT                   /locus_tag="PCH_Pc13g01460"
FT                   /number=3
FT   exon            complement(344712..345261)
FT                   /gene="Pc13g01460"
FT                   /locus_tag="PCH_Pc13g01460"
FT                   /number=4
FT   mRNA            join(<345529..345943,346009..>346589)
FT                   /gene="Pc13g01470"
FT                   /locus_tag="PCH_Pc13g01470"
FT   CDS_pept        join(345529..345943,346009..346589)
FT                   /gene="Pc13g01470"
FT                   /locus_tag="PCH_Pc13g01470"
FT                   /note="Title: similarity to hypothetical protein
FT                   SPAC12G12.02 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91216"
FT                   /db_xref="GOA:B6H1R2"
FT                   /db_xref="InterPro:IPR019310"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R2"
FT                   /inference="similar to AA sequence:PIR:S62533"
FT                   /protein_id="CAP91216.1"
FT                   /translation="MSTDTRNQIDQSAPSKRKTRDGSEEVPPARKKVHRKANKADDQAQ
FT                   FVDFSKGDAAKPKVTRQFKDKFAPKPEKEYPSINDLKKRIRDVKRLLNKVDLPADARIL
FT                   QERALAGYEQDLADETARRERSSLIKKYHFVRFLDRKTATKELNRLTRREKEDLDSKQK
FT                   ARLAAKIHNCRVNLNYTIYYPLTEKYIALYPNGKHDTTDPESELQKQETKSNDAKPPLW
FT                   SVVEKCMEEKTLDLLREGKLYINANGEKIQSSSSGATTAANSQKEQSKKKEQKKETKAA
FT                   TQKDKYVSKDDKKSSKKEKTARNEKASKQHEASQQPNAEDEDDSDGGFFE"
FT   exon            345529..345943
FT                   /gene="Pc13g01470"
FT                   /locus_tag="PCH_Pc13g01470"
FT                   /number=1
FT   intron          345944..346008
FT                   /gene="Pc13g01470"
FT                   /locus_tag="PCH_Pc13g01470"
FT                   /number=1
FT   exon            346009..346589
FT                   /gene="Pc13g01470"
FT                   /locus_tag="PCH_Pc13g01470"
FT                   /number=2
FT   mRNA            complement(<347926..>349626)
FT                   /gene="Pc13g01480"
FT                   /locus_tag="PCH_Pc13g01480"
FT   CDS_pept        complement(347926..349626)
FT                   /gene="Pc13g01480"
FT                   /locus_tag="PCH_Pc13g01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91217"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R3"
FT                   /protein_id="CAP91217.1"
FT                   /translation="MACTVSGETAFIKQQEILRDRCSKALADHLKENPDVVWTPKDGRG
FT                   ERPSSSEEAAKLKLVVDVEFDEETGQPDFPPGNNRLSDELVYLVTKFMNARDLGRRYPY
FT                   DFDKMGNINPQRVPSGPAPIIWAHGLPFFPVYKGYYILCGRAHAGCIGWLLHEKTGEIM
FT                   QANPIWSVGAVVAPDSAVKAPRNITRQMTQHKPSGSEKNPGYRGKAWARDVVAAEHHLC
FT                   AVFPNLDSDEIEVCPMWNSWGYNVRCGPMRSGVKPTTMPKDFFTSHGIKNIDYESLARP
FT                   YGNHLMDEDEDSDDKDDPDGDVEVIDRAGESVEDASGSNQPIMTQSASQMDVDMNLVSL
FT                   LEVTKQVPAQSPGQHQEQVPEEQDAVRAPVQSPAAAAEKIKEGVKENVKEEAKEEVNEE
FT                   AMEKAIEVPVKQVTEETAKDSEIAPSDLEEKQLAVSNSTVDTELAMMTNIGDSIEQSNE
FT                   NPAPEQTSTAPVLLAETTIQATAIVQPIEVQPKIKQSEIEHAVTGTSDDNTHTIEPLKV
FT                   EQIAPDQPGTEQLDQTAASVLPEDLKVAGVPASNKTDASRSQAPAEVPM"
FT   exon            complement(347926..349626)
FT                   /gene="Pc13g01480"
FT                   /locus_tag="PCH_Pc13g01480"
FT                   /number=1
FT   mRNA            join(<351510..351668,351725..>352594)
FT                   /gene="Pc13g01490"
FT                   /locus_tag="PCH_Pc13g01490"
FT   CDS_pept        join(351510..351668,351725..352594)
FT                   /gene="Pc13g01490"
FT                   /locus_tag="PCH_Pc13g01490"
FT                   /note="unknown EC_number=2.7.-.-"
FT                   /note="Title: similarity to tRNA 2-phosphotransferase Tpt1
FT                   - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91218"
FT                   /db_xref="GOA:B6H1R4"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R4"
FT                   /inference="similar to AA sequence:PIR:S51897"
FT                   /inference="protein motif:PFAM:PF01885"
FT                   /inference="protein motif:COGS:COG1859"
FT                   /protein_id="CAP91218.1"
FT                   /translation="MDHPKNNKDKRGRGQGQSRDVQVSKALSLLLRHAAEKEGLKMNTQ
FT                   GYASVSDVLNWRKLKSLKVTFPEILHAVDSSDKKRFALLHIPSAQPTKSTTQATTTPAT
FT                   SPDAEHEAGSIVGEEQPATSVLESAPTTSEAQQSATDQALSVKDTDPSNFLIRATQGHS
FT                   IKTVDAASFLEPLSLSDESKLPDTVVHGTFHATWPAILQSGGLRCMGRNHVHFATGPSL
FT                   ESVLAVNAEDAARSKPKPDDSRVISGMRRDAQVLIYIDVRKALKAGVPFWRSENGVILS
FT                   EGIPVTKGEAEKGEAQKFVTLDFFDVVVERKVGLGKIWEHGEVLQGLPETLTNKGNPKG
FT                   RR"
FT   exon            351510..351668
FT                   /gene="Pc13g01490"
FT                   /locus_tag="PCH_Pc13g01490"
FT                   /number=1
FT   intron          351669..351724
FT                   /gene="Pc13g01490"
FT                   /locus_tag="PCH_Pc13g01490"
FT                   /number=1
FT   exon            351725..352594
FT                   /gene="Pc13g01490"
FT                   /locus_tag="PCH_Pc13g01490"
FT                   /number=2
FT   mRNA            join(<353298..353545,353612..354044,354099..>354299)
FT                   /gene="Pc13g01500"
FT                   /locus_tag="PCH_Pc13g01500"
FT   CDS_pept        join(353298..353545,353612..354044,354099..354299)
FT                   /gene="Pc13g01500"
FT                   /locus_tag="PCH_Pc13g01500"
FT                   /note="unknown EC_number=1.13.11.37"
FT                   /note="Title: strong similarity to hydroxyquinol
FT                   1,2-dioxygenase BAA82713.1 - Arthrobacter sp."
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91219"
FT                   /db_xref="GOA:B6H1R5"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039390"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R5"
FT                   /inference="similar to AA sequence:TREMBL:AB016258.2"
FT                   /inference="protein motif:PFAM:PF04444"
FT                   /inference="protein motif:PFAM:PF00775"
FT                   /inference="protein motif:COGS:COG3485"
FT                   /protein_id="CAP91219.1"
FT                   /translation="MATHRFDPTFTDNVINAMGPKTTPRVRKLMAGLIRHMHDYAREEE
FT                   LTVDEWMAGVQMLNWAGQMSDDKRNEGQLVCDVLGLESLVDEITFTLAGEAQDAPTATA
FT                   ILGPFFRADTPYRENGEDIVKTKPADAEMAFMHGRVMDFQTKQPLVGATVEVWQASTNG
FT                   LYEQQDPEQVEFNLRGKFKTDEDGRYSFYCLRPTPYPVPNDGPGGKLLELMDRHPFRPA
FT                   HIHIIATYDNYRPLTTQIFDRKDKYLDNDSVFAVKDSLVVDFVPRKDDPKAAIELEYDV
FT                   KLVKFEASTGGA"
FT   exon            353298..353545
FT                   /gene="Pc13g01500"
FT                   /locus_tag="PCH_Pc13g01500"
FT                   /number=1
FT   intron          353546..353611
FT                   /gene="Pc13g01500"
FT                   /locus_tag="PCH_Pc13g01500"
FT                   /number=1
FT   exon            353612..354044
FT                   /gene="Pc13g01500"
FT                   /locus_tag="PCH_Pc13g01500"
FT                   /number=2
FT   intron          354045..354098
FT                   /gene="Pc13g01500"
FT                   /locus_tag="PCH_Pc13g01500"
FT                   /number=2
FT   exon            354099..354299
FT                   /gene="Pc13g01500"
FT                   /locus_tag="PCH_Pc13g01500"
FT                   /number=3
FT   mRNA            complement(join(<354440..354816,354910..>355345))
FT                   /gene="Pc13g01510"
FT                   /locus_tag="PCH_Pc13g01510"
FT   CDS_pept        complement(join(354440..354816,354910..355345))
FT                   /gene="Pc13g01510"
FT                   /locus_tag="PCH_Pc13g01510"
FT                   /note="unknown EC_number=3.1.1.24"
FT                   /note="Title: similarity to 3-oxoadipate enol-lactone
FT                   hydrolase part of the dual specificity protein pcaL
FT                   -Rhodococcus opacus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91220"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R6"
FT                   /inference="similar to AA sequence:TREMBL:AF003947.5"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /inference="protein motif:COGS:COG0596"
FT                   /protein_id="CAP91220.1"
FT                   /translation="MPFVQANSHRLNYADSHPDGPPTPNSLTFFFIHGLGSSQNYYYPV
FT                   IPHLTKLHRCITLDTYGSARSPYTDETVTLPGIAEDVIGVMDTLHIQKAVVVGHSMGGI
FT                   VVTELGARCPERIQGVVAIGPTHPSDTLVTVMNKRSETVLESGIEPMANTIPFGAVGSR
FT                   STPLQKAFIRELILGQDPKGYAALCRAIATAKPADYAAVKAPFLLIAGDEDKSASMEGC
FT                   QHIFHHISSEQKSLEVLKRVGHWHCIEAADEVGGLIAKFGDVLKAVNA"
FT   exon            complement(354440..354816)
FT                   /gene="Pc13g01510"
FT                   /locus_tag="PCH_Pc13g01510"
FT                   /number=1
FT   intron          complement(354817..354909)
FT                   /gene="Pc13g01510"
FT                   /locus_tag="PCH_Pc13g01510"
FT                   /number=1
FT   exon            complement(354910..355345)
FT                   /gene="Pc13g01510"
FT                   /locus_tag="PCH_Pc13g01510"
FT                   /number=2
FT   mRNA            complement(<355779..>356756)
FT                   /gene="Pc13g01520"
FT                   /locus_tag="PCH_Pc13g01520"
FT   CDS_pept        complement(355779..356756)
FT                   /gene="Pc13g01520"
FT                   /locus_tag="PCH_Pc13g01520"
FT                   /note="unknown EC_number=3.1.1.24"
FT                   /note="Title: strong similarity to 3-oxoadipate
FT                   enol-lactone hydrolase like protein An07g07290 -Aspergillus
FT                   niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91221"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R7"
FT                   /protein_id="CAP91221.1"
FT                   /translation="MPDEPRRIILEKSKTVKRRYQRSNQRFQFTASQIARLDREEEREK
FT                   KAKKLREKEKKRIANKKRKAEQEAQAREERKRRGIPDPNAARVPSSQPLLSMFLGAGKR
FT                   QSPAAPEPAPTVTELESHDNNLESASGDTEAESDAFDDLDEVLENDLSEIQDSGVRKEL
FT                   QGQEIGTATRAPCKEDDEFSDCSAFDDEEIIKKAETAATTRTTDEETKKPSIPKESSYL
FT                   QSPPAVLALESSFGGSFQYDPADFLEAEAAIITQMSPPGMKDRSPPKDISLLQPPLSDR
FT                   PYSRPTLASSFGDSFRDETADWIEETFAHGNGDPFDELHKTLSQ"
FT   exon            complement(355779..356756)
FT                   /gene="Pc13g01520"
FT                   /locus_tag="PCH_Pc13g01520"
FT                   /number=1
FT   mRNA            complement(join(<357058..357583,357644..357825,
FT                   357884..357941,358001..358011,358072..>358143))
FT                   /gene="Pc13g01530"
FT                   /locus_tag="PCH_Pc13g01530"
FT   CDS_pept        complement(join(357058..357583,357644..357825,
FT                   357884..357941,358001..358011,358072..358143))
FT                   /gene="Pc13g01530"
FT                   /locus_tag="PCH_Pc13g01530"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig589.tfa_450wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91222"
FT                   /db_xref="GOA:B6H1R8"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R8"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /inference="protein motif:COGS:COG0656"
FT                   /protein_id="CAP91222.1"
FT                   /translation="MAPISLQSTYKLVSGYEIPVVGFGVYQTPSDVTEKVTRKAIELGY
FT                   RHVDSAKVYGNEKESAAAIRGSGLDRSKIFYTSKVPSKCMGYEKAKKAIEESIAAANLG
FT                   YIDLMLIHAPYGGKEDRLGTWRALVEAQKAGHVRSLGVSNFAIQHLEELEEYIKSGAGG
FT                   QITVGQYEIHPWCPREDIAEWLRKREIIVEAYSPLVQATRMKEPVLQNLAKKHGKTEAQ
FT                   ILVRWSLQKGYVPLPKSVTESRILENSQVFDFTLSDEDMASLQLNTYEPVCWDPVRDCK
FT                   I"
FT   exon            complement(357058..357583)
FT                   /gene="Pc13g01530"
FT                   /locus_tag="PCH_Pc13g01530"
FT                   /number=1
FT   intron          complement(357584..357643)
FT                   /gene="Pc13g01530"
FT                   /locus_tag="PCH_Pc13g01530"
FT                   /number=1
FT   exon            complement(357644..357825)
FT                   /gene="Pc13g01530"
FT                   /locus_tag="PCH_Pc13g01530"
FT                   /number=2
FT   intron          complement(357826..357883)
FT                   /gene="Pc13g01530"
FT                   /locus_tag="PCH_Pc13g01530"
FT                   /number=2
FT   exon            complement(357884..357941)
FT                   /gene="Pc13g01530"
FT                   /locus_tag="PCH_Pc13g01530"
FT                   /number=3
FT   intron          complement(357942..358000)
FT                   /gene="Pc13g01530"
FT                   /locus_tag="PCH_Pc13g01530"
FT                   /number=3
FT   exon            complement(358001..358011)
FT                   /gene="Pc13g01530"
FT                   /locus_tag="PCH_Pc13g01530"
FT                   /number=4
FT   intron          complement(358012..358071)
FT                   /gene="Pc13g01530"
FT                   /locus_tag="PCH_Pc13g01530"
FT                   /number=4
FT   exon            complement(358072..358143)
FT                   /gene="Pc13g01530"
FT                   /locus_tag="PCH_Pc13g01530"
FT                   /number=5
FT   mRNA            join(<358980..359057,359124..359612,359680..>360324)
FT                   /gene="Pc13g01540"
FT                   /locus_tag="PCH_Pc13g01540"
FT   CDS_pept        join(358980..359057,359124..359612,359680..360324)
FT                   /gene="Pc13g01540"
FT                   /locus_tag="PCH_Pc13g01540"
FT                   /note="Title: strong similarity to cell cycle factor pelota
FT                   - Drosophila melanogaster"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91223"
FT                   /db_xref="GOA:B6H1P1"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P1"
FT                   /inference="similar to AA sequence:PIR:T47122"
FT                   /inference="protein motif:PFAM:PF03463"
FT                   /inference="protein motif:PFAM:PF03464"
FT                   /inference="protein motif:PFAM:PF03465"
FT                   /inference="protein motif:COGS:COG1537"
FT                   /inference="protein motif:COGS:COG1503"
FT                   /protein_id="CAP91223.1"
FT                   /translation="MRCIKNKIEHNGSGAVTLCPEEPEDMWHAYNLIRPDDILRASAIR
FT                   RVTTVQDTGSTSSARVHLNLVIRVKNLDFDPQSSQLHVSGQIINETPHTKIGQFHTLDL
FT                   ELNRNFTLEKEIGAGGEGVGWDSIAIESLKDAVDEGGKRRAEAVAVVMQEGLAHICFIG
FT                   QFQTILKQKIEMSVPRKRQGGGDHDKGMNKFFKVTLETLIRQMEFNTSLTSGANNEAVR
FT                   PVLLASPGFVASGFQKYIQSEASTTTPGLKRLLPSLVVVHSASGYTNSLSEVLQSPAVK
FT                   RLLADTKYARETKLMDDFLEQLRKETNKATYGPREVEDAVEQGAVGRGGGVLIVSNRLF
FT                   RSQDVAERKRWVALVDRVRDVEGGDVRILSSDHESGKRLEGLGGIAALLTFPVIEPDLD
FT                   SDAE"
FT   exon            358980..359057
FT                   /gene="Pc13g01540"
FT                   /locus_tag="PCH_Pc13g01540"
FT                   /number=1
FT   intron          359058..359123
FT                   /gene="Pc13g01540"
FT                   /locus_tag="PCH_Pc13g01540"
FT                   /number=1
FT   exon            359124..359612
FT                   /gene="Pc13g01540"
FT                   /locus_tag="PCH_Pc13g01540"
FT                   /number=2
FT   intron          359613..359679
FT                   /gene="Pc13g01540"
FT                   /locus_tag="PCH_Pc13g01540"
FT                   /number=2
FT   exon            359680..360324
FT                   /gene="Pc13g01540"
FT                   /locus_tag="PCH_Pc13g01540"
FT                   /number=3
FT   mRNA            complement(join(<361079..362027,362106..>362344))
FT                   /gene="Pc13g01550"
FT                   /locus_tag="PCH_Pc13g01550"
FT   CDS_pept        complement(join(361079..362027,362106..362344))
FT                   /gene="Pc13g01550"
FT                   /locus_tag="PCH_Pc13g01550"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An18g05710 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01550"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91224"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P2"
FT                   /protein_id="CAP91224.1"
FT                   /translation="MSIILEDNQPPGFLRLGPTWYHEIPFLPHGWETTNDRGCGSLKHA
FT                   AMKAMLRDQSALKPELFEYVHWYMAEYLWDALKRCNKQTMHMWKIMASVYPVQFYKVSP
FT                   YYCLSAGCPKKPLRDYMGILNSEDFRWRAILTIATTYCTATDLTTIPNIKNLVALDVHN
FT                   EPYTSNNAPLHPVGVNNDGLLLQDGFVRGWIESKALRHLRILRFYHQHEMTVASLAALR
FT                   ELPELQLVVAYECKKITETIQKYDKPANGVIPVKGWSACRLDWFWENHGTSKTIDDNLL
FT                   ALHHVYQSSLQTPGEDSRRPSSLPTNLPILEFKLPTVDHSKRDRVVVRSRYNAKSIVLF
FT                   TRDPVKQKLDIKKQQRAREKKKRTEPPEKGDHPAKRAVMKERGPMDISETLNQFF"
FT   exon            complement(361079..362027)
FT                   /gene="Pc13g01550"
FT                   /locus_tag="PCH_Pc13g01550"
FT                   /number=1
FT   intron          complement(362028..362105)
FT                   /gene="Pc13g01550"
FT                   /locus_tag="PCH_Pc13g01550"
FT                   /number=1
FT   exon            complement(362106..362344)
FT                   /gene="Pc13g01550"
FT                   /locus_tag="PCH_Pc13g01550"
FT                   /number=2
FT   mRNA            complement(join(<363998..365220,365274..>365901))
FT                   /gene="Pc13g01560"
FT                   /locus_tag="PCH_Pc13g01560"
FT   CDS_pept        complement(join(363998..365220,365274..365901))
FT                   /gene="Pc13g01560"
FT                   /locus_tag="PCH_Pc13g01560"
FT                   /note="Title: strong similarity to polyamine transport
FT                   protein Tpo4 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01560"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91225"
FT                   /db_xref="GOA:B6H1P3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P3"
FT                   /inference="similar to AA sequence:PIR:S67175"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP91225.1"
FT                   /translation="MQSFLQHRVLRRKLEQQFVTKHEKPENVWTHEGQYGYREGEIYTH
FT                   PRERSDDLAAERRREHGRRTFISGPSLQPRHSAASHLGREGDIEGAEYDPDLSTDPHTI
FT                   NSAETLGNTPDIMVTGVERPRPGFSTDSESDIESVKRNKLVVVTFEGEDDEMDPHNWTL
FT                   RRRMLVTLLTALMGCVIFWSSTIDTTALPKTRKVYHTSFEVQTLPTAMFLIGCGVGALI
FT                   TAPISEVIGRNPVYIPTMIGFMLFNTGAGLAQTIVQRVVCRGLAGFFGSAPAVLSAATL
FT                   VDVWSRIERVYAFPIYSIIIFIGPIVGPTPGSFAVDAESVSWRWVDWMTIIFAGLVLIP
FT                   VVLFLPESYSPILLYWKAQELRRLTGDDRYRSPLEFRKATFAHRLRASLYRPLLLFATE
FT                   PIILIHSVYLTVLFMILYTFLAGYVSIYHMASHFSPTSTALAFLGILVGVLLSLLILPI
FT                   SMWLLRREIYRSRRRGEHRPDPEISLYMAMFGAPAVPISLFWMGWTAELEFSYWSPLVA
FT                   SVFYGFGTVCIFVSGYQYVSDAFESHATSALSSLQMTRLVGAGAMVIVAEIMYTNLGVG
FT                   WTLTLWGCLSALFTPVPYLLYWRGYNLRQRSWYARRHEHD"
FT   exon            complement(363998..365220)
FT                   /gene="Pc13g01560"
FT                   /locus_tag="PCH_Pc13g01560"
FT                   /number=1
FT   intron          complement(365221..365273)
FT                   /gene="Pc13g01560"
FT                   /locus_tag="PCH_Pc13g01560"
FT                   /number=1
FT   exon            complement(365274..365901)
FT                   /gene="Pc13g01560"
FT                   /locus_tag="PCH_Pc13g01560"
FT                   /number=2
FT   mRNA            join(<366808..366824,366932..366944,367071..367200,
FT                   367273..367429,367492..>367654)
FT                   /gene="Pc13g01570"
FT                   /locus_tag="PCH_Pc13g01570"
FT   CDS_pept        join(366808..366824,366932..366944,367071..367200,
FT                   367273..367429,367492..367654)
FT                   /gene="Pc13g01570"
FT                   /locus_tag="PCH_Pc13g01570"
FT                   /EC_number="3.6.3.6"
FT                   /note="Title: strong similarity to H+-transporting ATPase
FT                   lipid-binding protein vma3 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01570"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91226"
FT                   /db_xref="GOA:B6H1P4"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P4"
FT                   /inference="similar to AA sequence:PIR:S43893"
FT                   /inference="protein motif:PFAM:PF00137"
FT                   /inference="protein motif:COGS:COG0636"
FT                   /protein_id="CAP91226.1"
FT                   /translation="MVSELCPVYAPFIGSMGCVCAIVFTCFGAAYGTAKAGVGVCSTAV
FT                   LRPDLVVKNIVPVVMAGIIGIYGLVVSVLVANDLKQNIPLYTGLVQLCTGLSVGLAGLA
FT                   SGFAIGVVGDAGVRGTAQQPRLYVGMILILIFAEVLGKNEIITAGLTQNEKLIRA"
FT   exon            366808..366824
FT                   /gene="Pc13g01570"
FT                   /locus_tag="PCH_Pc13g01570"
FT                   /number=1
FT   intron          366825..366931
FT                   /gene="Pc13g01570"
FT                   /locus_tag="PCH_Pc13g01570"
FT                   /number=1
FT   exon            366932..366944
FT                   /gene="Pc13g01570"
FT                   /locus_tag="PCH_Pc13g01570"
FT                   /number=2
FT   intron          366945..367070
FT                   /gene="Pc13g01570"
FT                   /locus_tag="PCH_Pc13g01570"
FT                   /number=2
FT   exon            367071..367200
FT                   /gene="Pc13g01570"
FT                   /locus_tag="PCH_Pc13g01570"
FT                   /number=3
FT   intron          367201..367272
FT                   /gene="Pc13g01570"
FT                   /locus_tag="PCH_Pc13g01570"
FT                   /number=3
FT   exon            367273..367429
FT                   /gene="Pc13g01570"
FT                   /locus_tag="PCH_Pc13g01570"
FT                   /number=4
FT   intron          367430..367491
FT                   /gene="Pc13g01570"
FT                   /locus_tag="PCH_Pc13g01570"
FT                   /number=4
FT   exon            367492..367654
FT                   /gene="Pc13g01570"
FT                   /locus_tag="PCH_Pc13g01570"
FT                   /number=5
FT   mRNA            complement(join(<368410..369047,369101..369510,
FT                   369630..>369949))
FT                   /gene="Pc13g01580"
FT                   /locus_tag="PCH_Pc13g01580"
FT   CDS_pept        complement(join(368410..369047,369101..369510,
FT                   369630..369949))
FT                   /exception="reasons given in citation"
FT                   /gene="Pc13g01580"
FT                   /locus_tag="PCH_Pc13g01580"
FT                   /note="putative sequencing error"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPCC1840.04 - Schizosaccharomyces pombe [putative
FT                   sequencing error]"
FT                   /db_xref="GOA:B6H1T6"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T6"
FT                   /inference="similar to AA sequence:PIR:T41172"
FT                   /inference="protein motif:PFAM:PF00656"
FT                   /inference="protein motif:COGS:COG4249"
FT                   /protein_id="CAP91227.1"
FT                   /translation="VMETRKTKLGEDHPDTLTSMANLASTYRNQGRWEEAEQLFVXVIE
FT                   TRKTKLGEDHPDTLTSMANLASTYRNXGRWEEAEQLFIXVIETRKTKLSEDHPDTLTSI
FT                   ANLASTYRNXGRWEEAEQLEVXVIETRKTKLGEDHPDTLTSMANLASTFIRASGKRPNS
FT                   SRCRLETRKTKLGEDHPDTLTSMANLASTYRNQGRWKEAEQLEVXVIETCKTKLGEDYP
FT                   DTLTSMANLVVTFSNQGRWEEAEXLEVQVMETSKIKLGEDHPDTLTSMANLAVTFSNRG
FT                   RWEEAEQLFVXVIETSKTKLGEDHPDTLTSMANLAVTYSNQGREXEAEQLFVXVIETRK
FT                   TKLGEDHPDTLTSMANLASTFYNQGRWEEAEXLNVQVMETRKTKLGEDHPDTLTSMANL
FT                   AFTWKSSGHDAEARSLLRECLTKQKQTLGLNHHTTLSNSETLLAWETEGEWQTDEESGS
FT                   DTEY"
FT   exon            complement(368410..369047)
FT                   /gene="Pc13g01580"
FT                   /locus_tag="PCH_Pc13g01580"
FT                   /number=1
FT   intron          complement(369048..369100)
FT                   /gene="Pc13g01580"
FT                   /locus_tag="PCH_Pc13g01580"
FT                   /number=1
FT   exon            complement(369101..369510)
FT                   /gene="Pc13g01580"
FT                   /locus_tag="PCH_Pc13g01580"
FT                   /number=2
FT   intron          complement(369511..369629)
FT                   /gene="Pc13g01580"
FT                   /locus_tag="PCH_Pc13g01580"
FT                   /number=2
FT   exon            complement(369630..369949)
FT                   /gene="Pc13g01580"
FT                   /locus_tag="PCH_Pc13g01580"
FT                   /number=3
FT   mRNA            complement(join(<371064..371167,371242..371903,
FT                   371963..372335,372397..372733,372806..372972,
FT                   373055..>373100))
FT                   /gene="Pc13g01590"
FT                   /locus_tag="PCH_Pc13g01590"
FT   CDS_pept        complement(join(371064..371167,371242..371903,
FT                   371963..372335,372397..372733,372806..372972,
FT                   373055..373100))
FT                   /gene="Pc13g01590"
FT                   /locus_tag="PCH_Pc13g01590"
FT                   /note="Title: strong similarity to component of
FT                   chaperonin-containing T-complex Cct7 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01590"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91228"
FT                   /db_xref="GOA:B6H1R9"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012720"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R9"
FT                   /inference="similar to AA sequence:PIR:S53376"
FT                   /inference="protein motif:PFAM:PF00118"
FT                   /inference="protein motif:COGS:COG0459"
FT                   /protein_id="CAP91228.1"
FT                   /translation="MAFNGQTPTIVVLKEGTDASQGKGQIISNINACVAVQGTVKSTLG
FT                   PYGGDLLLVDANGRQTITNDGATVMKLLDIVHPAARILTDIARSQDAEVGDGTTSVVVL
FT                   AGEILKEVRDLVEQGVSSQTIIKGLRRASAMAVNKVKEIAVDMMDASVSQEKKVETLRR
FT                   LAATAMNSKLIKRNSDFFTKMVVDAVLSLDQDDLNERLIGVKKVTGGGLQDSLFVDGVA
FT                   FKKTFSYAGFEQQPKHFENPSIVCLNVELELKSEKDNAEVRVEQVSEYQAIVDAEWQII
FT                   FNKLEAIYKTGAKVVLSKLPIGDLATQYFADRDIFCAGRVASDDMDRVCQATGAATQST
FT                   CTDIQARHLGTCGAFEERQIGGERFNLFSDCPRAKTCTLVLRGGAEQFIAEVERSLHDA
FT                   IMIVKRALRNTTIVAGGGATEMELSSYMHGFADRNVPHKQQAVVKAFAKALEVIPRQLC
FT                   DNAGFDATDILNRLRVEHRKGNTWAGVDFDKEGVRDNMVAFVWEPSLVKVNAIQAAVEA
FT                   SCLILSVDETIKNEESAQPGQQRGMPPGAAQRALRGRGRGMPRRG"
FT   exon            complement(371064..371167)
FT                   /gene="Pc13g01590"
FT                   /locus_tag="PCH_Pc13g01590"
FT                   /number=1
FT   intron          complement(371168..371241)
FT                   /gene="Pc13g01590"
FT                   /locus_tag="PCH_Pc13g01590"
FT                   /number=1
FT   exon            complement(371242..371903)
FT                   /gene="Pc13g01590"
FT                   /locus_tag="PCH_Pc13g01590"
FT                   /number=2
FT   intron          complement(371904..371962)
FT                   /gene="Pc13g01590"
FT                   /locus_tag="PCH_Pc13g01590"
FT                   /number=2
FT   exon            complement(371963..372335)
FT                   /gene="Pc13g01590"
FT                   /locus_tag="PCH_Pc13g01590"
FT                   /number=3
FT   intron          complement(372336..372396)
FT                   /gene="Pc13g01590"
FT                   /locus_tag="PCH_Pc13g01590"
FT                   /number=3
FT   exon            complement(372397..372733)
FT                   /gene="Pc13g01590"
FT                   /locus_tag="PCH_Pc13g01590"
FT                   /number=4
FT   intron          complement(372734..372805)
FT                   /gene="Pc13g01590"
FT                   /locus_tag="PCH_Pc13g01590"
FT                   /number=4
FT   exon            complement(372806..372972)
FT                   /gene="Pc13g01590"
FT                   /locus_tag="PCH_Pc13g01590"
FT                   /number=5
FT   intron          complement(372973..373054)
FT                   /gene="Pc13g01590"
FT                   /locus_tag="PCH_Pc13g01590"
FT                   /number=5
FT   exon            complement(373055..373100)
FT                   /gene="Pc13g01590"
FT                   /locus_tag="PCH_Pc13g01590"
FT                   /number=6
FT   mRNA            complement(join(<373552..374610,374664..>375161))
FT                   /gene="Pc13g01600"
FT                   /locus_tag="PCH_Pc13g01600"
FT   CDS_pept        complement(join(373552..374610,374664..375161))
FT                   /gene="Pc13g01600"
FT                   /locus_tag="PCH_Pc13g01600"
FT                   /note="Title: strong similarity to regulator protein Spt10
FT                   - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01600"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91229"
FT                   /db_xref="GOA:B6H1S0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR015416"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S0"
FT                   /inference="similar to AA sequence:PIR:S47865"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /inference="protein motif:COGS:COG1247"
FT                   /inference="protein motif:COGS:COG0454"
FT                   /inference="protein motif:COGS:COG1670"
FT                   /protein_id="CAP91229.1"
FT                   /translation="MSEVHGDSELVPSGPDLDYPLALAPRQVTLRDRVTVATLVPFASA
FT                   EEVPRALMKYLSDQFNKEIEKGDTYAMTEPIPLAQFGRYWFSNFGVVMLTGDIESAEQT
FT                   HAMDRAGANWTKICLGGFHIRPNYPGRSSHVCNGTFIVTDAARNKGVGRLMGESYLEWA
FT                   PRLGYTYAVFNLVYESNVASCRLWDSLGFKRIGRVPGGGSIKSQPGEFVDAIIYGRGLS
FT                   LDGEDSVSQDRFEKIRYYLKHGKYPRGADRAEKSRLRSAATHYKLLGGEDGEPERLMLK
FT                   DKEVVSDPQQQYDIAQEVHLKQHAGINKTTAAIAIKYHWVRIKETVNRVIRDCPQCKET
FT                   LKSPPIPGTKDDDKSPSETMSGMDMNSTMEQPPKEPVNDPQAMDEAPDEPPSYNPLMHQ
FT                   PIPAAMPGTVHPMAGFAPMPLDPQIMQLQQQLRRYQQQNPMAGQFAPGPHNLGMSSFDD
FT                   AMRYHTASNAYQMMVDDGSDPFRQDVLGLVNPPAHELQHDAELLAKFEYGNPSDGNYDF
FT                   T"
FT   exon            complement(373552..374610)
FT                   /gene="Pc13g01600"
FT                   /locus_tag="PCH_Pc13g01600"
FT                   /number=1
FT   intron          complement(374611..374663)
FT                   /gene="Pc13g01600"
FT                   /locus_tag="PCH_Pc13g01600"
FT                   /number=1
FT   exon            complement(374664..375161)
FT                   /gene="Pc13g01600"
FT                   /locus_tag="PCH_Pc13g01600"
FT                   /number=2
FT   mRNA            join(<375897..376709,376766..376779,376838..>377646)
FT                   /gene="Pc13g01610"
FT                   /locus_tag="PCH_Pc13g01610"
FT   CDS_pept        join(375897..376709,376766..376779,376838..377646)
FT                   /exception="reasons given in citation"
FT                   /gene="Pc13g01610"
FT                   /locus_tag="PCH_Pc13g01610"
FT                   /note="putative sequencing error"
FT                   /note="Title: strong similarity to lanthionine synthase
FT                   C-like protein like protein An18g05780 - Aspergillus niger
FT                   [putative sequencing error]"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S1"
FT                   /inference="protein motif:PFAM:PF05147"
FT                   /protein_id="CAP91230.1"
FT                   /translation="MSPKVTSRRALNSKLGIYVDXSGCDQNVSFRRTGWSPLSVFLIQV
FT                   SQFYCDRRAQILSTYAXDRIVFSRIFRGSTDATVFENFIAQLLALRKPVPKPVLVMDNA
FT                   SFRYSERIAHICVDVGVKLVYLPPYSPDLNPIQEFSAELKAFINDTKVVVNTDQGFITF
FT                   LGWCIDVVGAKEESAMGHFRHECLTIEAKGWK"
FT   exon            375897..376709
FT                   /gene="Pc13g01610"
FT                   /locus_tag="PCH_Pc13g01610"
FT                   /number=1
FT   intron          376710..376765
FT                   /gene="Pc13g01610"
FT                   /locus_tag="PCH_Pc13g01610"
FT                   /number=1
FT   exon            376766..376779
FT                   /gene="Pc13g01610"
FT                   /locus_tag="PCH_Pc13g01610"
FT                   /number=2
FT   intron          376780..376837
FT                   /gene="Pc13g01610"
FT                   /locus_tag="PCH_Pc13g01610"
FT                   /number=2
FT   exon            376838..377646
FT                   /gene="Pc13g01610"
FT                   /locus_tag="PCH_Pc13g01610"
FT                   /number=3
FT   mRNA            join(<377961..378150,378214..>380636)
FT                   /gene="Pc13g01620"
FT                   /locus_tag="PCH_Pc13g01620"
FT   CDS_pept        join(377961..378150,378214..380636)
FT                   /gene="Pc13g01620"
FT                   /locus_tag="PCH_Pc13g01620"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An18g05800 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91231"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S2"
FT                   /protein_id="CAP91231.1"
FT                   /translation="MDLIPPSYESATDRDAWTIIARYIPSSDLCAASLVCHRWHGLFMP
FT                   FLWGDPASHFGTDNDAVYVALTRFRRTLKYARQEVRALTHTIHLPPALSEIYGGPRPGW
FT                   LRDILECLPCLQCLMVSKLPFFDHHAMTALKTNERSSHYNIRLLLAEREPNTTSASLAQ
FT                   TLLLFPVLTYLDLSYTTPARDRNVLSTLAQMPFLRVLKLRGIGLKDNDAEFLADAIGQR
FT                   VRCLDLRDNMLTDIAICSLLQKSFLPTSERERQQSPRPATASPDPFSHSAINESDSDFF
FT                   KRPDLDEQFAKLLAQPVLFHPWVEDLPYMGITHLYITGNRISLEAVASLLRSSRLHALD
FT                   FGTIKPPDKAHHTHPYGKEEYPGAETLVPVLGKIAGDNLTYLRAHHAVLTGQPQTQDAV
FT                   SDDEFLPELSAQESLREVEQFELDASQQVYELSEETRPVFELADTSTTESTGSYSTTKG
FT                   LKTSQMLTAHEDEPTPSVRRGPAFAPEVVQPIPIHSSANGGTAFAVSRTGTWNTEQTEG
FT                   STLPSISMSLDCDKLATDFSLQATLQCSSPISTNDSLEQKVQELLSKRPRNQSIPLQGG
FT                   KESWFPYLHPSHIPHMESLVLTDVPSHVTPNSSILSALTRFITACSNEALLATLQAGSD
FT                   YSLPPGRARMQAEQQRSRSLFGLRRLILEITPVDSTKLTSWKPANQYNATGHSSTGDRD
FT                   SENLWSAAANDFSFFGEEECGVPENDPGKYFPMAVLNEKVSLMPMEDDSLHSPDSPRLG
FT                   RHLPRSPQTPGPPMTAEDRKQQCQASMIDLVAELAAFRRGKKAEYERVVRRERERRSTL
FT                   GTGASGLLMPSSPHISLSHYVEGHWKGEVKIVRNPVPKVRTGTVDMYGNYFEKGYLYP"
FT   exon            377961..378150
FT                   /gene="Pc13g01620"
FT                   /locus_tag="PCH_Pc13g01620"
FT                   /number=1
FT   intron          378151..378213
FT                   /gene="Pc13g01620"
FT                   /locus_tag="PCH_Pc13g01620"
FT                   /number=1
FT   exon            378214..380636
FT                   /gene="Pc13g01620"
FT                   /locus_tag="PCH_Pc13g01620"
FT                   /number=2
FT   mRNA            complement(join(<381011..381116,381182..381284,
FT                   381400..381527,381731..>381753))
FT                   /gene="Pc13g01630"
FT                   /locus_tag="PCH_Pc13g01630"
FT   CDS_pept        complement(join(381011..381116,381182..381284,
FT                   381400..381527,381731..381753))
FT                   /gene="Pc13g01630"
FT                   /locus_tag="PCH_Pc13g01630"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the small subunit S26 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01630"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91232"
FT                   /db_xref="GOA:B6H1S3"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="InterPro:IPR038551"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S3"
FT                   /inference="similar to AA sequence:PIR:T50824"
FT                   /inference="protein motif:PFAM:PF01283"
FT                   /inference="protein motif:COGS:COG4830"
FT                   /protein_id="CAP91232.1"
FT                   /translation="MVKKRANNGRNKNGRGHVKPVRCSNCARCTPKDKAIKRFTIRNMV
FT                   ESAAIRDISEASVFAEYSVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRIRFN
FT                   KDGKKLQPPTAAKAL"
FT   exon            complement(381011..381116)
FT                   /gene="Pc13g01630"
FT                   /locus_tag="PCH_Pc13g01630"
FT                   /number=1
FT   intron          complement(381117..381181)
FT                   /gene="Pc13g01630"
FT                   /locus_tag="PCH_Pc13g01630"
FT                   /number=1
FT   exon            complement(381182..381284)
FT                   /gene="Pc13g01630"
FT                   /locus_tag="PCH_Pc13g01630"
FT                   /number=2
FT   intron          complement(381285..381399)
FT                   /gene="Pc13g01630"
FT                   /locus_tag="PCH_Pc13g01630"
FT                   /number=2
FT   exon            complement(381400..381527)
FT                   /gene="Pc13g01630"
FT                   /locus_tag="PCH_Pc13g01630"
FT                   /number=3
FT   intron          complement(381528..381730)
FT                   /gene="Pc13g01630"
FT                   /locus_tag="PCH_Pc13g01630"
FT                   /number=3
FT   exon            complement(381731..381753)
FT                   /gene="Pc13g01630"
FT                   /locus_tag="PCH_Pc13g01630"
FT                   /number=4
FT   mRNA            join(<382422..382472,382550..383423,383476..383570,
FT                   383625..>384452)
FT                   /gene="Pc13g01640"
FT                   /locus_tag="PCH_Pc13g01640"
FT   CDS_pept        join(382422..382472,382550..383423,383476..383570,
FT                   383625..384452)
FT                   /gene="Pc13g01640"
FT                   /locus_tag="PCH_Pc13g01640"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   SPAC24C9.05c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01640"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91233"
FT                   /db_xref="GOA:B6H1S4"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S4"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /inference="protein motif:PFAM:PF00564"
FT                   /inference="protein motif:COGS:COG0517"
FT                   /protein_id="CAP91233.1"
FT                   /translation="MSAASSRQRQNQSKRDEAIRRKMEADLSKKRNAPAKSRNSRKAPP
FT                   GTVLALKPSQALQIKPSMSIAEAAQLMAAKREDCVLVTDDNERIAGIFTAKDLAFRVVG
FT                   LGLKAREVSVAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITK
FT                   CFYDAMEKLERAYSSSRKLYDALEGVQTELGSSQPQQVIQYVEALRSKMSGPTLETVLD
FT                   GLPPVTVSVRTTVKDAAALMKENHTTALLVQDQGSITGIFTSKDIVLRVIAPGLDPSTC
FT                   SVVRVMTPHPDFAPSDMSIQAALRKMHDGHYLNLPVMNEGGEIVGMVDVLKLTYATLEQ
FT                   INTMSTQDDEGPAWNKFWLSMDHESDSMVSGGHSQQLNTPHRSVMSPDLARSGYDNSLL
FT                   PNDSASHHGDEHSEVISQHHPAEPAAPTPFPFKFKAPGGRVHRVNVLTTNGVTDLVSQV
FT                   TAKLGKEVEAVGGEPTVEEGRLSNTGYALSYMDNEGDTVSITTDQDMTDAIDLARRTHR
FT                   DKVNLFVHDPAQPPIPAPVEPQHVKIVTPIEEQSVVEESASQESPVSKALPQQQAVPAH
FT                   APEEQLIAGVPNDLLLPGAIVTLAAVIAGVFILSRPSGR"
FT   exon            382422..382472
FT                   /gene="Pc13g01640"
FT                   /locus_tag="PCH_Pc13g01640"
FT                   /number=1
FT   intron          382473..382549
FT                   /gene="Pc13g01640"
FT                   /locus_tag="PCH_Pc13g01640"
FT                   /number=1
FT   exon            382550..383423
FT                   /gene="Pc13g01640"
FT                   /locus_tag="PCH_Pc13g01640"
FT                   /number=2
FT   intron          383424..383475
FT                   /gene="Pc13g01640"
FT                   /locus_tag="PCH_Pc13g01640"
FT                   /number=2
FT   exon            383476..383570
FT                   /gene="Pc13g01640"
FT                   /locus_tag="PCH_Pc13g01640"
FT                   /number=3
FT   intron          383571..383624
FT                   /gene="Pc13g01640"
FT                   /locus_tag="PCH_Pc13g01640"
FT                   /number=3
FT   exon            383625..384452
FT                   /gene="Pc13g01640"
FT                   /locus_tag="PCH_Pc13g01640"
FT                   /number=4
FT   mRNA            join(<385192..385374,385506..385728,385799..385974,
FT                   386028..386459,386513..388578,388633..>388840)
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT   CDS_pept        join(385192..385374,385506..385728,385799..385974,
FT                   386028..386459,386513..388578,388633..388840)
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT                   /note="Title: strong similarity to protein secretion
FT                   enhancer Pse-1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01650"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91234"
FT                   /db_xref="GOA:B6H1S5"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="InterPro:IPR040928"
FT                   /db_xref="InterPro:IPR041389"
FT                   /db_xref="InterPro:IPR041653"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S5"
FT                   /inference="similar to AA sequence:TREMBL:S45357.1"
FT                   /inference="protein motif:COGS:COG5215"
FT                   /inference="protein motif:COGS:COG5032"
FT                   /protein_id="CAP91234.1"
FT                   /translation="MSLLPPEIHTALSQLLSALGTPDNAVRSQAEDQLNNDWVQNRPDV
FT                   LLMGLAEQLGGATDTITRAFAAVLFRRIATKTRKDPATGDNKEIFSSLPSEQRIAIREK
FT                   LVVCLTSETVTDVRKKIGDTLAEVARQYTDNDEQWPELLGVLFQASQSPDSGVRETAYR
FT                   VFTTTPGIIEKQHEDAVVEVFTKGFKDDNISVRISAMEAFASLFRSISKKSQPKFFGLM
FT                   PDLLNILPPLKESSESEELSSALLALVELAEISPKMFKPMFNNLVKFSISVVGDKELSD
FT                   QVRQNALELMATFADYAPNMCKKEPEFAQEMVTQCLSLMTDVGADDDDAEEWNASEDLE
FT                   PEENDLNHIAGEQCMDRLANKLGGQAILQPAFSWIPRMMSSTNWRDRHAALMAISAISE
FT                   GCRDLMVGELDQVLALVVPALQDPHPRVRYAGCNALGQMSTDFAGTMQEKYHEIVLTNI
FT                   IPVLASTEPRVQSHAAAALVNFCEEAERSTLEPYLGNLLSHLLELLRSPKRYLQEQALS
FT                   TIATIADSAEAAFDQYYTTLMPLLLNVLKEEQGKEYRLLRAKAMECATLIALAVGKEKM
FT                   GQDALNLVQILGHIQQNIVDADDPQSQYLLHCWGRMCRVLGQDFVPYLPGVMPPLLTVA
FT                   AAKADIQLLDDEDQIEQVEQDEGWELVPLKGKIIGIKTSALEDKNTAIELITIYAQILE
FT                   QNFEPYVLETMEKIAVPGLAFFFHDPVRVSAAKLIPQLLNSYKKAHGGQSPGFAEMWNK
FT                   VAEKIIEVLSAEPTVDTLAEMYQCFYESVEVVGRNSLTPQHLQAFIESAKSTLEDYQMR
FT                   VKQRLEEQAELEDGDEENLDFEYAVEDDQNLLSDMNKAFHTIFKSQGNSFLPTWQQLIP
FT                   FYDAFITSQDPTQRQWALCIMDDVLEFCGEESWAFKDHIMQPLASGLRDENAANRQAAA
FT                   YGVGVAAQKGGAAWSDFVAASLPSLFQVTQHAQSRTEENVFATENASASIAKILHYNPS
FT                   KVQAPQDVVTNWIETLPITYDEEAAPYAYSFIAQLIDQQNPAVFAKADRVFGFIVQALE
FT                   AATLQGQTAARVATSAKQLVAVTGANADQILASVDPASQERVRKFFQ"
FT   sig_peptide     385192..385251
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            385192..385374
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT                   /number=1
FT   mat_peptide     join(385252..385374,385506..385728,385799..385974,
FT                   386028..386459,386513..388578,388633..388837)
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT   intron          385375..385505
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT                   /number=1
FT   exon            385506..385728
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT                   /number=2
FT   intron          385729..385798
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT                   /number=2
FT   exon            385799..385974
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT                   /number=3
FT   intron          385975..386027
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT                   /number=3
FT   exon            386028..386459
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT                   /number=4
FT   intron          386460..386512
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT                   /number=4
FT   exon            386513..388578
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT                   /number=5
FT   intron          388579..388632
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT                   /number=5
FT   exon            388633..388840
FT                   /gene="Pc13g01650"
FT                   /locus_tag="PCH_Pc13g01650"
FT                   /number=6
FT   mRNA            complement(join(<389102..389456,389534..389906,
FT                   390005..>390233))
FT                   /gene="Pc13g01660"
FT                   /locus_tag="PCH_Pc13g01660"
FT   CDS_pept        complement(join(389102..389456,389534..389906,
FT                   390005..390233))
FT                   /gene="Pc13g01660"
FT                   /locus_tag="PCH_Pc13g01660"
FT                   /note="Title: weak similarity to phenylcoumaran benzylic
FT                   ether reductase PT1 - Pinus taeda"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91235"
FT                   /db_xref="GOA:B6H1S6"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S6"
FT                   /inference="similar to AA sequence:TREMBL:AF242490.1"
FT                   /inference="protein motif:PFAM:PF02716"
FT                   /inference="protein motif:COGS:COG1088"
FT                   /inference="protein motif:COGS:COG0451"
FT                   /protein_id="CAP91235.1"
FT                   /translation="MSLAKDILLFGATGTIGSFILDAILTERPQFGRVAIFTSPHTAEA
FT                   KASQLNKLKEQGVEVIVGNVEDENDVKAAYEGIDTVISALGRNALAQQIPLIRLAAASP
FT                   TVKWFLPSEYGTDIKYGPASANEKPHQLKLKVRAYLEDEISRDDLAYSYVVTGPFAEMY
FT                   LNLLPGMEEAGGWDVKGRRAVLLGEEGKGEVSLTTMTDVGTLVLNTLLHATAETRNAAL
FT                   CVNSFTTGPDQIQAEFERQLGGQPWDVSRTSLAKLREAEAAAWDAGNPAATVLTLRRIW
FT                   GEGGTLYSERANGLIGEPKMMGLEEVVANEIQRVSKL"
FT   exon            complement(389102..389456)
FT                   /gene="Pc13g01660"
FT                   /locus_tag="PCH_Pc13g01660"
FT                   /number=1
FT   intron          complement(389457..389533)
FT                   /gene="Pc13g01660"
FT                   /locus_tag="PCH_Pc13g01660"
FT                   /number=1
FT   exon            complement(389534..389906)
FT                   /gene="Pc13g01660"
FT                   /locus_tag="PCH_Pc13g01660"
FT                   /number=2
FT   intron          complement(389907..390004)
FT                   /gene="Pc13g01660"
FT                   /locus_tag="PCH_Pc13g01660"
FT                   /number=2
FT   exon            complement(390005..390233)
FT                   /gene="Pc13g01660"
FT                   /locus_tag="PCH_Pc13g01660"
FT                   /number=3
FT   mRNA            complement(join(<390574..391440,391606..391785,
FT                   391847..>392731))
FT                   /gene="Pc13g01670"
FT                   /locus_tag="PCH_Pc13g01670"
FT   CDS_pept        complement(join(390574..391440,391606..391785,
FT                   391847..392731))
FT                   /gene="Pc13g01670"
FT                   /locus_tag="PCH_Pc13g01670"
FT                   /note="unknown EC_number=3.2.1.40"
FT                   /note="Title: strong similarity to alpha-L-rhamnosidase A
FT                   precursor rhaA - Aspergillus aculeatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91236"
FT                   /db_xref="GOA:B6H1S7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S7"
FT                   /inference="similar to AA sequence:TREMBL:AF284761.1"
FT                   /protein_id="CAP91236.1"
FT                   /translation="MAQLYWPSVVLILWSLFSLSTADTCWRETTCSGPTNTAFSGPWEK
FT                   NIYAPASRTVRPASTLSELKTNAVTDPAHPYKATLYGNGSIIVFDFGIEVGGIVHLDYT
FT                   STGSGALGLAFTEAKNWIGEWSDSSSALYHDGALYANISSTGKGTYVMPDKYLRGGFRY
FT                   LTVFLLTDYSTSVQIEDLTLELAFKPTWANLRAYQGYFHCSDELLNRIWYSGAYTLQTN
FT                   EVSVDTGRVTKGVTSGWVNNGTLGPGDTIIVDGAKRDRAVWPGDMGIAVPSAFVSLGDL
FT                   ESVKSALQIMYNTQNKTTGAFDESGPPLSQKGSDTYHMWSMIGTYKYVLYTNDTDFLFK
FT                   NWASYQHAMEYIYGKTGASLALWAGDSTNLSSIWSSQAANLKKAINTYCWDESYGAFKD
FT                   NATNTSLHPQDANSMAIMFGVVNEERTASISEKLLKNWTPIGAVAPELPENIASFISSF
FT                   EIQSHFIAHKPARALDLIRRSWGWYINNPNGTESTVIEGYLQNGTFGYRMDRGYGYDPS
FT                   YVSHAHGWSSGPTSALTEYVVGLSVVSPLGLTWKIAPQFGDLEFAEAGFVTSLGKFQAS
FT                   WILNSSGYVLTFSVPKGTDGNVTLPYVTASKKPSITIDGDQLMRGVAYADGAATVEVTG
FT                   GSHKVVVT"
FT   exon            complement(390574..391440)
FT                   /gene="Pc13g01670"
FT                   /locus_tag="PCH_Pc13g01670"
FT                   /number=1
FT   mat_peptide     complement(join(390577..391440,391606..391785,
FT                   391847..392665))
FT                   /gene="Pc13g01670"
FT                   /locus_tag="PCH_Pc13g01670"
FT   intron          complement(391441..391605)
FT                   /gene="Pc13g01670"
FT                   /locus_tag="PCH_Pc13g01670"
FT                   /number=1
FT   exon            complement(391606..391785)
FT                   /gene="Pc13g01670"
FT                   /locus_tag="PCH_Pc13g01670"
FT                   /number=2
FT   intron          complement(391786..391846)
FT                   /gene="Pc13g01670"
FT                   /locus_tag="PCH_Pc13g01670"
FT                   /number=2
FT   exon            complement(391847..392731)
FT                   /gene="Pc13g01670"
FT                   /locus_tag="PCH_Pc13g01670"
FT                   /number=3
FT   sig_peptide     complement(392666..392731)
FT                   /gene="Pc13g01670"
FT                   /locus_tag="PCH_Pc13g01670"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<393481..393828,393954..394460,394537..>394908)
FT                   /gene="Pc13g01680"
FT                   /locus_tag="PCH_Pc13g01680"
FT   CDS_pept        join(393481..393828,393954..394460,394537..394908)
FT                   /gene="Pc13g01680"
FT                   /locus_tag="PCH_Pc13g01680"
FT                   /note="unknown EC_number=1.1.1.61"
FT                   /note="Title: similarity to 4-hydroxybutyrate dehydrogenase
FT                   - Alcaligenes eutrophus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01680"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91237"
FT                   /db_xref="GOA:B6H1S8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S8"
FT                   /inference="similar to AA sequence:PIR:I39568"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /inference="protein motif:COGS:COG1454"
FT                   /inference="protein motif:COGS:COG1979"
FT                   /protein_id="CAP91237.1"
FT                   /translation="MSGETVRPAFEGRERPLLSYGIAFPAATARHLDGTFRASRVYVIC
FT                   SGSLSRNTNVMDQLETALEPDRLVGHWIGMRSHTLWSEVLQIAEEVQTAHADLLLTVGA
FT                   GSLTDGAKIIALVLANRVSTPEELETLAEGPKKRKYIEAPTLPIISVPTSLSAGEYSNF
FT                   AGGTEDHSKRKYSFQPPIRGPELVILDPWLAKTSPGSIWLSTGVRAMDHCIESLCAIAG
FT                   TTTKSDKLALNALGLLVPGLLRCKRDRSDREAHLQCQLGSVDAMAACTSGSIELGASHG
FT                   IGHQLGPLGVGHGETSCILLPAVCKFNAKYNANREKQARVRQFLIQDPIVSDVLRARSV
FT                   NVETSDLGDILDAIIRELGMPRSLSDVQVGRDQLDGLAENSLHDRWCKTNPVPLKEKSQ
FT                   VLEILEMVV"
FT   exon            393481..393828
FT                   /gene="Pc13g01680"
FT                   /locus_tag="PCH_Pc13g01680"
FT                   /number=1
FT   intron          393829..393953
FT                   /gene="Pc13g01680"
FT                   /locus_tag="PCH_Pc13g01680"
FT                   /number=1
FT   exon            393954..394460
FT                   /gene="Pc13g01680"
FT                   /locus_tag="PCH_Pc13g01680"
FT                   /number=2
FT   intron          394461..394536
FT                   /gene="Pc13g01680"
FT                   /locus_tag="PCH_Pc13g01680"
FT                   /number=2
FT   exon            394537..394908
FT                   /gene="Pc13g01680"
FT                   /locus_tag="PCH_Pc13g01680"
FT                   /number=3
FT   mRNA            <395829..>397076
FT                   /gene="Pc13g01690"
FT                   /locus_tag="PCH_Pc13g01690"
FT   CDS_pept        395829..397076
FT                   /gene="Pc13g01690"
FT                   /locus_tag="PCH_Pc13g01690"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_68_scaffold_4.tfa_380cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01690"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91238"
FT                   /db_xref="GOA:B6H1S9"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S9"
FT                   /protein_id="CAP91238.1"
FT                   /translation="MASTLRQNPWWAYQSLTRQQLRTSRLSSRHLSTTPLRSNASNNPL
FT                   RSRASAAADLQHAAQAQRRMILSAAGIITCAAGLYGVIKLDLFGLNELDTNKDDKTTPP
FT                   KNGAMRMDGPVGFTNGGPSLITIKGQDRLEQVPTGTSTIPTFPSTIRLPTPEATEGKQT
FT                   GDDLAPSAGEEYQLLGLGIRTVSFLSIQVYVVGLYVAKSDITELQRRLLRTAIHPPTTD
FT                   DDAAISGAGATAATSLVSPERQQLRELLLDPEHGDAAWSAIIKDNGIRTAFRIVPTRNT
FT                   DFMHLRDGWVRGITARAQAKKTAEPGEFQDESFGSSMNDFKAVFGSGKGKSVPKGQTLV
FT                   LMRDAHGALDALFQPGADKPVKWMGRVADERISRLVWLNYLAGKNVSSEGARASIVDGL
FT                   MTIVERPLGTVVQKVI"
FT   exon            395829..397076
FT                   /gene="Pc13g01690"
FT                   /locus_tag="PCH_Pc13g01690"
FT                   /number=1
FT   mRNA            complement(join(<397430..397584,397712..>397862))
FT                   /gene="Pc13g01700"
FT                   /locus_tag="PCH_Pc13g01700"
FT   CDS_pept        complement(join(397430..397584,397712..397862))
FT                   /gene="Pc13g01700"
FT                   /locus_tag="PCH_Pc13g01700"
FT                   /note="Title: similarity to glutaredoxin - Oryza sativa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01700"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91239"
FT                   /db_xref="GOA:B6H1T0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T0"
FT                   /inference="similar to AA sequence:PIR:JC5445"
FT                   /inference="protein motif:PFAM:PF00462"
FT                   /inference="protein motif:COGS:COG0695"
FT                   /inference="protein motif:COGS:COG0278"
FT                   /protein_id="CAP91239.1"
FT                   /translation="MSAAKTRAQSLINDNAVVVFSKSYCPYCDSSKKLLDSLNAKYTTL
FT                   ELDLEEEGAAIQSALAEISSQRTVPNIFINKKHIGGNSDLQGKKDLKDLLKEAGAI"
FT   exon            complement(397430..397584)
FT                   /gene="Pc13g01700"
FT                   /locus_tag="PCH_Pc13g01700"
FT                   /number=1
FT   intron          complement(397585..397711)
FT                   /gene="Pc13g01700"
FT                   /locus_tag="PCH_Pc13g01700"
FT                   /number=1
FT   exon            complement(397712..397862)
FT                   /gene="Pc13g01700"
FT                   /locus_tag="PCH_Pc13g01700"
FT                   /number=2
FT   mRNA            join(<397909..397920,397979..398050,398152..398205,
FT                   398355..398497,398559..>398691)
FT                   /gene="Pc13g01710"
FT                   /locus_tag="PCH_Pc13g01710"
FT   CDS_pept        join(397909..397920,397979..398050,398152..398205,
FT                   398355..398497,398559..398691)
FT                   /gene="Pc13g01710"
FT                   /locus_tag="PCH_Pc13g01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01710"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91240"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T1"
FT                   /protein_id="CAP91240.1"
FT                   /translation="MDEMGGVRDDERIGGRFRQISGIERCDDLVAAKYILIYLTRRLVG
FT                   EADQTKERGEIASKKAWEYGKTGFKDVSERNPKIGEKKRNHRVKKVTGRFESLIPILSI
FT                   AIWSELFRIPSYHFGRKNNGHRRREEKYQGMDA"
FT   exon            397909..397920
FT                   /gene="Pc13g01710"
FT                   /locus_tag="PCH_Pc13g01710"
FT                   /number=1
FT   intron          397921..397978
FT                   /gene="Pc13g01710"
FT                   /locus_tag="PCH_Pc13g01710"
FT                   /number=1
FT   exon            397979..398050
FT                   /gene="Pc13g01710"
FT                   /locus_tag="PCH_Pc13g01710"
FT                   /number=2
FT   intron          398051..398151
FT                   /gene="Pc13g01710"
FT                   /locus_tag="PCH_Pc13g01710"
FT                   /number=2
FT   exon            398152..398205
FT                   /gene="Pc13g01710"
FT                   /locus_tag="PCH_Pc13g01710"
FT                   /number=3
FT   intron          398206..398354
FT                   /gene="Pc13g01710"
FT                   /locus_tag="PCH_Pc13g01710"
FT                   /number=3
FT   exon            398355..398497
FT                   /gene="Pc13g01710"
FT                   /locus_tag="PCH_Pc13g01710"
FT                   /number=4
FT   intron          398498..398558
FT                   /gene="Pc13g01710"
FT                   /locus_tag="PCH_Pc13g01710"
FT                   /number=4
FT   exon            398559..398691
FT                   /gene="Pc13g01710"
FT                   /locus_tag="PCH_Pc13g01710"
FT                   /number=5
FT   mRNA            complement(join(<398967..400465,400538..>400568))
FT                   /gene="Pc13g01720"
FT                   /locus_tag="PCH_Pc13g01720"
FT   CDS_pept        complement(join(398967..400465,400538..400568))
FT                   /gene="Pc13g01720"
FT                   /locus_tag="PCH_Pc13g01720"
FT                   /note="Title: similarity to hypothetical protein 68B2.200
FT                   -Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01720"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91241"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T2"
FT                   /inference="similar to AA sequence:PIR:T48836"
FT                   /inference="protein motif:COGS:COG1674"
FT                   /inference="protein motif:COGS:COG2812"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /inference="protein motif:COGS:COG0455"
FT                   /inference="protein motif:COGS:COG4775"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /inference="protein motif:COGS:COG0188"
FT                   /inference="protein motif:COGS:COG0532"
FT                   /inference="protein motif:COGS:COG0642"
FT                   /protein_id="CAP91241.1"
FT                   /translation="MGFCGATCEREKKALISFSPQENHSSKQRNSHDSNSVRPKFSRQR
FT                   TSNGSRSSSVSRTARTHESPYLASNRGRREPSLNRHGSEAGSMRDAFGHEAASRKETEE
FT                   ANDGESYLDGKTNQEKWIHRDKLAKIESEELHQAAILFQRRMRGESKSSSGRGRSHDAH
FT                   PANGTGTATSPATEYSEPWPKVKEESGKQDVNDNVEDDEREHWDLRRPEEIAADDAAAS
FT                   IYSHPSLGKSASRIPVSTASPVPISAALGRDSRSSRSRAATDEEDRSSRSRRASEPINI
FT                   EQDGSTPSPESRPGSRGFSSTPNTLGKKTVKPTTGSTNRKTSAPPTNRKASTPRSRAVS
FT                   GNNIQRPTTRGGEPRPSTAVNRPEGDPPWLATMYKPDPRLPPDQQMIPTVAKRIMQEQW
FT                   EKEGRTPNTYDRNFEPLAVHPPDAPPAATKAEPEQQPVESLQLEELPPQPPKSPEPPRP
FT                   NTSTGYSTMPKVQDTPPMGLTPNPNPNWSPPVVTAQQAPKKEKSCGCCVVM"
FT   exon            complement(398967..400465)
FT                   /gene="Pc13g01720"
FT                   /locus_tag="PCH_Pc13g01720"
FT                   /number=1
FT   intron          complement(400466..400537)
FT                   /gene="Pc13g01720"
FT                   /locus_tag="PCH_Pc13g01720"
FT                   /number=1
FT   exon            complement(400538..400568)
FT                   /gene="Pc13g01720"
FT                   /locus_tag="PCH_Pc13g01720"
FT                   /number=2
FT   mRNA            complement(<401778..>402719)
FT                   /gene="Pc13g01730"
FT                   /locus_tag="PCH_Pc13g01730"
FT   CDS_pept        complement(401778..402719)
FT                   /gene="Pc13g01730"
FT                   /locus_tag="PCH_Pc13g01730"
FT                   /note="Title: similarity to hypothetical protein 8D4.210
FT                   -Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01730"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91242"
FT                   /db_xref="GOA:B6H1T3"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR003103"
FT                   /db_xref="InterPro:IPR017093"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036533"
FT                   /db_xref="InterPro:IPR039773"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T3"
FT                   /inference="similar to AA sequence:PIR:T48747"
FT                   /protein_id="CAP91242.1"
FT                   /translation="MSWRNPLKMLRRSPSYAPASNPQVSDGDFSYIAPSDIADPAADDA
FT                   EPDIIALRHRGTIYPLRFRAYSIDDNVLTIGDLRQAAAESTGAGHPDCVRLLYKGKLLK
FT                   NNAQTCKAEGLKQHSEVLCVVSEAGAGSPSDGSDDGHKIPVTTSAPTPPPLPRPTSAGD
FT                   ASSPPTPPSGKSKSSRRKKRNGKKSPVSSEAPGPSRPPRPTSSGHSAASAQPPNLKLLN
FT                   TPLEKIAALTGWFEQVMKPQCEEYTANPPSDPKKRGDEHRKLSETVLQSVQLVADGIEP
FT                   NGDETVRSARRALIRDSQAVLTELDRVLHSVA"
FT   exon            complement(401778..402719)
FT                   /gene="Pc13g01730"
FT                   /locus_tag="PCH_Pc13g01730"
FT                   /number=1
FT   mRNA            join(<404979..405030,405216..405356,405459..>405589)
FT                   /gene="Pc13g01740"
FT                   /locus_tag="PCH_Pc13g01740"
FT   CDS_pept        join(404979..405030,405216..405356,405459..405589)
FT                   /gene="Pc13g01740"
FT                   /locus_tag="PCH_Pc13g01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91243"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T4"
FT                   /protein_id="CAP91243.1"
FT                   /translation="MEDDKPLAVTAIHVATPLWVTCTRRLCRLRHIACTQHFVVIANIY
FT                   APPALILLSGWMQLPVICQAYGCLVVGHATTDEKYRSDRNVIQPRYGPGAFCGVQTPCL
FT                   AVS"
FT   exon            404979..405030
FT                   /gene="Pc13g01740"
FT                   /locus_tag="PCH_Pc13g01740"
FT                   /number=1
FT   intron          405031..405215
FT                   /gene="Pc13g01740"
FT                   /locus_tag="PCH_Pc13g01740"
FT                   /number=1
FT   exon            405216..405356
FT                   /gene="Pc13g01740"
FT                   /locus_tag="PCH_Pc13g01740"
FT                   /number=2
FT   intron          405357..405458
FT                   /gene="Pc13g01740"
FT                   /locus_tag="PCH_Pc13g01740"
FT                   /number=2
FT   exon            405459..405589
FT                   /gene="Pc13g01740"
FT                   /locus_tag="PCH_Pc13g01740"
FT                   /number=3
FT   mRNA            complement(join(<407803..409537,409596..>409903))
FT                   /gene="Pc13g01750"
FT                   /locus_tag="PCH_Pc13g01750"
FT   CDS_pept        complement(join(407803..409537,409596..409903))
FT                   /gene="Pc13g01750"
FT                   /locus_tag="PCH_Pc13g01750"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPCC622.11 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01750"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91244"
FT                   /db_xref="GOA:B6H1T5"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T5"
FT                   /inference="similar to AA sequence:PIR:T41491"
FT                   /inference="protein motif:PFAM:PF04791"
FT                   /protein_id="CAP91244.1"
FT                   /translation="MFPVSVSPISVGSNVFFAFALFLISALVLLLLRRFLTLRATPAYL
FT                   SVPIFLALALPASVVLLVPIDLASSSRDGSGPKAIWLPERMVLVCWRIAYWLIFVLTWV
FT                   ILPLLGEYVDSGYREPKGRLMYSLRSNAKYQLIVLGCALVGLVYVSISNGFEFRSIKGL
FT                   IMALAYVWGLVLAIYLMGHGLVSIPRNLLRNSNVSGRLRRLQAHAPRVHDRLMDSVNEL
FT                   ANLNSQVSQLQRRKTGTARDFQEWIEELREGHGQSDVRIPILESPDTSATIPSVITERY
FT                   LADLTRRLQRARHMKARFVDEWDRLVQLSADLQAIINSTASKKLEFAPAARRSSCIPRV
FT                   KFLNPYMRYQLYSNVIPSVRLAFGAFFAVASVCIVWSEMIKSLAPHLSAISLTVVPNWK
FT                   DSPVGFGGQLTASAWLLYMCSAALVGVSDVKVWGNRALVRRNTYGESACWYAGLVARLT
FT                   VPIAYNFLTFLPKDFRRSTTFYEFLGKLINLTPLGKGFDFIFPIFILLPICATLFNLYG
FT                   RIKNIFGCGLAEDDDIHDVENNPAGYGMGGWREGRDLIERELNGFGSLAVSSRGSRSTW
FT                   ASDRDDEGSPGSSRLRVPVAEGSQPAQRSVVAPTIVGGEEDDDENFFQSFAHRVKNTFD
FT                   TTNTPRWFQGEPFRLPRWMSGDNNTTEEGSALFGGRAVPGRLRLG"
FT   exon            complement(407803..409537)
FT                   /gene="Pc13g01750"
FT                   /locus_tag="PCH_Pc13g01750"
FT                   /number=1
FT   mat_peptide     complement(join(407806..409537,409596..409783))
FT                   /gene="Pc13g01750"
FT                   /locus_tag="PCH_Pc13g01750"
FT   intron          complement(409538..409595)
FT                   /gene="Pc13g01750"
FT                   /locus_tag="PCH_Pc13g01750"
FT                   /number=1
FT   exon            complement(409596..409903)
FT                   /gene="Pc13g01750"
FT                   /locus_tag="PCH_Pc13g01750"
FT                   /number=2
FT   sig_peptide     complement(409784..409903)
FT                   /gene="Pc13g01750"
FT                   /locus_tag="PCH_Pc13g01750"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<410154..410276,410604..410666,
FT                   410897..411250,411300..411386,411465..>411494))
FT                   /gene="Pc13g01760"
FT                   /locus_tag="PCH_Pc13g01760"
FT   CDS_pept        complement(join(410154..410276,410604..410666,
FT                   410897..411250,411300..411386,411465..411494))
FT                   /gene="Pc13g01760"
FT                   /locus_tag="PCH_Pc13g01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01760"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91245"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T7"
FT                   /protein_id="CAP91245.1"
FT                   /translation="MGDQWAIRAEEVQHGLISGREKKGKQVLVWNRDSSRSGRGTNTNT
FT                   DQHNEESKAFGQQRQMNSIRWPPPDCGLERMKTVVGWIGSVTGIMQPSSRTGPQLLSSL
FT                   HNGETIGGLKDKEHRYLRKIRMTLRQRQMSAQISLSWGAQSKKKWRSSEGYYDGGHKAS
FT                   SEVLPVLPGFPLLGQFSSRSTRRSGPDLIRRNQLVKMPETLPGGCGRVPGTPLYT"
FT   exon            complement(410154..410276)
FT                   /gene="Pc13g01760"
FT                   /locus_tag="PCH_Pc13g01760"
FT                   /number=1
FT   intron          complement(410277..410603)
FT                   /gene="Pc13g01760"
FT                   /locus_tag="PCH_Pc13g01760"
FT                   /number=1
FT   exon            complement(410604..410666)
FT                   /gene="Pc13g01760"
FT                   /locus_tag="PCH_Pc13g01760"
FT                   /number=2
FT   intron          complement(410667..410896)
FT                   /gene="Pc13g01760"
FT                   /locus_tag="PCH_Pc13g01760"
FT                   /number=2
FT   exon            complement(410897..411250)
FT                   /gene="Pc13g01760"
FT                   /locus_tag="PCH_Pc13g01760"
FT                   /number=3
FT   intron          complement(411251..411299)
FT                   /gene="Pc13g01760"
FT                   /locus_tag="PCH_Pc13g01760"
FT                   /number=3
FT   exon            complement(411300..411386)
FT                   /gene="Pc13g01760"
FT                   /locus_tag="PCH_Pc13g01760"
FT                   /number=4
FT   intron          complement(411387..411464)
FT                   /gene="Pc13g01760"
FT                   /locus_tag="PCH_Pc13g01760"
FT                   /number=4
FT   exon            complement(411465..411494)
FT                   /gene="Pc13g01760"
FT                   /locus_tag="PCH_Pc13g01760"
FT                   /number=5
FT   mRNA            join(<411592..411725,411803..414686,414741..>416087)
FT                   /gene="Pc13g01770"
FT                   /locus_tag="PCH_Pc13g01770"
FT   CDS_pept        join(411592..411725,411803..414686,414741..416087)
FT                   /gene="Pc13g01770"
FT                   /locus_tag="PCH_Pc13g01770"
FT                   /note="Title: strong similarity to protein mastermind like
FT                   protein An18g04690 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01770"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91246"
FT                   /db_xref="GOA:B6H1T8"
FT                   /db_xref="InterPro:IPR008626"
FT                   /db_xref="InterPro:IPR036546"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T8"
FT                   /protein_id="CAP91246.1"
FT                   /translation="MQVPKNDSVQSMMTYVAQMLQNQGPFQGWKADVLIKTRATNVYQM
FT                   ITSLRLIQPRIDLHQAAQAAMSFELKAFTKANEKIEYEKECTEKLLHIRNTRERQAAVA
FT                   YQSGMMPQTGAGPNQIPAAFPQHIPVSGQQQLAMGMNGQNQQAALQRQQQQQQSHAMLQ
FT                   QQQQQQQQQQQQQQQQQQRSQQRPGNGIPMVDDLSTLSAQDLDHVSRLANEMLNKTNPE
FT                   DMEKIKMNLSNMTPEQRQYLARKNLEPMTYFFRSQALNQIRRHRRARLEMGGRAPNPGV
FT                   DANGNMMGDPMMNSQHQRQMLQNMLNLQRNSAFPGNPGQTMDPPNFIGNVENIQGQQAD
FT                   GLRSQEAGQLVVPASSSQMNQAPFPNNNNNMFPQQMGQNGQANMNANNPNAQAQFLAQQ
FT                   HLQGGSNTPQDRLQFQAQQSQAQAQAQARVQAAQKAQMAMSGHGGQVTPQSQPQLNGQS
FT                   PVMPMLNQPMAPGQMSPVQVPAQARPPSRPANMGQHPAGVAGQAAMQGPLQIPSNIPPH
FT                   IQEQLARMPPEQARAFIMQQQRRAALNNMARANPGQQPQPQPGQAQSMMNNQMGNAIMR
FT                   GSMSGPQDLNSGGMPQGQQMTQQQRQQRQNELYKLQLLRQQNNGVEMTPEQGKQMDRVS
FT                   FPPSILNMNGTSMQVPSNIKSWGQLKQWANSNPQIASPNDLPRLMMLQKLHLGQLISAS
FT                   TNQPKDQNGQGPAATPFQGTQVPFNNAPGFLPGQQPGAMNMAAMRPITAQDIQMARQKL
FT                   GHQASNFTDEQIREILLRNRQKQMMQAAQNRAMQLEGNTQAGQLSQPATQPPVPTAQPV
FT                   PQIKPQNAQPPQSTPQAANAKAQTGAATKGAKGATGKQASKKRPSTDDTTEARATATPQ
FT                   MNQPVAVPGGPATAPQRPAFPFTQEQLAQMTPQQRAQVEAHMRSKQPQSRGQVLSRAAA
FT                   EEAWNRNLPPQVMEVYNDIAKNAPPAKPIPVSPEQKAAMTKQLREAVEVLGRLDALVQW
FT                   FAKMQGQEKNVKNLLAMRIQLMRQFKPSQEWGVNEQFTVTPDYLTGAILFMRKLFAVMI
FT                   SRMQQGQRPTSQAPSSNGQQMPGNMPALNATNLQQLQAQEEALQRARRASSQSAANAPA
FT                   APFAAPSPRGVPQYAAGGLAPENLKLPPPKKRKQSHGVASSPVQATAPPGAAAKYNKAV
FT                   ADATSNAAAMAGAFKCSVVECQHHYQGFPTQAVLDKHVEESHQPEEEETIEDPLKYYHE
FT                   SISMGLGLNSDDSPETQQMATLGPVPSSTKPSAAASPAKQGVSTPLIANNTPMARVTSQ
FT                   FGGKTASPAAASTQLLTPQLSSVKGSKPADKDGKKDAIKLEDSDTKDPWAECPTSLDTI
FT                   HDTFSNLASKDLPHLGYDSLEDFDINEATPVDDDWAAFASLTPPNEAEEAAFLEKFYEP
FT                   WDEDSIARAADWMRIPPEIQVKGIGPMGQLEVDWDAVARYEREGIRIRQTSK"
FT   exon            411592..411725
FT                   /gene="Pc13g01770"
FT                   /locus_tag="PCH_Pc13g01770"
FT                   /number=1
FT   intron          411726..411802
FT                   /gene="Pc13g01770"
FT                   /locus_tag="PCH_Pc13g01770"
FT                   /number=1
FT   exon            411803..414686
FT                   /gene="Pc13g01770"
FT                   /locus_tag="PCH_Pc13g01770"
FT                   /number=2
FT   intron          414687..414740
FT                   /gene="Pc13g01770"
FT                   /locus_tag="PCH_Pc13g01770"
FT                   /number=2
FT   exon            414741..416087
FT                   /gene="Pc13g01770"
FT                   /locus_tag="PCH_Pc13g01770"
FT                   /number=3
FT   mRNA            join(<416680..416763,416821..416897,416972..417856,
FT                   417912..>418185)
FT                   /gene="Pc13g01780"
FT                   /locus_tag="PCH_Pc13g01780"
FT   CDS_pept        join(416680..416763,416821..416897,416972..417856,
FT                   417912..418185)
FT                   /gene="Pc13g01780"
FT                   /locus_tag="PCH_Pc13g01780"
FT                   /note="Title: weak similarity to UDP-N-acetylglucosamine
FT                   transporter SLC35A3 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01780"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91247"
FT                   /db_xref="GOA:B6H1T9"
FT                   /db_xref="InterPro:IPR007271"
FT                   /db_xref="InterPro:IPR012404"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T9"
FT                   /inference="similar to AA sequence:TREMBL:BC005136.1"
FT                   /inference="protein motif:COGS:COG0697"
FT                   /protein_id="CAP91247.1"
FT                   /translation="MANNALIPLLVTMMLVTGVCNTILNKYQDMQCVRNCDSPDPNQRK
FT                   LFEQPVIQTAVMFIGEMGCWLVVGLNFVYRQYIAPRLSSDPSPLLTGGYHPINGYDEGI
FT                   DNEDDHTVDGLDSDSRHPKPLPEIDSRIPLRGLKVLLLAAPSSCDIAGTTLMNVGLLFV
FT                   AASIYQMTRGALVLFVGLFSVLFLRRRLHLYQWSALFIVVLGVAIVGLSGALFSGDSGH
FT                   DINQNASVTDVASRALIQARDVARTPEAVQTIIGVLLIAAAQIFTATQFVLEEWILEHY
FT                   AMEPIHVVGWEGVFGFLVTVVGMLIMYLIVGRTDAGRYGYFDVKQGLHELLANRAVAIS
FT                   SVFIMISIGGFNFFGLSVTRTVSATSRSTIDTCRTLFIWIVSLGLGWETFKWLQVVGFA
FT                   LLVYGTFMFNDIVRPPIKACLPRDRREGEVLLPEGPIEHI"
FT   sig_peptide     416680..416742
FT                   /gene="Pc13g01780"
FT                   /locus_tag="PCH_Pc13g01780"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            416680..416763
FT                   /gene="Pc13g01780"
FT                   /locus_tag="PCH_Pc13g01780"
FT                   /number=1
FT   mat_peptide     join(416743..416763,416821..416897,416972..417856,
FT                   417912..418182)
FT                   /gene="Pc13g01780"
FT                   /locus_tag="PCH_Pc13g01780"
FT   intron          416764..416820
FT                   /gene="Pc13g01780"
FT                   /locus_tag="PCH_Pc13g01780"
FT                   /number=1
FT   exon            416821..416897
FT                   /gene="Pc13g01780"
FT                   /locus_tag="PCH_Pc13g01780"
FT                   /number=2
FT   intron          416898..416971
FT                   /gene="Pc13g01780"
FT                   /locus_tag="PCH_Pc13g01780"
FT                   /number=2
FT   exon            416972..417856
FT                   /gene="Pc13g01780"
FT                   /locus_tag="PCH_Pc13g01780"
FT                   /number=3
FT   intron          417857..417911
FT                   /gene="Pc13g01780"
FT                   /locus_tag="PCH_Pc13g01780"
FT                   /number=3
FT   exon            417912..418185
FT                   /gene="Pc13g01780"
FT                   /locus_tag="PCH_Pc13g01780"
FT                   /number=4
FT   mRNA            complement(join(<418852..418947,419021..421154,
FT                   421206..421394,421451..>421596))
FT                   /gene="Pc13g01790"
FT                   /locus_tag="PCH_Pc13g01790"
FT   CDS_pept        complement(join(418852..418947,419021..421154,
FT                   421206..421394,421451..421596))
FT                   /gene="Pc13g01790"
FT                   /locus_tag="PCH_Pc13g01790"
FT                   /note="Title: strong similarity to gamma1-adaptin - Homo
FT                   sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01790"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91248"
FT                   /db_xref="GOA:B6H1U0"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017107"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U0"
FT                   /inference="similar to AA sequence:TREMBL:AB015317.1"
FT                   /inference="protein motif:PFAM:PF01602"
FT                   /inference="protein motif:PFAM:PF02883"
FT                   /inference="protein motif:COGS:COG5096"
FT                   /inference="protein motif:COGS:COG5240"
FT                   /inference="protein motif:COGS:COG1413"
FT                   /protein_id="CAP91248.1"
FT                   /translation="MQSNISTVKQFIRNVRSAKTIADERAVIQKESAAIRASFREESHD
FT                   SGIRRNNVAKLLYLFTLGERTHFGQIECLKLLASHRFADKRLGYLGTMLLLDENQEVLT
FT                   LVTNSLKNDLNHSNQYIVGLALCTLGNIASVEMSRDLFPEVESLMSTANPYIRRKAAIC
FT                   AMRICRKVPDLYEHFLEKAKNLLSDRNHGVLLCGLTLAIDLCEAEEEEEEEEEGGPVGV
FT                   IEMFRPLAGGLVRALKGLTTSGYAPEHDVSGITDPFLQVKILRFLRVLGRGDVATSELI
FT                   NDILAQVATNTDSSKNVGNSILYEAVLTILDIEADSGLRVLGVNILGKFLANKDNNIRY
FT                   VALNTLNKVVAIEPNAVQRHRNTILECLRDPDISIRRRALDLSFMLINEDNVRVLVREL
FT                   LAFLEVADNEFKSVMTTQIGIAADRFAPNKRWHMDTILRVLKLAGNYVKEQILSSFVRL
FT                   IATTPDLQTYAVQKLYSSLKEDISQEGLTLAATWTIGEYADSLLQGGQYEEEELVKEVR
FT                   ESDIVDLFTNILNSTYASQIAVEYIITASMKLTVRMSDPAQIERLRRLLSSRTADLSVE
FT                   IQQRAVEYTNLFGYDQIRRGVLERMPPPEIREEQRVLGAAPAAKKRQSKLLRGKSTTKV
FT                   AKPAEHDLLLDLVGGSDAPVTSPTSGGSNTADLLADILGGDSGMSSPSPGPAGQKNAIM
FT                   DLFGSNGPSPSPQPTQPTSASMDLLGAGGMGVSAPSPTTSPAPVTASTPAHTALNKDGL
FT                   VLTLQVQRSGNIAQILARFRNDSNFDRFTSVGLQAAVPKSQRLQLSAITKADLEAGDEG
FT                   TQSLRVTALNGGLPAKLRLRLRVTCARDGGNPVTDQVDWSEP"
FT   exon            complement(418852..418947)
FT                   /gene="Pc13g01790"
FT                   /locus_tag="PCH_Pc13g01790"
FT                   /number=1
FT   intron          complement(418948..419020)
FT                   /gene="Pc13g01790"
FT                   /locus_tag="PCH_Pc13g01790"
FT                   /number=1
FT   exon            complement(419021..421154)
FT                   /gene="Pc13g01790"
FT                   /locus_tag="PCH_Pc13g01790"
FT                   /number=2
FT   intron          complement(421155..421205)
FT                   /gene="Pc13g01790"
FT                   /locus_tag="PCH_Pc13g01790"
FT                   /number=2
FT   exon            complement(421206..421394)
FT                   /gene="Pc13g01790"
FT                   /locus_tag="PCH_Pc13g01790"
FT                   /number=3
FT   intron          complement(421395..421450)
FT                   /gene="Pc13g01790"
FT                   /locus_tag="PCH_Pc13g01790"
FT                   /number=3
FT   exon            complement(421451..421596)
FT                   /gene="Pc13g01790"
FT                   /locus_tag="PCH_Pc13g01790"
FT                   /number=4
FT   mRNA            join(<422422..422543,422615..423058,423120..423827,
FT                   423884..>424220)
FT                   /gene="Pc13g01800"
FT                   /locus_tag="PCH_Pc13g01800"
FT   CDS_pept        join(422422..422543,422615..423058,423120..423827,
FT                   423884..424220)
FT                   /gene="Pc13g01800"
FT                   /locus_tag="PCH_Pc13g01800"
FT                   /note="unknown EC_number=2.3.1.20"
FT                   /note="Title: similarity to diacylglycerol acyltransferase
FT                   DAGAT - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01800"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91249"
FT                   /db_xref="GOA:B6H1U1"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR014371"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U1"
FT                   /inference="similar to AA sequence:PIR:T52584"
FT                   /inference="protein motif:PFAM:PF03062"
FT                   /inference="protein motif:COGS:COG5056"
FT                   /protein_id="CAP91249.1"
FT                   /translation="MSSAVSQNESATLRPRAVPIQHGKSDVALPLPVDKLAQDTSGRST
FT                   PVSEDAPPSAHSISSARKQVRARNRLFYTINYVPRVSHFDPDSDYHNFRGFFTLFWIGL
FT                   AIMVGTSILRNIKDTGYPLQVRVWSLLTANVWGMGLSDAAMVISSGLVLPMHRLWRAGP
FT                   QWLRWSRGGMVLQSLGEAFWLVLWINWPFMMRWTWTAQVFFTLHTLTILMKLHSYAFYN
FT                   GHLSETQRRLASLDKPGSKTPEQPAAIHYPEVHRRRPSMKQRDEDQSTEPLERLREDLA
FT                   TELTSPLGNISYPQNLHIGNYVDFLFCPTLCYELEYPRRKERRWSEIGWKAAAVFGCIF
FT                   LLTLTSEEFIVPVLAEASSQLRVVSSATDKALVLAETISMLLFPFMIIFLLVFLVIFEY
FT                   VLGAFAELTRFADRHFYADWWNSCDWMEFSREWNVPVHHFLFRHVYWPARCNFSQPVAM
FT                   VITFLVSSIFHELVMSCITKKLRGYGFLAMMLQLPIVAIQKSRFFRGRTILNVGCHLFS
FT                   LVFSGLTDFLSRMHSSGPR"
FT   exon            422422..422543
FT                   /gene="Pc13g01800"
FT                   /locus_tag="PCH_Pc13g01800"
FT                   /number=1
FT   intron          422544..422614
FT                   /gene="Pc13g01800"
FT                   /locus_tag="PCH_Pc13g01800"
FT                   /number=1
FT   exon            422615..423058
FT                   /gene="Pc13g01800"
FT                   /locus_tag="PCH_Pc13g01800"
FT                   /number=2
FT   intron          423059..423119
FT                   /gene="Pc13g01800"
FT                   /locus_tag="PCH_Pc13g01800"
FT                   /number=2
FT   exon            423120..423827
FT                   /gene="Pc13g01800"
FT                   /locus_tag="PCH_Pc13g01800"
FT                   /number=3
FT   intron          423828..423883
FT                   /gene="Pc13g01800"
FT                   /locus_tag="PCH_Pc13g01800"
FT                   /number=3
FT   exon            423884..424220
FT                   /gene="Pc13g01800"
FT                   /locus_tag="PCH_Pc13g01800"
FT                   /number=4
FT   mRNA            <425288..>425443
FT                   /gene="Pc13g01810"
FT                   /locus_tag="PCH_Pc13g01810"
FT   CDS_pept        425288..425443
FT                   /pseudo
FT                   /gene="Pc13g01810"
FT                   /locus_tag="PCH_Pc13g01810"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical protein
FT                   bc0aa012e04t1 - Debaryomyces hansenii [putative
FT                   pseudogene]"
FT   exon            425288..425443
FT                   /gene="Pc13g01810"
FT                   /locus_tag="PCH_Pc13g01810"
FT                   /number=1
FT   mRNA            <425534..>426013
FT                   /gene="Pc13g01820"
FT                   /locus_tag="PCH_Pc13g01820"
FT   CDS_pept        425534..426013
FT                   /gene="Pc13g01820"
FT                   /locus_tag="PCH_Pc13g01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01820"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91251"
FT                   /db_xref="GOA:B6H1U2"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U2"
FT                   /inference="protein motif:COGS:COG0277"
FT                   /protein_id="CAP91251.1"
FT                   /translation="MGQFEHFFPIENLTEAGKGYFNYALCQSDRMRPYQLDNPIEEGLR
FT                   GVYLSDDVTVNLLANASGIFATLEYSWIPSYNNYTLQWFYQDLLEEIFLIFGEKYNVRP
FT                   HWNKMLFNDGTYASNIYPKINSWLDIQEQMDPHCQFVNEFLAESLGIERCVSLFQ"
FT   exon            425534..426013
FT                   /gene="Pc13g01820"
FT                   /locus_tag="PCH_Pc13g01820"
FT                   /number=1
FT   mRNA            complement(join(<427238..428495,428571..>428845))
FT                   /gene="Pc13g01830"
FT                   /locus_tag="PCH_Pc13g01830"
FT   CDS_pept        complement(join(427238..428495,428571..428845))
FT                   /gene="Pc13g01830"
FT                   /locus_tag="PCH_Pc13g01830"
FT                   /note="Title: strong similarity to DnaJ/Hsp40 family
FT                   protein like protein An18g03870 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01830"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91252"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U3"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /inference="protein motif:COGS:COG2214"
FT                   /inference="protein motif:COGS:COG0484"
FT                   /inference="protein motif:COGS:COG5269"
FT                   /protein_id="CAP91252.1"
FT                   /translation="MSTPPDIDPYAVLGVAKEATIPEIRAAHRKRVLKCHPDKIQDESQ
FT                   RIAAQDEFQKVQQAYELLSDDVRRTKHDQKVKIAELKRELLERRRTEVPMEVFFEEAMR
FT                   FTDEPRTMSRKFEDFGVRSKSKPTEEKKKARAPTSTYHQAKEKRETAKATHSDRAKTRD
FT                   QERRRQRQAEAKYDSTFDVCAESDDASDSSVPRYAHKRTSTPRRERERDSRSRPSESSR
FT                   RRERRYDEDDDISDHWQSKIESQYFNAEDYIASKTRKSKSPRRYHGHDSAEPESSTSRS
FT                   AGRSTRTRRRSSSRDRSYEHLESPRAYEVKPPKMQPSATSPGIKVPLRPSFLNTRAATS
FT                   SGFRQKRESRDSTLYEMAHEPLPSRTSKMRDRNDSGYSSPGTPEMLPRGTSPKTLYTVV
FT                   QEADHVVVEPKSSKYRSARSPDRDRVPSTRQVPKRSSTFQAYTEAAPRVETRSARPSSR
FT                   THPVEYITTAPKGNVKYGRTYKPEDVSYSPRRDYYYDEEYRPPAVGRRQSAY"
FT   exon            complement(427238..428495)
FT                   /gene="Pc13g01830"
FT                   /locus_tag="PCH_Pc13g01830"
FT                   /number=1
FT   intron          complement(428496..428570)
FT                   /gene="Pc13g01830"
FT                   /locus_tag="PCH_Pc13g01830"
FT                   /number=1
FT   exon            complement(428571..428845)
FT                   /gene="Pc13g01830"
FT                   /locus_tag="PCH_Pc13g01830"
FT                   /number=2
FT   mRNA            join(<430311..430393,430474..430549,430684..430770,
FT                   430841..>430921)
FT                   /gene="Pc13g01840"
FT                   /locus_tag="PCH_Pc13g01840"
FT   CDS_pept        join(430311..430393,430474..430549,430684..430770,
FT                   430841..430921)
FT                   /gene="Pc13g01840"
FT                   /locus_tag="PCH_Pc13g01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01840"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91253"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U4"
FT                   /protein_id="CAP91253.1"
FT                   /translation="MLNGAACASPDHDESIGKSANAERVNAVLPVILLFCVKVSYVLAQ
FT                   EWPTIHSNAIIALDHSHSFQPDCASRIHNPPIPSVVLLPLFPDSHANPARTGLGWIHNW
FT                   TLAA"
FT   exon            430311..430393
FT                   /gene="Pc13g01840"
FT                   /locus_tag="PCH_Pc13g01840"
FT                   /number=1
FT   intron          430394..430473
FT                   /gene="Pc13g01840"
FT                   /locus_tag="PCH_Pc13g01840"
FT                   /number=1
FT   exon            430474..430549
FT                   /gene="Pc13g01840"
FT                   /locus_tag="PCH_Pc13g01840"
FT                   /number=2
FT   intron          430550..430683
FT                   /gene="Pc13g01840"
FT                   /locus_tag="PCH_Pc13g01840"
FT                   /number=2
FT   exon            430684..430770
FT                   /gene="Pc13g01840"
FT                   /locus_tag="PCH_Pc13g01840"
FT                   /number=3
FT   intron          430771..430840
FT                   /gene="Pc13g01840"
FT                   /locus_tag="PCH_Pc13g01840"
FT                   /number=3
FT   exon            430841..430921
FT                   /gene="Pc13g01840"
FT                   /locus_tag="PCH_Pc13g01840"
FT                   /number=4
FT   mRNA            join(<431451..431615,431687..431737,431858..>431953)
FT                   /gene="Pc13g01850"
FT                   /locus_tag="PCH_Pc13g01850"
FT   CDS_pept        join(431451..431615,431687..431737,431858..431953)
FT                   /gene="Pc13g01850"
FT                   /locus_tag="PCH_Pc13g01850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01850"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91254"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A5"
FT                   /protein_id="CAP91254.1"
FT                   /translation="MAGRAIYWLAQRFVLFTAENSATGRSFGSAALSGSFEFGEIPVAD
FT                   DLRTSYWELTMGLYIACGVYSGHETRGYGAYARVALTPGLSDGFNYHPRGQRGAQFKK"
FT   sig_peptide     431451..431522
FT                   /gene="Pc13g01850"
FT                   /locus_tag="PCH_Pc13g01850"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            431451..431615
FT                   /gene="Pc13g01850"
FT                   /locus_tag="PCH_Pc13g01850"
FT                   /number=1
FT   mat_peptide     join(431523..431615,431687..431737,431858..431950)
FT                   /gene="Pc13g01850"
FT                   /locus_tag="PCH_Pc13g01850"
FT   intron          431616..431686
FT                   /gene="Pc13g01850"
FT                   /locus_tag="PCH_Pc13g01850"
FT                   /number=1
FT   exon            431687..431737
FT                   /gene="Pc13g01850"
FT                   /locus_tag="PCH_Pc13g01850"
FT                   /number=2
FT   intron          431738..431857
FT                   /gene="Pc13g01850"
FT                   /locus_tag="PCH_Pc13g01850"
FT                   /number=2
FT   exon            431858..431953
FT                   /gene="Pc13g01850"
FT                   /locus_tag="PCH_Pc13g01850"
FT                   /number=3
FT   mRNA            complement(join(<432227..433170,433317..>433512))
FT                   /gene="Pc13g01860"
FT                   /locus_tag="PCH_Pc13g01860"
FT   CDS_pept        complement(join(432227..433170,433317..433512))
FT                   /gene="Pc13g01860"
FT                   /locus_tag="PCH_Pc13g01860"
FT                   /note="Title: similarity to hypothetical protein CG16717
FT                   -Drosophila melanogaster"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01860"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91255"
FT                   /db_xref="GOA:B6H1A6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A6"
FT                   /inference="similar to AA sequence:TREMBL:AE003551.31"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /inference="protein motif:COGS:COG2129"
FT                   /inference="protein motif:COGS:COG0639"
FT                   /inference="protein motif:COGS:COG1409"
FT                   /protein_id="CAP91255.1"
FT                   /translation="MRQKTRFVCVSDTHGYTPSETGFKLPAGDVLIHAGDLTNNGSLKE
FT                   LCRTMDWICKADFEIKIIVGGNHDVTLDQAFYREHGARFHGQHLEDSYHCLNLIMESPS
FT                   VVLLRHEPALIRLTRADGPNTVFKIFGSPYSQSPGNWAFGYESNDAAALWAQIPIDTDI
FT                   VVTHTPPQSHCDQKPNGMFVGCAALRSALSLIRPHLAVCGHVHEGRGYERVRWRGNLIN
FT                   TEIETETGPESDSVDHVTRGVLPPMGSKKQSLVDLTGKRDKRLDNEGFSHPRPRQHDLT
FT                   ETQPISSASPGSESSAGVPEKASQRNSPSTHPSLGAGSPGPNSRGFDYALQTLRKETCI
FT                   VNAAIMSTSWPHQGGKRFNSPIVVDLELPVWQNHAVANG"
FT   exon            complement(432227..433170)
FT                   /gene="Pc13g01860"
FT                   /locus_tag="PCH_Pc13g01860"
FT                   /number=1
FT   intron          complement(433171..433316)
FT                   /gene="Pc13g01860"
FT                   /locus_tag="PCH_Pc13g01860"
FT                   /number=1
FT   exon            complement(433317..433512)
FT                   /gene="Pc13g01860"
FT                   /locus_tag="PCH_Pc13g01860"
FT                   /number=2
FT   mRNA            join(<434279..434299,434391..434526,434732..435044,
FT                   435116..>435254)
FT                   /gene="Pc13g01870"
FT                   /locus_tag="PCH_Pc13g01870"
FT   CDS_pept        join(434279..434299,434391..434526,434732..435044,
FT                   435116..435254)
FT                   /gene="Pc13g01870"
FT                   /locus_tag="PCH_Pc13g01870"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit L13a - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01870"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91256"
FT                   /db_xref="GOA:B6H1A7"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A7"
FT                   /inference="similar to AA sequence:SWISSPROT:R13A_YEAST"
FT                   /inference="protein motif:PFAM:PF00572"
FT                   /inference="protein motif:COGS:COG0102"
FT                   /protein_id="CAP91256.1"
FT                   /translation="MSSFESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNIS
FT                   GEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMIPHKTARGAAAMERL
FT                   KVFEGVPPPYDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRK
FT                   VKSKAYYERKKAARRVLAKAEQGANVDSKTKTQLAQYGY"
FT   exon            434279..434299
FT                   /gene="Pc13g01870"
FT                   /locus_tag="PCH_Pc13g01870"
FT                   /number=1
FT   intron          434300..434390
FT                   /gene="Pc13g01870"
FT                   /locus_tag="PCH_Pc13g01870"
FT                   /number=1
FT   exon            434391..434526
FT                   /gene="Pc13g01870"
FT                   /locus_tag="PCH_Pc13g01870"
FT                   /number=2
FT   intron          434527..434731
FT                   /gene="Pc13g01870"
FT                   /locus_tag="PCH_Pc13g01870"
FT                   /number=2
FT   exon            434732..435044
FT                   /gene="Pc13g01870"
FT                   /locus_tag="PCH_Pc13g01870"
FT                   /number=3
FT   intron          435045..435115
FT                   /gene="Pc13g01870"
FT                   /locus_tag="PCH_Pc13g01870"
FT                   /number=3
FT   exon            435116..435254
FT                   /gene="Pc13g01870"
FT                   /locus_tag="PCH_Pc13g01870"
FT                   /number=4
FT   mRNA            complement(<435946..>437340)
FT                   /gene="Pc13g01880"
FT                   /locus_tag="PCH_Pc13g01880"
FT   CDS_pept        complement(435946..437340)
FT                   /gene="Pc13g01880"
FT                   /locus_tag="PCH_Pc13g01880"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   PA3022 - Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01880"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91257"
FT                   /db_xref="GOA:B6H1A8"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A8"
FT                   /inference="similar to AA sequence:PIR:C83268"
FT                   /inference="protein motif:PFAM:PF03476"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /inference="protein motif:COGS:COG3217"
FT                   /protein_id="CAP91257.1"
FT                   /translation="MLIHLLQSLRISQNGPLVIRGAIVLILPLCILLAVVIQSGNIHTT
FT                   RRRLRHLQKLGLTTSNMADQYNPKFCLPPGTAIDGAPRIKAIYLHPIKSCGPVEVDRAL
FT                   LTKSGFMYDRCFAFATKSVTGDDTAASKWKFISQRKNPVMSRVKTELWLPHKYSNLRDP
FT                   LVQSGGCVVMTFEDPDLPSWTSRVETFFHTRNLSAPSQLSFIVPLDVTAAQAKLKTFGI
FT                   HSRDAKGLDIGGIPSIAAALPKLKKFLGIPADQMLTLFKCTPDTLTRTDKNLAPLEHIG
FT                   SPALHGYTDQQPVNINSLSSVHAVSALLPTENQPLNALRFRANIWIINAPAYEEETWKR
FT                   YRILPKSNGTQPRASVAPALSVVCRTSRCTMPNVNPETGSFDADTPPPGRKRGKAQPST
FT                   TLVQYRTVETGNKAALGYLGMHCVPEDGSLKSAEEQGAGLYIEVGDEIEVLERGAHLYG
FT                   STGDDY"
FT   exon            complement(435946..437340)
FT                   /gene="Pc13g01880"
FT                   /locus_tag="PCH_Pc13g01880"
FT                   /number=1
FT   mRNA            join(<438241..438378,438440..438635,438688..439134,
FT                   439203..439832,439888..>440195)
FT                   /gene="Pc13g01890"
FT                   /locus_tag="PCH_Pc13g01890"
FT   CDS_pept        join(438241..438378,438440..438635,438688..439134,
FT                   439203..439832,439888..440195)
FT                   /gene="Pc13g01890"
FT                   /locus_tag="PCH_Pc13g01890"
FT                   /note="unknown EC_number=6.2.1.3"
FT                   /note="Title: strong similarity to acyl-CoA synthase like
FT                   protein An18g03800 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01890"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91258"
FT                   /db_xref="GOA:B6H1A9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A9"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /inference="protein motif:COGS:COG0318"
FT                   /inference="protein motif:COGS:COG0365"
FT                   /inference="protein motif:COGS:COG1020"
FT                   /protein_id="CAP91258.1"
FT                   /translation="MSGSKSRLSGLLGHFTGSTPPVEHRVNTHTLSPTFFLPRAAAVEP
FT                   NAEAIYHVTANNKILRRSYGETADRARGMAYYLKKHGLSRVGILCPNTPAFLESIFGIA
FT                   AAGAVNIAVNYRLKQEDIAYIFDHGDAEVIIVDEEYVPLLEHYRSQHPRIPIIVDTDTD
FT                   ATEGELTGPFDEAVLEGLRHDIDTGSRGWEGLESQAADEESTIALAYTSGTTARPKGVE
FT                   FSHRGCYLATLGNVIETGLNYHRGRARYLWTLPMFHAMGWTFPWAVTAVRGTHYCLRKI
FT                   DYPEIWRLLKEEHITHFNAAPTVNTLLCNAKEAERLPEPVRVTVAASPPTPLLFEQMTD
FT                   LNLHPVHVYGMTETYGPITKGYHLPEWDELPLKDKYQRMARQGHGFITSLPARVIKTEV
FT                   PAGTITDVRKDGQEIGEIVFVGNICARGYYKDPEATRKLFAGGVLHSGDLAVWHPDGAI
FT                   QILDRAKDIIISGGENISSVALESMLVMHPDILEAGVVAVPDSHWGERPKAFVTVKEGK
FT                   SLQGSDLIDWARNTSGISKFMIPREVEVVTELPKTSTGKIRKNILRDWVKGPREA"
FT   exon            438241..438378
FT                   /gene="Pc13g01890"
FT                   /locus_tag="PCH_Pc13g01890"
FT                   /number=1
FT   intron          438379..438439
FT                   /gene="Pc13g01890"
FT                   /locus_tag="PCH_Pc13g01890"
FT                   /number=1
FT   exon            438440..438635
FT                   /gene="Pc13g01890"
FT                   /locus_tag="PCH_Pc13g01890"
FT                   /number=2
FT   intron          438636..438687
FT                   /gene="Pc13g01890"
FT                   /locus_tag="PCH_Pc13g01890"
FT                   /number=2
FT   exon            438688..439134
FT                   /gene="Pc13g01890"
FT                   /locus_tag="PCH_Pc13g01890"
FT                   /number=3
FT   intron          439135..439202
FT                   /gene="Pc13g01890"
FT                   /locus_tag="PCH_Pc13g01890"
FT                   /number=3
FT   exon            439203..439832
FT                   /gene="Pc13g01890"
FT                   /locus_tag="PCH_Pc13g01890"
FT                   /number=4
FT   intron          439833..439887
FT                   /gene="Pc13g01890"
FT                   /locus_tag="PCH_Pc13g01890"
FT                   /number=4
FT   exon            439888..440195
FT                   /gene="Pc13g01890"
FT                   /locus_tag="PCH_Pc13g01890"
FT                   /number=5
FT   mRNA            join(<440999..441730,441788..442471,442526..>442873)
FT                   /gene="Pc13g01900"
FT                   /locus_tag="PCH_Pc13g01900"
FT   CDS_pept        join(440999..441730,441788..442471,442526..442873)
FT                   /gene="Pc13g01900"
FT                   /locus_tag="PCH_Pc13g01900"
FT                   /note="Title: strong similarity to protein involved in SCF
FT                   dependent protein degradation Grr1 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01900"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91259"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B0"
FT                   /inference="similar to AA sequence:PIR:A41529"
FT                   /protein_id="CAP91259.1"
FT                   /translation="MHRLREAGRCPSAAPSETSGSTSPERAADDDTDFFMAQANDSQSS
FT                   IGVANFRDSRLSSEPSEPLPPIGRLPPEILIAIFSKLAAPLDMLNSMLVCRGWAANSVG
FT                   ILWHRPTCNTWANVRSVTTSLGKPDSLFNYADLIKRLNLSALSDDVSDGTILSFNQCKR
FT                   IERLTLTSCKNLTDKGVSDLVEGNRHLQALDVSDLRHLTDHTLATVSRDCPRLQGLNIT
FT                   GCSKVTDDALLIVSQKCRQIKRLKLNGVSNVSDRAIQSFAENCPSILEIDLHDCKLVTS
FT                   ASVTPLLTTLRHLRELRLAHCTELDDTAFLSLPPQVTFDSLRILDLTACENVRDDSVER
FT                   IVRAAPRLRNLVLAKCRFITDRSVMAICRLGKNLHYVHLGHCSNITDSAVISLVKSCNR
FT                   IRYIDLACCNLLTDRSVQQLATLPKLRRIGLVKCQAITDQSILALARPKIGHHPSVSSL
FT                   ERVHLSYCVQLRMKGIHALLNSCPRLTHLSLTGVQEFLRENLTVFCREAPPEFTQQQRD
FT                   VFCVFSGDGVNRLRDHLNRHEPQFQEEAEATMYDDDEELDEDEGQMTGLMNATVINDGD
FT                   DDYIDVGPLNT"
FT   exon            440999..441730
FT                   /gene="Pc13g01900"
FT                   /locus_tag="PCH_Pc13g01900"
FT                   /number=1
FT   intron          441731..441787
FT                   /gene="Pc13g01900"
FT                   /locus_tag="PCH_Pc13g01900"
FT                   /number=1
FT   exon            441788..442471
FT                   /gene="Pc13g01900"
FT                   /locus_tag="PCH_Pc13g01900"
FT                   /number=2
FT   intron          442472..442525
FT                   /gene="Pc13g01900"
FT                   /locus_tag="PCH_Pc13g01900"
FT                   /number=2
FT   exon            442526..442873
FT                   /gene="Pc13g01900"
FT                   /locus_tag="PCH_Pc13g01900"
FT                   /number=3
FT   mRNA            <443096..>443572
FT                   /gene="Pc13g01910"
FT                   /locus_tag="PCH_Pc13g01910"
FT   CDS_pept        443096..443572
FT                   /gene="Pc13g01910"
FT                   /locus_tag="PCH_Pc13g01910"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   contig_1_62_scaffold_4.tfa_400wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01910"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91260"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B1"
FT                   /protein_id="CAP91260.1"
FT                   /translation="MCNRIEFKQFSFLSFIIPQFNDCSCVSVADLRSRPAYVVVYTGRL
FT                   FSDSMWDSLGMNPFSPGLPTLNIPEITDPSTFDIGVTTDTVNPRSTLEISRARDLVFTR
FT                   LSSLQQTLPHRRMDGTLQSVIAIWEEYDSRKADSSSIVHWLDVMREKGLVITLW"
FT   exon            443096..443572
FT                   /gene="Pc13g01910"
FT                   /locus_tag="PCH_Pc13g01910"
FT                   /number=1
FT   mRNA            complement(join(<443747..445030,445074..>445433))
FT                   /gene="Pc13g01920"
FT                   /locus_tag="PCH_Pc13g01920"
FT   CDS_pept        complement(join(443747..445030,445074..445433))
FT                   /gene="Pc13g01920"
FT                   /locus_tag="PCH_Pc13g01920"
FT                   /note="Title: strong similarity to myo-inositol transport
FT                   protein Itr2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01920"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91261"
FT                   /db_xref="GOA:B6H1B2"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B2"
FT                   /inference="similar to AA sequence:PIR:B40538"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP91261.1"
FT                   /translation="MWPLNSKKDDNDTKIANPEPETKDDLESAHIEKIDASIDNIATSI
FT                   DNLPVSWFVWLAALTASMAGLLFGYDTGIISGVLVVLGDSLDGRPATSSEKEMITSLCS
FT                   GGAFIGAIFAGNTADRFGRKMAIYLGCVLFIAGAVLQAAAYTIVQMAIGRLVIGFGVGC
FT                   GAMVLPLYVAEIAPAKARGKLIGLNNMSITGGQVISYAIGAAFASVPHGWRYMVGLGGV
FT                   PAVVLGVLMPFCPESPRHLAYNGRRDEARVVLRKIYAKATEDQIDAVLLSICTACDQAR
FT                   EINESGSRFSKIKKLHTVPSNLRALVSACGLMVISQLSGFNALMYYSATLFSLVGFDNP
FT                   TAVGLVVAGTNFIMTFVNMMVIDGMGRRKLLLSTVWGMSVGMVAIAVAFRWIPINMETM
FT                   EVTTTGISPAAIAVLVFIIWFVVFYGVSVGNTAWMSTDFFPLEVRAMGTMWLTCSNWGA
FT                   NVIISSTFLSMMKAWTTSGAFGFFAAICGLGYIWIYFFYPEVSGLVLEEVKEVFEHGFG
FT                   VDYARQLRKERKDIIEERMKTQEKPIAVGH"
FT   exon            complement(443747..445030)
FT                   /gene="Pc13g01920"
FT                   /locus_tag="PCH_Pc13g01920"
FT                   /number=1
FT   intron          complement(445031..445073)
FT                   /gene="Pc13g01920"
FT                   /locus_tag="PCH_Pc13g01920"
FT                   /number=1
FT   exon            complement(445074..445433)
FT                   /gene="Pc13g01920"
FT                   /locus_tag="PCH_Pc13g01920"
FT                   /number=2
FT   mRNA            complement(join(<446823..448036,448110..>448506))
FT                   /gene="Pc13g01930"
FT                   /locus_tag="PCH_Pc13g01930"
FT   CDS_pept        complement(join(446823..448036,448110..448506))
FT                   /exception="reasons given in citation"
FT                   /gene="Pc13g01930"
FT                   /locus_tag="PCH_Pc13g01930"
FT                   /note="putative sequencing error"
FT                   /note="unknown EC_number=3.2.1.26"
FT                   /note="Title: strong similarity to exo-inulinase inu1
FT                   -Aspergillus niger [putative sequencing error]"
FT                   /db_xref="GOA:B6H1B3"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR037674"
FT                   /db_xref="InterPro:IPR039527"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B3"
FT                   /inference="similar to AA sequence:TREMBL:AAW315793.1"
FT                   /inference="protein motif:PFAM:PF00251"
FT                   /inference="protein motif:COGS:COG1621"
FT                   /protein_id="CAP91262.1"
FT                   /translation="MGFCNWATVIANLLVPLGILTFSSGFFPYKPLIPGLATFDETGEN
FT                   VTVPAVFDKVIFMVVDALRRCLHIATLYIRMTRVSYLHRGDLIRSGAALPFTAYASAPT
FT                   VTMPRLKAITTGSVPSFLDVILNIAESDTTSTLAYQDTWLAQLKAIGGRLVMYGDDTWL
FT                   KLFPGMFDRADGTTSFFVSDFTEVDHNVTRHVPNELARDDWSALIMHYLGLDHIGHKAG
FT                   PKSPFMLPKQHEMDSVVTDIYTAMQQQHHLQSTLFVLCGDHGMNEAGNHGGSSAGETSP
FT                   ALLLMSPKFEALGRRESPVEPSGDMQYYQTVEQADIAPTLAGLLGIPIPLNSLGVFIPD
FT                   FLDMWDNGSHKLRILRQNAEQLLNTLTTTFPGFTFDSDISTSCASEALSAIEEARCAWA
FT                   RVQRLIYDKDEAGDSYSTVGPALLHFLRIAQEVMSRTASNYDVSRLILGLLITGAAGLL
FT                   VLPATYKECTRHGSSGLFLMLMIVTCGMMMFASSYVEEEQQFWYWICSGWIVYLHIKSQ
FT                   SSAKPVSHKRFGSLLYCIFRPHDTIHETLHIFLMTQSRATNVPLFLIFRIQAGILSSMN
FT                   LTGIEVTITTLVFQYMTFFAFGGSNAISSVDLASGYNGVGSYSVVLVGVLTFASNWAGP
FT                   IWWASQSHRLRPKNPAEQNPSALLTFHVAMSLVSVMAACTALRTHLFIWTVFSPKYLYS
FT                   MAWATANHVAVNLLGEAIFSRSQSRYHYS"
FT   exon            complement(446823..448036)
FT                   /gene="Pc13g01930"
FT                   /locus_tag="PCH_Pc13g01930"
FT                   /number=1
FT   mat_peptide     complement(join(446826..448036,448110..448449))
FT                   /gene="Pc13g01930"
FT                   /locus_tag="PCH_Pc13g01930"
FT   intron          complement(448037..448109)
FT                   /gene="Pc13g01930"
FT                   /locus_tag="PCH_Pc13g01930"
FT                   /number=1
FT   exon            complement(448110..448506)
FT                   /gene="Pc13g01930"
FT                   /locus_tag="PCH_Pc13g01930"
FT                   /number=2
FT   sig_peptide     complement(448450..448506)
FT                   /gene="Pc13g01930"
FT                   /locus_tag="PCH_Pc13g01930"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            <449919..>451004
FT                   /gene="Pc13g01940"
FT                   /locus_tag="PCH_Pc13g01940"
FT   CDS_pept        449919..451004
FT                   /gene="Pc13g01940"
FT                   /locus_tag="PCH_Pc13g01940"
FT                   /note="unknown EC_number=1.8.3.1"
FT                   /note="Title: strong similarity to sulfite like protein
FT                   An12g06030 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01940"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91263"
FT                   /db_xref="GOA:B6H1B4"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B4"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /inference="protein motif:PFAM:PF03404"
FT                   /inference="protein motif:COGS:COG2041"
FT                   /protein_id="CAP91263.1"
FT                   /translation="MSTNESRNESSLAESSRVGRAQNECVTIYRPSQHREAPPPHKQQE
FT                   YITHDTLLFEEMHMGIAVVDIAKWRLVVDGMVENPFSISLPELCALPKLSVVAFHECYG
FT                   SPLRPSDRNIWRVGNVTWTGVPLKFLLNIAQPLGSARYMWSEGLDHGAFAGKKITCYQK
FT                   DVPLEKAMSDEVLVAYEVNSEPLRRERGGPVRLVVPGWFGTNSTKWLWRLSFQAQRAPG
FT                   IFASHYYNRPNPQGGIQPVWEVEPNSMIIDPSPNAKVVGPRVMIRGWAWSWDGIEAVQI
FT                   RQSGKSEWQQAETKPRQDFSWQAFRHFIVLPKGRCSVVAQAISRSGKMQPLENQRNCAH
FT                   NVDFEVIVESEGRIHQITDSL"
FT   exon            449919..451004
FT                   /gene="Pc13g01940"
FT                   /locus_tag="PCH_Pc13g01940"
FT                   /number=1
FT   mRNA            complement(<451974..>452741)
FT                   /gene="Pc13g01950"
FT                   /locus_tag="PCH_Pc13g01950"
FT   CDS_pept        complement(451974..452741)
FT                   /gene="Pc13g01950"
FT                   /locus_tag="PCH_Pc13g01950"
FT                   /note="Title: similarity to transcription regulator 2 of
FT                   pai operon paiB - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01950"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91264"
FT                   /db_xref="GOA:B6H1B5"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B5"
FT                   /inference="similar to AA sequence:PIR:B35145"
FT                   /inference="protein motif:PFAM:PF04299"
FT                   /inference="protein motif:COGS:COG2808"
FT                   /protein_id="CAP91264.1"
FT                   /translation="MFLPPVHAETEIAVLFQFIRENPLGMLITGIKSSQEFLQCTHAPF
FT                   VLDLPEETTGSPLQGRLRAHIAKQNPQVKAMIEELVTKPNILELEDNVLVVFNGKYNHY
FT                   VTPKYYVETKPDTGKVVPTWNYSAVQVYGKLSLYYDSKTPEAGAFLAKQMDDLSQHAEK
FT                   SVMGHMGGEKPQPWKVSDAPEKYIELMQRNIVGIEIRIEKVQGKFKMSQEMKPGDREGV
FT                   VAGFTRMGGENAEGMANLVEERGALHDSRAQSG"
FT   exon            complement(451974..452741)
FT                   /gene="Pc13g01950"
FT                   /locus_tag="PCH_Pc13g01950"
FT                   /number=1
FT   mRNA            join(<453284..453655,453721..453787,453950..>454134)
FT                   /gene="Pc13g01960"
FT                   /locus_tag="PCH_Pc13g01960"
FT   CDS_pept        join(453284..453655,453721..453787,453950..454134)
FT                   /gene="Pc13g01960"
FT                   /locus_tag="PCH_Pc13g01960"
FT                   /note="Title: similarity to hypothetical protein
FT                   SPAC13C5.04 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01960"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91265"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B6"
FT                   /inference="similar to AA sequence:PIR:S58096"
FT                   /inference="protein motif:COGS:COG0512"
FT                   /inference="protein motif:COGS:COG0505"
FT                   /inference="protein motif:COGS:COG0518"
FT                   /protein_id="CAP91265.1"
FT                   /translation="MSRPTPLRIAVLINTPSDDYDFWTDVRQAWQESFAKVAPNAEVDF
FT                   YDPVFERAFPDASKYDLIALSGGKADASSSDPWVLGVLDFVRTVVRDHPKTKILGVCWG
FT                   HQAVARALGGEVGAVPTGPIAAIQDIALTDAGKKFLTFATSAVLSFQAHPEISNRLAKK
FT                   MLLADDKEYNGNSTAEQLKAEVQKLDQPTDGVKLLKRVIQWLDE"
FT   exon            453284..453655
FT                   /gene="Pc13g01960"
FT                   /locus_tag="PCH_Pc13g01960"
FT                   /number=1
FT   intron          453656..453720
FT                   /gene="Pc13g01960"
FT                   /locus_tag="PCH_Pc13g01960"
FT                   /number=1
FT   exon            453721..453787
FT                   /gene="Pc13g01960"
FT                   /locus_tag="PCH_Pc13g01960"
FT                   /number=2
FT   intron          453788..453949
FT                   /gene="Pc13g01960"
FT                   /locus_tag="PCH_Pc13g01960"
FT                   /number=2
FT   exon            453950..454134
FT                   /gene="Pc13g01960"
FT                   /locus_tag="PCH_Pc13g01960"
FT                   /number=3
FT   mRNA            complement(join(<455215..456816,456868..>456957))
FT                   /gene="Pc13g01970"
FT                   /locus_tag="PCH_Pc13g01970"
FT   CDS_pept        complement(join(455215..456816,456868..456957))
FT                   /gene="Pc13g01970"
FT                   /locus_tag="PCH_Pc13g01970"
FT                   /note="Title: similarity to RNA polymerase II transcription
FT                   factor Upc2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01970"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91266"
FT                   /db_xref="GOA:B6H1B7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B7"
FT                   /inference="similar to AA sequence:PIR:S61580"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /protein_id="CAP91266.1"
FT                   /translation="MYEPAPPRPKKTDIVRSRNGCQSCRKRRTKCDEKKPVCGTCVRLG
FT                   IVCESVKLDLKFRVVTAPPPKKTGAKAEPAEPDSTRLGLQLFGQHSRSPQIPNINLAQS
FT                   LQHTDRDVFYSTYWEDHCLPALHPIFRCASELLGFPALKDAILALSSCNISRIYAERKY
FT                   STSFPTTGTLSPNLIHQTRSQLYYSSAIKKFISLTQDDHRNNAAEVLTILVLFGYIEAS
FT                   MGNFDGYYCHVQGLSAFLVELRETTGYSLYRALLISWLQSQFLIWWARTYFSSLDVQRN
FT                   MPSIDFPRGLEGTSDSFHDLRVVVLSILCESHRLNVKETLKHWRDKTDFEPALASVLQS
FT                   DRDDTEDRFARLQDESKRLDEWLSYLPPSEQPLVGDASETSPIFFQAHDAALNFAYYVV
FT                   ARIMQCISFLRNLPCRDAQHLGSECLEIEPWARLLLRIVQGTDMQTSIIRNNYTIGFSG
FT                   LLLAASLRCQDLSLSMQIEKWLQTLEEKQPTEEGAFPVYQALAVVKAINRQRTMGRDVF
FT                   GVSQTMDDGGGMPKFTHYNSQMITNILVHGKCRSTGDLFTECIDLQ"
FT   exon            complement(455215..456816)
FT                   /gene="Pc13g01970"
FT                   /locus_tag="PCH_Pc13g01970"
FT                   /number=1
FT   intron          complement(456817..456867)
FT                   /gene="Pc13g01970"
FT                   /locus_tag="PCH_Pc13g01970"
FT                   /number=1
FT   exon            complement(456868..456957)
FT                   /gene="Pc13g01970"
FT                   /locus_tag="PCH_Pc13g01970"
FT                   /number=2
FT   mRNA            join(<459027..459171,459222..459398,459454..460057,
FT                   460107..>460692)
FT                   /gene="Pc13g01980"
FT                   /locus_tag="PCH_Pc13g01980"
FT   CDS_pept        join(459027..459171,459222..459398,459454..460057,
FT                   460107..460692)
FT                   /gene="Pc13g01980"
FT                   /locus_tag="PCH_Pc13g01980"
FT                   /note="unknown EC_number=1.2.1.16"
FT                   /note="Title: strong similarity to succinate-semialdehyde
FT                   dehydrogenase NAD(P)+ gabD - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01980"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91267"
FT                   /db_xref="GOA:B6H1B8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B8"
FT                   /inference="similar to AA sequence:PIR:F65045"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /inference="protein motif:COGS:COG1012"
FT                   /protein_id="CAP91267.1"
FT                   /translation="MSRLSFPQKSSEAVSNNVATAKDLELLVQDQAFIDGCWVKRKQTF
FT                   NVYEPSTAQVLGTVADCDLNDIQSAIESANVAQKNFYSSTTAAQRGNLLRKWHDLVMQN
FT                   IEDLGRILCLENGKTINEAKGEIAYAASFIAWFAEEATRSYGDTIPSSTPNTIVMTEKE
FT                   PVGVCGIVTPWNFPAAMITRKVAPALAAGCAVVIKPPSETPFTCLALTKLALKAEIPGK
FT                   AIQVCPTKNRQVASELATHPLVRKISFTGSTNVGKNLAILAAGTLKRISLELGGNAPFI
FT                   VFDDADVDLAVEGAMMSKFPCSGQTCVCANRLYVQRGILDKFTRSLVQKVSELRLGPGI
FT                   EDSCTQGPLINASAVNKVKNHIEDAVSKGASVEIGGSAPEAPGFFMQPTVLSGVTVDML
FT                   VARDETFGPLAPIFPFDTEEEVLQLANSTEFGLAGYIFSGNVARVMRVARKLEIGMCGV
FT                   NTGKISAAESPFGGVKESGYGLEGSKYGMAEYQTIKTITLGNLHM"
FT   exon            459027..459171
FT                   /gene="Pc13g01980"
FT                   /locus_tag="PCH_Pc13g01980"
FT                   /number=1
FT   intron          459172..459221
FT                   /gene="Pc13g01980"
FT                   /locus_tag="PCH_Pc13g01980"
FT                   /number=1
FT   exon            459222..459398
FT                   /gene="Pc13g01980"
FT                   /locus_tag="PCH_Pc13g01980"
FT                   /number=2
FT   intron          459399..459453
FT                   /gene="Pc13g01980"
FT                   /locus_tag="PCH_Pc13g01980"
FT                   /number=2
FT   exon            459454..460057
FT                   /gene="Pc13g01980"
FT                   /locus_tag="PCH_Pc13g01980"
FT                   /number=3
FT   intron          460058..460106
FT                   /gene="Pc13g01980"
FT                   /locus_tag="PCH_Pc13g01980"
FT                   /number=3
FT   exon            460107..460692
FT                   /gene="Pc13g01980"
FT                   /locus_tag="PCH_Pc13g01980"
FT                   /number=4
FT   mRNA            <461140..>462651
FT                   /gene="Pc13g01990"
FT                   /locus_tag="PCH_Pc13g01990"
FT   CDS_pept        461140..462651
FT                   /gene="Pc13g01990"
FT                   /locus_tag="PCH_Pc13g01990"
FT                   /note="Title: strong similarity to high-affinity glucose
FT                   transporter HGT1 - Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g01990"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91268"
FT                   /db_xref="GOA:B6H1B9"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B9"
FT                   /inference="similar to AA sequence:SWISSPROT:HGT1_KLULA"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP91268.1"
FT                   /translation="MSFELEGTKLSLGVAFTTSCGFLLFGYDQGVFGGLIENGSFQSTF
FT                   RQPSQMVIGQIAATYDLGCFFGAIFCMVYGDRIGRRLSIALGCIVLTIGAVIQTVSFSV
FT                   AQIIVGRFIAGLGNGLNTTAIPVWQSEMSKPQHRGRLAVFHLVLNQLGNVTAQWLNFGL
FT                   GYIGHQQVSWRFPIAFQIFYALVTLVLLPWLPDSSRWLIQKGRLEQAKAVTARLHAKGI
FT                   HDPDLLALHEASVQSVQHELEVSKVSWRTLLQRDSLQTRRRVLLGMGTQFMQQWGGINA
FT                   INYYLPVVFASLQVSRQMSLILSACNAINVMVFTAVALTTIEKVGRKRLMLWGAVGQGT
FT                   CFALLTSGLGVGGSQWSAVAIAFVFAYYTVFGMSWIAVPWMYPAEINTQAWRNRGAGLA
FT                   TATNWICNYAVVLVTPIGIENIDWRYYIIYVVLNFSFVPIVSFWYVETAGLSLEEIDKI
FT                   FEGKTYGIPLDVSEGGATTENEEGKARQDEVNSEWIEAVDSSKRD"
FT   exon            461140..462651
FT                   /gene="Pc13g01990"
FT                   /locus_tag="PCH_Pc13g01990"
FT                   /number=1
FT   mRNA            join(<462938..463012,463078..463160,463216..463559,
FT                   463644..464103,464154..464362,464416..464548,
FT                   464605..464829,464890..465045,465097..>465772)
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT   CDS_pept        join(462938..463012,463078..463160,463216..463559,
FT                   463644..464103,464154..464362,464416..464548,
FT                   464605..464829,464890..465045,465097..465772)
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /note="Title: weak similarity to nitrate assimilation
FT                   regulatory protein nirA - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02000"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91269"
FT                   /db_xref="GOA:B6H1C0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C0"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP91269.1"
FT                   /translation="MPQTKTVKPARKHVTTACIPCRDGKCDGSKPSCKNCESKNKDCTY
FT                   RQRNDKRKIPVRVAVSLLASRVAVLSQHIQNAGFGVPAMDKNDRDTLRGILQSLGIACE
FT                   NVLSDENTSHSAGASFPGSQRPVDTTRFVAHDQTNITSPQPPAPGCDNYHPGGDLPPLH
FT                   ERSAGPSQLSESYRMHVVTPTQFPPNVDVIPSENPETDSEDEVTDQFACRLGRVQLTHD
FT                   GQLRYFGSTSNLNLLDVSDDIRNFTSSLFQKDAQDTLEDLGLNIEVEEAFEKHLLQLYF
FT                   AWQDPCLHVVDSEAFWKAKNQNRYEGLTSAYYSQALCDAMCAMGAAYEPKYHPDLVTFP
FT                   RSLSQFFGDRAKALLELEIENPSLATIQALVICSNYEASGTRDTRGWLYSGMAMRLAFD
FT                   QGLHLDVTPYVEKGIITAEECKIRRTVFWSSSLNDQFWGYYLGRSVRSPVAGVSVRKPC
FT                   WNDRSPMSQQAPRWRSYGCSQVNIQGIANPSDMIFQQWIALYDLMSPVTDVLYGCLEIS
FT                   RTALQELTADTVARLLAWKNNLPNDLNVDATKESYYYLPHVLTLHLQYYQFMIHCHRPY
FT                   ISKNHIQPRPLQGPGPGHARRMCLESAISIVKVLNMYERRYSFRKANVQMVSYVFSAAL
FT                   ILMFVTVPGQSSTQHSDLVRYLSTCFWALDEMGTCFENAKRTSRFLSTLQQQWHKRKRG
FT                   MAQKGAKRGPENENSPGKHPKRSRNTAGTQNWLGDNLCSSAELGVPVAVDSPISHETHD
FT                   LSFFGDNGPDLVEFMDPELCNILLSDGIPRAMN"
FT   exon            462938..463012
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=1
FT   intron          463013..463077
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=1
FT   exon            463078..463160
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=2
FT   intron          463161..463215
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=2
FT   exon            463216..463559
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=3
FT   intron          463560..463643
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=3
FT   exon            463644..464103
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=4
FT   intron          464104..464153
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=4
FT   exon            464154..464362
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=5
FT   intron          464363..464415
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=5
FT   exon            464416..464548
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=6
FT   intron          464549..464604
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=6
FT   exon            464605..464829
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=7
FT   intron          464830..464889
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=7
FT   exon            464890..465045
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=8
FT   intron          465046..465096
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=8
FT   exon            465097..465772
FT                   /gene="Pc13g02000"
FT                   /locus_tag="PCH_Pc13g02000"
FT                   /number=9
FT   mRNA            complement(join(<465931..466562,466612..466684,
FT                   466749..467578,467635..467952,468008..>468200))
FT                   /gene="Pc13g02010"
FT                   /locus_tag="PCH_Pc13g02010"
FT   CDS_pept        complement(join(465931..466562,466612..466684,
FT                   466749..467578,467635..467952,468008..468200))
FT                   /gene="Pc13g02010"
FT                   /locus_tag="PCH_Pc13g02010"
FT                   /note="unknown EC_number=2.2.1.3"
FT                   /note="Title: strong similarity to dihydroxyacetone
FT                   synthase DAS1 - Candida boidinii"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91270"
FT                   /db_xref="GOA:B6H1C1"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C1"
FT                   /inference="similar to AA sequence:TREMBL:AF086822.1"
FT                   /inference="protein motif:PFAM:PF00456"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /inference="protein motif:PFAM:PF02780"
FT                   /inference="protein motif:COGS:COG0021"
FT                   /protein_id="CAP91270.1"
FT                   /translation="MPDDEHAVLTLRNLIFDICNQNGGGHGGSAVGMAAIGVALWKHIM
FT                   RYNPSNPDWFDRDRFVLSNGHCAMFLYALNYLTGFNAWTMNELKGYGGGKENGFTTIAH
FT                   GHPEIECPGIEVTTGPLGQGIANSVGLAIASKNLAARFNRPGYEVVSSRVYCMTGDGCL
FT                   MEGVALEAISLAGHLQLDNLVLVYDNNGVTCDGPLSWINTEDINQKMRASGWHVLDVMD
FT                   GCDNVQAICSSLRRAQSLKGKPTFINIRTVIGVGTTTAGTAKAHHGSFDVESVAKSKLA
FT                   IGQDPYQSHKPTARGLDYFRERKQHGEALEKSWQHLLMQYTLDFPDLASDFASRLRGAK
FT                   PDLGSLLQDLDSSQFSQMPTRESNGLILQKLWETCPSFCGGGADLVNSNKFFYSDTDVF
FT                   HPSVSYQGRYIRYGIREHAMASISNGLAAYHPGTFLPVTATFLMFYIYAAPGVRMGALS
FT                   HLPTIHIATHDSFAEGQNGPTHQPVELDSLYRAMPNLTYIRPSDAEEVIGAWMWAVESA
FT                   SSPTMISVGRDPVDQPAITSRFNVSKGAYVLEEHPDAQLTLVSCGTSLHYAIRAANELS
FT                   EQLSIRCRIVSAPSFDLFDQQPAEYRESVFPLDGNPIISVEEYVATTWARYVTASVGMT
FT                   SYGYSASNPSNYERFGLDTRGIVLRVKRYLAFLNGRSARQMGWRSI"
FT   exon            complement(465931..466562)
FT                   /gene="Pc13g02010"
FT                   /locus_tag="PCH_Pc13g02010"
FT                   /number=1
FT   intron          complement(466563..466611)
FT                   /gene="Pc13g02010"
FT                   /locus_tag="PCH_Pc13g02010"
FT                   /number=1
FT   exon            complement(466612..466684)
FT                   /gene="Pc13g02010"
FT                   /locus_tag="PCH_Pc13g02010"
FT                   /number=2
FT   intron          complement(466685..466748)
FT                   /gene="Pc13g02010"
FT                   /locus_tag="PCH_Pc13g02010"
FT                   /number=2
FT   exon            complement(466749..467578)
FT                   /gene="Pc13g02010"
FT                   /locus_tag="PCH_Pc13g02010"
FT                   /number=3
FT   intron          complement(467579..467634)
FT                   /gene="Pc13g02010"
FT                   /locus_tag="PCH_Pc13g02010"
FT                   /number=3
FT   exon            complement(467635..467952)
FT                   /gene="Pc13g02010"
FT                   /locus_tag="PCH_Pc13g02010"
FT                   /number=4
FT   intron          complement(467953..468007)
FT                   /gene="Pc13g02010"
FT                   /locus_tag="PCH_Pc13g02010"
FT                   /number=4
FT   exon            complement(468008..468200)
FT                   /gene="Pc13g02010"
FT                   /locus_tag="PCH_Pc13g02010"
FT                   /number=5
FT   mRNA            complement(join(<468820..469122,469174..469585,
FT                   469641..>470083))
FT                   /gene="Pc13g02020"
FT                   /locus_tag="PCH_Pc13g02020"
FT   CDS_pept        complement(join(468820..469122,469174..469585,
FT                   469641..470083))
FT                   /gene="Pc13g02020"
FT                   /locus_tag="PCH_Pc13g02020"
FT                   /note="unknown EC_number=1.1.1.14"
FT                   /note="Title: strong similarity to L-iditol-2 dehydrogenase
FT                   SORD - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91271"
FT                   /db_xref="GOA:B6H1C2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C2"
FT                   /inference="similar to AA sequence:PIR:A54674"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /inference="protein motif:COGS:COG1063"
FT                   /inference="protein motif:COGS:COG1064"
FT                   /protein_id="CAP91271.1"
FT                   /translation="MTVSPRTSKGQYLHGPQQLRLEERPMPSIGPSDVRIRVRSTTLCG
FT                   SDMHYFKFGRNGSIEVKEPLCGGHEAAGEVVEVGATALETGKFKVGDSVAIESGVACLE
FT                   CDRCKAGRYNICAQMRFRSSGASFPHFQGTLQEFVDHPAEWCHKLSRTLSFDDGALLEP
FT                   LSVCVHSVNRAGMKQGARCLVLGAGAVGLLCAAVAKIEHRSPVVIADVDKGRVAFALEH
FT                   GFADVGFVVDPKKGDTVESRLSVAKDLALQIGNQKWPGGEEVRQVDHVFECTGVESCVQ
FT                   TSIYATTNGGNVVLVGMGTAIQTWPIAELTGREINVVSVWRYVNCYPRAIEIMEGVRAN
FT                   SLKPDVTKLITHQFVGLDSIPSAYDTAGKTRDGESKLVIKTVVNF"
FT   exon            complement(468820..469122)
FT                   /gene="Pc13g02020"
FT                   /locus_tag="PCH_Pc13g02020"
FT                   /number=1
FT   intron          complement(469123..469173)
FT                   /gene="Pc13g02020"
FT                   /locus_tag="PCH_Pc13g02020"
FT                   /number=1
FT   exon            complement(469174..469585)
FT                   /gene="Pc13g02020"
FT                   /locus_tag="PCH_Pc13g02020"
FT                   /number=2
FT   intron          complement(469586..469640)
FT                   /gene="Pc13g02020"
FT                   /locus_tag="PCH_Pc13g02020"
FT                   /number=2
FT   exon            complement(469641..470083)
FT                   /gene="Pc13g02020"
FT                   /locus_tag="PCH_Pc13g02020"
FT                   /number=3
FT   mRNA            join(<470395..470499,470553..470611,470667..470761,
FT                   470830..471113,471176..471283,471353..471584,
FT                   471637..471934,471983..>472490)
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT   CDS_pept        join(470395..470499,470553..470611,470667..470761,
FT                   470830..471113,471176..471283,471353..471584,
FT                   471637..471934,471983..472490)
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /note="unknown EC_number=1.14.13.22"
FT                   /note="Title: strong similarity to lactone-specific
FT                   esterase estf1 - Pseudomonas fluorescens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91272"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C3"
FT                   /inference="similar to AA sequence:TREMBL:AF090329.2"
FT                   /inference="protein motif:PFAM:PF00743"
FT                   /inference="protein motif:COGS:COG2072"
FT                   /protein_id="CAP91272.1"
FT                   /translation="MASSYAPTAIIIGAGPGGISMAYRLKHELGFNDFLIYEKLDGVGG
FT                   TWRSNTYPGCGCDLPSHLYSFSFNLNANWSKELCEQPEILQYIEDTVDKFDLRQHVVTS
FT                   VECLGGAWNPDEKEWTVKFRDVETGLEFERHATVFVSAVGAISFPRDVRFKGMENFKGD
FT                   MFHTARWDHSVDYTGKRVAVIGNGCSAAQVVPAVSGKAAFVQQYARSAQWYHPRPNKSF
FT                   SQLEKWSFRWLPLWQRWLRLRIFLTAEQEAYTYFSSEAGIKARLAAEDESREYILSRTP
FT                   QQYKKAVVPDFPLGCKRRIFDPGYLDSLHQSNVKLCNEGIQEFTENGIIGSSGIEDEFD
FT                   IVVLATGFQVSQFLAPMEIYGRHGVSLNKQWSESRGAQAYYGTFVHNFPNLAIIFGPNT
FT                   FPANNSALFACETQVCFAVKALFEPILDRRARVVEVKQSAEERHTISLQEQLKGTVFAG
FT                   DCSNWYINEFGRNAASWPARAAFLWLETFWPNWKAFLWKDGSATWPLYRLARWWKMGSW
FT                   CSKASIAAIVAIFLSHNRAGSTLGVTGAFETLHERIRALTCYLAI"
FT   exon            470395..470499
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=1
FT   intron          470500..470552
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=1
FT   exon            470553..470611
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=2
FT   intron          470612..470666
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=2
FT   exon            470667..470761
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=3
FT   intron          470762..470829
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=3
FT   exon            470830..471113
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=4
FT   intron          471114..471175
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=4
FT   exon            471176..471283
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=5
FT   intron          471284..471352
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=5
FT   exon            471353..471584
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=6
FT   intron          471585..471636
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=6
FT   exon            471637..471934
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=7
FT   intron          471935..471982
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=7
FT   exon            471983..472490
FT                   /gene="Pc13g02030"
FT                   /locus_tag="PCH_Pc13g02030"
FT                   /number=8
FT   mRNA            join(<472872..473198,473252..>473992)
FT                   /gene="Pc13g02040"
FT                   /locus_tag="PCH_Pc13g02040"
FT   CDS_pept        join(472872..473198,473252..473992)
FT                   /gene="Pc13g02040"
FT                   /locus_tag="PCH_Pc13g02040"
FT                   /note="unknown EC_number=1.1.1.18"
FT                   /note="Title: strong similarity to myo-inositol
FT                   2-dehydrogenase yisS - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91273"
FT                   /db_xref="GOA:B6H1C4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C4"
FT                   /inference="similar to AA sequence:PIR:B69838"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /inference="protein motif:COGS:COG0673"
FT                   /protein_id="CAP91273.1"
FT                   /translation="MTKVKANIGVVGLGRMGQRHALNILHQVPRAKLFAVCTPASHEIE
FT                   WAKAKLVPDGVLVFQSFEEMIHTPGLDAVVIASPTELHIAQTLTAMQLEIHVLCEKPIT
FT                   RDIPQLRDLMETAKQHPQTKVMVGFVRRFDENYMDAIQKIKSGAIGEPLIVRSQGAEKL
FT                   DKSGFFIEYARQSGGIFVDTVVHDIDLTLSILGEEVRPKALWATGIIAHHHEMKDFKDV
FT                   DNSVGVVEFWGGRIAHYYHSRTTSHGYDNCTDIIGMNGKISINSVPHSNRVQVSNASGI
FT                   MQDCTPSWIDRYREAFVTEVNQFTDAILDNTELPMRLSAAYTGLKIATAFQESLETGRK
FT                   IEFDENGDRIVSNGK"
FT   exon            472872..473198
FT                   /gene="Pc13g02040"
FT                   /locus_tag="PCH_Pc13g02040"
FT                   /number=1
FT   intron          473199..473251
FT                   /gene="Pc13g02040"
FT                   /locus_tag="PCH_Pc13g02040"
FT                   /number=1
FT   exon            473252..473992
FT                   /gene="Pc13g02040"
FT                   /locus_tag="PCH_Pc13g02040"
FT                   /number=2
FT   mRNA            complement(join(<474394..474610,474660..474883,
FT                   474932..475013,475078..475155,475207..475351,
FT                   475405..>475471))
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT   CDS_pept        complement(join(474394..474610,474660..474883,
FT                   474932..475013,475078..475155,475207..475351,
FT                   475405..475471))
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT                   /note="unknown EC_number=1.1.1.250"
FT                   /note="Title: strong similarity to D-arabinitol
FT                   2-dehydrogenase ARDH - Pichia stipitis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91274"
FT                   /db_xref="GOA:B6H1C5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C5"
FT                   /inference="similar to AA sequence:PIR:S57351"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /inference="protein motif:COGS:COG1028"
FT                   /protein_id="CAP91274.1"
FT                   /translation="MANLASSLAARFSLGGRVILITGGGRGIGMALSKTCLDAGATVVV
FT                   TDVLPQPDPVFLDWRKSTPDQLHYYCCDLTNKEEVGRTFTSILEKFHHIHGVVTAAGIC
FT                   IDKPFLKHEWEDIQNLQAVNETGTFFAVQNVVKNMKQYGIKGSIVMICSQSAQHVCPGH
FT                   LLTAYAGSKGFVFSMARSLAHELAPDGIRVNTVSPGYIATDMNLSLASLRPELLKIFCE
FT                   APPLRRVGTPQDVELAVLYLLSGGSSYVTGQDLAIDGGMQVSSGNYKL"
FT   exon            complement(474394..474610)
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT                   /number=1
FT   mat_peptide     complement(join(474397..474610,474660..474883,
FT                   474932..475013,475078..475155,475207..475337))
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT   intron          complement(474611..474659)
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT                   /number=1
FT   exon            complement(474660..474883)
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT                   /number=2
FT   intron          complement(474884..474931)
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT                   /number=2
FT   exon            complement(474932..475013)
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT                   /number=3
FT   intron          complement(475014..475077)
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT                   /number=3
FT   exon            complement(475078..475155)
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT                   /number=4
FT   intron          complement(475156..475206)
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT                   /number=4
FT   exon            complement(475207..475351)
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT                   /number=5
FT   sig_peptide     complement(join(475338..475351,475405..475471))
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(475352..475404)
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT                   /number=5
FT   exon            complement(475405..475471)
FT                   /gene="Pc13g02050"
FT                   /locus_tag="PCH_Pc13g02050"
FT                   /number=6
FT   mRNA            complement(join(<475746..476632,476694..>476973))
FT                   /gene="Pc13g02060"
FT                   /locus_tag="PCH_Pc13g02060"
FT   CDS_pept        complement(join(475746..476632,476694..476973))
FT                   /gene="Pc13g02060"
FT                   /locus_tag="PCH_Pc13g02060"
FT                   /note="Title: similarity to hypothetical protein
FT                   SPCC757.02c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91275"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C6"
FT                   /inference="similar to AA sequence:PIR:T41593"
FT                   /protein_id="CAP91275.1"
FT                   /translation="MTQTGKHALIFGASGISGWSLLNQTLQYPTPTTFNRVTGLCNRPW
FT                   ISEDAYLPDDNRLNIVSGIDLTQSVEAVKAQLKEKVAKVESVDVVFFCAYIQTGDFQSL
FT                   RKVNTDLLQTAIKAISAVSPTMEAVILQTGGKGYGLEFPKEVTIQPPLHEKMPRIPSPW
FT                   RENVFYYDQYDLLKRLSEDQNWTFTEIRPDGIVGFAPGSNVMNMAYGIAFYLTLYREVN
FT                   GKDAKVPFPGRLHGYHTRHTDTFQDILSKMEIFAALNRGKCQNGSSFNCGDGEAVTWAQ
FT                   VWPGICSYFGLNGVEPDGMQKNMQDFVSENKAIWDRLVLTHDLKKGLIESQNWGHTNFM
FT                   LVDFDFAREYSLEAARSVGFNEQIDTLQGYHVTFDRMVNARFIPVPSS"
FT   exon            complement(475746..476632)
FT                   /gene="Pc13g02060"
FT                   /locus_tag="PCH_Pc13g02060"
FT                   /number=1
FT   intron          complement(476633..476693)
FT                   /gene="Pc13g02060"
FT                   /locus_tag="PCH_Pc13g02060"
FT                   /number=1
FT   exon            complement(476694..476973)
FT                   /gene="Pc13g02060"
FT                   /locus_tag="PCH_Pc13g02060"
FT                   /number=2
FT   mRNA            join(<478622..478821,478879..479223,479283..>479481)
FT                   /gene="Pc13g02070"
FT                   /locus_tag="PCH_Pc13g02070"
FT   CDS_pept        join(478622..478821,478879..479223,479283..479481)
FT                   /gene="Pc13g02070"
FT                   /locus_tag="PCH_Pc13g02070"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_26_scaffold_2.tfa_460cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91276"
FT                   /db_xref="GOA:B6H1C7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C7"
FT                   /protein_id="CAP91276.1"
FT                   /translation="MSDFWLTEHIRHLVVQPADARLNPPEGYLFVQDGFIISCGVIYAL
FT                   LYVFVMIRAVKDRVLPGTIKYLSLTLAYELYYAFATTSTRLERICFLAWFELDLTFVAL
FT                   ALWRVYRPDQRKRIAGEMFIYCITALAGLRYLGYLYPDDREQITAYWTGILLQLPVGWV
FT                   YVYGLVKHRSLLGHSLEIWLLRYLGCFTAYGLFIWRYLNVPRNWEYVGSFWSIATIVTT
FT                   LIPETVYPFLYIWVFNQNRNKVKMG"
FT   exon            478622..478821
FT                   /gene="Pc13g02070"
FT                   /locus_tag="PCH_Pc13g02070"
FT                   /number=1
FT   intron          478822..478878
FT                   /gene="Pc13g02070"
FT                   /locus_tag="PCH_Pc13g02070"
FT                   /number=1
FT   exon            478879..479223
FT                   /gene="Pc13g02070"
FT                   /locus_tag="PCH_Pc13g02070"
FT                   /number=2
FT   intron          479224..479282
FT                   /gene="Pc13g02070"
FT                   /locus_tag="PCH_Pc13g02070"
FT                   /number=2
FT   exon            479283..479481
FT                   /gene="Pc13g02070"
FT                   /locus_tag="PCH_Pc13g02070"
FT                   /number=3
FT   mRNA            join(<480553..480791,480978..>481170)
FT                   /gene="Pc13g02080"
FT                   /locus_tag="PCH_Pc13g02080"
FT   CDS_pept        join(480553..480791,480978..481170)
FT                   /gene="Pc13g02080"
FT                   /locus_tag="PCH_Pc13g02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91277"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C8"
FT                   /protein_id="CAP91277.1"
FT                   /translation="MPSTTPKDLTMQTRDFHLPPARAPPSLQPLHHLSQRLLPNPSDLI
FT                   VHGAISAFNNEALLSPSPKQTWLQTGEDANSLIARSIKGPGESAEIVFLVTKNGTWMQY
FT                   NPNYAGNVSHALRIVAMTAFQEQRRLSTCSVSATRNSWR"
FT   exon            480553..480791
FT                   /gene="Pc13g02080"
FT                   /locus_tag="PCH_Pc13g02080"
FT                   /number=1
FT   intron          480792..480977
FT                   /gene="Pc13g02080"
FT                   /locus_tag="PCH_Pc13g02080"
FT                   /number=1
FT   exon            480978..481170
FT                   /gene="Pc13g02080"
FT                   /locus_tag="PCH_Pc13g02080"
FT                   /number=2
FT   mRNA            complement(<481456..>482402)
FT                   /gene="Pc13g02090"
FT                   /locus_tag="PCH_Pc13g02090"
FT   CDS_pept        complement(481456..482402)
FT                   /pseudo
FT                   /gene="Pc13g02090"
FT                   /locus_tag="PCH_Pc13g02090"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to LTR-containing
FT                   retrotransposable elements MARS1 - Ascobolus immersus
FT                   [putative pseudogene]"
FT                   /inference="similar to AA sequence:PIR:S71892"
FT   exon            complement(481456..482402)
FT                   /gene="Pc13g02090"
FT                   /locus_tag="PCH_Pc13g02090"
FT                   /number=1
FT   mRNA            complement(join(<482809..483222,483308..>483720))
FT                   /gene="Pc13g02100"
FT                   /locus_tag="PCH_Pc13g02100"
FT   CDS_pept        complement(join(482809..483222,483308..483720))
FT                   /exception="reasons given in citation"
FT                   /gene="Pc13g02100"
FT                   /locus_tag="PCH_Pc13g02100"
FT                   /note="putative sequencing error"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1495_1.tfa_610wg - Aspergillus fumigatus [putative
FT                   sequencing error]"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C9"
FT                   /protein_id="CAP91279.1"
FT                   /translation="KLEVNANYYPLPIYRKLYIXSRYESKAXLYIAPRISSDTSIPYVD
FT                   AKDIILHLKTIFANLNRRIEAYTAYYKLKIKPKDSFTNFLIEFIXLAEEAIVITENYKR
FT                   NLYSKLPYLLXSXVIXVVNXDTILFDIFTQIYXSIAHEISLXXEVKTSSRTRSTIPATG
FT                   AGGISAANXLNTPRVKREYTLSLSTSERETLIREGXYFNYKEYRYITYNYPKKKPTLAI
FT                   ATTTPTINPPRIDEIIELKANTDSGKVPT"
FT   exon            complement(482809..483222)
FT                   /gene="Pc13g02100"
FT                   /locus_tag="PCH_Pc13g02100"
FT                   /number=1
FT   mat_peptide     complement(join(482812..483222,483308..483648))
FT                   /gene="Pc13g02100"
FT                   /locus_tag="PCH_Pc13g02100"
FT   intron          complement(483223..483307)
FT                   /gene="Pc13g02100"
FT                   /locus_tag="PCH_Pc13g02100"
FT                   /number=1
FT   exon            complement(483308..483720)
FT                   /gene="Pc13g02100"
FT                   /locus_tag="PCH_Pc13g02100"
FT                   /number=2
FT   sig_peptide     complement(483649..483720)
FT                   /gene="Pc13g02100"
FT                   /locus_tag="PCH_Pc13g02100"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<484774..485273,485337..485349,
FT                   485406..485532,485581..>485714))
FT                   /gene="Pc13g02110"
FT                   /locus_tag="PCH_Pc13g02110"
FT   CDS_pept        complement(join(484774..485273,485337..485349,
FT                   485406..485532,485581..485714))
FT                   /gene="Pc13g02110"
FT                   /locus_tag="PCH_Pc13g02110"
FT                   /note="Title: similarity to hypothetical protein An03g06600
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91280"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D0"
FT                   /protein_id="CAP91280.1"
FT                   /translation="MPKKKGCAAKIVKKPSWIPVSPDLSRDRVIQNNLPGKELLYALAS
FT                   LRLHSKYSDISLTCGNTIYTVYKCIVCTRSEFFAKACSSGFKESSIDYRVKGCLSGSSH
FT                   DILEETSTVNDSGSPTVFTAKPIPYIAESGADEDSLGRPVEPIEDLIAEIDPLSFHILI
FT                   YSLADRMFIVGLEAISKAKVERELLRRLDANTFQSAIVEIYNSTPASDRGLRDLAVEIT
FT                   LYHLRELRTSKERADFAFPSWRDPCHNLRLICLPQ"
FT   exon            complement(484774..485273)
FT                   /gene="Pc13g02110"
FT                   /locus_tag="PCH_Pc13g02110"
FT                   /number=1
FT   intron          complement(485274..485336)
FT                   /gene="Pc13g02110"
FT                   /locus_tag="PCH_Pc13g02110"
FT                   /number=1
FT   exon            complement(485337..485349)
FT                   /gene="Pc13g02110"
FT                   /locus_tag="PCH_Pc13g02110"
FT                   /number=2
FT   intron          complement(485350..485405)
FT                   /gene="Pc13g02110"
FT                   /locus_tag="PCH_Pc13g02110"
FT                   /number=2
FT   exon            complement(485406..485532)
FT                   /gene="Pc13g02110"
FT                   /locus_tag="PCH_Pc13g02110"
FT                   /number=3
FT   intron          complement(485533..485580)
FT                   /gene="Pc13g02110"
FT                   /locus_tag="PCH_Pc13g02110"
FT                   /number=3
FT   exon            complement(485581..485714)
FT                   /gene="Pc13g02110"
FT                   /locus_tag="PCH_Pc13g02110"
FT                   /number=4
FT   mRNA            <486089..>486868
FT                   /gene="Pc13g02120"
FT                   /locus_tag="PCH_Pc13g02120"
FT   CDS_pept        486089..486868
FT                   /gene="Pc13g02120"
FT                   /locus_tag="PCH_Pc13g02120"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   slr1870 - Synechocystis sp."
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91281"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I0"
FT                   /inference="similar to AA sequence:PIR:S77109"
FT                   /inference="protein motif:COGS:COG1432"
FT                   /protein_id="CAP91281.1"
FT                   /translation="MAGDTIPKLAVLIDADNARPSVVNLLLSEIAKYGTAHAKRAHGDW
FT                   TRSSLQGWKDVLLEQSIQPIQQFAYTHGKNATDSAMIIDAMDLLYSNRYDGFCLVSSDS
FT                   DFTRLAARIRESGLIVYGFGEQKTPKPFVAACDKFIYTENLVHLDELVPHTNSVMIPGN
FT                   HVPTLQAQNDSRLRNQLRTTVEAASDDDGWARLSSVGQLLTKKYPDFDSRSYGYHKLSD
FT                   LIAASSWFETTRRSLRNGLSPEIFVRDKRRKSKALAD"
FT   exon            486089..486868
FT                   /gene="Pc13g02120"
FT                   /locus_tag="PCH_Pc13g02120"
FT                   /number=1
FT   mRNA            join(<488391..488465,488526..488550,488620..488826,
FT                   488925..489012,489151..489451,489538..489808,
FT                   489916..490672,490726..>490975)
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT   CDS_pept        join(488391..488465,488526..488550,488620..488826,
FT                   488925..489012,489151..489451,489538..489808,
FT                   489916..490672,490726..490975)
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /note="unknown EC_number=3.5.1.-"
FT                   /note="Title: weak similarity to glutaminase A gtaA
FT                   -Aspergillus oryzae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91282"
FT                   /db_xref="GOA:B6H1I1"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014870"
FT                   /db_xref="InterPro:IPR032514"
FT                   /db_xref="InterPro:IPR033433"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I1"
FT                   /protein_id="CAP91282.1"
FT                   /translation="MWPLSPLLLLSLAAGSFVRLSSYPLAVKTPYLPAWLPGDQAKNVS
FT                   TARPEFWAGQPLTWKVITRVNGEVYSLFGCPDENITSVDQISISYSATHTVVTLKTGNN
FT                   NNIEGEVDVMTAIDESWSAQPGQMVMGCAAPSTILSQFPLFGQVSRNISNYTRDDLVAF
FT                   AYRFGCRNVVQTSSVTFAIGLQQDLNGFFGEVYESLYFEPLWSTTEEVVDHFLEDEACA
FT                   REESKKLDQQLIIFCSWLISSSWGLIHISVPWCSKDTSYHLGFMKAISASGRVSPISGL
FT                   LPSALPAFYVLAPDYIPLLLKPVLNMTLGWPMDYALHDIGKHYPNATGPTENDEYTFPL
FT                   QQTSTLLWMVYAYQKPSGDIEWAKPFLPALHRYADYLVRHGQYPPEERSTIDHNESRAN
FT                   QTLIAISASIGLKAYGALSGMANYTDIGNLYASTIMDLGTDTKQAHFTSHYGRADSSWI
FT                   TSYPLAYDKLLGLDTFDEAVYEMQSTWYKDLIQPDGLQFSSDVQFTVADLEMMAAATCS
FT                   NDVQALIVDSLHQTTTSRIDSVPGPTRWNVTGANSGRQSSTKAQAAVGGYWMLAAVNMS
FT                   GQGVPVELPSELWLTQDIYQVPLKPSQVSLTKVRIPELIAQGHKGQTQKNGTAVRPGAQ
FT                   QPEGSKDIQEVVTASKLIHIDL"
FT   sig_peptide     488391..488456
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            488391..488465
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=1
FT   mat_peptide     join(488457..488465,488526..488550,488620..488826,
FT                   488925..489012,489151..489451,489538..489808,
FT                   489916..490672,490726..490972)
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT   intron          488466..488525
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=1
FT   exon            488526..488550
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=2
FT   intron          488551..488619
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=2
FT   exon            488620..488826
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=3
FT   intron          488827..488924
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=3
FT   exon            488925..489012
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=4
FT   intron          489013..489150
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=4
FT   exon            489151..489451
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=5
FT   intron          489452..489537
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=5
FT   exon            489538..489808
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=6
FT   intron          489809..489915
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=6
FT   exon            489916..490672
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=7
FT   intron          490673..490725
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=7
FT   exon            490726..490975
FT                   /gene="Pc13g02130"
FT                   /locus_tag="PCH_Pc13g02130"
FT                   /number=8
FT   mRNA            complement(join(<491195..491359,491427..492373,
FT                   492423..492448,492493..>493149))
FT                   /gene="Pc13g02140"
FT                   /locus_tag="PCH_Pc13g02140"
FT   CDS_pept        complement(join(491195..491359,491427..492373,
FT                   492423..492448,492493..493149))
FT                   /exception="reasons given in citation"
FT                   /gene="Pc13g02140"
FT                   /locus_tag="PCH_Pc13g02140"
FT                   /note="putative sequencing error"
FT                   /note="Title: strong similarity to hypothetical membrane
FT                   transport protein SPAC3H1.06c - Schizosaccharomyces pombe
FT                   [putative sequencing error]"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I2"
FT                   /inference="similar to AA sequence:PIR:T38738"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP91283.1"
FT                   /translation="EVRKKRNPIGGIEIFTTSLSEIDRILTIKSSIEEDLKLREIKKIL
FT                   PLEYHDLAEVFSKKKLDKLPLYRPGVDHDIILKAEAXPGYYPLYKLSLNKLKAAKXYII
FT                   KNLDKGFIILSASPYISLILIVKKPSGRLRFYINFRKLNIITKKDYYPLPLIDKVLXRT
FT                   SKAKYFTKLNIRXGFYRIRLTLGAEDLTTFRTRYGSFKYKVILFGLTNGPAIFXRFINN
FT                   ILREYIDKYIVTFI"
FT   exon            complement(491195..491359)
FT                   /gene="Pc13g02140"
FT                   /locus_tag="PCH_Pc13g02140"
FT                   /number=1
FT   intron          complement(491360..491426)
FT                   /gene="Pc13g02140"
FT                   /locus_tag="PCH_Pc13g02140"
FT                   /number=1
FT   exon            complement(491427..492373)
FT                   /gene="Pc13g02140"
FT                   /locus_tag="PCH_Pc13g02140"
FT                   /number=2
FT   intron          complement(492374..492422)
FT                   /gene="Pc13g02140"
FT                   /locus_tag="PCH_Pc13g02140"
FT                   /number=2
FT   exon            complement(492423..492448)
FT                   /gene="Pc13g02140"
FT                   /locus_tag="PCH_Pc13g02140"
FT                   /number=3
FT   intron          complement(492449..492492)
FT                   /gene="Pc13g02140"
FT                   /locus_tag="PCH_Pc13g02140"
FT                   /number=3
FT   exon            complement(492493..493149)
FT                   /gene="Pc13g02140"
FT                   /locus_tag="PCH_Pc13g02140"
FT                   /number=4
FT   mRNA            complement(<493631..>493987)
FT                   /gene="Pc13g02150"
FT                   /locus_tag="PCH_Pc13g02150"
FT   CDS_pept        complement(493631..493987)
FT                   /pseudo
FT                   /gene="Pc13g02150"
FT                   /locus_tag="PCH_Pc13g02150"
FT                   /note="putative pseudogene"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An11g05870 - Aspergillus niger [putative pseudogene]"
FT   exon            complement(493631..493987)
FT                   /gene="Pc13g02150"
FT                   /locus_tag="PCH_Pc13g02150"
FT                   /number=1
FT   mRNA            <494415..>495099
FT                   /gene="Pc13g02160"
FT                   /locus_tag="PCH_Pc13g02160"
FT   CDS_pept        494415..495099
FT                   /pseudo
FT                   /gene="Pc13g02160"
FT                   /locus_tag="PCH_Pc13g02160"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to polyketide synthase PKS1
FT                   -Cochliobolus heterostrophus [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:CHU68040.1"
FT                   /inference="protein motif:COGS:COG3321"
FT                   /inference="protein motif:COGS:COG1020"
FT   exon            494415..495099
FT                   /gene="Pc13g02160"
FT                   /locus_tag="PCH_Pc13g02160"
FT                   /number=1
FT   mRNA            <495404..>498367
FT                   /gene="Pc13g02170"
FT                   /locus_tag="PCH_Pc13g02170"
FT   CDS_pept        495404..498367
FT                   /gene="Pc13g02170"
FT                   /locus_tag="PCH_Pc13g02170"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   9G6.250 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02170"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91286"
FT                   /db_xref="GOA:B6H1I3"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H1I3"
FT                   /inference="protein motif:COGS:COG2234"
FT                   /inference="protein motif:COGS:COG2195"
FT                   /inference="protein motif:COGS:COG0624"
FT                   /protein_id="CAP91286.1"
FT                   /translation="MATRKARNPLAFMPWPVTILTTAMYLALIIPLLVIHHNVPPAPRT
FT                   SPNGLNLTEAWQDLQSLTKGFHPYNSHQNDEVRSWLLERIDAIKQSTPSTEEYRDAKEE
FT                   KPDVFVFDDLVSNLTFIDKSVGVYFEGTNILVYIRGSEDNKQNWWETPGRAPVGKGGVL
FT                   VNAHYDSVSTGYGATDDGVGVVTCLQLVKYFLTPGHAPRRGLVVLFNNGEEDYLNGARV
FT                   YSQHPMARFAHTFLNLEGAGAGGRATLFRSSDTEVTQAYAKSEHPFGSVLSANGFEKGL
FT                   ISSQTDYVVLEGILGLRGLDVAFFEPRARYHTDQDDARHTSIDSLWHMLSTAVATTEEL
FT                   VSDTTDRFDGHIRDDGTVPSGSGTRAVWFDLFGSAFAVFRLHTLFALSVTLLIVAPLTL
FT                   LVTSVILSRADKMYLFRSSVYSEINDDYIPLRGLRGFFRFPFLISIPTGVTVGLAYMVT
FT                   KVNPFIAHSSSYAVWSMMISAWIFLAWFVSRVANSARPSAFHRVYTWTWMFVLTWSLMV
FT                   VCTVYEHEEGLAGGYFIFFYFAGTFLATWISYLELFALPTKSEYVGRLAESRRPSTQGS
FT                   RLAASGDEHQDDAAEEDPTESTSLLHGRHRPTFANYVRVGVDRASQDEEEEEEDPNVYE
FT                   HEQGWSGVLPRWTWLLQLLITAPVILMLIVPLALLTTSALSQTGQDGSPQLLIYLFISC
FT                   LTALLFAPMLPFIHRYTYHLPIFLLFVFIGTMIYNLVAFPFADSNRLKLFFLQEVDLDN
FT                   GISTASLTGMPPFVSDVTYGLPSAAGQNESCDWTFRGKRKLQRCSWSAPLPHVVPDGDS
FT                   LSVSSEDADSLLDATELSPDWISFSISHPQRDSSSVRFEVSGQNTRNCRINMDGNSITN
FT                   FSVIGSSAPDHRFLNPSPDGLNRIQLWSRTWDNKWTVDVDFSKHDSSETDEVDESSITG
FT                   RITCLWSDNNRVGLIPALDEVRQFSPAWVAVTKFSDGLIEGSRAFEIKRSSLGALGS"
FT   exon            495404..498367
FT                   /gene="Pc13g02170"
FT                   /locus_tag="PCH_Pc13g02170"
FT                   /number=1
FT   mRNA            complement(<499214..>500314)
FT                   /gene="Pc13g02180"
FT                   /locus_tag="PCH_Pc13g02180"
FT   CDS_pept        complement(499214..500314)
FT                   /gene="Pc13g02180"
FT                   /locus_tag="PCH_Pc13g02180"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1471_1.tfa_970cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91287"
FT                   /db_xref="GOA:B6H1I4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I4"
FT                   /protein_id="CAP91287.1"
FT                   /translation="MGDFTAPGNGISGHYQGTSLGMKITIATLAGVTWYNAFELMILLF
FT                   VTFAEYRGLYFWSLFISSSVGLLPYSLGFLLKFFKITDDIAWFPVTLLTIGWWSMVTGQ
FT                   SIVLYSRLHLVVSNQRVLRRVLIMIVVNAIILHLPTTALTYGTNMADDTTLWTKTYNIM
FT                   EKIQMTGFCIQEFIISGLYIWETVRMLRLDPDRIKRKIQYQLLAINLIIIILDLGLLVA
FT                   EYLDFYIMETMLKGVVYSIKLKLEFAVLGKLIHLVHNHVWKPESFSAPRDLPDFVDATR
FT                   VTSDMTHATHSAIQRRPSRMDADDISIAMFEHLPPDRIRTNSDLSHSWSNEGRAYHVDH
FT                   LPIDFTNPFAHYPRYQSRRGIPEKPG"
FT   exon            complement(499214..500314)
FT                   /gene="Pc13g02180"
FT                   /locus_tag="PCH_Pc13g02180"
FT                   /number=1
FT   mRNA            complement(<501217..>502122)
FT                   /gene="Pc13g02190"
FT                   /locus_tag="PCH_Pc13g02190"
FT   CDS_pept        complement(501217..502122)
FT                   /gene="Pc13g02190"
FT                   /locus_tag="PCH_Pc13g02190"
FT                   /note="Title: strong similarity to hypothetical
FT                   UDP-galactose 4-epimerase - Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91288"
FT                   /db_xref="GOA:B6H1I5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I5"
FT                   /inference="similar to AA sequence:TREMBL:AP002998.26"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /inference="protein motif:COGS:COG1088"
FT                   /inference="protein motif:COGS:COG0451"
FT                   /inference="protein motif:COGS:COG1087"
FT                   /protein_id="CAP91288.1"
FT                   /translation="MGKRIVITGGSGKAGQHIIRYLLQQGHDLLNLDLVPLPAELEERV
FT                   HTLRVDLTNTGQVYSALGSHFHLSEPFREPLGLVPDAVIHMAGYSRNMIVPDEETFRSN
FT                   TSAMYNIIEGASRLGIKKIIIASSITVYGVSYAEGDVDYPSFPVDETVDANPMDTYAIS
FT                   KVCGESIARGFARRYGRDIYILRIGRIVAPEEYKQSMFRSYVENPEKWAPHGWAYIDAR
FT                   DLGQMCDRAVQKDGLGFQIFNAVNDGITNYENTAEFLARVCPGVPVTRELGAREAPICN
FT                   RKIKELLGFREEHHWMKYYE"
FT   exon            complement(501217..502122)
FT                   /gene="Pc13g02190"
FT                   /locus_tag="PCH_Pc13g02190"
FT                   /number=1
FT   mRNA            complement(<503512..>504276)
FT                   /gene="Pc13g02200"
FT                   /locus_tag="PCH_Pc13g02200"
FT   CDS_pept        complement(503512..504276)
FT                   /gene="Pc13g02200"
FT                   /locus_tag="PCH_Pc13g02200"
FT                   /note="Title: similarity to hypothetical protein
FT                   -Mycobacterium avium"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02200"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91289"
FT                   /db_xref="GOA:B6H1I6"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I6"
FT                   /inference="similar to AA sequence:TREMBLNEW:AE017241.111"
FT                   /protein_id="CAP91289.1"
FT                   /translation="MESPKKLKIASLGSSFAAGPDIPPQIEPRAALRSGQNYPHLLAQH
FT                   LNADLTDLSVSGATLLNITVEPQATPFNVTFPPQSSDLPEDANIITVTAGGNDINYIGG
FT                   MIADACDAELQSSVSLSPSELAERLGGVLDQIHKRAPGARIFLVEYLAVLGPGTQAGRD
FT                   IPLTQERIQYHRGVADVLQHAYSVAVQGRTDWCETVPIHQLSQEHALGSKEPWVGGFES
FT                   GPLLHPNLDGMKAVADILAETIRKSTLSKALL"
FT   exon            complement(503512..504276)
FT                   /gene="Pc13g02200"
FT                   /locus_tag="PCH_Pc13g02200"
FT                   /number=1
FT   mRNA            <505248..>505661
FT                   /gene="Pc13g02210"
FT                   /locus_tag="PCH_Pc13g02210"
FT   CDS_pept        505248..505661
FT                   /gene="Pc13g02210"
FT                   /locus_tag="PCH_Pc13g02210"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_7_scaffold_1.tfa_1010wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91290"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I7"
FT                   /protein_id="CAP91290.1"
FT                   /translation="MQISQFLLATGLFASSILAAPITSSDWTILDMKRVCNGENTSCTW
FT                   TFGIDSGLDITDCTFIVEATDASHANGGPSTCGAYTVSSGWSGEFDPTNGFTTLSVANE
FT                   EIGQIIWPAYTDEQLADGDVVKPDQSYPPTAFP"
FT   sig_peptide     505248..505304
FT                   /gene="Pc13g02210"
FT                   /locus_tag="PCH_Pc13g02210"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            505248..505661
FT                   /gene="Pc13g02210"
FT                   /locus_tag="PCH_Pc13g02210"
FT                   /number=1
FT   mat_peptide     505305..505658
FT                   /gene="Pc13g02210"
FT                   /locus_tag="PCH_Pc13g02210"
FT   mRNA            complement(<505971..>506774)
FT                   /gene="Pc13g02220"
FT                   /locus_tag="PCH_Pc13g02220"
FT   CDS_pept        complement(505971..506774)
FT                   /gene="Pc13g02220"
FT                   /locus_tag="PCH_Pc13g02220"
FT                   /note="Title: strong similarity to proline racemase prdF
FT                   -Clostridium sticklandii"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91291"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I8"
FT                   /inference="similar to AA sequence:TREMBL:CST130879.14"
FT                   /inference="protein motif:PFAM:PF05544"
FT                   /inference="protein motif:COGS:COG3938"
FT                   /protein_id="CAP91291.1"
FT                   /translation="MESEEYAPMSGSNTICTATVLLETGMVPMKEPITQLTLDTAAGLV
FT                   TVEAKCEGGKCKSVAFDNVPAFVFELDYQVLVPGLGEVSVDIAWGGMMYVLVAAASVGL
FT                   KVESRYSTQLVEIGERIKRAVQATYTPVHPVNPKIKGVSILAFTEPLVEENGCKAAVNT
FT                   VVVSPGRFDRSPCGTGTCARLAVLHARGQLAEGEVFKHRSIIGTEFTSHIRGTTRVGGY
FT                   KAVLPTVAGRAWITSFKQVVLDSSDPFPEGFRVGDQWQMAPSSLL"
FT   exon            complement(505971..506774)
FT                   /gene="Pc13g02220"
FT                   /locus_tag="PCH_Pc13g02220"
FT                   /number=1
FT   mRNA            complement(join(<507640..508502,508550..508581,
FT                   508757..>508917))
FT                   /gene="Pc13g02230"
FT                   /locus_tag="PCH_Pc13g02230"
FT   CDS_pept        complement(join(507640..508502,508550..508581,
FT                   508757..508917))
FT                   /gene="Pc13g02230"
FT                   /locus_tag="PCH_Pc13g02230"
FT                   /note="Title: similarity to hypothetical protein encoded by
FT                   B1D4.080 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91292"
FT                   /db_xref="GOA:B6H1I9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I9"
FT                   /inference="similar to AA sequence:TREMBL:NCB1D4.6"
FT                   /protein_id="CAP91292.1"
FT                   /translation="MQEQKSQSCADLLILPRNKGDAGDWRQTRRTNFHLDDPNNLSDII
FT                   PGWSNICIITRNSGVETGFNTWSRFSVKKVDHDARFKWYHPNIFTRWLPLTKQTIILAF
FT                   DLDPPIKERFLKSVMKSEESWLNDPFWVYPHLVEQIALIQEPAVWAIRDHVRSMETEGK
FT                   PQGRPQPDYRRLHDIARHAIHVNETLDIAVQNIEHILTQHASYTKSKPDNTSPASEDIH
FT                   LRLGSWQSFIANLRSRSIANEKRLQNEIQLAFNTVAQHDASVTLEIGRATQLDSATMKT
FT                   IAFVTLTFLPPTFICAIFSTSFFDFGGDSGWSMSNKFWVYWVFAIPTTVFTTLVWTYWP
FT                   NIRRIFFSKNE"
FT   exon            complement(507640..508502)
FT                   /gene="Pc13g02230"
FT                   /locus_tag="PCH_Pc13g02230"
FT                   /number=1
FT   intron          complement(508503..508549)
FT                   /gene="Pc13g02230"
FT                   /locus_tag="PCH_Pc13g02230"
FT                   /number=1
FT   exon            complement(508550..508581)
FT                   /gene="Pc13g02230"
FT                   /locus_tag="PCH_Pc13g02230"
FT                   /number=2
FT   intron          complement(508582..508756)
FT                   /gene="Pc13g02230"
FT                   /locus_tag="PCH_Pc13g02230"
FT                   /number=2
FT   exon            complement(508757..508917)
FT                   /gene="Pc13g02230"
FT                   /locus_tag="PCH_Pc13g02230"
FT                   /number=3
FT   mRNA            complement(join(<509129..509322,509382..509956,
FT                   510042..510241,510290..>510925))
FT                   /gene="Pc13g02240"
FT                   /locus_tag="PCH_Pc13g02240"
FT   CDS_pept        complement(join(509129..509322,509382..509956,
FT                   510042..510241,510290..510925))
FT                   /gene="Pc13g02240"
FT                   /locus_tag="PCH_Pc13g02240"
FT                   /note="Title: strong similarity to choline permease Hnm1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91293"
FT                   /db_xref="GOA:B6H1J0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J0"
FT                   /inference="similar to AA sequence:PIR:S11175"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /inference="protein motif:COGS:COG0833"
FT                   /protein_id="CAP91293.1"
FT                   /translation="MADEVTAPQQHSSKNKGSEPHPPGQFPSVEEGKQTSANGVLEALG
FT                   YEPELVRNRSTLQVAFMSFVLAAIPYGLATTFTYPLIGGGPVNIIWGWLAVSLITLCVA
FT                   ASLGEITSVYPTAGGVYYQTFMLSPPSYRRIASWICGWSYVVGNITITLAVNLGSTLFF
FT                   VSCINVFESAPGVGIFQATTYQVFLIFLAVTFLANAISAFGNKWLPYLDTFAIFWTLAG
FT                   VLAIVICILAIAKEGRHDAEYVFTSFEPASGWPAGWSFCVGLLQAAYTTSSTGMVICMC
FT                   EEVREPSTQVPKAMVGTVILNTLAGFLFLVPLVFVLPDTKVLAALESGQPVPSIIKSAI
FT                   GSPVGSFLLLLPLILLSLFCVIGCTTAVSRSTWAFARDGGIPGSVWWRQVNRDGVPFNA
FT                   MMLGMTVQILLGFIYFGSTTAFNAFTGVGVITLTVSYVCPIVVSLAGGRRHIKNGQFDL
FT                   GTLGLVCNIVALGWCILVIPLFCMPSSIPVAANTVNYAPVVFVAFILVASGWYWVWGYE
FT                   KYVGPPTMDDEFRSSAW"
FT   exon            complement(509129..509322)
FT                   /gene="Pc13g02240"
FT                   /locus_tag="PCH_Pc13g02240"
FT                   /number=1
FT   intron          complement(509323..509381)
FT                   /gene="Pc13g02240"
FT                   /locus_tag="PCH_Pc13g02240"
FT                   /number=1
FT   exon            complement(509382..509956)
FT                   /gene="Pc13g02240"
FT                   /locus_tag="PCH_Pc13g02240"
FT                   /number=2
FT   intron          complement(509957..510041)
FT                   /gene="Pc13g02240"
FT                   /locus_tag="PCH_Pc13g02240"
FT                   /number=2
FT   exon            complement(510042..510241)
FT                   /gene="Pc13g02240"
FT                   /locus_tag="PCH_Pc13g02240"
FT                   /number=3
FT   intron          complement(510242..510289)
FT                   /gene="Pc13g02240"
FT                   /locus_tag="PCH_Pc13g02240"
FT                   /number=3
FT   exon            complement(510290..510925)
FT                   /gene="Pc13g02240"
FT                   /locus_tag="PCH_Pc13g02240"
FT                   /number=4
FT   mRNA            complement(<513181..>514125)
FT                   /gene="Pc13g02250"
FT                   /locus_tag="PCH_Pc13g02250"
FT   CDS_pept        complement(513181..514125)
FT                   /gene="Pc13g02250"
FT                   /locus_tag="PCH_Pc13g02250"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An15g06870 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91294"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J1"
FT                   /protein_id="CAP91294.1"
FT                   /translation="MACLVKTMRDPPRESIAQVDGDANTWLIGPLQLHCRKGSSGTFTW
FT                   YDEDDNLSYTLTDAPDPLPPTIPLDDPRFKLVYDAGDSSAVWSVGNSAFCKVKLCRQGV
FT                   TSEAATLKFVQKLVYEQQPDFKIPKVLHQTEHNDRSYLFLTRVQGRTLGDAWPTLDEKW
FT                   RQHYIKAIVNVCKFLESQECDKLCGADGKNALELYLIKYGAEKDYSPDNLRQGCILIGM
FT                   DCSKFVFYHADLGPRNIIVEDIPKTGTVGIIDWELAGYFPRGWIRTKFRISSGLNLPDT
FT                   ATDKPTAWRSGVQELLGEDGFEHYAPEWLSWWD"
FT   exon            complement(513181..514125)
FT                   /gene="Pc13g02250"
FT                   /locus_tag="PCH_Pc13g02250"
FT                   /number=1
FT   mRNA            join(<515497..515601,515684..>517471)
FT                   /gene="Pc13g02260"
FT                   /locus_tag="PCH_Pc13g02260"
FT   CDS_pept        join(515497..515601,515684..517471)
FT                   /gene="Pc13g02260"
FT                   /locus_tag="PCH_Pc13g02260"
FT                   /note="Title: similarity to transcription activator of
FT                   lysine pathway Lys14 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91295"
FT                   /db_xref="GOA:B6H1J2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J2"
FT                   /inference="similar to AA sequence:PIR:S61587"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /protein_id="CAP91295.1"
FT                   /translation="MENTKELPSPQKKRQNPNRCRPKSRGGCQRCKQRRRRCDEAKPSC
FT                   QECTKRGHTCPGYQKQSLQWRYVFKGSEEAHQPVPPIGSPSTIATESFEVNNSTEQGKD
FT                   NIQDETHNIWDTACPNLFDQLPNFDGPTDAWFYTESTSNGTALGKPDGEVDGLSILRQR
FT                   LAHTSVPSFLIQLPVMLVQYYFHTVCNQWSSFDCPLNPFRTIISRLWSRNAAIYFAIQS
FT                   MSAASLANDFPTMRAIGIQTQQQAIACLNNSVQKGSTQTKDDEYFLALLMIGSTTAWHD
FT                   ASDLGLPYLRAAQDHLLRQERQYKNADSALAKQHPLFKQCLLWWNLLAAFVTEDSPIVD
FT                   VESSIENSETDLAVYLVDGQILPHPWTGSLRYSLSLFYRTARIIRAAKTSHRRRPEALD
FT                   PTLIDLTSMAEELELRQEAENLEDKILFTGFSFYCGPIDIGDSNTPPSHFLTLAEVYRC
FT                   TALLQIYHVFPEILEERLQSNQAADDESPIPALFLVLFPVAAEWSSCSVEDARHTLALH
FT                   IVSLLEQLPSTSGTKVMQPVVLACISSDLVFSSGSVLGAIENAIPSLNTLDVDIAQARR
FT                   KVKMRLSELTIILPKLPMQRIYNVVHETWDRADSGLEEFWLDVMVDLNLETIMG"
FT   exon            515497..515601
FT                   /gene="Pc13g02260"
FT                   /locus_tag="PCH_Pc13g02260"
FT                   /number=1
FT   intron          515602..515683
FT                   /gene="Pc13g02260"
FT                   /locus_tag="PCH_Pc13g02260"
FT                   /number=1
FT   exon            515684..517471
FT                   /gene="Pc13g02260"
FT                   /locus_tag="PCH_Pc13g02260"
FT                   /number=2
FT   mRNA            complement(join(<518074..518232,518284..518445,
FT                   518495..518735,518782..518998,519051..519129,
FT                   519177..>519236))
FT                   /gene="Pc13g02270"
FT                   /locus_tag="PCH_Pc13g02270"
FT   CDS_pept        complement(join(518074..518232,518284..518445,
FT                   518495..518735,518782..518998,519051..519129,
FT                   519177..519236))
FT                   /gene="Pc13g02270"
FT                   /locus_tag="PCH_Pc13g02270"
FT                   /note="Title: strong similarity to hypothetical
FT                   2-hydroxyhepta-2,4-diene-1,7-dioate isomerase BH2000
FT                   -Bacillus halodurans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91296"
FT                   /db_xref="GOA:B6H1J3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J3"
FT                   /inference="similar to AA sequence:PIR:H83899"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /inference="protein motif:COGS:COG0179"
FT                   /protein_id="CAP91296.1"
FT                   /translation="MGVSNMNQMEFQDTPAAKHPVWKRWVRFRAEDGKIYGGEPVNPDI
FT                   DVGQAIEKDVEVSVKVVTGNSALDYDAPFTGEIKTIDELLSPVSQAEAGTVRCVGLNYK
FT                   EHAAEMKLTLPNTPTVFLKASTCIASASEPIILPSNVDYDEADYEVELAIIIGRQCKNV
FT                   SVSKAGDYVLGYAVANDVTARKHQEKTSQWSYAKGMDGFCPLGPCIVSTEQIPDAARLN
FT                   LKTRLNGKIMQNGSADDMIFSIPEIVSYVSQGHTLLPGTVIITGTPCGIGISQSPPQFL
FT                   QPGDELRISISHGLGTQICPIARA"
FT   exon            complement(518074..518232)
FT                   /gene="Pc13g02270"
FT                   /locus_tag="PCH_Pc13g02270"
FT                   /number=1
FT   intron          complement(518233..518283)
FT                   /gene="Pc13g02270"
FT                   /locus_tag="PCH_Pc13g02270"
FT                   /number=1
FT   exon            complement(518284..518445)
FT                   /gene="Pc13g02270"
FT                   /locus_tag="PCH_Pc13g02270"
FT                   /number=2
FT   intron          complement(518446..518494)
FT                   /gene="Pc13g02270"
FT                   /locus_tag="PCH_Pc13g02270"
FT                   /number=2
FT   exon            complement(518495..518735)
FT                   /gene="Pc13g02270"
FT                   /locus_tag="PCH_Pc13g02270"
FT                   /number=3
FT   intron          complement(518736..518781)
FT                   /gene="Pc13g02270"
FT                   /locus_tag="PCH_Pc13g02270"
FT                   /number=3
FT   exon            complement(518782..518998)
FT                   /gene="Pc13g02270"
FT                   /locus_tag="PCH_Pc13g02270"
FT                   /number=4
FT   intron          complement(518999..519050)
FT                   /gene="Pc13g02270"
FT                   /locus_tag="PCH_Pc13g02270"
FT                   /number=4
FT   exon            complement(519051..519129)
FT                   /gene="Pc13g02270"
FT                   /locus_tag="PCH_Pc13g02270"
FT                   /number=5
FT   intron          complement(519130..519176)
FT                   /gene="Pc13g02270"
FT                   /locus_tag="PCH_Pc13g02270"
FT                   /number=5
FT   exon            complement(519177..519236)
FT                   /gene="Pc13g02270"
FT                   /locus_tag="PCH_Pc13g02270"
FT                   /number=6
FT   mRNA            join(<519855..520033,520087..520111,520167..520200,
FT                   520254..520458,520516..520620,520674..521240,
FT                   521298..>521469)
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT   CDS_pept        join(519855..520033,520087..520111,520167..520200,
FT                   520254..520458,520516..520620,520674..521240,
FT                   521298..521469)
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /note="Title: strong similarity to high-affinity nicotinic
FT                   acid permease Tna1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91297"
FT                   /db_xref="GOA:B6H1J4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J4"
FT                   /inference="similar to AA sequence:PIR:S64593"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /inference="protein motif:COGS:COG2271"
FT                   /protein_id="CAP91297.1"
FT                   /translation="MDKETDIKQTDLSSDHDVQMGNFVVDPIREKRLLWKLDLCICPLV
FT                   MLIFLVAYLDRSNLGNAAVAGMPEDIGLIGNELGNAVSLFYATYVFFEIPFSMLLKKLR
FT                   PNRLISALIIGFSVSILAAGFIKNAAGLYITRLFLGVFESGLFPCLTVLLTTFYKREEQ
FT                   AQRISYLFVSAALSGGFGGLLAFGLVRLDGAGGLEGWRWLFIVEGIMSAVVGIATFFLL
FT                   PNNYETAYFLNEDDKELMRMRMQQSARYADTEEFDIKEVWKTLRDPKSWLTSFNQICVN
FT                   ICSFGFSTFLPTIIRGFGFDSVKTQLLTVPVYIWASAFYLVVANLSDRVRMRAVFMVPL
FT                   CLVTAVGYAMLLGVDVHARGPLYFATYVCVTGIYAVVGLGVSWNANSHSGYYKRAMGVG
FT                   LQQTIGNCAGLIVSGISYWHARVVALTSS"
FT   exon            519855..520033
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /number=1
FT   intron          520034..520086
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /number=1
FT   exon            520087..520111
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /number=2
FT   intron          520112..520166
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /number=2
FT   exon            520167..520200
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /number=3
FT   intron          520201..520253
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /number=3
FT   exon            520254..520458
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /number=4
FT   intron          520459..520515
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /number=4
FT   exon            520516..520620
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /number=5
FT   intron          520621..520673
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /number=5
FT   exon            520674..521240
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /number=6
FT   intron          521241..521297
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /number=6
FT   exon            521298..521469
FT                   /gene="Pc13g02280"
FT                   /locus_tag="PCH_Pc13g02280"
FT                   /number=7
FT   mRNA            complement(join(<521850..523609,523667..>523892))
FT                   /gene="Pc13g02290"
FT                   /locus_tag="PCH_Pc13g02290"
FT   CDS_pept        complement(join(521850..523609,523667..523892))
FT                   /gene="Pc13g02290"
FT                   /locus_tag="PCH_Pc13g02290"
FT                   /note="Title: similarity to hypothetical transcription
FT                   regulator protein CAA91958.1 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02290"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91298"
FT                   /db_xref="GOA:B6H1H0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H0"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP91298.1"
FT                   /translation="MSTNEGKRNKLALDPRPRARRGRKTTSCSQCHARKQKCNRELPCS
FT                   RCIQRGIPQLCQWAEKEKGHAMPPERVRTAADTQGTELGQLYIARGAPSFFGNSYFGHQ
FT                   VAARMIQESAPDLPPMSLLSSKDSLQSFRNDSGPFSQVWDLLGLLPRNKVTVDRLIEKF
FT                   LTEINWAIDTVHPETFRSQFAEFWGRKFGFDEIAGVDLRWLALLFIILAFSVLLDSPTI
FT                   SSPEKRKESEEASLRFYWAARRAIVISPSFHGESLDLVRAGLMVTRYLLYTRQVAESWL
FT                   TISFAMRMAQAQGMHIDGEKWGLSRKATEIRRRLWSNLYLLDKTIALALGRPYAISDHM
FT                   CLIKAPDNIWLDGLTDEESSTATAHALSYPTMSTVTLLGSGLGKIAGEIQDRCFGLYPA
FT                   SYDMVIEMDNKLVAWKEKLPSYFSVEDPDLSLDGSHTFLPWHRLYLHSAFHFARITLHR
FT                   PYLLRESITNRFSLSHEACISSASSDLKIRLQSLNYGTSENMRWTLGTHNMFNSAFILG
FT                   IIAVRRPIAPQTTAILNDLEEYCERLRKDVWLNEFGLAEVKVVELCILRTTGLARATEQ
FT                   PGEQTSMSPPEVLPGFMAQERERNSMMSTPMNIESIVADGSPSHPPGSSPDIMWPAVWE
FT                   DQNFAFPQAADLETWEQMISEIAYHT"
FT   exon            complement(521850..523609)
FT                   /gene="Pc13g02290"
FT                   /locus_tag="PCH_Pc13g02290"
FT                   /number=1
FT   intron          complement(523610..523666)
FT                   /gene="Pc13g02290"
FT                   /locus_tag="PCH_Pc13g02290"
FT                   /number=1
FT   exon            complement(523667..523892)
FT                   /gene="Pc13g02290"
FT                   /locus_tag="PCH_Pc13g02290"
FT                   /number=2
FT   mRNA            join(<524533..524583,524662..>526500)
FT                   /gene="Pc13g02300"
FT                   /locus_tag="PCH_Pc13g02300"
FT   CDS_pept        join(524533..524583,524662..526500)
FT                   /gene="Pc13g02300"
FT                   /locus_tag="PCH_Pc13g02300"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1471_1.tfa_1060wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02300"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91299"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H1"
FT                   /protein_id="CAP91299.1"
FT                   /translation="MAIRRSARLRRAQDTPEVEEMTPQPVTTPRLYSVAEGEETDSSEL
FT                   PHIQTPLAKTPSQKTPRASAQQKRASIRTPTSVTAPRPSREEMHPSKAQQSTTKQADSG
FT                   LLLGFNPIKKDANGNVVKSGISDNTPTKSKASPLTDQFGTPGFEYKFHSQETELSDEAK
FT                   QLMESVRADAARIKAQMVQENSEPKPEDRETEQCHGDRKIAMPKGKANRFSDIHMAEFR
FT                   KMDSIAGHASSFRATPGRFQPVTKSLKRSKSKAQLDEPESQNSSPSRSATKVSNLSTPT
FT                   AATAAKRVKHNQSEDTSTRHESKDRTQKVKTPRRPAGPRPRPRANVRSSLMTPTHASLA
FT                   RTTSTSIKAPNTSMIPSLKLSPAAKTIASPRTPRTDFNPRLKGKLPTIGSLKSILRRRQ
FT                   PLFSRDPAKIASGTHVAAPDFNPRSLFGGAGDVSDSAPTPSPKKHVEFTPSVKSRHQLA
FT                   VASPSPSKAPSAQHRSMAEDVVYPTLPALTPEKNSAVLTSTTPTSEFKSIRPVRKSDAG
FT                   KEPAPYEELPVVTHGIAHGIVNKKRHRNEVNDDDAPSTANSENVPPTNVQSDERSTKRF
FT                   KSNPPTPSPVKKRLTKTPVRPSGQIGTPASKQRSRGVLSMSRLNMLSKPKRQA"
FT   exon            524533..524583
FT                   /gene="Pc13g02300"
FT                   /locus_tag="PCH_Pc13g02300"
FT                   /number=1
FT   intron          524584..524661
FT                   /gene="Pc13g02300"
FT                   /locus_tag="PCH_Pc13g02300"
FT                   /number=1
FT   exon            524662..526500
FT                   /gene="Pc13g02300"
FT                   /locus_tag="PCH_Pc13g02300"
FT                   /number=2
FT   mRNA            complement(join(<527539..527833,527899..533301,
FT                   533368..533385,533442..>533452))
FT                   /gene="Pc13g02310"
FT                   /locus_tag="PCH_Pc13g02310"
FT   CDS_pept        complement(join(527539..527833,527899..533301,
FT                   533368..533385,533442..533452))
FT                   /gene="Pc13g02310"
FT                   /locus_tag="PCH_Pc13g02310"
FT                   /note="Title: strong similarity to ATPase Mot1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02310"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91300"
FT                   /db_xref="GOA:B6H1H2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022707"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H2"
FT                   /inference="similar to AA sequence:PIR:S22775"
FT                   /inference="protein motif:PFAM:PF00176"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /inference="protein motif:COGS:COG0553"
FT                   /protein_id="CAP91300.1"
FT                   /translation="MASRLDRLVTLLETGSTQLIRNTAAQQLADVQKQHPDELFNLLGR
FT                   ILPYLRSKSWDTRTASAKAIGLIVSNADIHDPNEDDGLQIKSAAEEDDVEIKSEIKSEE
FT                   PIPADDFLKLDTLDIPSVLKYGKRLLGSAGKEYEYSLASMEPASRLQHQKKTLTSRLGL
FT                   EGEYLEEDLIEDIELAPKVVTPAPKHEPTIPPIPHHSSLHEASSRRPSSPSESATKEDG
FT                   GLSKRQLNQLKRKNKQNAKMGANKVRVVDLSSRRQSDIVTTPLATTPHPVKAENGDDHN
FT                   GETKPDYFSFERTEEDDDSKLVTEFKGAVAPERPHILPDIVEQGAGWPLEHMCEFLTMD
FT                   IFDSNWEVRHGAAMALREVIRVQGAAAGRLDGKSRSENDALNRRWLDDLSCRLLCVLML
FT                   DRFGDYISDNVVAPIRETVGQTLGALLSHLHPNSVRAAYRCLYRIIMQTDLGLDRPVWE
FT                   VCHGGMIGLRYLVAVRKDLLVKDSNMMDGVLEAVMKGLADYDDDVRAVSAATLVPIAEE
FT                   FVSSRTGTLGPLMNIVWDCLSNLQDDLSASTGSVMDLLAKLCTFSQVLDAMKANAADDP
FT                   EASFGKLVPRLYPFLRHTITSVRSAVLRALMTFLKLEGEGTTDWVDGKALRLIFQNLLV
FT                   ERNEGVLKLSGQVWSELLNVVEMRGSFKSEDELSGSIQPLITLTLGAFGVPRYPIPMNT
FT                   SLFIKPSGLPFSAALPAPTPSKGSPPASIPGGAETKVGRRRKSEKKEKEPPPPSAHNVD
FT                   GHMLSGDIDLVGADTMLRSKIYAAKALGALISFWDKNELSSLWPAILDGLNASASTTQL
FT                   ASAMVLEEYARQSGPESKYRSSLCDRLRPILEGERPSWYSDIACYLHVARSQCHSLLNT
FT                   FRDHAHVAPSRLPTLAVVVQGDSEAGPNAFSLADAEKIVGPDFDRLKKNLTPAQRITAT
FT                   QVLNDTRTTAQSAVEEARLMREQRDMRVLAATAGALVALRDIPKKPGHIIKGMMDSVKK
FT                   EENVELQQRSATAVAGLIEHYTAATKRGPVDKIIGNLVKYCCVDTSETPEFPHNVQLEK
FT                   SILSLRKEEDRRDHPDAAKFEREAREARIMRRGAKDALEQLAVKFGPELLEKVPNLAKL
FT                   VERPLRDALAGDELPEDITNPENELGQEIVDGLSTLRALLPKFDPGLHEWVIDLMPIIA
FT                   KGLQCRLSVIRYAAAKCFATICSVITVKGMTMLVEKVLPLINNGLDVNHRQGAIECIYH
FT                   LIHVMEDGILPYVIFLVVPVLGRMSDSDNDVRLLATTSFATLVKLVPLEAGIPDPPGFS
FT                   AELLEGRDRERKFMSQMLDVRKVEPFEIPVAIKAELRPYQQDGVNWLAFLNRYNLHGIL
FT                   CDDMGLGKTLQTICIVASDHHMRAEEFAKSQSTDSRKLPSLIVCPPSLSGHWQQEVKQY
FT                   APFLSCIAYVGPPAERTRLQPLLATTDVIVTSYDVCRNDNDILSPINFNYCVLDEGHLI
FT                   KNPKAKITSSVKKLASNHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKVFLDRFAKP
FT                   IAASRFSKSSSKEQEAGALAIEALHKQVLPFLLRRLKEEVLNDLPPKIIQNYYCDPSEL
FT                   QKKLFEDFTKKEQKELADKVGSADRGDKEHIFQALQYMRRLCNSPALVVKEGHKQYNEV
FT                   QSFLSAKRSNIRDVSHAPKLNALKDLLVDCGIGLDHTAEGELDTGASYVSPHRALVFCQ
FT                   MKEMLDIVQNDVLKKLLPSVQYLRLDGGVEATKRQDIVNRFNTDPSYDVLLLTTSVGGL
FT                   GLNLTGADTVIFVEHDWNPQKDIQAMDRAHRIGQKKVVNVYRLITRGTLEEKILNLQRF
FT                   KIDVASTVVNQQNAGLGTMDTDQLLDLFNLGETADTAEKPSDTAGYEVDMVDIDGEVKE
FT                   KGKKGWLDDLGELWDDRQYQEEYNLDSFLETMKN"
FT   exon            complement(527539..527833)
FT                   /gene="Pc13g02310"
FT                   /locus_tag="PCH_Pc13g02310"
FT                   /number=1
FT   intron          complement(527834..527898)
FT                   /gene="Pc13g02310"
FT                   /locus_tag="PCH_Pc13g02310"
FT                   /number=1
FT   exon            complement(527899..533301)
FT                   /gene="Pc13g02310"
FT                   /locus_tag="PCH_Pc13g02310"
FT                   /number=2
FT   intron          complement(533302..533367)
FT                   /gene="Pc13g02310"
FT                   /locus_tag="PCH_Pc13g02310"
FT                   /number=2
FT   exon            complement(533368..533385)
FT                   /gene="Pc13g02310"
FT                   /locus_tag="PCH_Pc13g02310"
FT                   /number=3
FT   intron          complement(533386..533441)
FT                   /gene="Pc13g02310"
FT                   /locus_tag="PCH_Pc13g02310"
FT                   /number=3
FT   exon            complement(533442..533452)
FT                   /gene="Pc13g02310"
FT                   /locus_tag="PCH_Pc13g02310"
FT                   /number=4
FT   mRNA            complement(join(<534213..534278,534420..534468,
FT                   534758..534900,534984..>535199))
FT                   /gene="Pc13g02320"
FT                   /locus_tag="PCH_Pc13g02320"
FT   CDS_pept        complement(join(534213..534278,534420..534468,
FT                   534758..534900,534984..535199))
FT                   /gene="Pc13g02320"
FT                   /locus_tag="PCH_Pc13g02320"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1471_1.tfa_1080cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02320"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91301"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H4"
FT                   /protein_id="CAP91301.1"
FT                   /translation="MASDHNLRTQFPPPRIKPANAVWLFLGPGRCYPFWQEVLGCYVVN
FT                   SGDGASGKKKCVPALDDYYECLHHRKEALRTMKMQAAYRKAEAAHPRENAPKAEQIRSL
FT                   GLLGKEEDAANVLSQREIGLLASPTRLAAYPGENNAQGKGEGNGIEDENLYTP"
FT   exon            complement(534213..534278)
FT                   /gene="Pc13g02320"
FT                   /locus_tag="PCH_Pc13g02320"
FT                   /number=1
FT   intron          complement(534279..534419)
FT                   /gene="Pc13g02320"
FT                   /locus_tag="PCH_Pc13g02320"
FT                   /number=1
FT   exon            complement(534420..534468)
FT                   /gene="Pc13g02320"
FT                   /locus_tag="PCH_Pc13g02320"
FT                   /number=2
FT   intron          complement(534469..534757)
FT                   /gene="Pc13g02320"
FT                   /locus_tag="PCH_Pc13g02320"
FT                   /number=2
FT   exon            complement(534758..534900)
FT                   /gene="Pc13g02320"
FT                   /locus_tag="PCH_Pc13g02320"
FT                   /number=3
FT   intron          complement(534901..534983)
FT                   /gene="Pc13g02320"
FT                   /locus_tag="PCH_Pc13g02320"
FT                   /number=3
FT   exon            complement(534984..535199)
FT                   /gene="Pc13g02320"
FT                   /locus_tag="PCH_Pc13g02320"
FT                   /number=4
FT   mRNA            join(<535472..536999,537051..537207,537261..>538362)
FT                   /gene="Pc13g02330"
FT                   /locus_tag="PCH_Pc13g02330"
FT   CDS_pept        join(535472..536999,537051..537207,537261..538362)
FT                   /gene="Pc13g02330"
FT                   /locus_tag="PCH_Pc13g02330"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   15E6.130 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02330"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91302"
FT                   /db_xref="GOA:B6H1H5"
FT                   /db_xref="InterPro:IPR013244"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H5"
FT                   /protein_id="CAP91302.1"
FT                   /translation="MALEELSDAHAILLATHLCASGSVADLPILQARFPHCFPLERLLR
FT                   IILTFLPESTEPSQYTTVLQELANSSNLPSDRPIDTSAVQDLSESLARKRVRKIHLRPL
FT                   QRPDEEDEIASADPLTKFLIHRAHLIDSETALQPLILDLIIPFYEHSPVIRTWLISSLL
FT                   PLLRLNYEFYAHRDETISLEILESMDDQTAVNILLSLMSSEENSMDLVNNLRGLIGPWL
FT                   YGGNRSKRRRLNEAAQQSSVSFIEGSEKPQATELAGWEHVNEWLLSRSLVDRDSVVGAF
FT                   TRWDGPSDVDLGGYDNGGTQLSEEQAKDLQVRYGQSGLAVVYAHADSSMAVLEGSFQVL
FT                   TRVAKLLDLEDSSYLTPDSELPSVHYDTESMSSTSRASLLQNSLLRPTNPLTKPSPPSV
FT                   SFLSALLLSLRILTELGHLVPCRVAANMCLHSTEEMQLAELKSVVDSTVKQPNLNQDWS
FT                   MVRQRLLWLRDWQAEQFDNAWDEPSPYHGLFWRIPRDTVEIEILKALLAAKEYELAIDI
FT                   YTNSKSAPLEPAQVEAAVQEAIFTAYDNASNGNRTRGGMKRAYDILQSFTPHFPDSVVF
FT                   KQIHALIAATHALSYYSLTLQHGVPFQPVSIRVHHDPILLIEKVLEQNAKSYTKLDDLL
FT                   SIGRNLVAADVPTQAASNEAEDEPTHHKPSKEHALLTAERRITSLAIASALSSNDFGTA
FT                   YSYILTRLTPPSLLSTSSPLLNTTSVPDDITWRAVYNAGRHRATTPTHPPPTLQSQISH
FT                   LSQRMELLSLSLVLVPSPDPLPEILGAWRRCDEELTSLRAREQQEEDLWDRKGDTLSSV
FT                   PGGFGPSDSERDAFDTERQRAARRARAAMPNSHHHEAPMGLFEVARGAALALHKNAFPL
FT                   RGAADGSAPLAPRDGDRPLSPDSEGHVRKRDMVSNMMTGGLVSGIGWVLGADPVNKK"
FT   sig_peptide     535472..535546
FT                   /gene="Pc13g02330"
FT                   /locus_tag="PCH_Pc13g02330"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            535472..536999
FT                   /gene="Pc13g02330"
FT                   /locus_tag="PCH_Pc13g02330"
FT                   /number=1
FT   mat_peptide     join(535547..536999,537051..537207,537261..538359)
FT                   /gene="Pc13g02330"
FT                   /locus_tag="PCH_Pc13g02330"
FT   intron          537000..537050
FT                   /gene="Pc13g02330"
FT                   /locus_tag="PCH_Pc13g02330"
FT                   /number=1
FT   exon            537051..537207
FT                   /gene="Pc13g02330"
FT                   /locus_tag="PCH_Pc13g02330"
FT                   /number=2
FT   intron          537208..537260
FT                   /gene="Pc13g02330"
FT                   /locus_tag="PCH_Pc13g02330"
FT                   /number=2
FT   exon            537261..538362
FT                   /gene="Pc13g02330"
FT                   /locus_tag="PCH_Pc13g02330"
FT                   /number=3
FT   mRNA            complement(join(<539305..539434,539488..539857,
FT                   539917..540208,540278..>540457))
FT                   /gene="Pc13g02340"
FT                   /locus_tag="PCH_Pc13g02340"
FT   CDS_pept        complement(join(539305..539434,539488..539857,
FT                   539917..540208,540278..>540457))
FT                   /exception="reasons given in citation"
FT                   /gene="Pc13g02340"
FT                   /locus_tag="PCH_Pc13g02340"
FT                   /note="putative sequencing error"
FT                   /note="unknown EC_number=2.7.1.-"
FT                   /note="Title: strong similarity to protein kinase of the
FT                   MAP kinase kinase 2 Mkk2 - Saccharomyces cerevisiae
FT                   [truncated ORF][putative sequencing error]"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H6"
FT                   /inference="similar to AA sequence:PIR:S69045"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP91303.1"
FT                   /translation="VFTYKFDSNGFLVKLKVRIYIYRDLXTINSEEKRIATLTIRTTYA
FT                   IFALITIFNLDTIXLNAINTFLNSDLNKVIYIXILEGFYNRGKVXKLLKALYRLRKSPR
FT                   LXXXEATRVLKKLGFEYILEDLYLFIRDRIIIFFYIDNIIIAYYRLRLXEALXLXRELA
FT                   KHXELREIGEALXFLRIRILXDIXKYKLXLYXDSYISSIATKYGLIYSRKYLTPLPANX
FT                   INKFTGIVTREXIYKYXXKLGLALYLTVITRLDTAKAANYLAKFLINLGLEHLDAINRL
FT                   IXYLYNTRYXALKFYPTYDNPTLXFSSDASFGDYINRKSSEGFLYKLFGATVNXKASKX
FT                   KIVTTSITEAELLTILEAGKIVIXXKRLFNIVRLNYKVGLTIDYDNKXTVNLLTRKXPX
FT                   IRIKLRYIDIYNHXLRXEISTSSISVRXVITTDIXVDRLTKLLLLXSYKAFITSLGLIN
FT                   IKPLVEEQIVX"
FT   exon            complement(539305..539434)
FT                   /gene="Pc13g02340"
FT                   /locus_tag="PCH_Pc13g02340"
FT                   /number=1
FT   intron          complement(539435..539487)
FT                   /gene="Pc13g02340"
FT                   /locus_tag="PCH_Pc13g02340"
FT                   /number=1
FT   exon            complement(539488..539857)
FT                   /gene="Pc13g02340"
FT                   /locus_tag="PCH_Pc13g02340"
FT                   /number=2
FT   intron          complement(539858..539916)
FT                   /gene="Pc13g02340"
FT                   /locus_tag="PCH_Pc13g02340"
FT                   /number=2
FT   exon            complement(539917..540208)
FT                   /gene="Pc13g02340"
FT                   /locus_tag="PCH_Pc13g02340"
FT                   /number=3
FT   intron          complement(540209..540277)
FT                   /gene="Pc13g02340"
FT                   /locus_tag="PCH_Pc13g02340"
FT                   /number=3
FT   exon            complement(540278..>540457)
FT                   /gene="Pc13g02340"
FT                   /locus_tag="PCH_Pc13g02340"
FT                   /number=4
FT   gap             540460..540559
FT                   /estimated_length=unknown
FT   mRNA            <545228..>545881
FT                   /gene="Pc13g02350"
FT                   /locus_tag="PCH_Pc13g02350"
FT   CDS_pept        545228..545881
FT                   /gene="Pc13g02350"
FT                   /locus_tag="PCH_Pc13g02350"
FT                   /note="Title: weak similarity to DNA-directed RNA
FT                   polymerase II largest subunit - Cyanidioschyzon merolae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91304"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H7"
FT                   /inference="similar to AA sequence:TREMBL:AB095187.1"
FT                   /protein_id="CAP91304.1"
FT                   /translation="MRFTTATIAFFAGLAIAAPGADQTVYETDEVTITSCAPTVTDCPG
FT                   NSGAGVEPTGSTTPSSVPAAVTSPAGEAPVSSAETPASSVETPAWSSETPAWSSVPTWA
FT                   PSVPAPSAPSSAPSAPAPPAGTPVVSNSVIAVTTCVPTVIYSTVPVTATTPAGSNVPHG
FT                   PTGGVPHVPSSSKGVATGTASVSPATSSPAFNGGATLSGSLGFAGAAAVAAFFL"
FT   sig_peptide     545228..545296
FT                   /gene="Pc13g02350"
FT                   /locus_tag="PCH_Pc13g02350"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            545228..545881
FT                   /gene="Pc13g02350"
FT                   /locus_tag="PCH_Pc13g02350"
FT                   /number=1
FT   mat_peptide     545297..545878
FT                   /gene="Pc13g02350"
FT                   /locus_tag="PCH_Pc13g02350"
FT   mRNA            <547999..>548772
FT                   /gene="Pc13g02360"
FT                   /locus_tag="PCH_Pc13g02360"
FT   CDS_pept        547999..548772
FT                   /gene="Pc13g02360"
FT                   /locus_tag="PCH_Pc13g02360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02360"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91305"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H8"
FT                   /protein_id="CAP91305.1"
FT                   /translation="MLFCLSQRRTRESLKPPPDLDYPLMDLSSLEGAPIVNPRFIVPPD
FT                   TTTPRIRTQSRASIQHLFSKPLPPRPASTDGISPTQHRNTLQDWPLDLSTIDGNIKRAS
FT                   ARRRTRPPPNEVSPDCDPRGREMRPRIQHTPRPPVRPRSCVPLTWLEDEKKWLVGEIYI
FT                   PRTPDSRPRDDIASSRSPVSPISPISPWQDMFQRLDEHLEYNNRLCRENLLRQTPSYDG
FT                   HRLSQTHDPDLGDDRVSRWVATARRMHENRRIGGD"
FT   exon            547999..548772
FT                   /gene="Pc13g02360"
FT                   /locus_tag="PCH_Pc13g02360"
FT                   /number=1
FT   mRNA            join(<551074..551257,551342..552503,552556..>552808)
FT                   /gene="Pc13g02370"
FT                   /locus_tag="PCH_Pc13g02370"
FT   CDS_pept        join(551074..551257,551342..552503,552556..552808)
FT                   /gene="Pc13g02370"
FT                   /locus_tag="PCH_Pc13g02370"
FT                   /note="Title: strong similarity to inhibitor of the
FT                   interferon-induced double-stranded RNA-activated protein
FT                   kinase like protein An18g03700 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91306"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H9"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /inference="protein motif:COGS:COG0457"
FT                   /protein_id="CAP91306.1"
FT                   /translation="MDIDSQGPQNNGVNGTEERSPTPPPHQPNSASADEADSFKLAGNK
FT                   FFKDGNYRRAIEEYNKAIEINPNSSAYLSNRAAAYMSAKQFLNALEDVQRSNELDPNNP
FT                   KIMHRWAKILTSLGRPEEALEVLSRIQPPATATDRAAAEKMLRFVTQAEQTIAEDRGLS
FT                   MVIYCLDQARQGLGQGVKEPRKWTLLAAEAHLRLDNVNSLGKAQDIAISLLRENSQDPD
FT                   AMMIRARAFYALGESEQAQKLLKMCLGLDPDMKQAIKLLRIVQKLARTKEEGNNAFKAK
FT                   DYHRAIELWAQALEVDPSNKDMNAKILGNRAQAYINLKEYDSAIEDCTEALRLDSGYIK
FT                   AMKCRAKAHGKAGNWEEAVRDYKSVAENNPNEPGIAEEIHEAEFELKKSQRKDYYKILG
FT                   VGKDASDQEIKKAYRKLAILYHPDKNRDGAAGDEKFKEIGEAYETLIDSQKRAAYDNGD
FT                   ELREGMPGGMHGGMHGFGGINPDILRDMMNGGGGFGGASFGGASFGGGGFGGGGFGGHS
FT                   HGGNPFGGPGAGFSF"
FT   exon            551074..551257
FT                   /gene="Pc13g02370"
FT                   /locus_tag="PCH_Pc13g02370"
FT                   /number=1
FT   intron          551258..551341
FT                   /gene="Pc13g02370"
FT                   /locus_tag="PCH_Pc13g02370"
FT                   /number=1
FT   exon            551342..552503
FT                   /gene="Pc13g02370"
FT                   /locus_tag="PCH_Pc13g02370"
FT                   /number=2
FT   intron          552504..552555
FT                   /gene="Pc13g02370"
FT                   /locus_tag="PCH_Pc13g02370"
FT                   /number=2
FT   exon            552556..552808
FT                   /gene="Pc13g02370"
FT                   /locus_tag="PCH_Pc13g02370"
FT                   /number=3
FT   mRNA            complement(<553935..>556187)
FT                   /gene="Pc13g02380"
FT                   /locus_tag="PCH_Pc13g02380"
FT   CDS_pept        complement(553935..556187)
FT                   /gene="Pc13g02380"
FT                   /locus_tag="PCH_Pc13g02380"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_68_scaffold_4.tfa_200cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91307"
FT                   /db_xref="GOA:B6H1G7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G7"
FT                   /inference="protein motif:COGS:COG1196"
FT                   /inference="protein motif:COGS:COG0542"
FT                   /protein_id="CAP91307.1"
FT                   /translation="MDDGPPPPPPPHGENPHTTQGEYRKSSDLPDGNYDIFIVPPHSAG
FT                   SGFLYLPSLQCNRNSFLAGVASTLVACFVWSYISPIVKAWYLATVASGSGTGMAVLAIG
FT                   VGVAGWLFGSIQSTSSGDNKGNGGARGGRFGFGGFGGGSGGPGDPGGPGGPRNAGPNTN
FT                   QYSSGANYGGNGAGQQRQQGGNFGGGQPHGNQYSGNQHGSGTPPNSDNNKREKEEAEKR
FT                   AKEERAKEERAREQRAKEERAREERAREERAREERVREERAKQERAREERAREERAREE
FT                   RIKEERAREERAKERAKEEAERERAREETRRKEELRRKMEEFKRKRDAEAKEKEKKRER
FT                   EAMEKELQERREQLEREMAAARAAAEKEARERLEREAAEARERQAKAEAEAKAKLEKLE
FT                   AEAKEKAAKEAAEKEAAAKAAAQKEAMAKFAALKEAASKKYAEKKAQDAKKEAAAKSPP
FT                   PKPASTSNVPRTPSPKKPAPYSTAKTANEDDAYSFRPYDRPRRPYAAGSVYSESSYTPS
FT                   NSTARTTPPPSHRSTYSTKDPDKIVIQGVYAFNNAFMKTPVAQLVSGQGMITDGLVLRI
FT                   TTEGLFIDDDLRGIGQREWDVKAWTLKLAEVWCPQVNAASSAKTASSNPFSFRRGNNVP
FT                   TNEESEAFLGNLLKVCKNTCRLASPSACFARSATASHDGGPVHPPQAEFRGLHILRASV
FT                   RDQEGKKYVFVLQDTEAWKVAIGLQRLRGGALVRALGVSALPVPECKTMLSALGYV"
FT   exon            complement(553935..556187)
FT                   /gene="Pc13g02380"
FT                   /locus_tag="PCH_Pc13g02380"
FT                   /number=1
FT   mRNA            join(<558256..559147,559209..559306,559360..>561405)
FT                   /gene="Pc13g02390"
FT                   /locus_tag="PCH_Pc13g02390"
FT   CDS_pept        join(558256..559147,559209..559306,559360..561405)
FT                   /gene="Pc13g02390"
FT                   /locus_tag="PCH_Pc13g02390"
FT                   /note="unknown EC_number=2.7.1.-"
FT                   /note="Title: weak similarity to ser/thr protein kinase
FT                   Prk1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02390"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91308"
FT                   /db_xref="GOA:B6H1G8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G8"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP91308.1"
FT                   /translation="MSSQSHHGHSATPRQFPVYNPVAAVAAPAGTLLPGTKIQVGSHRV
FT                   VVEKYLSEGGFAHVYVVRLPQPVNGSETAVLKRVAVPDKAALANMRTEVETMKKLKGHR
FT                   HIVKYIDSHASQLRGGGYEVFLVMEYCAGGGLIDFMNTRLQHRLTEPEIVKIFSDVAEG
FT                   VACMHYLKPPLLHRDLKVENVLISGKGSSATYKLCDFGSSAPPRPAATSAAEGRLIEDD
FT                   VQRHTTLQYRSPEMIDVYRKQPIDEKSDIWALGVFLYKLCYYTTPFEEVGQMAILNATF
FT                   KYPSYPSFSSRLKLLIGSMLKEDPRNRPNIYEVVREVCKMQGKEVPIKDIYSNRSVSEA
FT                   RKYQELPPTPTEAPAVGAVFSPPMQETEIIPEIAPMRRGRPGKSSSSQPSSERPSPSPY
FT                   RPAAEGSSSDPFAALDGSAARKKTAEEMSKRFPSLDQFDILHEKGDKFEFEPTVESKPE
FT                   DEDLSRRLTNALADDAFARRVSPERAPKPVYKRPSQNSPVRAPNLRETPAPQSVPLYQP
FT                   TPQRPTMVSTGTMTSPIQTPRLPDPKLLSRPIYRFPSSDAEHRSFSEPFTTEKEQRVTR
FT                   PHKAPSPPMSSLNVEESSRLPSDRISSQSNSARPSMETLRRPPTLEVNEPVGRSKSAIG
FT                   KARPMSVQAGVRYDPPYDSESPRSSLDMSRLQYEGGAPLRSVRTDVDRESDRTISSDVD
FT                   YLRAMEEEESNRKREKRSSGSHKHNKRGSLSTLSLSGGKNLFAGRFGDAFRRFEAGNPE
FT                   KSSSPSVEDAPRQGLIGTSDSADEGLSPNDEITLEDADRDDISPEMRRELERRRLSQEE
FT                   KRVANAAAEYRRRVAETGDGGGRTTGDGARSRTIQNKVQSLLGESEKPTVPKTATGYGR
FT                   FTETSSSLQAKQSEARPTSSSQLPASHTSGPTYAARDGSMALPDRRELPQSAAPTPYPS
FT                   TQRPAARPAAPPKPKNLRAGTATSRPGTGHDHGPSQETQTPASPGDDWEAKFSQRFPSL
FT                   SGLEMETEIKIPKISSLRTREV"
FT   exon            558256..559147
FT                   /gene="Pc13g02390"
FT                   /locus_tag="PCH_Pc13g02390"
FT                   /number=1
FT   intron          559148..559208
FT                   /gene="Pc13g02390"
FT                   /locus_tag="PCH_Pc13g02390"
FT                   /number=1
FT   exon            559209..559306
FT                   /gene="Pc13g02390"
FT                   /locus_tag="PCH_Pc13g02390"
FT                   /number=2
FT   intron          559307..559359
FT                   /gene="Pc13g02390"
FT                   /locus_tag="PCH_Pc13g02390"
FT                   /number=2
FT   exon            559360..561405
FT                   /gene="Pc13g02390"
FT                   /locus_tag="PCH_Pc13g02390"
FT                   /number=3
FT   mRNA            join(<561742..561772,561826..561922,562060..>562450)
FT                   /gene="Pc13g02400"
FT                   /locus_tag="PCH_Pc13g02400"
FT   CDS_pept        join(561742..561772,561826..561922,562060..562450)
FT                   /gene="Pc13g02400"
FT                   /locus_tag="PCH_Pc13g02400"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1471_1.tfa_980cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91309"
FT                   /db_xref="GOA:B6H1G9"
FT                   /db_xref="InterPro:IPR019145"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G9"
FT                   /protein_id="CAP91309.1"
FT                   /translation="MAPVTLKTVDDDLKDVIQHLFEIQSAVHGYLGPETQQELVRKIKN
FT                   LTLALSTLSTHTQLPPTQENQPDANTDPSNPSLASIQLPPEIIDYVDSARNPDIYTREF
FT                   VELVQRGNQDLRGKREAFASFRDVLAREMRSAMPECRGEVDRVVAATSGAVDGPDGATE
FT                   AAATSGGLN"
FT   exon            561742..561772
FT                   /gene="Pc13g02400"
FT                   /locus_tag="PCH_Pc13g02400"
FT                   /number=1
FT   intron          561773..561825
FT                   /gene="Pc13g02400"
FT                   /locus_tag="PCH_Pc13g02400"
FT                   /number=1
FT   exon            561826..561922
FT                   /gene="Pc13g02400"
FT                   /locus_tag="PCH_Pc13g02400"
FT                   /number=2
FT   intron          561923..562059
FT                   /gene="Pc13g02400"
FT                   /locus_tag="PCH_Pc13g02400"
FT                   /number=2
FT   exon            562060..562450
FT                   /gene="Pc13g02400"
FT                   /locus_tag="PCH_Pc13g02400"
FT                   /number=3
FT   mRNA            join(<563010..563112,563221..563267,563326..563745,
FT                   563780..564296,564356..564743,564793..>565402)
FT                   /gene="Pc13g02410"
FT                   /locus_tag="PCH_Pc13g02410"
FT   CDS_pept        join(563010..563112,563221..563267,563326..563745,
FT                   563780..564296,564356..564743,564793..565402)
FT                   /gene="Pc13g02410"
FT                   /locus_tag="PCH_Pc13g02410"
FT                   /note="Title: similarity to nitrate assimilation regulatory
FT                   protein nirA - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91310"
FT                   /db_xref="GOA:B6H1H3"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H3"
FT                   /inference="similar to AA sequence:PIR:A41697"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP91310.1"
FT                   /translation="MKQISEDEFPDLMKYNASSKDPIGGSVFALSPEKAKSIDCQLGVV
FT                   QSKPRPTNHRIAELEQENEILRQKCAQLRSSNTISAGRVQSEPDHSVTSESTPRTPLPF
FT                   SRVTGIGLSWNDSPSTSTRDASHPEVPENDRRNTSLYHGPTSTVYDDTSPNHDEQNRPG
FT                   QSNEEGTRHFLFSQTARQSKLDLMQYEQLEPLNLAAGKLDFDGIDPEIGMHLLSIYWSR
FT                   QLYTAQIIYRPAFMRDMACEGPYFSKLLLNAIFFVVSKHCDRPELRSDPNDITTAGWKF
FT                   RQRFTQLLRDSFDKSEMTTLQALLIMSNALFSRCDERSLSWLYAGNAFNMFIDLGLHVL
FT                   PAVDSITAEELEIRKRVLWGAYLIDKIQCLFQGRPPLLNRVNLRASLDFLDDYDELEPF
FT                   QGITYMNTKPGVIPSLNVSLLTNLCELTTIVERILREIYSESRESNLIHRDRANISEEI
FT                   KSQLRTWRQNLPLRLDYLSFPDQAVFLPQSACLLALFNVLIILVHRPLIIGHDRVINST
FT                   TAHESVNACTAAANQIVQILHDYSQHFSLSSAPYMLSYATYISATIHARIVAQKGSNSS
FT                   MFQSLVLCRNILAEHTRLYSAAEKAKENLDKLISHLGISAADDNLRTGSPGSSGSNFPN
FT                   EHMVMDESINVAREPGVADGAVEFGSSLMSLELSDLDLEAIAQGFQVDVESHSFWNSLV
FT                   "
FT   exon            563010..563112
FT                   /gene="Pc13g02410"
FT                   /locus_tag="PCH_Pc13g02410"
FT                   /number=1
FT   intron          563113..563220
FT                   /gene="Pc13g02410"
FT                   /locus_tag="PCH_Pc13g02410"
FT                   /number=1
FT   exon            563221..563267
FT                   /gene="Pc13g02410"
FT                   /locus_tag="PCH_Pc13g02410"
FT                   /number=2
FT   intron          563268..563325
FT                   /gene="Pc13g02410"
FT                   /locus_tag="PCH_Pc13g02410"
FT                   /number=2
FT   exon            563326..563745
FT                   /gene="Pc13g02410"
FT                   /locus_tag="PCH_Pc13g02410"
FT                   /number=3
FT   intron          563746..563779
FT                   /gene="Pc13g02410"
FT                   /locus_tag="PCH_Pc13g02410"
FT                   /number=3
FT   exon            563780..564296
FT                   /gene="Pc13g02410"
FT                   /locus_tag="PCH_Pc13g02410"
FT                   /number=4
FT   intron          564297..564355
FT                   /gene="Pc13g02410"
FT                   /locus_tag="PCH_Pc13g02410"
FT                   /number=4
FT   exon            564356..564743
FT                   /gene="Pc13g02410"
FT                   /locus_tag="PCH_Pc13g02410"
FT                   /number=5
FT   intron          564744..564792
FT                   /gene="Pc13g02410"
FT                   /locus_tag="PCH_Pc13g02410"
FT                   /number=5
FT   exon            564793..565402
FT                   /gene="Pc13g02410"
FT                   /locus_tag="PCH_Pc13g02410"
FT                   /number=6
FT   mRNA            complement(join(<565507..566072,566141..566233,
FT                   566283..>566436))
FT                   /gene="Pc13g02420"
FT                   /locus_tag="PCH_Pc13g02420"
FT   CDS_pept        complement(join(565507..566072,566141..566233,
FT                   566283..566436))
FT                   /gene="Pc13g02420"
FT                   /locus_tag="PCH_Pc13g02420"
FT                   /note="unknown EC_number=4.1.3.-"
FT                   /note="Title: strong similarity to
FT                   2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase hpcH
FT                   -Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91311"
FT                   /db_xref="GOA:B6H1J5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J5"
FT                   /inference="similar to AA sequence:PIR:S49311"
FT                   /inference="protein motif:PFAM:PF03328"
FT                   /inference="protein motif:COGS:COG3836"
FT                   /protein_id="CAP91311.1"
FT                   /translation="MQGLNRVKTVLDKGGLALGVWQLLPGSNMSRTLARAGYDWVLVDC
FT                   EHGNIDDAAMHEAVPAITSYGVSPIVRVPDFQSWMIKRALDAGAHGVLAPLVRTVEDTK
FT                   AFVEACRFPPQGKRGFGSPFPMDRFGRDVSATQYLTEANANLLLSVQIETKEAFDNVDS
FT                   IAAVEGLDLLFVGPFDLGNGIGHPVLGSTFAPELEQAIERILSSAHKAGKKAGIYCGNG
FT                   KQAKKYADLGYDFVNVVTDVGALTSSLASEMEIVTQKAGRTASGPYGS"
FT   exon            complement(565507..566072)
FT                   /gene="Pc13g02420"
FT                   /locus_tag="PCH_Pc13g02420"
FT                   /number=1
FT   intron          complement(566073..566140)
FT                   /gene="Pc13g02420"
FT                   /locus_tag="PCH_Pc13g02420"
FT                   /number=1
FT   exon            complement(566141..566233)
FT                   /gene="Pc13g02420"
FT                   /locus_tag="PCH_Pc13g02420"
FT                   /number=2
FT   intron          complement(566234..566282)
FT                   /gene="Pc13g02420"
FT                   /locus_tag="PCH_Pc13g02420"
FT                   /number=2
FT   exon            complement(566283..566436)
FT                   /gene="Pc13g02420"
FT                   /locus_tag="PCH_Pc13g02420"
FT                   /number=3
FT   mRNA            join(<566928..567389,567437..567591,567646..>568855)
FT                   /gene="Pc13g02430"
FT                   /locus_tag="PCH_Pc13g02430"
FT   CDS_pept        join(566928..567389,567437..567591,567646..568855)
FT                   /gene="Pc13g02430"
FT                   /locus_tag="PCH_Pc13g02430"
FT                   /note="unknown EC_number=4.2.1.9"
FT                   /note="Title: strong similarity to dihydroxy-acid
FT                   dehydratase like protein An15g06700 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91312"
FT                   /db_xref="GOA:B6H1J6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J6"
FT                   /inference="protein motif:PFAM:PF00920"
FT                   /inference="protein motif:COGS:COG0129"
FT                   /protein_id="CAP91312.1"
FT                   /translation="MGVASKADNAQVPVKQPGRTLRSSAWFDCRSNPGMTAIYMERYFN
FT                   YGITKEELMSGKPMIGIAQTGSDIAPCNRHHIELSKRVREGIRTAGGIPFEFPTHPIQE
FT                   TSRRPTATLDRNLAYLGLVEILTGYFLDGVVLLTGCDKTTPACLMAAATMNIPAICMNV
FT                   GPMLNGYSKETLTGAGTVLWHGRELYATGDIDEHEFMDYIARGTPSVGHCNTMGTASTM
FT                   NALAESLGMALPGSAAIPAAYRHRAQCAYETGKRIVEMVEADRKPCDIMTREAFENAIV
FT                   ANAAIGGSTNAPIHINAIAQHAGVEVSMDDWDTFGSTIPLLLNMQPSGEYLGEEYYRAG
FT                   GLPAIMAELLDQGKLNGDALTCNGKTLAENVRGKHTWDRRVIKPYDDPLMKDAGFAHLK
FT                   GNLFDSAIMKTCVISPAFRKRYLSNPDDPEAFEGSVVVFDGPEDYEHRLENTPHIDEKT
FT                   ILVMRGVGPIGYPGAAEVVNMHPPGRLLKEGIDGLFCIGDGRQSGTSGSPSILNASPEA
FT                   AAGGNLAILKDGDRLRIDLRKRRVDMLITDEEIEQRRKALGTEGYPILPSGTPWQEIFR
FT                   QETEQLSKGMVLRKAVKYQRLAQEGQPLRHNH"
FT   exon            566928..567389
FT                   /gene="Pc13g02430"
FT                   /locus_tag="PCH_Pc13g02430"
FT                   /number=1
FT   intron          567390..567436
FT                   /gene="Pc13g02430"
FT                   /locus_tag="PCH_Pc13g02430"
FT                   /number=1
FT   exon            567437..567591
FT                   /gene="Pc13g02430"
FT                   /locus_tag="PCH_Pc13g02430"
FT                   /number=2
FT   intron          567592..567645
FT                   /gene="Pc13g02430"
FT                   /locus_tag="PCH_Pc13g02430"
FT                   /number=2
FT   exon            567646..568855
FT                   /gene="Pc13g02430"
FT                   /locus_tag="PCH_Pc13g02430"
FT                   /number=3
FT   mRNA            complement(<569181..>570518)
FT                   /gene="Pc13g02440"
FT                   /locus_tag="PCH_Pc13g02440"
FT   CDS_pept        complement(569181..570518)
FT                   /gene="Pc13g02440"
FT                   /locus_tag="PCH_Pc13g02440"
FT                   /note="Title: strong similarity to erythromycin esterase
FT                   type like protein An18g03600 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91313"
FT                   /db_xref="GOA:B6H1J7"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR014622"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J7"
FT                   /inference="protein motif:PFAM:PF05139"
FT                   /inference="protein motif:COGS:COG2312"
FT                   /inference="protein motif:COGS:COG3842"
FT                   /inference="protein motif:COGS:COG3839"
FT                   /protein_id="CAP91313.1"
FT                   /translation="MPQLQELFNSAVQPLPAIEDKGFASHFDTFAGSRVILLGDGSHGT
FT                   SEFYSARAEITKRLIERHGYTMVAVEADWPDAEAIDRYVRLRPGPKAQIGGKAKQYEPF
FT                   NRFPTWMWRNAEMQQLVEWMRDRNQALPPEQRAGFYGLDLYSMGASIRAVIEYLEKVDR
FT                   PTAKQARQRYGCLEPWVDEPTSYGLASLRGMEDCEAPVIKMLGELLEKRLEYASSHDGD
FT                   EYHSGEQNAHLVRDAEKYYKSMYYSSASSWNLRDTHMFDTLERLLKHNEGEKAIVWAHN
FT                   SHVGDARYTSMGYRRNEINIGQLCRERLGGDNVTILGCGTHTGTVAAAHEWDDDMEVMS
FT                   VRPSRDDSWEIVAHDTGVPSFVLELRKDRIDPALRAAMAAEQRLERFIGVIYRPDTERV
FT                   SHYSQAFLHKQLDGYIWFDRTQAVKPLEVIQPETPLGKGETYPFGL"
FT   exon            complement(569181..570518)
FT                   /gene="Pc13g02440"
FT                   /locus_tag="PCH_Pc13g02440"
FT                   /number=1
FT   mRNA            join(<570959..571793,571862..>572229)
FT                   /gene="Pc13g02450"
FT                   /locus_tag="PCH_Pc13g02450"
FT   CDS_pept        join(<570959..571793,571862..572229)
FT                   /gene="Pc13g02450"
FT                   /locus_tag="PCH_Pc13g02450"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1471_1.tfa_1040cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91314"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J8"
FT                   /protein_id="CAP91314.1"
FT                   /translation="LPVSSPSPRLDRCGQAMESLYGSFSNIEDPNTWTPPPRSGGHRGR
FT                   YLWTDAFGVVNFLTMHQEYKRTGNDTTGDDRYLVLAGRLIETVHDVLGKTRDGRSRLRG
FT                   ATDENPLSGGLRIGKTDARGPDGDGQYHHYLTVWMFALNRMAKASGDLKYNRQAIELAK
FT                   AIHPRFFVDRAAARPRMIWKMSMDLSEPLVKSEGNLDPIDGFVVFRLLQDTAMEAGDGA
FT                   FLAEEIDDYRRTMERKGEHFVSSDPLDLGMTLWTAHWFSGRERWAADLAGKCFEQIYNL
FT                   FEINQYLERNIKFRLAFREFGTCMGIQCQSEVKEKERTVDLKCYSDAIIAAWDPYMQLS
FT                   ISDDLTPADLRPITRVMYASALIPGGKLSQTILYDESGILTHFPIPAFQAGFLGPEPTP
FT                   T"
FT   exon            570959..571793
FT                   /gene="Pc13g02450"
FT                   /locus_tag="PCH_Pc13g02450"
FT                   /number=1
FT   intron          571794..571861
FT                   /gene="Pc13g02450"
FT                   /locus_tag="PCH_Pc13g02450"
FT                   /number=1
FT   exon            571862..572229
FT                   /gene="Pc13g02450"
FT                   /locus_tag="PCH_Pc13g02450"
FT                   /number=2
FT   mRNA            complement(join(<572608..572682,572914..>573801))
FT                   /gene="Pc13g02460"
FT                   /locus_tag="PCH_Pc13g02460"
FT   CDS_pept        complement(join(572608..572682,572914..573801))
FT                   /gene="Pc13g02460"
FT                   /locus_tag="PCH_Pc13g02460"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPBC543.08 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91315"
FT                   /db_xref="GOA:B6H1J9"
FT                   /db_xref="InterPro:IPR019388"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J9"
FT                   /inference="similar to AA sequence:TREMBL:SPBC543.8"
FT                   /protein_id="CAP91315.1"
FT                   /translation="MATATARPVTLLSTVLLIYPATLLLGSLFSAISPTARHSRDLSGS
FT                   SPQPASPLAPSLATDLHLSESPVNYFARKNNIFNVYFVKIGWLWTTAAFVSLLIFQPLY
FT                   SPSRRESSSQQQARFRRTLQAILRYALATTVWYLATQWFFGPAIIDRGFVATGGKCERA
FT                   LEEVEKMTAGQSSPTGLETLFTAATCKAAGGAWRGGHDISGHVLMLVLATGLLAFEAVG
FT                   ASAHAPACVSQAGPTADAGRERKASDADSTPVIDSTETGGFARTWSLRLVWGVVGLGWW
FT                   MLFMTAIWFHTWLEKIALFSGMEKPSNRLHPDVETPGYT"
FT   exon            complement(572608..572682)
FT                   /gene="Pc13g02460"
FT                   /locus_tag="PCH_Pc13g02460"
FT                   /number=1
FT   mat_peptide     complement(join(572611..572682,572914..573711))
FT                   /gene="Pc13g02460"
FT                   /locus_tag="PCH_Pc13g02460"
FT   intron          complement(572683..572913)
FT                   /gene="Pc13g02460"
FT                   /locus_tag="PCH_Pc13g02460"
FT                   /number=1
FT   exon            complement(572914..573801)
FT                   /gene="Pc13g02460"
FT                   /locus_tag="PCH_Pc13g02460"
FT                   /number=2
FT   sig_peptide     complement(573712..573801)
FT                   /gene="Pc13g02460"
FT                   /locus_tag="PCH_Pc13g02460"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<574647..574677,574750..575378,
FT                   575435..575571,575626..575637,575773..>575881))
FT                   /gene="Pc13g02470"
FT                   /locus_tag="PCH_Pc13g02470"
FT   CDS_pept        complement(join(574647..574677,574750..575378,
FT                   575435..575571,575626..575637,575773..575881))
FT                   /gene="Pc13g02470"
FT                   /locus_tag="PCH_Pc13g02470"
FT                   /note="Title: strong similarity to mitochondrial carrier
FT                   protein Ymc1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91316"
FT                   /db_xref="GOA:B6H1K0"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K0"
FT                   /inference="similar to AA sequence:PIR:S54080"
FT                   /inference="protein motif:PFAM:PF00153"
FT                   /protein_id="CAP91316.1"
FT                   /translation="METEVIDSIDKGNGGALRTIKDLTAGAVGGMAQVMLGQPFDIVKV
FT                   RLQTTTQYKSALECATQIFKKEGPTAFYKGTLTPLIGIGACVSVQFGAYHEARRRLEEL
FT                   NKKKYANSALSYTQYYMAGSFAGLTNSVLSGPIEHVRIRLQAQPHGAGRLYSGPIDCVS
FT                   KLAAQGGALRGIYRGQAVTLLREAQAYGAWFMAFEFMMNGDAKRNNIKREDMSKAKIAI
FT                   YGGLAGEVLWLSSYPFDVIKSKMQTDGFGAEQKFSTMRDCFKKTYAIEGLGGFWKGIGP
FT                   TLLRAMPVSAGTFLTVELAMQALG"
FT   exon            complement(574647..574677)
FT                   /gene="Pc13g02470"
FT                   /locus_tag="PCH_Pc13g02470"
FT                   /number=1
FT   intron          complement(574678..574749)
FT                   /gene="Pc13g02470"
FT                   /locus_tag="PCH_Pc13g02470"
FT                   /number=1
FT   exon            complement(574750..575378)
FT                   /gene="Pc13g02470"
FT                   /locus_tag="PCH_Pc13g02470"
FT                   /number=2
FT   intron          complement(575379..575434)
FT                   /gene="Pc13g02470"
FT                   /locus_tag="PCH_Pc13g02470"
FT                   /number=2
FT   exon            complement(575435..575571)
FT                   /gene="Pc13g02470"
FT                   /locus_tag="PCH_Pc13g02470"
FT                   /number=3
FT   intron          complement(575572..575625)
FT                   /gene="Pc13g02470"
FT                   /locus_tag="PCH_Pc13g02470"
FT                   /number=3
FT   exon            complement(575626..575637)
FT                   /gene="Pc13g02470"
FT                   /locus_tag="PCH_Pc13g02470"
FT                   /number=4
FT   intron          complement(575638..575772)
FT                   /gene="Pc13g02470"
FT                   /locus_tag="PCH_Pc13g02470"
FT                   /number=4
FT   exon            complement(575773..575881)
FT                   /gene="Pc13g02470"
FT                   /locus_tag="PCH_Pc13g02470"
FT                   /number=5
FT   mRNA            join(<576150..576173,576224..579095,579157..>579308)
FT                   /gene="Pc13g02480"
FT                   /locus_tag="PCH_Pc13g02480"
FT   CDS_pept        join(576150..576173,576224..579095,579157..579308)
FT                   /gene="Pc13g02480"
FT                   /locus_tag="PCH_Pc13g02480"
FT                   /note="Title: strong similarity to translation initiation
FT                   factor like protein An18g05570 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91317"
FT                   /db_xref="GOA:B6H1K1"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K1"
FT                   /inference="protein motif:PFAM:PF04760"
FT                   /inference="protein motif:PFAM:PF00009"
FT                   /inference="protein motif:PFAM:PF03144"
FT                   /inference="protein motif:COGS:COG0532"
FT                   /protein_id="CAP91317.1"
FT                   /translation="MHRRPICRLSRRAEWSNSAYRTPTLTALTARRTIRLSATRWNSLG
FT                   PSNENDDGTASNPAPTKPKFGSRWGSKQATPSAGLSFAEQAMRQTLVANNQPPPPVPAP
FT                   TQRRQERSNQQLNSGQSNQQRKPYVRRVSPRDNQDAHMMGSRETPRHQRRSPFGQEKNP
FT                   FKEENTGSYTRWPKGSSRNQERNPFSRGTKPAFEEENPFAPEKTQNRFQGQFQNRATRD
FT                   HPMAHNDWKCPECMKHVFASKQVCPFCKASRPSDAQPKFRITREYSDSPGPSQFKQSRS
FT                   PSEYTSKFQQLGESVLTELEQDVQPNTTETTKRHSEKSDRPRTKEEAEDFKKNQWSWDM
FT                   SALEQLENLEEQEQPPPSKPMKRREGRKGRENESDGADFDSEDRERLRAERRRQQKEKN
FT                   AQRAAKKAAAQAAPAPLYLPEFISVSNLADVIGVRPAQFVQRMEDMGFEEITYRDILDA
FT                   ETAGLVAAEFNYEAIFDSGKADLHAAPELEDTSGLPPRPPVVTIMGHVDHGKTTILDWL
FT                   RKSSVAASEHGGITQHIGAFSVMMPSGKAITFLDTPGHSAFLEMRRRGADVTDIVVLVV
FT                   AADDSVKPQTIEAIKHATQAKVPVIVAISKIDKEGNNPDRVKGDLSVHGIHVEDYGGDV
FT                   QAIGVSGKTGQGMVELEEAIVALSEMLDHRASTTCNVEGWVIEASTKSYGRVASALIRR
FT                   GTLRPGDIIVAGTAWARVRTLRNEAGVAISEATPGMPVEIDGWREQPGAGTELLQAPTE
FT                   QKAKDVVDYRLEKSDTQKMGIDMVAINEARRELLEKRRRENEDEETAKEVEPTGPKSVN
FT                   FVLKGDVDGSVEAVLNSVAAVGNNEVFANIIRSGVGPVSEFDIEHAGSANGKIVSFNQA
FT                   IDPNIMRIAEAEGVDILDHNIIYKLIDDIKAILSEKLPPTITTRVTGEAEVQQVFEITV
FT                   KGREKTAIAGSRVRNGLINKTRKVRVLRGEEIVYDGAMVSLKNVKKDVTEMRKDTECGI
FT                   AFENWTGFAPGDHVQCYEEISEKRYL"
FT   exon            576150..576173
FT                   /gene="Pc13g02480"
FT                   /locus_tag="PCH_Pc13g02480"
FT                   /number=1
FT   intron          576174..576223
FT                   /gene="Pc13g02480"
FT                   /locus_tag="PCH_Pc13g02480"
FT                   /number=1
FT   exon            576224..579095
FT                   /gene="Pc13g02480"
FT                   /locus_tag="PCH_Pc13g02480"
FT                   /number=2
FT   intron          579096..579156
FT                   /gene="Pc13g02480"
FT                   /locus_tag="PCH_Pc13g02480"
FT                   /number=2
FT   exon            579157..579308
FT                   /gene="Pc13g02480"
FT                   /locus_tag="PCH_Pc13g02480"
FT                   /number=3
FT   mRNA            complement(join(<579876..580262,580332..581987,
FT                   582038..>582097))
FT                   /gene="Pc13g02490"
FT                   /locus_tag="PCH_Pc13g02490"
FT   CDS_pept        complement(join(579876..580262,580332..581987,
FT                   582038..582097))
FT                   /gene="Pc13g02490"
FT                   /locus_tag="PCH_Pc13g02490"
FT                   /note="Title: similarity to maltose pathway regulatory
FT                   protein Mal13 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91318"
FT                   /db_xref="GOA:B6H1K6"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K6"
FT                   /inference="similar to AA sequence:PIR:S64623"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /protein_id="CAP91318.1"
FT                   /translation="MDLKTRLRKACDACSIRKVKCDTGGPPCRSCASLDIPCTYERPSR
FT                   RRGPPNRHAEAFKKQKREPEDTASLSPADYPSAATPLATPLTNPQCASVSLSVESICSL
FT                   HTMQMLLDDFFTYIHPLVPIPHEPSFRAAFERREDVTNHTFLALLASMIGLLVASFPRR
FT                   PKLRLNTEAERTAFPNSIALVKRCLDVAIQARGTGYLDRDATVYDAAISYFLAICAGYI
FT                   YNMRRCRVYLSECRAMLQVYDLCRSPTTTNRPSSTLGPLSPLSPASVTVLDSPAHNFTE
FT                   SRGVDLITQELGRRLFYVTFVGYQTLHQMGSSDIKVHVPPETPTDRYPPLPLEIDDEFL
FT                   FSTHVEPQPSDRVSRLVGFNANVRVYSSYTALLAWEIAFGSGQIFDWEHQRNCIWDCLK
FT                   RAKSALIDVPAELSLHHPKHVSPAGLSGLGEDDTIFSYSNDHIHQERRAIQYEIQKANI
FT                   YASQLCNRSFLVEKYWSLFETFSKYGKSPKFTAPGSTTPHIKMEGRPDSVPSASASATP
FT                   TGTASSETSTQAQPHAETDYIGRMMAEERKLVIKDLFVLLRTVNEVNMEPNGASITNKI
FT                   RQVASTLLSLSHKPNQSNTEIPNLTTAAAPSPSPTTAPPGLHILTAAEAESYLHAFIET
FT                   LVRLECHSAMGDAANSADGVSPQMNGRAMSYLSDYERDQEELSQWASLKEYQQKFAEAG
FT                   GVLHQL"
FT   exon            complement(579876..580262)
FT                   /gene="Pc13g02490"
FT                   /locus_tag="PCH_Pc13g02490"
FT                   /number=1
FT   intron          complement(580263..580331)
FT                   /gene="Pc13g02490"
FT                   /locus_tag="PCH_Pc13g02490"
FT                   /number=1
FT   exon            complement(580332..581987)
FT                   /gene="Pc13g02490"
FT                   /locus_tag="PCH_Pc13g02490"
FT                   /number=2
FT   intron          complement(581988..582037)
FT                   /gene="Pc13g02490"
FT                   /locus_tag="PCH_Pc13g02490"
FT                   /number=2
FT   exon            complement(582038..582097)
FT                   /gene="Pc13g02490"
FT                   /locus_tag="PCH_Pc13g02490"
FT                   /number=3
FT   mRNA            complement(join(<582718..582892,582944..583521,
FT                   583568..>583618))
FT                   /gene="Pc13g02500"
FT                   /locus_tag="PCH_Pc13g02500"
FT   CDS_pept        complement(join(582718..582892,582944..583521,
FT                   583568..583618))
FT                   /gene="Pc13g02500"
FT                   /locus_tag="PCH_Pc13g02500"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   B13D15.090 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91319"
FT                   /db_xref="GOA:B6H1K2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K2"
FT                   /inference="similar to AA sequence:TREMBLNEW:BX842630.9"
FT                   /protein_id="CAP91319.1"
FT                   /translation="MSRLLDPSRAAWLYPFWGIYYFASNRFLWPLFKARLVPIVLLSSF
FT                   IYFILFFFTYLPQVAFLAIFQGSSAWVSGAFLVLGEGAAIVAALFEAFFVDETLVDIFD
FT                   AVLVNEGQEELVTTSRVIYPEPGNPAKRLGTPTTSAVYSPFSLRQIVEFIILLPLIFIP
FT                   VAGTPMFLLLTGYRAGPFHHWRYFHLLDMTKQQRKESISRRQLQYTTFGTVALILQLIP
FT                   PFSMLFLMTTAAGSALWVTDIERKRRAINQQSSRLGEQYRDDIMP"
FT   exon            complement(582718..582892)
FT                   /gene="Pc13g02500"
FT                   /locus_tag="PCH_Pc13g02500"
FT                   /number=1
FT   intron          complement(582893..582943)
FT                   /gene="Pc13g02500"
FT                   /locus_tag="PCH_Pc13g02500"
FT                   /number=1
FT   exon            complement(582944..583521)
FT                   /gene="Pc13g02500"
FT                   /locus_tag="PCH_Pc13g02500"
FT                   /number=2
FT   intron          complement(583522..583567)
FT                   /gene="Pc13g02500"
FT                   /locus_tag="PCH_Pc13g02500"
FT                   /number=2
FT   exon            complement(583568..583618)
FT                   /gene="Pc13g02500"
FT                   /locus_tag="PCH_Pc13g02500"
FT                   /number=3
FT   mRNA            complement(join(<584024..584551,584603..>584791))
FT                   /gene="Pc13g02510"
FT                   /locus_tag="PCH_Pc13g02510"
FT   CDS_pept        complement(join(584024..584551,584603..584791))
FT                   /gene="Pc13g02510"
FT                   /locus_tag="PCH_Pc13g02510"
FT                   /note="Title: similarity to L-2-haloalkanoic acid
FT                   dehalogenase hadL - Pseudomonas putida"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91320"
FT                   /db_xref="GOA:B6H1K3"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K3"
FT                   /inference="similar to AA sequence:PIR:A44830"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /inference="protein motif:COGS:COG0637"
FT                   /inference="protein motif:COGS:COG0546"
FT                   /inference="protein motif:COGS:COG1011"
FT                   /protein_id="CAP91320.1"
FT                   /translation="MTAKTVVAFDLYGTLLSTESIAKQLEKRCDNAKAQSISALWRRYQ
FT                   LEYTWRLNSMGKPHFQSSTRNSLLHALADNNEQLSDDHIEHLMQAYNDLSTFSDVNPAL
FT                   AQIAADPSIQAVIFSNGTKTMLSNSVLRSKDLSPHASVFQDIVTVDEVQQYKPSKASYE
FT                   HLAKQTGQDPLQMSKLWLISGNPFDIVGARATGMQAIWVDRVGAGWKDAVAPDLQPTAI
FT                   VHDLKHIVKEINRHQI"
FT   exon            complement(584024..584551)
FT                   /gene="Pc13g02510"
FT                   /locus_tag="PCH_Pc13g02510"
FT                   /number=1
FT   intron          complement(584552..584602)
FT                   /gene="Pc13g02510"
FT                   /locus_tag="PCH_Pc13g02510"
FT                   /number=1
FT   exon            complement(584603..584791)
FT                   /gene="Pc13g02510"
FT                   /locus_tag="PCH_Pc13g02510"
FT                   /number=2
FT   mRNA            join(<584952..585137,585248..>585826)
FT                   /gene="Pc13g02520"
FT                   /locus_tag="PCH_Pc13g02520"
FT   CDS_pept        join(584952..585137,585248..585826)
FT                   /gene="Pc13g02520"
FT                   /locus_tag="PCH_Pc13g02520"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1471_1.tfa_530cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91321"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K4"
FT                   /inference="protein motif:COGS:COG1403"
FT                   /protein_id="CAP91321.1"
FT                   /translation="MTSGENYAVFRECLSNAIVARSEEKPTRRKPKVKRAERKDVKTAT
FT                   TFSTRRADPEELAEFVDFLASETFAIFPTPLQTLSYAAIQHDPSLSALYIPPDTDTPLP
FT                   RATLETIFSPIPVSVTDSLLVYGIIPDRADLVDFLAPVLTEYISSVTTGPPAWASTRAD
FT                   ACEICERDWIPLSYHHLIPRGVHAKVIKKGWHDEWMLNSVAWLCRACHSFVHRMASNEE
FT                   LAREWFTVERICEREDVQDWAKWVGRVRWKAR"
FT   exon            584952..585137
FT                   /gene="Pc13g02520"
FT                   /locus_tag="PCH_Pc13g02520"
FT                   /number=1
FT   intron          585138..585247
FT                   /gene="Pc13g02520"
FT                   /locus_tag="PCH_Pc13g02520"
FT                   /number=1
FT   exon            585248..585826
FT                   /gene="Pc13g02520"
FT                   /locus_tag="PCH_Pc13g02520"
FT                   /number=2
FT   mRNA            complement(join(<586128..587858,587890..>588090))
FT                   /gene="Pc13g02530"
FT                   /locus_tag="PCH_Pc13g02530"
FT   CDS_pept        complement(join(586128..587858,587890..588090))
FT                   /gene="Pc13g02530"
FT                   /locus_tag="PCH_Pc13g02530"
FT                   /note="Title: similarity to cellulosomal scaffoldin
FT                   anchoring protein C - Acetivibrio cellulolyticus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91322"
FT                   /db_xref="GOA:B6H1K5"
FT                   /db_xref="InterPro:IPR003566"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K5"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /inference="protein motif:COGS:COG5411"
FT                   /inference="protein motif:COGS:COG3468"
FT                   /inference="protein motif:COGS:COG2812"
FT                   /inference="protein motif:COGS:COG0553"
FT                   /inference="protein motif:COGS:COG1197"
FT                   /inference="protein motif:COGS:COG1674"
FT                   /protein_id="CAP91322.1"
FT                   /translation="MLRFQFFLFLLLPWMASAGPIFRWLSPSLESPEPTSLPLLPDIER
FT                   REPGGITAITPVAAPTQLPFTPTIKPTKLTIFPKPTTTPEPTATPEPTTTPEPTATPEP
FT                   TTTPEPTTTPEPTATPEPTATPEPTTTPEPTTTPEPTTTPEPTATPEPTTTPEPTTTPE
FT                   PTATPEPTTTPEPTATPEPTTTQEQATTKKSTTISHASTTTRLSISSSTTPGVLHSSPI
FT                   TSSLPVHVPGSTSSLGSLVIPSSAQSPSDSLPGGATSIKATTATPSVSTSTSTQPTTTP
FT                   VPTVPTSSSIAVGAIAPLGGASSSSSSTSTPVIPTSNPIQPAKATQAQSTSLQQISTSS
FT                   SKPVVTVTEPVIVYVTKGAPKPFSTSVIHHTPSVNNSPVSSAKPTVKPSVEPTTTSLMF
FT                   VTIHSTATSVVRVTVYPSSSSSSSSSSSSSSSSSASSYSALSSSTGSAPSVNAAPIVLT
FT                   TINSATQSLSSSSLLLSSSSEIAPVVTAHVTSTSVVPLTVYPATSPPASSLLPPSSEAA
FT                   SIVTVRVTSTSVVPVTVYSTTSPSAPLLPSLSETAPVVTVHVTSTKTLLVTSYGSTATA
FT                   AETTHPADPTSAVDANIATPTSKQGQGILTVIPVTPPGFVTITETETETKTVTDRITET
FT                   VTATVTRG"
FT   exon            complement(586128..587858)
FT                   /gene="Pc13g02530"
FT                   /locus_tag="PCH_Pc13g02530"
FT                   /number=1
FT   mat_peptide     complement(join(586131..587858,587890..588036))
FT                   /gene="Pc13g02530"
FT                   /locus_tag="PCH_Pc13g02530"
FT   intron          complement(587859..587889)
FT                   /gene="Pc13g02530"
FT                   /locus_tag="PCH_Pc13g02530"
FT                   /number=1
FT   exon            complement(587890..588090)
FT                   /gene="Pc13g02530"
FT                   /locus_tag="PCH_Pc13g02530"
FT                   /number=2
FT   sig_peptide     complement(588037..588090)
FT                   /gene="Pc13g02530"
FT                   /locus_tag="PCH_Pc13g02530"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<588913..590995,591057..>591268))
FT                   /gene="Pc13g02540"
FT                   /locus_tag="PCH_Pc13g02540"
FT   CDS_pept        complement(join(588913..590995,591057..591268))
FT                   /gene="Pc13g02540"
FT                   /locus_tag="PCH_Pc13g02540"
FT                   /note="Title: strong similarity to mitochondrial ceramidase
FT                   AAF86240.1 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91323"
FT                   /db_xref="GOA:B6H1K7"
FT                   /db_xref="InterPro:IPR006823"
FT                   /db_xref="InterPro:IPR031329"
FT                   /db_xref="InterPro:IPR031331"
FT                   /db_xref="InterPro:IPR038445"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K7"
FT                   /inference="similar to AA sequence:TREMBL:AF250847.1"
FT                   /inference="protein motif:PFAM:PF04734"
FT                   /protein_id="CAP91323.1"
FT                   /translation="MTNFRMGVTFAGVTLSVLVFLQLIAVFKLDSQPQSPLPGLSSNFN
FT                   QWKSRANAAAADDIFLVGAGKADVTGPVVEIAFAGYASLDQLGGGLKQRLYSRAFIFAD
FT                   PNKPDETFVYLVLDTLTGDTAVRHGVLEGLTALGGKYARYGEHNVAMTGTHSHSGPGAW
FT                   MNYLLPQIPALGFDKQSYQAIVDGAILSIIRAHENLVPGRLSFGSIDLEDTNINRSPFS
FT                   YEHNPDEERARYSANVEKSLSLIRFDRESDNKTAAILTWFPVHGTSMYNNNTLVSGDNK
FT                   GVAAYLFERSVDGDARFTDDAVIGFSQANVGDTSPNILGAWCEDGSEEMCRYEDSTCGG
FT                   RNEDCHGRGPFFREKDNGAKSCFEIGRRQYSAAKKLYEEMDTTPIKITGGSAVKSFHVY
FT                   QDMNGYTFPSPFNSSTLTTCPAALGYSFAAGTTDGPGAFDFTQNVTGPAGRNPLWKIAR
FT                   AVIHQPSKEQQQCQSPKNVLLDIGTLTEPYAWAADIIDIQVLRVGQLFLIISTSEATTM
FT                   SGRRWKEAIAKGAKDYLSVSDPLVVLGAPSNSYAHYVTTEEEYGAQRYEGGSTLYGPNT
FT                   LAAYVNLTLTYLPYLGSSLEVAKLPAIQPGPSPPINTNRSLSFIAGVVYDGAPIGKHFG
FT                   NVTSNPGSGPYGPGDIVKTTFVGANPRNNLHLESTYAAVERKNDYGTWEVVRNDRDWNL
FT                   VFTWKRTNEILGHSEVTIEWEIEDEYYSIDTTSPPQAGTYRMHYYGDSKNPLGQISPFE
FT                   GISGTFTVKTS"
FT   exon            complement(588913..590995)
FT                   /gene="Pc13g02540"
FT                   /locus_tag="PCH_Pc13g02540"
FT                   /number=1
FT   intron          complement(590996..591056)
FT                   /gene="Pc13g02540"
FT                   /locus_tag="PCH_Pc13g02540"
FT                   /number=1
FT   exon            complement(591057..591268)
FT                   /gene="Pc13g02540"
FT                   /locus_tag="PCH_Pc13g02540"
FT                   /number=2
FT   mRNA            join(<592100..592136,592194..>592807)
FT                   /gene="Pc13g02550"
FT                   /locus_tag="PCH_Pc13g02550"
FT   CDS_pept        join(592100..592136,592194..592807)
FT                   /gene="Pc13g02550"
FT                   /locus_tag="PCH_Pc13g02550"
FT                   /note="Title: similarity to hypothetical protein T12A2.7
FT                   -Caenorhabditis elegans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02550"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91324"
FT                   /db_xref="GOA:B6H1K8"
FT                   /db_xref="InterPro:IPR008409"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K8"
FT                   /inference="similar to AA sequence:PIR:T34349"
FT                   /inference="protein motif:PFAM:PF05700"
FT                   /protein_id="CAP91324.1"
FT                   /translation="MPLINESHDSLPYIDAAPTASAQARAQQLINAELSPEHASAMHPW
FT                   IPEAPEPKFSQFMQQELARKAQGAPLTGGIDLSRYEAPEAPTRTSDTDSPDLDTWRQTL
FT                   QKAYASSSHLSKRHENLALLEEHGKNAWLIGNSQLEEILGSLEKELAETKEASEEVNKQ
FT                   RKIAQEASQGELVSLEETWKQRLGAILDVEVASEQLRMQRLDYMRQVAQQQAR"
FT   exon            592100..592136
FT                   /gene="Pc13g02550"
FT                   /locus_tag="PCH_Pc13g02550"
FT                   /number=1
FT   intron          592137..592193
FT                   /gene="Pc13g02550"
FT                   /locus_tag="PCH_Pc13g02550"
FT                   /number=1
FT   exon            592194..592807
FT                   /gene="Pc13g02550"
FT                   /locus_tag="PCH_Pc13g02550"
FT                   /number=2
FT   mRNA            complement(join(<593551..594722,594779..>595007))
FT                   /gene="Pc13g02560"
FT                   /locus_tag="PCH_Pc13g02560"
FT   CDS_pept        complement(join(593551..594722,594779..595007))
FT                   /gene="Pc13g02560"
FT                   /locus_tag="PCH_Pc13g02560"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1471_1.tfa_580cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02560"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91325"
FT                   /db_xref="GOA:B6H1K9"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K9"
FT                   /inference="protein motif:PFAM:PF01073"
FT                   /inference="protein motif:COGS:COG1087"
FT                   /inference="protein motif:COGS:COG1088"
FT                   /inference="protein motif:COGS:COG0451"
FT                   /protein_id="CAP91325.1"
FT                   /translation="MTWLIAAGLVGLGALYMWHVNSAMKIVPEEARKLSPHRWTVEEIE
FT                   AAYKKSMKAPIDVTKSLPPKQSRRYVIVGGNGLVGAWIVSHLLARGEDPKAIRILDIVS
FT                   PEQDVINKGVGWIKTNITDELAVTTAFEEPWVANVTNLPLTVYHTAAIIRPQDRLKSFL
FT                   PLSSKVNIDGTRNVLNAARAAGATAFIWTSSGSIALHQPTFWIAPWATQPKRVVQVVSD
FT                   STKLPESHDQFFGNYAVTKTEAERLVREADDPAINFRTGCIRPTNGVYGTGGQANNIIT
FT                   GVYLQNGGSPTWARPILQSFVHAENVSIAHLLYEQRLIQQSEPGSKLPNTGGQAFTVTD
FT                   PNPAIAFEDLYTLLTTLSRTPLAFPEVQPLPLLVMAYFIELYTFLQYKYLSWFLPRLSG
FT                   DIAQLQPSIFSIINVHVFADDSRARLAPEMGGLGYNPPLSTLEGLCRRLVDWNTKAERE
FT                   GVEAGTNM"
FT   exon            complement(593551..594722)
FT                   /gene="Pc13g02560"
FT                   /locus_tag="PCH_Pc13g02560"
FT                   /number=1
FT   mat_peptide     complement(join(593554..594722,594779..594938))
FT                   /gene="Pc13g02560"
FT                   /locus_tag="PCH_Pc13g02560"
FT   intron          complement(594723..594778)
FT                   /gene="Pc13g02560"
FT                   /locus_tag="PCH_Pc13g02560"
FT                   /number=1
FT   exon            complement(594779..595007)
FT                   /gene="Pc13g02560"
FT                   /locus_tag="PCH_Pc13g02560"
FT                   /number=2
FT   sig_peptide     complement(594939..595007)
FT                   /gene="Pc13g02560"
FT                   /locus_tag="PCH_Pc13g02560"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<596531..596862,596921..597297,597359..597635,
FT                   597699..>598428)
FT                   /gene="Pc13g02570"
FT                   /locus_tag="PCH_Pc13g02570"
FT   CDS_pept        join(596531..596862,596921..597297,597359..597635,
FT                   597699..598428)
FT                   /gene="Pc13g02570"
FT                   /locus_tag="PCH_Pc13g02570"
FT                   /note="Title: strong similarity to polyamine transport
FT                   protein Tpo1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02570"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91326"
FT                   /db_xref="GOA:B6H1L0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L0"
FT                   /inference="similar to AA sequence:PIR:S64779"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP91326.1"
FT                   /translation="MAAQHSNSESQEKWPQNTETVSQDTDSIESVSTVETQTDRDALGK
FT                   TLTARASRTSHMSLSERVTTIATNATADPDYEVDWDGDDDPENPKNWNLKYKSMGIVFL
FT                   SWNTLIVVLYSTSYTSGITLMAEEFAQSGTIVTLGLTFYLFGLAIGSMFMAPLSEVYGR
FT                   KPVCVICLAVFTVLIIPCALAKSVTALIVVRFIAAFFGSVMISTAPGMVADLVDDEHRA
FT                   LAISVWSIGPLNGPVIGPVIGGFVTQYLGWRWMCWIALILSAIALVFAILLKETYAPTI
FT                   LQKKAARLRKETGESRWWSRYDQKASLPEILKLNLSRPFVMAVTEPICIFWNIYIAIIY
FT                   GILYLCFVAYPIVFRDIRGWQLGVSGLAFLGIGIGVLLTIACEPLIRRLVNSHPKDPET
FT                   GKPHPEAMVAFVCICATIIPVGELWFAWTCSPASIHWIVPILAGIPFGAGNTGVFIYAS
FT                   NYLTHSYGMYAASALAGNSVIRSILGGVLPLAGSSMYASLGPNWAGTLLGLLEVVIVPI
FT                   PFVFYKYGHKIRMKSPLIVRMQEEKTKLEGKRAKRQLRLQQVNQADEKKVEEAV"
FT   exon            596531..596862
FT                   /gene="Pc13g02570"
FT                   /locus_tag="PCH_Pc13g02570"
FT                   /number=1
FT   intron          596863..596920
FT                   /gene="Pc13g02570"
FT                   /locus_tag="PCH_Pc13g02570"
FT                   /number=1
FT   exon            596921..597297
FT                   /gene="Pc13g02570"
FT                   /locus_tag="PCH_Pc13g02570"
FT                   /number=2
FT   intron          597298..597358
FT                   /gene="Pc13g02570"
FT                   /locus_tag="PCH_Pc13g02570"
FT                   /number=2
FT   exon            597359..597635
FT                   /gene="Pc13g02570"
FT                   /locus_tag="PCH_Pc13g02570"
FT                   /number=3
FT   intron          597636..597698
FT                   /gene="Pc13g02570"
FT                   /locus_tag="PCH_Pc13g02570"
FT                   /number=3
FT   exon            597699..598428
FT                   /gene="Pc13g02570"
FT                   /locus_tag="PCH_Pc13g02570"
FT                   /number=4
FT   mRNA            complement(<598607..>599017)
FT                   /gene="Pc13g02580"
FT                   /locus_tag="PCH_Pc13g02580"
FT   CDS_pept        complement(598607..599017)
FT                   /pseudo
FT                   /gene="Pc13g02580"
FT                   /locus_tag="PCH_Pc13g02580"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An18g05440 - Aspergillus niger [putative pseudogene]"
FT   exon            complement(598607..599017)
FT                   /gene="Pc13g02580"
FT                   /locus_tag="PCH_Pc13g02580"
FT                   /number=1
FT   mRNA            join(<599628..599802,599899..600103,600186..600394,
FT                   600452..>600531)
FT                   /gene="Pc13g02590"
FT                   /locus_tag="PCH_Pc13g02590"
FT   CDS_pept        join(599628..599802,599899..600103,600186..600394,
FT                   600452..600531)
FT                   /gene="Pc13g02590"
FT                   /locus_tag="PCH_Pc13g02590"
FT                   /note="Title: similarity to endosomal protein Snf7
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02590"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91328"
FT                   /db_xref="GOA:B6H1L1"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L1"
FT                   /inference="similar to AA sequence:PIR:S52590"
FT                   /inference="protein motif:PFAM:PF03357"
FT                   /protein_id="CAP91328.1"
FT                   /translation="MWSWFGGAAAQKRKDAPKNAILQLREQLDMLQKRERHLETQISEQ
FT                   EAMARKNVNSDKNAAKNALRRKKVHEKNLEQTTAQIMQLEQQIYSIEAANINHETLAAM
FT                   KQAGAAMKQIHGGMKLEDVDKTMEELQDQHALSAEIGSVITSFPIGEQPDEDELDAELG
FT                   NLEQEALDAKMLHTGPVPVGSQLDRLPAAGNTDLKQPAKAQEEDDEEAELAKLRAEMAM
FT                   "
FT   exon            599628..599802
FT                   /gene="Pc13g02590"
FT                   /locus_tag="PCH_Pc13g02590"
FT                   /number=1
FT   intron          599803..599898
FT                   /gene="Pc13g02590"
FT                   /locus_tag="PCH_Pc13g02590"
FT                   /number=1
FT   exon            599899..600103
FT                   /gene="Pc13g02590"
FT                   /locus_tag="PCH_Pc13g02590"
FT                   /number=2
FT   intron          600104..600185
FT                   /gene="Pc13g02590"
FT                   /locus_tag="PCH_Pc13g02590"
FT                   /number=2
FT   exon            600186..600394
FT                   /gene="Pc13g02590"
FT                   /locus_tag="PCH_Pc13g02590"
FT                   /number=3
FT   intron          600395..600451
FT                   /gene="Pc13g02590"
FT                   /locus_tag="PCH_Pc13g02590"
FT                   /number=3
FT   exon            600452..600531
FT                   /gene="Pc13g02590"
FT                   /locus_tag="PCH_Pc13g02590"
FT                   /number=4
FT   mRNA            complement(join(<603174..603786,603847..604768,
FT                   604844..604987,605096..>605144))
FT                   /gene="Pc13g02600"
FT                   /locus_tag="PCH_Pc13g02600"
FT   CDS_pept        complement(join(603174..603786,603847..604768,
FT                   604844..604987,605096..605144))
FT                   /gene="Pc13g02600"
FT                   /locus_tag="PCH_Pc13g02600"
FT                   /note="Title: strong similarity to nuclear localization
FT                   protein Npl6 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02600"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91329"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E6"
FT                   /inference="similar to AA sequence:PIR:S30792"
FT                   /protein_id="CAP91329.1"
FT                   /translation="MPRKLRAAAQAAAKSIKNVPSIPDGSDEEMVDVPSSHSSSPIAEQ
FT                   EDSPEKDPDVELEAEPESKQEELAAATPAGDSILADTDNTPSYGPGRPSLPPRGKRRIG
FT                   RPPKYPRPEWNPADGEQPLRVTTPVKRRRGRPAASGGRWARNRGPSHLTQVPVDKEGNM
FT                   MDVINDEVSIPPDPIGATKVDENGHLQGGREYRVRTFKILGRGDRLYMLSTEPARCIGF
FT                   RDSYLFFQKHKMLYKIIIDDDAKRDLIERDLIPHSYKGRAIGVVTARSVFREFGAKIIV
FT                   GGKKITDDYDEAAARERGDVEGELAVPEDRLPGPGETYNRNQYVAWHGASSVYHTNAPA
FT                   VPLVGGKPVDTKKRRVPVTDDNWMLEHARAASNFNSKLAEMRRKNLGGVYDVHTNIMQH
FT                   PKIMQPTHARWERVSPAPASVPTELTANMNLLNLSNGGSPSAHENQTSHETQESHEATT
FT                   GETATERLATTFSPVPAHLHDRCVIQDIVYESPPYSNMGIPGPDGDVHDIGPNGLVSVA
FT                   NPEHPEFMTPEILELLPPGCKEALVDAAAQEVEWKSKWTSETKDGERTQPTKSYAWYP"
FT   exon            complement(603174..603786)
FT                   /gene="Pc13g02600"
FT                   /locus_tag="PCH_Pc13g02600"
FT                   /number=1
FT   intron          complement(603787..603846)
FT                   /gene="Pc13g02600"
FT                   /locus_tag="PCH_Pc13g02600"
FT                   /number=1
FT   exon            complement(603847..604768)
FT                   /gene="Pc13g02600"
FT                   /locus_tag="PCH_Pc13g02600"
FT                   /number=2
FT   intron          complement(604769..604843)
FT                   /gene="Pc13g02600"
FT                   /locus_tag="PCH_Pc13g02600"
FT                   /number=2
FT   exon            complement(604844..604987)
FT                   /gene="Pc13g02600"
FT                   /locus_tag="PCH_Pc13g02600"
FT                   /number=3
FT   intron          complement(604988..605095)
FT                   /gene="Pc13g02600"
FT                   /locus_tag="PCH_Pc13g02600"
FT                   /number=3
FT   exon            complement(605096..605144)
FT                   /gene="Pc13g02600"
FT                   /locus_tag="PCH_Pc13g02600"
FT                   /number=4
FT   mRNA            complement(join(<606459..606536,606585..606821,
FT                   607012..>607260))
FT                   /gene="Pc13g02610"
FT                   /locus_tag="PCH_Pc13g02610"
FT   CDS_pept        complement(join(606459..606536,606585..606821,
FT                   607012..607260))
FT                   /gene="Pc13g02610"
FT                   /locus_tag="PCH_Pc13g02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02610"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91330"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E7"
FT                   /protein_id="CAP91330.1"
FT                   /translation="MIAFFRSRSIVRMTVRPRTCGYTRVPYQKRLRGITNSPLSMRPFP
FT                   FDFDTCTYLSFPSLIALRISISTLTAGYLILASDDNIGIKSSFTHREIVTTFSFQYGPG
FT                   RALSSPCICIPGEIVRYAVVAVGRSQASTCVIGARREVPASALTCGSADLRPGSCMNDK
FT                   EKETLESFADLRFGPSDYSIHGLE"
FT   exon            complement(606459..606536)
FT                   /gene="Pc13g02610"
FT                   /locus_tag="PCH_Pc13g02610"
FT                   /number=1
FT   intron          complement(606537..606584)
FT                   /gene="Pc13g02610"
FT                   /locus_tag="PCH_Pc13g02610"
FT                   /number=1
FT   exon            complement(606585..606821)
FT                   /gene="Pc13g02610"
FT                   /locus_tag="PCH_Pc13g02610"
FT                   /number=2
FT   intron          complement(606822..607011)
FT                   /gene="Pc13g02610"
FT                   /locus_tag="PCH_Pc13g02610"
FT                   /number=2
FT   exon            complement(607012..607260)
FT                   /gene="Pc13g02610"
FT                   /locus_tag="PCH_Pc13g02610"
FT                   /number=3
FT   mRNA            join(<608075..608127,608418..609649,609714..>611113)
FT                   /gene="Pc13g02620"
FT                   /locus_tag="PCH_Pc13g02620"
FT   CDS_pept        join(608075..608127,608418..609649,609714..611113)
FT                   /gene="Pc13g02620"
FT                   /locus_tag="PCH_Pc13g02620"
FT                   /note="unknown EC_number=2.7.-.-"
FT                   /note="Title: strong similarity to cAMP-dependent protein
FT                   kinase sck1p - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91331"
FT                   /db_xref="GOA:B6H1E8"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E8"
FT                   /inference="similar to AA sequence:PIR:S55694"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:PFAM:PF00433"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP91331.1"
FT                   /translation="MAAQSGPVLHGDDMKTMNSGLEDDSQDQIRSNDSTPTPTGIATPE
FT                   PDPVDKRLPSIMHNYFQVGSFSGDKASLPRLWSCLSKPSEDSQSNAHTQHSSDSSESFV
FT                   MMEQEDGPDKMEEHPSLHTPPHSLLQHESDEMELGTSPGVSSIFTTLKSYLISPTQTPP
FT                   EDHPSRRQTSLPVSSISDDPVLATHFSNPSLPPTSDAFSLIEAPLLDHEKPHVPISSEN
FT                   LAKLTESVPDGLRLKNTPPLTPRAMSNEVPAAQEKNATSAPQESAQETPPSESKPEDME
FT                   SSTDEITMKLDEAFPSQSQSEDAPASPTSTSPANGAPTGPINGKLFVKITDGRGLRPSF
FT                   DPYVVCVFEWNEYISKGARDGEEEKKRRQQESDAEEAAGRPMAIPLKTRSSSHNSAVEG
FT                   DHKGRTPVTDPHWDHEATLYVTPTQLFTWVYDRNNQEAFLGHVRLRVNLKEDHSRLEGW
FT                   FPLVARGAGDNQVSGEIHLDMKFEKTDRKQVGPNDFLVLKLIGKGTFGQVYQVKKKDTQ
FT                   RIYAMKVLSKKVIIQKKEVVHTLGERNILVRTAMTASPFIVGLKFSFQTPTDLYLVTDY
FT                   MSGGELFWHLQREGRFQEARAKFYIAELILALQHLHEHDIVYRDLKPENILLDANGHIA
FT                   LCDFGLSKANLSQNDTTNTFCGTTEYLAPEVLLDEQGYTKMVDFWSLGVLVFEMCCGWS
FT                   PFYAEDTQQMYKNIAFGKVRFPRDALSTEGRNFVKGLLNRNPKHRLGANGDAKELMAHP
FT                   FFHDINWDTLCRKEVIPPFKPQLQSETDTSNFDPEFTNAMELNNSLNLRAANVANGLMP
FT                   ASTPLSPGMQANFKGFTFVNESSIDHHLMDDSDHMEDDAMHDDHWQRGHRSGNSVDQRM
FT                   TGVQKTHDGTEPGIFNVDDTFDM"
FT   exon            608075..608127
FT                   /gene="Pc13g02620"
FT                   /locus_tag="PCH_Pc13g02620"
FT                   /number=1
FT   intron          608128..608417
FT                   /gene="Pc13g02620"
FT                   /locus_tag="PCH_Pc13g02620"
FT                   /number=1
FT   exon            608418..609649
FT                   /gene="Pc13g02620"
FT                   /locus_tag="PCH_Pc13g02620"
FT                   /number=2
FT   intron          609650..609713
FT                   /gene="Pc13g02620"
FT                   /locus_tag="PCH_Pc13g02620"
FT                   /number=2
FT   exon            609714..611113
FT                   /gene="Pc13g02620"
FT                   /locus_tag="PCH_Pc13g02620"
FT                   /number=3
FT   mRNA            complement(join(<612555..613047,613111..>613475))
FT                   /gene="Pc13g02630"
FT                   /locus_tag="PCH_Pc13g02630"
FT   CDS_pept        complement(join(612555..613047,613111..613475))
FT                   /gene="Pc13g02630"
FT                   /locus_tag="PCH_Pc13g02630"
FT                   /note="Title: strong similarity to ankyrin 2 like protein
FT                   An19g00080 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02630"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91332"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D1"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /inference="protein motif:COGS:COG0666"
FT                   /protein_id="CAP91332.1"
FT                   /translation="MSVHKTTEYPISRVGTPPSIPAKTLLLVHQIPELGEQQLREFLDR
FT                   TVRDGHDIRHLYQVMIDAIRSNKVYLVKELLRCKMPISPIYVREAVKGKAKDILTVFFD
FT                   NGWDINAPMSGMNPPILTNALKDLDMTIWLLDHAADPNTRCDIDTTPLSYAVRHTDLPT
FT                   IDLLLRRGGDVRIGQLVHNAIYRESDTLKVVETLVDRGASLDSLMYQDHQYSWNMFPFM
FT                   RETPLHTAVALRRHDVIRYLIHKGANVKIENYRGQTVMQSADEDTKRVIMQEIQESSTF
FT                   HASL"
FT   exon            complement(612555..613047)
FT                   /gene="Pc13g02630"
FT                   /locus_tag="PCH_Pc13g02630"
FT                   /number=1
FT   intron          complement(613048..613110)
FT                   /gene="Pc13g02630"
FT                   /locus_tag="PCH_Pc13g02630"
FT                   /number=1
FT   exon            complement(613111..613475)
FT                   /gene="Pc13g02630"
FT                   /locus_tag="PCH_Pc13g02630"
FT                   /number=2
FT   mRNA            complement(<613712..>614394)
FT                   /gene="Pc13g02640"
FT                   /locus_tag="PCH_Pc13g02640"
FT   CDS_pept        complement(613712..614394)
FT                   /pseudo
FT                   /gene="Pc13g02640"
FT                   /locus_tag="PCH_Pc13g02640"
FT                   /note="putative sequencing error"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An10g00280 - Aspergillus niger [putative sequencing
FT                   error][putative pseudogene]"
FT   exon            complement(613712..614394)
FT                   /gene="Pc13g02640"
FT                   /locus_tag="PCH_Pc13g02640"
FT                   /number=1
FT   mRNA            join(<614937..615027,615180..615410,615515..615555,
FT                   615838..>615948)
FT                   /gene="Pc13g02650"
FT                   /locus_tag="PCH_Pc13g02650"
FT   CDS_pept        join(614937..615027,615180..615410,615515..615555,
FT                   615838..615948)
FT                   /gene="Pc13g02650"
FT                   /locus_tag="PCH_Pc13g02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02650"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91334"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D2"
FT                   /protein_id="CAP91334.1"
FT                   /translation="MFQRGYRKTSSQRKTAQSVACSRQSYGSGPVDAQRDQDVIEGVAT
FT                   GRPGSVPGYLLAALMHCPKLLEGISDGDWRHFEGEERAEELAESDRTQKALVLVADRKA
FT                   CEEGEPLSEIVDNEDEDGRLTLVCGAPQAQDAAQDAARGPVGRSGLAVRGGPG"
FT   exon            614937..615027
FT                   /gene="Pc13g02650"
FT                   /locus_tag="PCH_Pc13g02650"
FT                   /number=1
FT   intron          615028..615179
FT                   /gene="Pc13g02650"
FT                   /locus_tag="PCH_Pc13g02650"
FT                   /number=1
FT   exon            615180..615410
FT                   /gene="Pc13g02650"
FT                   /locus_tag="PCH_Pc13g02650"
FT                   /number=2
FT   intron          615411..615514
FT                   /gene="Pc13g02650"
FT                   /locus_tag="PCH_Pc13g02650"
FT                   /number=2
FT   exon            615515..615555
FT                   /gene="Pc13g02650"
FT                   /locus_tag="PCH_Pc13g02650"
FT                   /number=3
FT   intron          615556..615837
FT                   /gene="Pc13g02650"
FT                   /locus_tag="PCH_Pc13g02650"
FT                   /number=3
FT   exon            615838..615948
FT                   /gene="Pc13g02650"
FT                   /locus_tag="PCH_Pc13g02650"
FT                   /number=4
FT   mRNA            <616696..>617133
FT                   /gene="Pc13g02660"
FT                   /locus_tag="PCH_Pc13g02660"
FT   CDS_pept        616696..617133
FT                   /gene="Pc13g02660"
FT                   /locus_tag="PCH_Pc13g02660"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An11g08750 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91335"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D3"
FT                   /inference="protein motif:COGS:COG0662"
FT                   /inference="protein motif:COGS:COG1917"
FT                   /protein_id="CAP91335.1"
FT                   /translation="MTSKPKPAILPSTYTRTTPPETFPTPGHGDISWHTLISSPQTEST
FT                   DLCAGIATCPPATGHLCAHRHTQSEIYHILEGEGNVTIDGVVSRVQAGSTVFIPSDAEH
FT                   GIVNTGPADLRWFYVFPTGSFGDVVYRFTEDEGEAKGKAKL"
FT   exon            616696..617133
FT                   /gene="Pc13g02660"
FT                   /locus_tag="PCH_Pc13g02660"
FT                   /number=1
FT   mRNA            join(<618980..619365,619447..>621352)
FT                   /gene="Pc13g02670"
FT                   /locus_tag="PCH_Pc13g02670"
FT   CDS_pept        join(618980..619365,619447..621352)
FT                   /gene="Pc13g02670"
FT                   /locus_tag="PCH_Pc13g02670"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An18g05340 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91336"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D4"
FT                   /protein_id="CAP91336.1"
FT                   /translation="MSVVATRTETPVVSYNSIPENHVDYTVHSRTSSISSYRTNYTTST
FT                   APTTYSPSSPSSSYRQCDSVNSLPKLTEPIQRRVPHEVYEVIINHLEELHKGQHQTGCT
FT                   TCFQRDLHALSLTCRSWEKAVRGPLYHSIHIVGNDSPAQLKKYRLKRGSRLKLLRRTLR
FT                   ERKLLANLVYELRVPQLDLLFTTTKQGPQWQEYRDLVASVVMVCPNLERLLGLSIPYHH
FT                   EFDRLTHALSTRKKLKEHTWVLGEPAEVSELSPRDDSCPGSLGPSQMFEFLNYHTSWTS
FT                   LETMMLYGLNGNGALEPSISLRMFNLLPSLRNLCITSFNKDSFDDNTLMCLPPLESLRL
FT                   ENLPGITDAGLSQYTSRPESLSLRTLVLIEQNVESLLVISKILASLRGLERFKIVQTGK
FT                   CPTLPGDHMIFQPILASSTLKYLHWDVACPDPGTALTQLDTLPFQKPTKPSNTPNYHLA
FT                   QSIISAGFPQLEALRAPSDVEPPGALQAVCRPILKGQALLRPDRYSLPRSSHGSVNTRP
FT                   LALPAGNNLTSARIRAQTFIDMAAKDTEAGMPVLIQDYSDSYVPDNAQNSQFEDDPDQE
FT                   MDDYGIWAACERFKHKDNDHNGPKTVYEFRMPTLMGRSGFRDPATGASIPHFILRPDIP
FT                   GQELDGGLIGWKQLLASNQSLSYAAGVGVNCFNSGNPSIPPPEEPMSPSSSISRFGWGS
FT                   LSGRSMTGTSPTTPTTPLMPTSSASGSALPWEKDTCTGTWNHKAGRDWWFHMERDRPGN
FT                   SELVDIKQLF"
FT   exon            618980..619365
FT                   /gene="Pc13g02670"
FT                   /locus_tag="PCH_Pc13g02670"
FT                   /number=1
FT   intron          619366..619446
FT                   /gene="Pc13g02670"
FT                   /locus_tag="PCH_Pc13g02670"
FT                   /number=1
FT   exon            619447..621352
FT                   /gene="Pc13g02670"
FT                   /locus_tag="PCH_Pc13g02670"
FT                   /number=2
FT   mRNA            <622004..>623950
FT                   /gene="Pc13g02680"
FT                   /locus_tag="PCH_Pc13g02680"
FT   CDS_pept        622004..623950
FT                   /gene="Pc13g02680"
FT                   /locus_tag="PCH_Pc13g02680"
FT                   /note="unknown EC_number=6.1.1.18"
FT                   /note="Title: strong similarity to glutamine--tRNA ligase
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02680"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91337"
FT                   /db_xref="GOA:B6H1D5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D5"
FT                   /inference="similar to AA sequence:PIR:SYBYQT"
FT                   /inference="protein motif:PFAM:PF00749"
FT                   /inference="protein motif:PFAM:PF03950"
FT                   /inference="protein motif:COGS:COG0008"
FT                   /protein_id="CAP91337.1"
FT                   /translation="MDPAKPVDLPERPKEATEPTVPPKKSKSQEKKEAAAAKKAAAKLA
FT                   AKQDQPKSKGEPKAPKAKEAPAPRDPQAMFKVGFLHDVYQEKPLSETVPKIRTRFPPEP
FT                   NGYLHIGHSKAIAINFGFAKYHGGECILRFDDTNPEGEEERYYNAIREIVTWLGFTPVR
FT                   ETNASDNFDRLYELAEDLIQRDGAYVCHCTKAEIKAQRGEVEGGQRGGERFACSHRTRP
FT                   IEESMAEFRAMRDGKYKAGEAALRMKQDITDPNPQMWDLFAWRIMGSEDKQHHLTGGKW
FT                   KIYPTYDFAHCLCDSIEEISHSLCTTEFELSRVSYEWLCDKLEVYRPNQREYGRLNITG
FT                   TVLSKRKIIQLVKEGHVRDWDDPRLYTLIALRRRGVPPGAILSFVNDLGVTKNTTNVQV
FT                   TKFEQIVRQYLETTVPRLMVVLEPLKVIIDDLPEDHLELIDCPFSKDPAFGTHDIPFTK
FT                   TVYIERSDFRAVDSPDYFRLAPGKTVGLLKVPYPITATSFETDPATGEVTCVHAKYEKP
FT                   AEGEAPVKPKSFIHWIGESPAHNSPIRAEVRAFNSLFKSEDPSAHPAGFLADINPDSEE
FT                   IFKDAMVETGFRDISRSAPWPKEEGAGEPGENKHSIRFQGMRVAYFAVDRESTDEKLVL
FT                   NRIVTLKDTQGKN"
FT   exon            622004..623950
FT                   /gene="Pc13g02680"
FT                   /locus_tag="PCH_Pc13g02680"
FT                   /number=1
FT   mRNA            complement(join(<624530..625188,625250..625665,
FT                   625794..>626107))
FT                   /gene="Pc13g02690"
FT                   /locus_tag="PCH_Pc13g02690"
FT   CDS_pept        complement(join(624530..625188,625250..625665,
FT                   625794..626107))
FT                   /gene="Pc13g02690"
FT                   /locus_tag="PCH_Pc13g02690"
FT                   /note="deleted EC_number 3.4.99.46"
FT                   /note="Title: strong similarity to proteasome 19S
FT                   regulatory particle subunit Rpt5 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02690"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91338"
FT                   /db_xref="GOA:B6H1D6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D6"
FT                   /inference="similar to AA sequence:PIR:S46605"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /inference="protein motif:COGS:COG0464"
FT                   /inference="protein motif:COGS:COG1222"
FT                   /protein_id="CAP91338.1"
FT                   /translation="MSTLEDLDDLEQEQRDKKQDQNDGDGKKPEGDGDADMKDADKNDE
FT                   EEEMLDEDILNSSTADIVTRRRMLENEMRIMKSEFQRLTHEQSTMREKVKDNQEKIENN
FT                   RQLPYLVGNVVELLDLDVEAEAAEEGANIDLDATRVGKSAVIKTSTRQTIFLPLIGLVD
FT                   HETLKPGDLIGVNKDSYLILDTLPAEYDNRVKAMEVDEKPTEKYTDIGGLDKQIEEIVE
FT                   AIVWPMKEAERFKKIGIKAPKGALMYGPPGTGKTLLARACAAETNATFLKLAGPQLVQM
FT                   FIGDGAKLVRDCFALAKEKAPSIIFIDELDAVGTKRFDSEKSGDREVQRTMLELLNQLD
FT                   GFASDDRIKVLAATNRVDVLDPALLRSGRLDRKIEFPLPNEEARANILQIHSRKMSVED
FT                   SVNWAELARSTDEFGGAQLKAVCVEAGMIALRKGQSKIGHENYVDAIAEVQAKKKDTNM
FT                   GIYV"
FT   exon            complement(624530..625188)
FT                   /gene="Pc13g02690"
FT                   /locus_tag="PCH_Pc13g02690"
FT                   /number=1
FT   intron          complement(625189..625249)
FT                   /gene="Pc13g02690"
FT                   /locus_tag="PCH_Pc13g02690"
FT                   /number=1
FT   exon            complement(625250..625665)
FT                   /gene="Pc13g02690"
FT                   /locus_tag="PCH_Pc13g02690"
FT                   /number=2
FT   intron          complement(625666..625793)
FT                   /gene="Pc13g02690"
FT                   /locus_tag="PCH_Pc13g02690"
FT                   /number=2
FT   exon            complement(625794..626107)
FT                   /gene="Pc13g02690"
FT                   /locus_tag="PCH_Pc13g02690"
FT                   /number=3
FT   mRNA            complement(join(<626394..626509,626690..627172,
FT                   627229..627328,627381..627480,627538..627646,
FT                   627702..627762,627818..627884,627949..627966,
FT                   628026..>628120))
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT   CDS_pept        complement(join(626394..626509,626690..627172,
FT                   627229..627328,627381..627480,627538..627646,
FT                   627702..627762,627818..627884,627949..627966,
FT                   628026..628120))
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /note="unknown EC_number=1.14.11.1"
FT                   /note="Title: similarity to gamma-butyrobetaine hydroxylase
FT                   - Pseudomonas sp."
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02700"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91339"
FT                   /db_xref="GOA:B6H1D7"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR012776"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D7"
FT                   /inference="similar to AA sequence:PIR:S32457"
FT                   /inference="protein motif:PFAM:PF03322"
FT                   /inference="protein motif:COGS:COG2175"
FT                   /protein_id="CAP91339.1"
FT                   /translation="MAWNGRQSGRTMPDIVTFPGKAKDGREVVLNFGRFFLRENCQCPK
FT                   CIHPDTMQRISDTFSIPQNVKIESIEHNDNMVEIKWSDNHLGLYSYDWLYAHAQSDVYI
FT                   SKTNPVSYPTRIRRFSPVMDPDQSPRVKYDDVMSDDESLHIWLSHIWDQGFCFVDDVPI
FT                   NPEATQYLIERIAFIRNTHYGGFWDFTADLTFKDTAYTNEFLGAHTDNTYFTDPARLQL
FT                   FHLLSHTEGSGGENLLIDGFAAAQQLRDESHKDYVQLVKHRQPWHASGNEDICIQPSAM
FT                   APVFSIHPDMDKLYQIRWNNYDRAPKTDWSASEQTSWYRAARHYNEILQTREMWTKLKP
FT                   GSALINNDDYISRLRLLKFGRKEMLDNLGNVKLNSRNPYYFI"
FT   exon            complement(626394..626509)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=1
FT   intron          complement(626510..626689)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=1
FT   exon            complement(626690..627172)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=2
FT   intron          complement(627173..627228)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=2
FT   exon            complement(627229..627328)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=3
FT   intron          complement(627329..627380)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=3
FT   exon            complement(627381..627480)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=4
FT   intron          complement(627481..627537)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=4
FT   exon            complement(627538..627646)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=5
FT   intron          complement(627647..627701)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=5
FT   exon            complement(627702..627762)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=6
FT   intron          complement(627763..627817)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=6
FT   exon            complement(627818..627884)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=7
FT   intron          complement(627885..627948)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=7
FT   exon            complement(627949..627966)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=8
FT   intron          complement(627967..628025)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=8
FT   exon            complement(628026..628120)
FT                   /gene="Pc13g02700"
FT                   /locus_tag="PCH_Pc13g02700"
FT                   /number=9
FT   mRNA            complement(join(<628667..629009,629079..629172,
FT                   629228..629654,629709..>629828))
FT                   /gene="Pc13g02710"
FT                   /locus_tag="PCH_Pc13g02710"
FT   CDS_pept        complement(join(628667..629009,629079..629172,
FT                   629228..629654,629709..629828))
FT                   /gene="Pc13g02710"
FT                   /locus_tag="PCH_Pc13g02710"
FT                   /note="unknown EC_number=5.1.2.-"
FT                   /note="Title: strong similarity to multifunctional
FT                   beta-oxidation protein - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02710"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91340"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D8"
FT                   /inference="similar to AA sequence:PIR:S54786"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /inference="protein motif:COGS:COG2030"
FT                   /protein_id="CAP91340.1"
FT                   /translation="MSAPGAGHEFPAQEVSWQKRDVLLFANSIGVKADELHFLYELHPN
FT                   FAVFPTYSLILRMSKNTSDFRTIALTPKPLAFKLTDQEVTDFYARQKAVHIPGVPDLDH
FT                   RHGVDGQRKITILKPLPTTSAGRKFELRNKVIGVYDKGKPGTVIETEQSIVDKESGEVY
FT                   SKVVSSGFLVGQGGWGGPKGPSTVNYAPPEGRAPDATHVVQSNSETAHLYRLNGDYNPL
FT                   HATPEPGQKMGFGGIIIHGLFSWNSAAHGILREFGGSNPANMKEFQARFASPVRPGDKL
FT                   TTEIWRMGNIQDGYEEIRFVTKNDKGRVVLSNGRCLLKVTGVKSKL"
FT   exon            complement(628667..629009)
FT                   /gene="Pc13g02710"
FT                   /locus_tag="PCH_Pc13g02710"
FT                   /number=1
FT   intron          complement(629010..629078)
FT                   /gene="Pc13g02710"
FT                   /locus_tag="PCH_Pc13g02710"
FT                   /number=1
FT   exon            complement(629079..629172)
FT                   /gene="Pc13g02710"
FT                   /locus_tag="PCH_Pc13g02710"
FT                   /number=2
FT   intron          complement(629173..629227)
FT                   /gene="Pc13g02710"
FT                   /locus_tag="PCH_Pc13g02710"
FT                   /number=2
FT   exon            complement(629228..629654)
FT                   /gene="Pc13g02710"
FT                   /locus_tag="PCH_Pc13g02710"
FT                   /number=3
FT   intron          complement(629655..629708)
FT                   /gene="Pc13g02710"
FT                   /locus_tag="PCH_Pc13g02710"
FT                   /number=3
FT   exon            complement(629709..629828)
FT                   /gene="Pc13g02710"
FT                   /locus_tag="PCH_Pc13g02710"
FT                   /number=4
FT   mRNA            complement(join(<630476..630951,631007..631338,
FT                   631398..631507,631573..631592,631670..631683,
FT                   631740..>631831))
FT                   /gene="Pc13g02720"
FT                   /locus_tag="PCH_Pc13g02720"
FT   CDS_pept        complement(join(630476..630951,631007..631338,
FT                   631398..631507,631573..631592,631670..631683,
FT                   631740..631831))
FT                   /gene="Pc13g02720"
FT                   /locus_tag="PCH_Pc13g02720"
FT                   /note="unknown EC_number=2.1.1.126"
FT                   /note="Title: strong similarity to protein Odp1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02720"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91341"
FT                   /db_xref="GOA:B6H1D9"
FT                   /db_xref="InterPro:IPR025799"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D9"
FT                   /inference="similar to AA sequence:PIR:S45890"
FT                   /inference="protein motif:COGS:COG0500"
FT                   /inference="protein motif:COGS:COG2230"
FT                   /inference="protein motif:COGS:COG2226"
FT                   /protein_id="CAP91341.1"
FT                   /translation="MDTESDSPQGITSSADRMVGMEHSEVRYFTSYDHHGIHEEMLKDD
FT                   VRTRSYRDSIYQNRHIFKDKVVLDVGCGTGILSMFAARAGAKHVIGVDMSSIIEKARQI
FT                   VEVNGLSDKITLLQGKMEEVNLPFPKVDIIISEWMGYFLLYESMLDTVLYARDTYLNPG
FT                   GLIFPDKATMYVAGIEDGDYKDDKIGFWDNVYGFDYSPMKEIALNEPLVDTVEMKALVT
FT                   DPCAIITFDLNTVTTADLAFKVPYALTAKRPDFIHALIAWFDIEFSACHKPIHFSTGPH
FT                   AKYTHWKQTVFYLRDVLTVEEDERVTGWVENRPNDKNKRDLDISISYKFETPDATRAAE
FT                   GGCFYRM"
FT   exon            complement(630476..630951)
FT                   /gene="Pc13g02720"
FT                   /locus_tag="PCH_Pc13g02720"
FT                   /number=1
FT   intron          complement(630952..631006)
FT                   /gene="Pc13g02720"
FT                   /locus_tag="PCH_Pc13g02720"
FT                   /number=1
FT   exon            complement(631007..631338)
FT                   /gene="Pc13g02720"
FT                   /locus_tag="PCH_Pc13g02720"
FT                   /number=2
FT   intron          complement(631339..631397)
FT                   /gene="Pc13g02720"
FT                   /locus_tag="PCH_Pc13g02720"
FT                   /number=2
FT   exon            complement(631398..631507)
FT                   /gene="Pc13g02720"
FT                   /locus_tag="PCH_Pc13g02720"
FT                   /number=3
FT   intron          complement(631508..631572)
FT                   /gene="Pc13g02720"
FT                   /locus_tag="PCH_Pc13g02720"
FT                   /number=3
FT   exon            complement(631573..631592)
FT                   /gene="Pc13g02720"
FT                   /locus_tag="PCH_Pc13g02720"
FT                   /number=4
FT   intron          complement(631593..631669)
FT                   /gene="Pc13g02720"
FT                   /locus_tag="PCH_Pc13g02720"
FT                   /number=4
FT   exon            complement(631670..631683)
FT                   /gene="Pc13g02720"
FT                   /locus_tag="PCH_Pc13g02720"
FT                   /number=5
FT   intron          complement(631684..631739)
FT                   /gene="Pc13g02720"
FT                   /locus_tag="PCH_Pc13g02720"
FT                   /number=5
FT   exon            complement(631740..631831)
FT                   /gene="Pc13g02720"
FT                   /locus_tag="PCH_Pc13g02720"
FT                   /number=6
FT   mRNA            join(<632518..632643,632693..633567,633629..>633683)
FT                   /gene="Pc13g02730"
FT                   /locus_tag="PCH_Pc13g02730"
FT   CDS_pept        join(632518..632643,632693..633567,633629..633683)
FT                   /gene="Pc13g02730"
FT                   /locus_tag="PCH_Pc13g02730"
FT                   /note="Title: strong similarity to hypothetical membrane
FT                   protein YCR044c - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02730"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91342"
FT                   /db_xref="GOA:B6H1E0"
FT                   /db_xref="InterPro:IPR007217"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E0"
FT                   /inference="similar to AA sequence:PIR:S19457"
FT                   /inference="protein motif:PFAM:PF04080"
FT                   /inference="protein motif:COGS:COG5237"
FT                   /protein_id="CAP91342.1"
FT                   /translation="MNLGVGRANLYTLFAFVFLASLIGKSNASLGDHLPDFKECVQVCK
FT                   TENCQNGNSVLRMSNHHPNSSPRLALLTSLALHHRLLLWTCPAECDYTCQHVITDRRVS
FT                   RDPPMISPIVQFHGKWPFRRLLGMQEPFSVLFSFFNFAAHWHGMSRIQESIPAWHSLRP
FT                   YYMMFGYIGLASWSFSMIFHMRDFPLTEKLDYWAAGANVLYGLYLAVVRIFRLDLENTP
FT                   YRPTLRRFWTAICILLYTLHVGYLTFWSWDYTYNMIANVVVGIIQNLMWTGFSIFRYRR
FT                   LEKSWAAWPGMIVAWIIMAMSLELLDFPPWNGLIDAHSLWHLGTVVPAVWWYSFLIKDA
FT                   QDDIAAHRLKA"
FT   sig_peptide     632518..632601
FT                   /gene="Pc13g02730"
FT                   /locus_tag="PCH_Pc13g02730"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            632518..632643
FT                   /gene="Pc13g02730"
FT                   /locus_tag="PCH_Pc13g02730"
FT                   /number=1
FT   mat_peptide     join(632602..632643,632693..633567,633629..633680)
FT                   /gene="Pc13g02730"
FT                   /locus_tag="PCH_Pc13g02730"
FT   intron          632644..632692
FT                   /gene="Pc13g02730"
FT                   /locus_tag="PCH_Pc13g02730"
FT                   /number=1
FT   exon            632693..633567
FT                   /gene="Pc13g02730"
FT                   /locus_tag="PCH_Pc13g02730"
FT                   /number=2
FT   intron          633568..633628
FT                   /gene="Pc13g02730"
FT                   /locus_tag="PCH_Pc13g02730"
FT                   /number=2
FT   exon            633629..633683
FT                   /gene="Pc13g02730"
FT                   /locus_tag="PCH_Pc13g02730"
FT                   /number=3
FT   mRNA            join(<634098..634190,634259..634272,634379..634523,
FT                   634597..634611,634672..635163,635219..>636079)
FT                   /gene="Pc13g02740"
FT                   /locus_tag="PCH_Pc13g02740"
FT   CDS_pept        join(634098..634190,634259..634272,634379..634523,
FT                   634597..634611,634672..635163,635219..636079)
FT                   /gene="Pc13g02740"
FT                   /locus_tag="PCH_Pc13g02740"
FT                   /note="unknown EC_number=5.4.2.3"
FT                   /note="Title: strong similarity to phosphoacetylglucosamine
FT                   mutase AGM1 - Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91343"
FT                   /db_xref="GOA:B6H1E1"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR016657"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E1"
FT                   /inference="similar to AA sequence:TREMBL:AB032082.1"
FT                   /inference="protein motif:PFAM:PF00408"
FT                   /inference="protein motif:COGS:COG1109"
FT                   /protein_id="CAP91343.1"
FT                   /translation="MASPAVKKAITEAALQYAKPEGKVFEYGTAGFRMKADLLNTVVFA
FT                   VGLLASLRSKKLSGQWIGVMVTASHNPAEDNGVKLVDPMGEMLEAEWEAYATRLANAPL
FT                   DKIADVYDELIKEIDVKMTNPARVVFARDTRASGSRLVGVLNAALTATEVEFVDLKYMT
FT                   TPQLHYVVRCKNTLGTQYEYGEPTEQGYYEKLANSFKKVMRGVKVQGSLTVDCANGVGG
FT                   PKLRELMKYLTGIDIKVVNDDVINPDALNFDCGADYVKTKQRAPPSSKAAVLDRCASLD
FT                   GDADRLVYYFLDESNVFRLLDGDRIATLAASFIGDLARNAGIASKLKIGVVQTAYANGA
FT                   STDYIEKVLKLPIICTNTGVKHLHHAALRFDVGVYFEANGHGTVTFSENALKVIKNTEP
FT                   QSPAQQHALESLQALTDLINQAVGDALSDALLVEAILAHKGWSPKEWLGTYTDLPSRLV
FT                   RVEVNDRSIFKAYDAERKLESPPGLQGTIESLQSRYNKGRSFARASGTEDAVRVYAEAA
FT                   SRSEADDLATRVANAVSEAGSA"
FT   exon            634098..634190
FT                   /gene="Pc13g02740"
FT                   /locus_tag="PCH_Pc13g02740"
FT                   /number=1
FT   intron          634191..634258
FT                   /gene="Pc13g02740"
FT                   /locus_tag="PCH_Pc13g02740"
FT                   /number=1
FT   exon            634259..634272
FT                   /gene="Pc13g02740"
FT                   /locus_tag="PCH_Pc13g02740"
FT                   /number=2
FT   intron          634273..634378
FT                   /gene="Pc13g02740"
FT                   /locus_tag="PCH_Pc13g02740"
FT                   /number=2
FT   exon            634379..634523
FT                   /gene="Pc13g02740"
FT                   /locus_tag="PCH_Pc13g02740"
FT                   /number=3
FT   intron          634524..634596
FT                   /gene="Pc13g02740"
FT                   /locus_tag="PCH_Pc13g02740"
FT                   /number=3
FT   exon            634597..634611
FT                   /gene="Pc13g02740"
FT                   /locus_tag="PCH_Pc13g02740"
FT                   /number=4
FT   intron          634612..634671
FT                   /gene="Pc13g02740"
FT                   /locus_tag="PCH_Pc13g02740"
FT                   /number=4
FT   exon            634672..635163
FT                   /gene="Pc13g02740"
FT                   /locus_tag="PCH_Pc13g02740"
FT                   /number=5
FT   intron          635164..635218
FT                   /gene="Pc13g02740"
FT                   /locus_tag="PCH_Pc13g02740"
FT                   /number=5
FT   exon            635219..636079
FT                   /gene="Pc13g02740"
FT                   /locus_tag="PCH_Pc13g02740"
FT                   /number=6
FT   mRNA            complement(join(<636362..637449,637506..>637899))
FT                   /gene="Pc13g02750"
FT                   /locus_tag="PCH_Pc13g02750"
FT   CDS_pept        complement(join(636362..637449,637506..637899))
FT                   /gene="Pc13g02750"
FT                   /locus_tag="PCH_Pc13g02750"
FT                   /note="Title: strong similarity to RNA helicase-like
FT                   protein Rrp3 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02750"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91344"
FT                   /db_xref="GOA:B6H1E2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E2"
FT                   /inference="similar to AA sequence:PIR:S46713"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /inference="protein motif:COGS:COG0513"
FT                   /protein_id="CAP91344.1"
FT                   /translation="MPITKKRKVAHAEPAAPVEDSDASSNASSSSPQPTAENPDIGDSE
FT                   PQATADDPNVKDATSETEPSATTAPKTFKELGLIDSLCEACDKMGYKAPTPIQSESIPL
FT                   ALQGRDIIGLAETGSGKTASFVLPILQALMEKPQSFFGLVLAPTRELAYQISLACESLG
FT                   ATINVRSTTLVGGMDMVPQSIALGKKPHIIVATPGRLLDHLENTKGFSLRSLKFLVMDE
FT                   ADRLLDMDFGPILDKILKVLPRERRTFLFSATLSSKVESLQRASLSNPARVSISSSKYA
FT                   TVETLQQTYLLRPYKHKDIYLVYLLHEFIGQSVIIFMRTVHETQRVAFLLRGLGFGAIP
FT                   LHGQMSQSARLGALGKFRSKSREILVATDVAARGLDIPSVDCVLNFDLPTDSKTYIHRV
FT                   GRTARAGKSGTAISFVTQYDVEIWQRIEAAMGKELAEYPAPKDEAMVFAEQVSASQRDA
FT                   IQAMKHYDEKKGAKGKGKFSFKGKRSRDAMDQEEG"
FT   exon            complement(636362..637449)
FT                   /gene="Pc13g02750"
FT                   /locus_tag="PCH_Pc13g02750"
FT                   /number=1
FT   intron          complement(637450..637505)
FT                   /gene="Pc13g02750"
FT                   /locus_tag="PCH_Pc13g02750"
FT                   /number=1
FT   exon            complement(637506..637899)
FT                   /gene="Pc13g02750"
FT                   /locus_tag="PCH_Pc13g02750"
FT                   /number=2
FT   mRNA            join(<638108..638308,638359..>639501)
FT                   /gene="Pc13g02760"
FT                   /locus_tag="PCH_Pc13g02760"
FT   CDS_pept        join(638108..638308,638359..639501)
FT                   /gene="Pc13g02760"
FT                   /locus_tag="PCH_Pc13g02760"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   Ssf1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02760"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91345"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E3"
FT                   /inference="similar to AA sequence:PIR:S46700"
FT                   /inference="protein motif:PFAM:PF04427"
FT                   /protein_id="CAP91345.1"
FT                   /translation="MAKQRVKKRTHQKPQNASAVKGSTASMSKTPKSMVIRVGASQVGS
FT                   SVTQLVKDVRRMMEPDTAVRLKERKSNRLRDYTVMTGPLGVTHLMLFSKSATGNTNMRL
FT                   AVTPRGPTLHFKVENYSLCKDVERSMKRPKSGGQDHKTPPLLVMNNFTTPDATEESKVP
FT                   KRLETLTTTIFQSLFPPINPQNQPLSSIRRVMLLNREPAEKDSDSYILTLRHYAIATKK
FT                   TGVSKRIRRLDPKEIRNRDKKKTAVPNLGKLEDAADYLLDPSAAGYTSASETELDTDAE
FT                   VEVQESATRRVLNKREMQRQKAAEKGQDKPAHTTGVEKRAVKLVELGPRLRLRLMKVED
FT                   GVCDGKVMWHDFITKSEKEMRKMDQSWDVRRKEKEQRKKLQKENIERKKQEKAKARGSG
FT                   KEVAEEDEDEDMDDEDWLSDDDFEKDAEGEGEPADDDSEADSDESMEE"
FT   exon            638108..638308
FT                   /gene="Pc13g02760"
FT                   /locus_tag="PCH_Pc13g02760"
FT                   /number=1
FT   intron          638309..638358
FT                   /gene="Pc13g02760"
FT                   /locus_tag="PCH_Pc13g02760"
FT                   /number=1
FT   exon            638359..639501
FT                   /gene="Pc13g02760"
FT                   /locus_tag="PCH_Pc13g02760"
FT                   /number=2
FT   mRNA            complement(join(<640039..640586,640641..640763,
FT                   640816..>640846))
FT                   /gene="Pc13g02770"
FT                   /locus_tag="PCH_Pc13g02770"
FT   CDS_pept        complement(join(640039..640586,640641..640763,
FT                   640816..640846))
FT                   /gene="Pc13g02770"
FT                   /locus_tag="PCH_Pc13g02770"
FT                   /note="Title: strong similarity to riboflavin synthase Rib5
FT                   - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02770"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91346"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E4"
FT                   /inference="similar to AA sequence:PIR:S34072"
FT                   /inference="protein motif:PFAM:PF00677"
FT                   /inference="protein motif:COGS:COG0307"
FT                   /protein_id="CAP91346.1"
FT                   /translation="MFTGLVETIGTVTALEPIDTSSSGGGGTSLTISDCEEILTDAHLG
FT                   DSIAVNGTCLTVTAFDKTWFKVGCAPETLRRTNLGSLQANSNVNLERAVSADTRMGGHF
FT                   VQGHVDTVAEILSVTPDGNSLVFRLQPRDRDILRYVVEKGYVTLDGASLTVTKVVDGQD
FT                   GYWEVMLIAYTQGKVVTAAKKPGDLVNVEIDIVGKYVEKSVQGYFAGTSGGDFAILEKM
FT                   VNRIVDERLKK"
FT   exon            complement(640039..640586)
FT                   /gene="Pc13g02770"
FT                   /locus_tag="PCH_Pc13g02770"
FT                   /number=1
FT   intron          complement(640587..640640)
FT                   /gene="Pc13g02770"
FT                   /locus_tag="PCH_Pc13g02770"
FT                   /number=1
FT   exon            complement(640641..640763)
FT                   /gene="Pc13g02770"
FT                   /locus_tag="PCH_Pc13g02770"
FT                   /number=2
FT   intron          complement(640764..640815)
FT                   /gene="Pc13g02770"
FT                   /locus_tag="PCH_Pc13g02770"
FT                   /number=2
FT   exon            complement(640816..640846)
FT                   /gene="Pc13g02770"
FT                   /locus_tag="PCH_Pc13g02770"
FT                   /number=3
FT   mRNA            join(<641042..641215,641274..641305,641380..641503,
FT                   641563..642067,642127..642420,642479..>642690)
FT                   /gene="Pc13g02780"
FT                   /locus_tag="PCH_Pc13g02780"
FT   CDS_pept        join(641042..641215,641274..641305,641380..641503,
FT                   641563..642067,642127..642420,642479..642690)
FT                   /gene="Pc13g02780"
FT                   /locus_tag="PCH_Pc13g02780"
FT                   /note="Title: strong similarity to subunit of
FT                   succinyl-CoA:benzylsuccinate CoA-transferase like protein
FT                   An18g05120 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02780"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91347"
FT                   /db_xref="GOA:B6H1E5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E5"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /inference="protein motif:COGS:COG1804"
FT                   /protein_id="CAP91347.1"
FT                   /translation="MTVALRFQVAARRSGLSWGSNALRRTIPGRSYSSAVAADGSLPLA
FT                   GIRVLDMTRVLAGPYCTQXLGDLGADVIKVEHPVRGDDTRAWGPPYAKYEDASRKGPGE
FT                   SAYYLAVNRNKKSLGLSFQHKSGVEILHKLAKECDVLVENYLPGGLKKYGMDYETLREI
FT                   NPKLIYASITGYGQTGPYSNRAGYDVMVEAEMGLMHITGARDGAPVKVGVAVTDLTTGL
FT                   YTSNAIMAALIARGRTGRGQHIDACLSDCQVATLSNLASSALISGQKDSGRWGTAHPSI
FT                   VPYRSYKTSDGDILFGGGNDKLFGVLCDRLGFSEWKTDARFVTNSDRVQHRAEIDGMIE
FT                   STTMQKTTQEWLDIFEGSGMPYAAVNDIQGTLNHKHVLARDMVTEVEHPACGPIKLVNT
FT                   PIKYSEATPGVRTPPPTLGQHTDEILGSVLDYGEADIARLKDEGVVS"
FT   exon            641042..641215
FT                   /gene="Pc13g02780"
FT                   /locus_tag="PCH_Pc13g02780"
FT                   /number=1
FT   intron          641216..641273
FT                   /gene="Pc13g02780"
FT                   /locus_tag="PCH_Pc13g02780"
FT                   /number=1
FT   exon            641274..641305
FT                   /gene="Pc13g02780"
FT                   /locus_tag="PCH_Pc13g02780"
FT                   /number=2
FT   intron          641306..641379
FT                   /gene="Pc13g02780"
FT                   /locus_tag="PCH_Pc13g02780"
FT                   /number=2
FT   exon            641380..641503
FT                   /gene="Pc13g02780"
FT                   /locus_tag="PCH_Pc13g02780"
FT                   /number=3
FT   intron          641504..641562
FT                   /gene="Pc13g02780"
FT                   /locus_tag="PCH_Pc13g02780"
FT                   /number=3
FT   exon            641563..642067
FT                   /gene="Pc13g02780"
FT                   /locus_tag="PCH_Pc13g02780"
FT                   /number=4
FT   intron          642068..642126
FT                   /gene="Pc13g02780"
FT                   /locus_tag="PCH_Pc13g02780"
FT                   /number=4
FT   exon            642127..642420
FT                   /gene="Pc13g02780"
FT                   /locus_tag="PCH_Pc13g02780"
FT                   /number=5
FT   intron          642421..642478
FT                   /gene="Pc13g02780"
FT                   /locus_tag="PCH_Pc13g02780"
FT                   /number=5
FT   exon            642479..642690
FT                   /gene="Pc13g02780"
FT                   /locus_tag="PCH_Pc13g02780"
FT                   /number=6
FT   misc_RNA        642947..642967
FT                   /gene="small non coding RNA"
FT                   /locus_tag="PCH_Pc13e00010"
FT                   /product="small non coding RNA"
FT                   /inference="profile:QRNA:2.01"
FT   mRNA            <643313..>644860
FT                   /gene="Pc13g02790"
FT                   /locus_tag="PCH_Pc13g02790"
FT   CDS_pept        643313..644860
FT                   /gene="Pc13g02790"
FT                   /locus_tag="PCH_Pc13g02790"
FT                   /note="Title: similarity to polycomblike protein XPcl2
FT                   -Xenopus laevis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02790"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91348"
FT                   /db_xref="GOA:B6H1E9"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E9"
FT                   /inference="similar to AA sequence:TREMBL:AB050540.1"
FT                   /inference="protein motif:PFAM:PF00628"
FT                   /inference="protein motif:COGS:COG5141"
FT                   /protein_id="CAP91348.1"
FT                   /translation="MRVSSAFMDLPATDINPGCPQNVHEGNIFDHEGVSEAIQPLPYHS
FT                   ELIAENIPWATWGSPAPLQEEAVWTTAGAMETGQQNASAALASNRTRSGRRITQPVARE
FT                   AYPVTTKEPTVTTKGPTVKAAAKKRKRLNRQVNIVCTGCYRGHSPSNNLIVLCDSCDAP
FT                   WHQRCHNPNIDNEVIEIPETNWFCIKCKPEQRQAGWRKSGKNAMKVKKVGRPKKPGVFG
FT                   SQIGGNHYTEEERRAYLSSLSHDSLVQLVVKVSNEWPSVPLFPPDMQPVTDFTLSPAIP
FT                   HNHQASKPTPKNNARSAILDWENLESMSQNANAMDSKQRISETSDATTPAATALDADKT
FT                   FAAMVSDSVPEPAPPAALGGIPAGQIFAGSSHTHAYATAPQTSTTTTPQTPSRATRRFT
FT                   SQAAPAARHARTASFVSSYSDLLTDDESSYSQSRQQSPTPSASQSSHAESQHESDYDPG
FT                   DYRAYPEAGQGFQVPLTPSDLDIMAEDKDCLTFSHSIRGPEAQNKKPYSPFGQRKQW"
FT   exon            643313..644860
FT                   /gene="Pc13g02790"
FT                   /locus_tag="PCH_Pc13g02790"
FT                   /number=1
FT   mRNA            complement(join(<645084..645119,645205..645305,
FT                   645389..645415,645487..645639,645724..645755,
FT                   645975..646002,646151..>646202))
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT   CDS_pept        complement(join(645084..645119,645205..645305,
FT                   645389..645415,645487..645639,645724..645755,
FT                   645975..646002,646151..646202))
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02800"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91349"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F0"
FT                   /protein_id="CAP91349.1"
FT                   /translation="MAFLYFLGTGQAFGQRASVAHRTRATGIPKGFPRAPLGRSKEPSE
FT                   PQGRNRHWTTEAICWRYDSLELKWPVTCRGTGEEGRGGGGRGEVAEGQEGTWVKNXHGD
FT                   YPEYRIGDLVYPFRRLILTSSRQAKGKRRKYEESTQSL"
FT   exon            complement(645084..645119)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /number=1
FT   mat_peptide     complement(join(645087..645119,645205..645305,
FT                   645389..645415,645487..645639,645724..645755,
FT                   645975..646002,646151..646160))
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT   intron          complement(645120..645204)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /number=1
FT   exon            complement(645205..645305)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /number=2
FT   intron          complement(645306..645388)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /number=2
FT   exon            complement(645389..645415)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /number=3
FT   intron          complement(645416..645486)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /number=3
FT   exon            complement(645487..645639)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /number=4
FT   intron          complement(645640..645723)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /number=4
FT   exon            complement(645724..645755)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /number=5
FT   intron          complement(645756..645974)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /number=5
FT   exon            complement(645975..646002)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /number=6
FT   intron          complement(646003..646150)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /number=6
FT   exon            complement(646151..646202)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /number=7
FT   sig_peptide     complement(646161..646202)
FT                   /gene="Pc13g02800"
FT                   /locus_tag="PCH_Pc13g02800"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<646315..647005,647050..647468,
FT                   647618..648386,648448..>648881))
FT                   /gene="Pc13g02810"
FT                   /locus_tag="PCH_Pc13g02810"
FT   CDS_pept        complement(join(646315..647005,647050..647468,
FT                   647618..648386,648448..648881))
FT                   /gene="Pc13g02810"
FT                   /locus_tag="PCH_Pc13g02810"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   ncu09412.1 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02810"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91350"
FT                   /db_xref="GOA:B6H1G2"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G2"
FT                   /protein_id="CAP91350.1"
FT                   /translation="MATSTVDEGGPVGIKKELREALDAIVSSGTFASQGRLPHVDPQIK
FT                   VQDVGAISLPLQESQLRQMMKQAHQAPYGKGSETLVDTAVRNTLELNPGQFELSNPNWD
FT                   NYIKRACTCVARDLGVDSPVSAELYKMLIYEKGAMFKPHTDTEKAPGMFATLVIGLPSP
FT                   FEGGEVAVKHQGKKMVLTTLQHGFSYVSWYSDVVHEILAVRSGYRWVLTYNLCIDPSRP
FT                   CPTACLHTDEARHLHRILKTWLNQNTAERELSHAYYRLDHEYTKANISLNALKGRDLAS
FT                   VHLLKEISNDLNMEIFLAVIAKGQMGPCRYEEPYSRKSYRSSRSYFNIYLENHNAGYRG
FT                   RSGAIHALEQIINTSYEVDTLVGLDGCEVMESMPLKNDNVLQMKCFDVDPQEDYMGYQG
FT                   NFAVVIVPRDSIAHFLKVPTERSGPYTESTCQGNKALMIGYLAKSLAHTPDDQFLIKTL
FT                   KDLCQEVWTMSETGPPGSSRPPRVVLPEAVITKVLQAAIISKDPDFVKDAVGRLERNLS
FT                   PDFFTWVQEQTAVGLITFDTIKDILLSGSIVGILSRTICSHAPAMEASDFHSLWLPFLH
FT                   HLVRFCEANSIPTSTPDYQRIFAAILKAYINNYVGERPSHDGNYVRPTVGHGCADCISL
FT                   NRFLSDPAQTVGRFSVNQKRRHHLHLRLDAAKIDCTHETERIGSPQTLVVTKSFPRHER
FT                   DSAAWGKRKAEAGVKLLDFNKRDLTGWFGEEYEGLMGMVGHGPSSGRRPAGPVPNRPTR
FT                   PRKRKAADIDVVDLRDD"
FT   exon            complement(646315..647005)
FT                   /gene="Pc13g02810"
FT                   /locus_tag="PCH_Pc13g02810"
FT                   /number=1
FT   intron          complement(647006..647049)
FT                   /gene="Pc13g02810"
FT                   /locus_tag="PCH_Pc13g02810"
FT                   /number=1
FT   exon            complement(647050..647468)
FT                   /gene="Pc13g02810"
FT                   /locus_tag="PCH_Pc13g02810"
FT                   /number=2
FT   intron          complement(647469..647617)
FT                   /gene="Pc13g02810"
FT                   /locus_tag="PCH_Pc13g02810"
FT                   /number=2
FT   exon            complement(647618..648386)
FT                   /gene="Pc13g02810"
FT                   /locus_tag="PCH_Pc13g02810"
FT                   /number=3
FT   intron          complement(648387..648447)
FT                   /gene="Pc13g02810"
FT                   /locus_tag="PCH_Pc13g02810"
FT                   /number=3
FT   exon            complement(648448..648881)
FT                   /gene="Pc13g02810"
FT                   /locus_tag="PCH_Pc13g02810"
FT                   /number=4
FT   mRNA            join(<650582..651107,651273..>651856)
FT                   /gene="Pc13g02820"
FT                   /locus_tag="PCH_Pc13g02820"
FT   CDS_pept        join(650582..651107,651273..651856)
FT                   /gene="Pc13g02820"
FT                   /locus_tag="PCH_Pc13g02820"
FT                   /note="Title: strong similarity to retinal short-chain
FT                   dehydrogenase/reductase like protein An18g05090
FT                   -Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02820"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91351"
FT                   /db_xref="GOA:B6H1G3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /inference="protein motif:COGS:COG1028"
FT                   /protein_id="CAP91351.1"
FT                   /translation="MTSSTPQLLRTTAKPSHPAPGTTNSHTNFLTIDTLISILSKSLLN
FT                   PFVAWIFVLCLRAQVTPSTDPAWILAVSYATVLTVLSIARLINQRAADGVPRTVDFEHE
FT                   VVVITGGASGLGLLIAQMYSMRGASVAVLDIKAVPENSRDEIFGEGVLYITCDVADRGA
FT                   LEVAKERILQEVGTPTIVINCAAARINGLSLLDLPADAFEKTIRTNLLAAFHLYQVFLP
FT                   GIIAAESGGTLATVSSVLGQLSAAGLSDYAASKAGLSALHRTIEAEIRGNPLIKTLLVE
FT                   VGQMSTPLFDWVRAPNNFFAPVLEPVEVAREMVAAIDSGRGGVIRLPIYAKLVNWYAVL
FT                   PATVQRVARYLSGIDAAVNQSRETSGKTD"
FT   exon            650582..651107
FT                   /gene="Pc13g02820"
FT                   /locus_tag="PCH_Pc13g02820"
FT                   /number=1
FT   intron          651108..651272
FT                   /gene="Pc13g02820"
FT                   /locus_tag="PCH_Pc13g02820"
FT                   /number=1
FT   exon            651273..651856
FT                   /gene="Pc13g02820"
FT                   /locus_tag="PCH_Pc13g02820"
FT                   /number=2
FT   mRNA            complement(join(<652057..653397,653455..>653457))
FT                   /gene="Pc13g02830"
FT                   /locus_tag="PCH_Pc13g02830"
FT   CDS_pept        complement(join(652057..653397,653455..653457))
FT                   /gene="Pc13g02830"
FT                   /locus_tag="PCH_Pc13g02830"
FT                   /note="Title: strong similarity to protein Sof1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02830"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91352"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007287"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F1"
FT                   /inference="similar to AA sequence:PIR:S35323"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /inference="protein motif:PFAM:PF04158"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP91352.1"
FT                   /translation="MKIKALTRSTASQQAPGSAVVRQSRNLDPTQHPFERAREYTRALN
FT                   AIKMERMFAAPFLAQMGNGHVDGVYSMAKDPGSLERFASGSGDGVVKVWDLTTQGEVWN
FT                   TQGHENMVKGLCWTPERKLLSCASDRTIKLWDPYNSSSEAPPMATYLGNSAFTSVTHHR
FT                   TLPSFAAASGVISVYDISRPSSTPSQTLHWPTSVDTITSVAFNQTETSILASTAMDRSV
FT                   IMYDLRTSQPVHKTTLRLASNAISWNPMEAFNFAVANEDHNAYLFDMRKMDRALNVLKD
FT                   HVAAVMDVDFSPTGEELVTASYDRTIRLWNRSTGHSRDIYHTKRMQRVFSATFTPDNKY
FT                   VLSGSDDGNIRLWRANASDRSGVKTARQRSKLEYDQALIKRYSHMPEIRRIKRQRHVPK
FT                   PIKKAGEIKREELNAIKRREENVRKHTKKSNLAPRTHEREKMILASEQ"
FT   exon            complement(652057..653397)
FT                   /gene="Pc13g02830"
FT                   /locus_tag="PCH_Pc13g02830"
FT                   /number=1
FT   intron          complement(653398..653454)
FT                   /gene="Pc13g02830"
FT                   /locus_tag="PCH_Pc13g02830"
FT                   /number=1
FT   exon            complement(653455..653457)
FT                   /gene="Pc13g02830"
FT                   /locus_tag="PCH_Pc13g02830"
FT                   /number=2
FT   mRNA            join(<653681..653942,653997..>655003)
FT                   /gene="Pc13g02840"
FT                   /locus_tag="PCH_Pc13g02840"
FT   CDS_pept        join(653681..653942,653997..655003)
FT                   /gene="Pc13g02840"
FT                   /locus_tag="PCH_Pc13g02840"
FT                   /note="Title: strong similarity to 26S proteasome subunit 9
FT                   - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02840"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91353"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040773"
FT                   /db_xref="InterPro:IPR040780"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F2"
FT                   /inference="similar to AA sequence:TREMBL:HSAF1212.1"
FT                   /inference="protein motif:PFAM:PF01399"
FT                   /inference="protein motif:COGS:COG5159"
FT                   /inference="protein motif:COGS:COG5187"
FT                   /protein_id="CAP91353.1"
FT                   /translation="MSFKVSPRIQEVRGLAKEDPSKAATSYQKILSEGPGSTEASSRDY
FT                   EHALIGLGEVYRDAKKPQEIADLIKTSRDTFSSFAKAKTAKLVRQLLDLISEIPNTLEL
FT                   QGNVIQSCIEWAIAERRSFLRQALQARLVAIYMQKQSYYDALTLINSLLSELKRLDDKL
FT                   MLVEVQLLESRVYHALGNQAKARAALTAARTSAASVYTPPNLQAGLDMQSGMLHAEDKD
FT                   FTTSYSYFIEALEGYSSLDESDLATATLQYMLLCKIMLNLVDDVTQLQGSKQAQKYASP
FT                   RLEAMKAVARAHANRSLEEYEKALSTYRYELGSDVFIRNHLRRLYDAMLEQNLIKVIEP
FT                   FSRVELDHIAKMVGLDTQQVERKLSQMILDKVIIGVLDQGSGCLIVYDETERDQAYDAA
FT                   LETIEKLGNVVEGLYTNQASLLE"
FT   exon            653681..653942
FT                   /gene="Pc13g02840"
FT                   /locus_tag="PCH_Pc13g02840"
FT                   /number=1
FT   intron          653943..653996
FT                   /gene="Pc13g02840"
FT                   /locus_tag="PCH_Pc13g02840"
FT                   /number=1
FT   exon            653997..655003
FT                   /gene="Pc13g02840"
FT                   /locus_tag="PCH_Pc13g02840"
FT                   /number=2
FT   mRNA            join(<655342..655432,655494..656362,656415..>656939)
FT                   /gene="Pc13g02850"
FT                   /locus_tag="PCH_Pc13g02850"
FT   CDS_pept        join(655342..655432,655494..656362,656415..656939)
FT                   /gene="Pc13g02850"
FT                   /locus_tag="PCH_Pc13g02850"
FT                   /note="Title: strong similarity to
FT                   SWI/SNF-related,matrix-associated, actin-dependent
FT                   regulator of chromatin SMARCD1 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02850"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91354"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F3"
FT                   /inference="similar to AA sequence:TREMBL:AF109733.1"
FT                   /inference="protein motif:PFAM:PF02201"
FT                   /inference="protein motif:COGS:COG5531"
FT                   /protein_id="CAP91354.1"
FT                   /translation="MQAPMQQHYARAMPPNAQRSPAAPRRPPGPGGAMPVPMPQHAVAQ
FT                   QYMASRPMPHPNDAALRRSRKPTDKNLPDGIEEVIIGEGVQQYKNLRDLEKRLDAAVVR
FT                   KRLDIQDSINKTVKKYRTMRIWISNTVENQPWQGPGNNPGSGRYKVRIEGRLLDDETDP
FT                   TVPDKDEKDEDAMDHDGAQDDKAKKSESKSQSQRFSHFFKAINIDFDKPVSAIPDEVKP
FT                   VNWSKPNAHPNTPAPPNAEFDSLQFSRASQDNLNVTISLVRDEVPERYKLSKELAEVLD
FT                   VEEETRSGIVLGIWDYIRAMELQEDEEKRQVRCDHRLRSIFGREQMFFPQIPESVGPHT
FT                   SPMEPIKLPYTIRVDEDFHANPTPTIYDIQVAVEDPLRTKMMALTQNPAYTSGLRQISS
FT                   LDDQVALIVQALTHSRARHSFYTALSKDPANFVRRWISSQRRDLETIMGEATRGGGEDG
FT                   SGPEFRYGSVDGPWDSEVAKEAVRYMLAKPEAAAAR"
FT   exon            655342..655432
FT                   /gene="Pc13g02850"
FT                   /locus_tag="PCH_Pc13g02850"
FT                   /number=1
FT   intron          655433..655493
FT                   /gene="Pc13g02850"
FT                   /locus_tag="PCH_Pc13g02850"
FT                   /number=1
FT   exon            655494..656362
FT                   /gene="Pc13g02850"
FT                   /locus_tag="PCH_Pc13g02850"
FT                   /number=2
FT   intron          656363..656414
FT                   /gene="Pc13g02850"
FT                   /locus_tag="PCH_Pc13g02850"
FT                   /number=2
FT   exon            656415..656939
FT                   /gene="Pc13g02850"
FT                   /locus_tag="PCH_Pc13g02850"
FT                   /number=3
FT   mRNA            complement(join(<657372..658111,658207..>658690))
FT                   /gene="Pc13g02860"
FT                   /locus_tag="PCH_Pc13g02860"
FT   CDS_pept        complement(join(657372..658111,658207..658690))
FT                   /gene="Pc13g02860"
FT                   /locus_tag="PCH_Pc13g02860"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   encoded by B7F18.130 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02860"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91355"
FT                   /db_xref="GOA:B6H1F4"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F4"
FT                   /inference="similar to AA sequence:TREMBL:NCB7F18.11"
FT                   /inference="protein motif:PFAM:PF05967"
FT                   /protein_id="CAP91355.1"
FT                   /translation="MLDPFPPPPEWLRSLAEPYAIRLNSPTLADHIHEVIAAFAFYLFI
FT                   HAVLSPRLSPILFARSYNKLTPRTKLNWDIHVVSLVQSVVINAAALWVMYYDEERSSMT
FT                   SGERVFGYTGACGLIQALAVGYFVYDLIVSIVHVRMFGIGMLFHAVSALWVFSLGFVIS
FT                   QRPFLNYFAPTFILYELSSPFLNIHWFLDKVNMTGSRAQWYNGMALLFSFFSCRLVWGT
FT                   WQTVVVYGDMWNALQQTWSAAAAPLSEPASVNANVFYPARDGSLCVNEACARANAEITK
FT                   FKEYTAGGVPTWLVVTYVGSNLILNFLNFFWFSKMVETVLKRFRAPAAAAEKKPGRAEK
FT                   AAQLKEDIVHDVVLEAASKLEQEETAILQGDLSSLQEQVSSGVDSGLGEELRKRKAELV
FT                   AKISLPGV"
FT   exon            complement(657372..658111)
FT                   /gene="Pc13g02860"
FT                   /locus_tag="PCH_Pc13g02860"
FT                   /number=1
FT   intron          complement(658112..658206)
FT                   /gene="Pc13g02860"
FT                   /locus_tag="PCH_Pc13g02860"
FT                   /number=1
FT   exon            complement(658207..658690)
FT                   /gene="Pc13g02860"
FT                   /locus_tag="PCH_Pc13g02860"
FT                   /number=2
FT   mRNA            complement(join(<659500..659684,659743..659908,
FT                   659979..660691,660749..>661019))
FT                   /gene="Pc13g02870"
FT                   /locus_tag="PCH_Pc13g02870"
FT   CDS_pept        complement(join(659500..659684,659743..659908,
FT                   659979..660691,660749..661019))
FT                   /pseudo
FT                   /gene="Pc13g02870"
FT                   /locus_tag="PCH_Pc13g02870"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: similarity to SR-protein-specific kinase
FT                   SRPK2 - Mus musculus"
FT                   /inference="similar to AA sequence:TREMBL:MMU92456.1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT   exon            complement(659500..659684)
FT                   /gene="Pc13g02870"
FT                   /locus_tag="PCH_Pc13g02870"
FT                   /number=1
FT   intron          complement(659685..659742)
FT                   /gene="Pc13g02870"
FT                   /locus_tag="PCH_Pc13g02870"
FT                   /number=1
FT   exon            complement(659743..659908)
FT                   /gene="Pc13g02870"
FT                   /locus_tag="PCH_Pc13g02870"
FT                   /number=2
FT   intron          complement(659909..659978)
FT                   /gene="Pc13g02870"
FT                   /locus_tag="PCH_Pc13g02870"
FT                   /number=2
FT   exon            complement(659979..660691)
FT                   /gene="Pc13g02870"
FT                   /locus_tag="PCH_Pc13g02870"
FT                   /number=3
FT   intron          complement(660692..660748)
FT                   /gene="Pc13g02870"
FT                   /locus_tag="PCH_Pc13g02870"
FT                   /number=3
FT   exon            complement(660749..661019)
FT                   /gene="Pc13g02870"
FT                   /locus_tag="PCH_Pc13g02870"
FT                   /number=4
FT   mRNA            complement(join(<661475..665896,666422..666599,
FT                   667185..>669355))
FT                   /gene="Pc13g02880"
FT                   /locus_tag="PCH_Pc13g02880"
FT   CDS_pept        complement(join(661475..665896,666422..666599,
FT                   667185..669355))
FT                   /gene="Pc13g02880"
FT                   /locus_tag="PCH_Pc13g02880"
FT                   /note="Title: strong similarity to golgin-245 like protein
FT                   An18g05040 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02880"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91357"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F5"
FT                   /protein_id="CAP91357.1"
FT                   /translation="MLKRGLRRWDSSDPERAPPPLPMNPRSMSPMSPATRSNVSPNIQA
FT                   VAAKFTEKPSEHAPSSYTTNPMPLKSSPERSLVKGQHHKRMQSLQPEDTRQDARTDFMN
FT                   YLENKSPERPLRATIIEAAKPRDPTKSISSPALRQDADRDMNYSLSSRYLSKPILGEST
FT                   PPSATMLALQNMQLPLEPDPPSPSKPPKLIAGPLEPQPHPTKNTSMDSLSNQLHSLTDI
FT                   ASSLQREMMNLSRRSKDNATDLVSLKAATNARDEDIRKSLKDLSSHLTNKYLDADATRF
FT                   DFSNLFKGGDGPNPKDPDSPVSKRSYSVPRMPSPNPFAFDRDSCVSPSPISDGSAALAL
FT                   LEKVLREMATKEGEERLLELVEEIKSRPAGTASDKDADNKVTTMLEEILNLVKEDPSSK
FT                   ALVRSYGVAANLDNIQSKNASPEPTRSRSMRSVDPETERALDLSNSDKGDGSSPNSDEV
FT                   MAILRSVKNSVVEGGGMTNGVKSLVRELRGEVLGMGRELGRRLDEIETSRANDQPEDQP
FT                   RAAGPEEISAIVNRSLDDLKEQLAATINESRQQSSDLSEFRSTMNSAAIYSVVKKALDE
FT                   FELPQPQAISRGAEMDREDILETVREAWETYKPEIEFNNFGLERDEILTCLEEGLKSYQ
FT                   PQHEQAVTYDQVLAAVEDGMQKFIPPQIEHPPSISRDEIILTIRECLEKQPEPASRSLD
FT                   EEHVGHLHSMRDEILDAVSKAMASHTEGSSKDSYDSGLGRDEIVSAVSDGLEAHFTAAK
FT                   EMDEPRISRHDVMNAVNEAFDAQQSAVAVASALSTNVQEPSISREEIFSAIAEGIQNGN
FT                   SITREIELNQDDLMEAITSGLNVAIGTANTNVGGEMTDRLQTLFEGMKEEFKQYSAAGG
FT                   RDTEQVLDAIKDGLDVVRKEIETYVVTAADLSGKDEVIDTVKEGFRLLQADMEKTITDT
FT                   SLLNASRGIPDTPELLDAMEKEFEHLRGTITTLLLRNNATEDKDEILDAIREVADRHKN
FT                   DSGDGVVETIKQEFETLRERMDMSMVRAEPGAEKDEIISALREHFDNLREQTSLKDGKE
FT                   NDVVNTIKQEFESLRERMEMSVVRAEPGAEKDEIISALREHFDILRDETSRRDGNESTL
FT                   SATSELLDAFTDGVGSIRDDLKKLLEKPTEFDNSEIVNAIKDGLADLKLEMDSLRGSNK
FT                   ELDDASTVRGGELMLANEPSITPDIDGLKALIAQLHDKVEAIETTPRAAEPAEDALKRS
FT                   HLDEVLLALHEVQLAMGEMSTQQSTENGDPAGKQDIEVLEQLLLSTKTQLDELVFPSPD
FT                   QVATPEHIGALETMIRDAKDSIAEFSSRVEAEAPTKSEIGTLEGLIKDIWVVLGEMKSK
FT                   AKDGEEDESEKLLKSDLQTVEAMIFEVKTQVDELKLPDVDTLPTKTDIQELSTLVCDFR
FT                   EKMEASNELTAQGFDARKVEHGGLAEKIDEAKFVVGELGDELKSKLDGSTEGLTELKQL
FT                   LEGLAITAESFTTVESIKELTDLINREFERSRGEEDAVKAEKEERDAATIVKHDETRAA
FT                   IIVELGTKIDEKISEVLAKYEDANASLHSKFSETEERDLAHTESLTSTRSLAEDIKLVI
FT                   GAMGDSVNETCERLSVDTKALIEQVDQSRQQMENMHNDVRSRQEQSQAENERAAAATDR
FT                   VESKLLEFHPRILESVQEILTIVSQHYDHSQKSAEDFKSELSALPSNLPAMLPALPPPE
FT                   SDRALAIEDTPLHSKIDDLLEHTKNNKVHEVLTTLLDHSKNDQLHEKLDRALDQASGSN
FT                   DQIYEKLNELLDHATNGNGPVHEKLDALLSRLNPPEPDHSVTQMTKLDEMHRDIMENSR
FT                   RMNEMFAAQSALIAEDTERKRREAEEAAVALERRVSQREQVEAELVGLHEEKDSMLNMI
FT                   HRLKAEKEDMIKQNNKLSKDLSGLETALEIRHEEMRQMEDRADGLEKRILEGVLDHART
FT                   VLLGRSNSVQAMNLKRNRSTRSTRSSRAGARSPSVASTASTAKEPKDSRSLLGNGVGMA
FT                   LKRMPTSLHAGTGAVQPNIGKERRILSLSHVTGNRGVDRQASVKSGITNLKRSHSVKSN
FT                   SPRKSSWAGPTSVADKENVPFHEEDEIASQAEDAVPQRKTSYAESNAPTDRKTSYAESD
FT                   LATETEHNYAPSNAGTDRRTSYAASNAGTERKTSYSGSIVDSVVADAAGQRRVSGVSST
FT                   NSYSVAESSVADHDHEDRHDDISIDGSDSEDDAQTTREDAEHSGHENQNEDHEMSRQIR
FT                   EANEAAEAEVMKLLAPPSDSGLGTDVAV"
FT   exon            complement(661475..665896)
FT                   /gene="Pc13g02880"
FT                   /locus_tag="PCH_Pc13g02880"
FT                   /number=1
FT   intron          complement(665897..666421)
FT                   /gene="Pc13g02880"
FT                   /locus_tag="PCH_Pc13g02880"
FT                   /number=1
FT   exon            complement(666422..666599)
FT                   /gene="Pc13g02880"
FT                   /locus_tag="PCH_Pc13g02880"
FT                   /number=2
FT   intron          complement(666600..667184)
FT                   /gene="Pc13g02880"
FT                   /locus_tag="PCH_Pc13g02880"
FT                   /number=2
FT   exon            complement(667185..669355)
FT                   /gene="Pc13g02880"
FT                   /locus_tag="PCH_Pc13g02880"
FT                   /number=3
FT   mRNA            join(<670201..670254,670427..>670972)
FT                   /gene="Pc13g02890"
FT                   /locus_tag="PCH_Pc13g02890"
FT   CDS_pept        join(670201..670254,670427..670972)
FT                   /gene="Pc13g02890"
FT                   /locus_tag="PCH_Pc13g02890"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit Rpl27 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02890"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91358"
FT                   /db_xref="GOA:B6H1F6"
FT                   /db_xref="InterPro:IPR001141"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR038655"
FT                   /db_xref="InterPro:IPR041991"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F6"
FT                   /inference="similar to AA sequence:PIR:S46790"
FT                   /inference="protein motif:PFAM:PF01777"
FT                   /inference="protein motif:COGS:COG2163"
FT                   /protein_id="CAP91358.1"
FT                   /translation="MKVGRVAIITRGRYAGKKVVIIQPVDAGSKSHPFSHAIVAGIERY
FT                   PLKVTRGMGKKLVDRRSRIKPFIKVVNYNHLMPTRYTLELEGLKGTVTNDTFKEVSQRE
FT                   DAKKTIKKALEDRYTSGKNRWFFTALRTFGPGYTHICISRLDTNTPKQVSKRFTWAFCR
FT                   FERTGLGEGEVEKPSSTFGPCEHGMGKHTPWLETDS"
FT   exon            670201..670254
FT                   /gene="Pc13g02890"
FT                   /locus_tag="PCH_Pc13g02890"
FT                   /number=1
FT   intron          670255..670426
FT                   /gene="Pc13g02890"
FT                   /locus_tag="PCH_Pc13g02890"
FT                   /number=1
FT   exon            670427..670972
FT                   /gene="Pc13g02890"
FT                   /locus_tag="PCH_Pc13g02890"
FT                   /number=2
FT   mRNA            <672032..>672823
FT                   /gene="Pc13g02900"
FT                   /locus_tag="PCH_Pc13g02900"
FT   CDS_pept        672032..672823
FT                   /gene="Pc13g02900"
FT                   /locus_tag="PCH_Pc13g02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02900"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91359"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F7"
FT                   /protein_id="CAP91359.1"
FT                   /translation="MAIPLKTIHEDSREEWMDNEVHRHYNMPMVAVRAEPRVLMHCNVC
FT                   RDTASVQKTSVSIDKWVNTEYFIWEMSAGLADSGANPQWTELFEEQYQERWMQIQSEFE
FT                   SIADLPERFLHKVPVPPFLVAEVRIKTNKFPCHWRLRADTGRHMIDTSFWHLWKSILQQ
FT                   DSFIVGPFDVILKVPSHTPAGEDVVDPWNMSLSNDRHSAASDDFSYLRWDRAYNDSAPL
FT                   DFTCLGEGAQRDSSPPAGRRRSRSTSAIRELSQRMRDSLFL"
FT   exon            672032..672823
FT                   /gene="Pc13g02900"
FT                   /locus_tag="PCH_Pc13g02900"
FT                   /number=1
FT   mRNA            complement(join(<674072..674170,674374..>674628))
FT                   /gene="Pc13g02910"
FT                   /locus_tag="PCH_Pc13g02910"
FT   CDS_pept        complement(join(674072..674170,674374..674628))
FT                   /gene="Pc13g02910"
FT                   /locus_tag="PCH_Pc13g02910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02910"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91360"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F8"
FT                   /protein_id="CAP91360.1"
FT                   /translation="MTYASASTPLCESSPSARTLAMPVMYPLIGLSVGPSNRPLYSREY
FT                   VTASGPNVGGKPKALAGLEIVLPRACDGRSDSSQIHPNLGGKPKKALVVARFSDLVVGT
FT                   WKKLDMATGLDLS"
FT   exon            complement(674072..674170)
FT                   /gene="Pc13g02910"
FT                   /locus_tag="PCH_Pc13g02910"
FT                   /number=1
FT   intron          complement(674171..674373)
FT                   /gene="Pc13g02910"
FT                   /locus_tag="PCH_Pc13g02910"
FT                   /number=1
FT   exon            complement(674374..674628)
FT                   /gene="Pc13g02910"
FT                   /locus_tag="PCH_Pc13g02910"
FT                   /number=2
FT   mRNA            join(<675394..675465,675553..>676044)
FT                   /gene="Pc13g02920"
FT                   /locus_tag="PCH_Pc13g02920"
FT   CDS_pept        join(675394..675465,675553..676044)
FT                   /gene="Pc13g02920"
FT                   /locus_tag="PCH_Pc13g02920"
FT                   /note="Title: strong similarity to host infection protein
FT                   cap20 - Colletotrichum gloeosporioides"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02920"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91361"
FT                   /db_xref="InterPro:IPR037445"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F9"
FT                   /inference="similar to AA sequence:TREMBL:CG18061.1"
FT                   /protein_id="CAP91361.1"
FT                   /translation="MPHAEAKMGEPVVNGEKHYSQFFDHLTSYPIISDSISYYKGNPYG
FT                   AKSLEYADQGYTRLAKPVLPYFSTPYSYVAPYIARADSLGDKGLSQIDARFPIFKEDTQ
FT                   KLRGSIYNSASLPVRVVGDVKHHVTDIYGSEYKKCGGDSVFASGKAVITTSLVLSQESL
FT                   AWVNAFLQSKKEEAKEVVNEKNSH"
FT   exon            675394..675465
FT                   /gene="Pc13g02920"
FT                   /locus_tag="PCH_Pc13g02920"
FT                   /number=1
FT   intron          675466..675552
FT                   /gene="Pc13g02920"
FT                   /locus_tag="PCH_Pc13g02920"
FT                   /number=1
FT   exon            675553..676044
FT                   /gene="Pc13g02920"
FT                   /locus_tag="PCH_Pc13g02920"
FT                   /number=2
FT   mRNA            join(<676663..676876,676960..>677651)
FT                   /gene="Pc13g02930"
FT                   /locus_tag="PCH_Pc13g02930"
FT   CDS_pept        join(676663..676876,676960..677651)
FT                   /gene="Pc13g02930"
FT                   /locus_tag="PCH_Pc13g02930"
FT                   /note="Title: similarity to hypothetical protein SPCC645.04
FT                   - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02930"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91362"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="InterPro:IPR037445"
FT                   /db_xref="InterPro:IPR041898"
FT                   /db_xref="InterPro:IPR041899"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G0"
FT                   /inference="similar to AA sequence:PIR:T41521"
FT                   /protein_id="CAP91362.1"
FT                   /translation="MVKKLVRLAIASEYSRLPIRRNDISAKVLGEQGSRQFKLVFDQAQ
FT                   REMRQRFGMEMTELPAREKVTITQRRAAQKTEKPSSANKSWIVTSTLPLPYRSSDILIP
FT                   TKAPSLYTESTYTGLYSFIIAVIVLNGGSLAEQKLDRYLSRTNAEVATPIDRTDKLLQR
FT                   LCKEGYIIKTREMDGGEEVIEYVLGPRGKIEVGTSGVAGLVRTVYGKEKGDHEGLTHLQ
FT                   REELEDFEGKLGRSLGIEPAPVRANGVDGASDVGDARVNGSAEDCEAPQSSGPRRSSRR
FT                   APTQEEDEEEDDDSEEYEEE"
FT   exon            676663..676876
FT                   /gene="Pc13g02930"
FT                   /locus_tag="PCH_Pc13g02930"
FT                   /number=1
FT   intron          676877..676959
FT                   /gene="Pc13g02930"
FT                   /locus_tag="PCH_Pc13g02930"
FT                   /number=1
FT   exon            676960..677651
FT                   /gene="Pc13g02930"
FT                   /locus_tag="PCH_Pc13g02930"
FT                   /number=2
FT   mRNA            complement(join(<678639..679747,679806..680074,
FT                   680142..>680146))
FT                   /gene="Pc13g02940"
FT                   /locus_tag="PCH_Pc13g02940"
FT   CDS_pept        complement(join(678639..679747,679806..680074,
FT                   680142..680146))
FT                   /gene="Pc13g02940"
FT                   /locus_tag="PCH_Pc13g02940"
FT                   /note="Title: strong similarity to translation elongation
FT                   factor 1 alpha - Podospora anserina"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02940"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91363"
FT                   /db_xref="GOA:B6H1G1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G1"
FT                   /inference="similar to AA sequence:PIR:S43861"
FT                   /inference="protein motif:PFAM:PF00009"
FT                   /inference="protein motif:PFAM:PF03144"
FT                   /inference="protein motif:PFAM:PF03143"
FT                   /inference="protein motif:COGS:COG5256"
FT                   /inference="protein motif:COGS:COG0050"
FT                   /inference="protein motif:COGS:COG2895"
FT                   /protein_id="CAP91363.1"
FT                   /translation="MGKEERSHLNIVVIGHVDSGKSTTTGHMIYKCGGIDQRTIEKFEK
FT                   EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFQTSKYEVTVIDAPGHRDFIKNMI
FT                   TGTSQADCAILIIASGTGEFEAGISKDGQTREHALLAFTLGVKQLIVALNKMDTCKWSE
FT                   ERYNEIVKETSNFIKKVGYNPKAVPFVPISGFNGDNMLEASTNCPWYKGWEKETKAGKA
FT                   TGKTLLEAIDAIEPPVRPSNKPLRLPLQDVYKISGIGTVPVGRVETGIISPGMVVTFAP
FT                   ANVTTEVKSVEMHHQQLKAGNPGDNVGFNVKNVSVKEVRRGNVASDSKNDPAAGCDSFN
FT                   AQVIVLNHPGQVGAGYAPVLDCHTAHIACKFAELLEKIDRRTGKATETSPKFIKSGDAA
FT                   IVKMVPSKPMCVETFTDYPPLGRFAVRDMRQTVAVGVIKSVVKNAGGAGKVTKAAAKAG
FT                   KK"
FT   exon            complement(678639..679747)
FT                   /gene="Pc13g02940"
FT                   /locus_tag="PCH_Pc13g02940"
FT                   /number=1
FT   intron          complement(679748..679805)
FT                   /gene="Pc13g02940"
FT                   /locus_tag="PCH_Pc13g02940"
FT                   /number=1
FT   exon            complement(679806..680074)
FT                   /gene="Pc13g02940"
FT                   /locus_tag="PCH_Pc13g02940"
FT                   /number=2
FT   intron          complement(680075..680141)
FT                   /gene="Pc13g02940"
FT                   /locus_tag="PCH_Pc13g02940"
FT                   /number=2
FT   exon            complement(680142..680146)
FT                   /gene="Pc13g02940"
FT                   /locus_tag="PCH_Pc13g02940"
FT                   /number=3
FT   mRNA            complement(join(<681324..681359,681414..681508,
FT                   681596..681805,681874..>681883))
FT                   /gene="Pc13g02950"
FT                   /locus_tag="PCH_Pc13g02950"
FT   CDS_pept        complement(join(681324..681359,681414..681508,
FT                   681596..681805,681874..681883))
FT                   /gene="Pc13g02950"
FT                   /locus_tag="PCH_Pc13g02950"
FT                   /note="unknown EC_number=2.7.7.6"
FT                   /note="Title: strong similarity to RNA polymerase III
FT                   subunit like protein An18g04850 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02950"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91364"
FT                   /db_xref="GOA:B6H1G4"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR034014"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G4"
FT                   /inference="protein motif:PFAM:PF02150"
FT                   /inference="protein motif:PFAM:PF01096"
FT                   /inference="protein motif:COGS:COG1594"
FT                   /protein_id="CAP91364.1"
FT                   /translation="MLVFCPNCSNALTISKAESSTRFPAGVNRFECRVCPYEAPLEKNY
FT                   FEKKAMKQKEVDDVFGGKEEFANADSVATQCPAESCNGERAYFFQLQIRSADEPMTTFL
FT                   KCTSCGARWREN"
FT   exon            complement(681324..681359)
FT                   /gene="Pc13g02950"
FT                   /locus_tag="PCH_Pc13g02950"
FT                   /number=1
FT   intron          complement(681360..681413)
FT                   /gene="Pc13g02950"
FT                   /locus_tag="PCH_Pc13g02950"
FT                   /number=1
FT   exon            complement(681414..681508)
FT                   /gene="Pc13g02950"
FT                   /locus_tag="PCH_Pc13g02950"
FT                   /number=2
FT   intron          complement(681509..681595)
FT                   /gene="Pc13g02950"
FT                   /locus_tag="PCH_Pc13g02950"
FT                   /number=2
FT   exon            complement(681596..681805)
FT                   /gene="Pc13g02950"
FT                   /locus_tag="PCH_Pc13g02950"
FT                   /number=3
FT   intron          complement(681806..681873)
FT                   /gene="Pc13g02950"
FT                   /locus_tag="PCH_Pc13g02950"
FT                   /number=3
FT   exon            complement(681874..681883)
FT                   /gene="Pc13g02950"
FT                   /locus_tag="PCH_Pc13g02950"
FT                   /number=4
FT   mRNA            join(<682354..682365,682424..682601,682677..>683005)
FT                   /gene="Pc13g02960"
FT                   /locus_tag="PCH_Pc13g02960"
FT   CDS_pept        join(682354..682365,682424..682601,682677..683005)
FT                   /gene="Pc13g02960"
FT                   /locus_tag="PCH_Pc13g02960"
FT                   /note="unknown EC_number=2.7.1.-"
FT                   /note="Title: similarity to death-associated protein kinase
FT                   DAPK - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02960"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91365"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G5"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /inference="protein motif:COGS:COG0666"
FT                   /protein_id="CAP91365.1"
FT                   /translation="MADEGASPRELVVEACRRDQPHLIEQVLNEMEEKTNEQVAQFFNE
FT                   VTDSMGNHALHVCAQYGSYDTMDALFDIQFFECDPLTRLDNDTPLHIAVRYANDKDAEL
FT                   GEAMIKMMCEAGCDPRVRNKHGQKPAELVFNNNEIKKTLQQTEYIMAEGIQNTGDGVDS
FT                   DGGEASDSD"
FT   exon            682354..682365
FT                   /gene="Pc13g02960"
FT                   /locus_tag="PCH_Pc13g02960"
FT                   /number=1
FT   intron          682366..682423
FT                   /gene="Pc13g02960"
FT                   /locus_tag="PCH_Pc13g02960"
FT                   /number=1
FT   exon            682424..682601
FT                   /gene="Pc13g02960"
FT                   /locus_tag="PCH_Pc13g02960"
FT                   /number=2
FT   intron          682602..682676
FT                   /gene="Pc13g02960"
FT                   /locus_tag="PCH_Pc13g02960"
FT                   /number=2
FT   exon            682677..683005
FT                   /gene="Pc13g02960"
FT                   /locus_tag="PCH_Pc13g02960"
FT                   /number=3
FT   mRNA            complement(join(<683264..684599,684657..>685036))
FT                   /gene="Pc13g02970"
FT                   /locus_tag="PCH_Pc13g02970"
FT   CDS_pept        complement(join(683264..684599,684657..685036))
FT                   /gene="Pc13g02970"
FT                   /locus_tag="PCH_Pc13g02970"
FT                   /note="unknown EC_number=2.4.1.-"
FT                   /note="Title: strong similarity to hypothetical glycosyl
FT                   transferase SPCC330.08 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02970"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91366"
FT                   /db_xref="GOA:B6H1G6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR031814"
FT                   /db_xref="InterPro:IPR038013"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G6"
FT                   /inference="similar to AA sequence:PIR:T41318"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /inference="protein motif:COGS:COG0438"
FT                   /inference="protein motif:COGS:COG0297"
FT                   /protein_id="CAP91366.1"
FT                   /translation="MALLSNAILATLVLTATAVLLPKLTGVLLGLVFRGVGWLIWRRTR
FT                   SRREYVIARARSEEEELRASRPKGSTLSRNGAEDEDWEKVDSSGTGGVQTTAGSGSSSG
FT                   SGNESYESPEDWDGIIGFFHPFCNAGGGGERVLWEAIRATQKRWPKAICAIYTGDHEVN
FT                   KATMLEKVENRFNIRLHAPTVVLLYLTTRKYVVSSSYPYMTLLGQSLGSLIVAYDAFTL
FT                   LVPDVFVDTMGYAFTLALCKWFFPRIPVGAYVHYPTISTDMLASLDDKSGVQGINSGAG
FT                   RGWKGKTKRRYWEIFAKLYGWVGRQVDVVMCNSSWTAAHIRTLWGTGKKINNSSGDGSP
FT                   SSPAVVFPPTAVTELQSNIVVDTDSEKTRQPVLLYIAQFRPEKNHPLVLRSFARFLQER
FT                   TNNPAYEGQPPPRLVLIGSVRHSSPDETHIYNLRLLAHELRIRDHTTFLCDASWPVMLS
FT                   HLRTASVGVNAMWNEHFGICVVEYQAAGLICVTHDSGGPREDIVVDLGDGATGFRAETE
FT                   EQFAASFEAALALPEAEKLAMRQRARRSAQRFTEEEFSRKWLDQVQKLVKASTV"
FT   exon            complement(683264..684599)
FT                   /gene="Pc13g02970"
FT                   /locus_tag="PCH_Pc13g02970"
FT                   /number=1
FT   mat_peptide     complement(join(683267..684599,684657..684982))
FT                   /gene="Pc13g02970"
FT                   /locus_tag="PCH_Pc13g02970"
FT   intron          complement(684600..684656)
FT                   /gene="Pc13g02970"
FT                   /locus_tag="PCH_Pc13g02970"
FT                   /number=1
FT   exon            complement(684657..685036)
FT                   /gene="Pc13g02970"
FT                   /locus_tag="PCH_Pc13g02970"
FT                   /number=2
FT   sig_peptide     complement(684983..685036)
FT                   /gene="Pc13g02970"
FT                   /locus_tag="PCH_Pc13g02970"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            <685294..>686331
FT                   /gene="Pc13g02980"
FT                   /locus_tag="PCH_Pc13g02980"
FT   CDS_pept        685294..686331
FT                   /gene="Pc13g02980"
FT                   /locus_tag="PCH_Pc13g02980"
FT                   /note="Title: weak similarity to mitochondrial
FT                   intermembrane space.export machinery component Oxa1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02980"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91367"
FT                   /db_xref="GOA:B6H202"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniProtKB/TrEMBL:B6H202"
FT                   /inference="similar to AA sequence:PIR:S47329"
FT                   /inference="protein motif:COGS:COG0706"
FT                   /protein_id="CAP91367.1"
FT                   /translation="MYALRSSQTIQLTRRAIQLPRSQVRYFHPTRPASFSVVGLALDSS
FT                   TAFIHGVHTVSCLPWVASIPLTAVLIRTFVGLPILLYTRLHRHREMKIVPILSAWMKRY
FT                   AQKQMDQVPTANLRNYNNTEVKRNILTELRKRTAVLHKRWGVSSKYKAIGFLQIPVFIA
FT                   LMESLRGMSGNNSGIIAWLSSFIESSQDPASTAQPLHLTIEPTLANEGALWFPDLLAGD
FT                   PTGVLPLCLTASILGNVLMGWKVKPWKEIALLPKIEMYKQTLFTGLRSFVIVLTCYIGF
FT                   ASFVQGMPTALMLYWITSTNVATLQTWVLDKKVFSPPGFKRFVEKSIAFEKPGVEDPFQ
FT                   LKNLR"
FT   exon            685294..686331
FT                   /gene="Pc13g02980"
FT                   /locus_tag="PCH_Pc13g02980"
FT                   /number=1
FT   mRNA            complement(join(<687188..687299,687357..688376,
FT                   688430..>689094))
FT                   /gene="Pc13g02990"
FT                   /locus_tag="PCH_Pc13g02990"
FT   CDS_pept        complement(join(687188..687299,687357..688376,
FT                   688430..689094))
FT                   /gene="Pc13g02990"
FT                   /locus_tag="PCH_Pc13g02990"
FT                   /note="unknown EC_number=3.1.3.43"
FT                   /note="Title: strong similarity to pyruvate dehydrogenase
FT                   phosphatase isoenzyme 1 PDP1 - Rattus norvegicus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g02990"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91368"
FT                   /db_xref="GOA:B6H203"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B6H203"
FT                   /inference="similar to AA sequence:TREMBL:AF062740.1"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /inference="protein motif:COGS:COG0631"
FT                   /protein_id="CAP91368.1"
FT                   /translation="MRQATVQACRTARRAPVWNIAAKRPCPLTFNQLRGIRPYSGGRRS
FT                   SHTPVAPRSSMHRRNLSLAVISTVVASGAWYTCQGDTVKSAATQIRSFASSALNSAYAE
FT                   GPAESTRRALLVSGDQFYTATLSADQPLTKHTDDSDRRVLEMLTPEQATQKLRKNEESY
FT                   LVNRGKGVVRYDVVQVPSNSPIEDDHAEKIVEIPASVSAVSDGEPSSDWMFWGVFDGHS
FT                   GWTTSAKLRNVLISYVARELNTTYKAASADPSLLMPTSEAIDAAIKKGFVRLDNDIVHE
FT                   SFKEVMKSKSRRVAAELLAPALSGSCALLSFYDSQTKDLKVAVTGDSRAVLGRRSPSGK
FT                   WTATALSEDQTGGTPSEMKRLREEHPGEPYVTKNGRILGQLEPSRAFGDAFYKWSRDVQ
FT                   DTIKAKFFGRTPHPMLKTPPYVTAEPIITTTKIDPSKGDFVVMATDGLWEMLSNEEVVG
FT                   LVGHWVEQQQSAAASTGSKAWLQSWFGFDNQKKLPVETAADGSTEGQRRPIRQQQYDIS
FT                   GAASRFVVEDKNAATHLVRNAMGGKDKDMVCALLTLPSPYSRRYRDDVTVEVIFFGQGP
FT                   DSRTVEVNQEASASEQPPKSKL"
FT   exon            complement(687188..687299)
FT                   /gene="Pc13g02990"
FT                   /locus_tag="PCH_Pc13g02990"
FT                   /number=1
FT   intron          complement(687300..687356)
FT                   /gene="Pc13g02990"
FT                   /locus_tag="PCH_Pc13g02990"
FT                   /number=1
FT   exon            complement(687357..688376)
FT                   /gene="Pc13g02990"
FT                   /locus_tag="PCH_Pc13g02990"
FT                   /number=2
FT   intron          complement(688377..688429)
FT                   /gene="Pc13g02990"
FT                   /locus_tag="PCH_Pc13g02990"
FT                   /number=2
FT   exon            complement(688430..689094)
FT                   /gene="Pc13g02990"
FT                   /locus_tag="PCH_Pc13g02990"
FT                   /number=3
FT   mRNA            join(<689376..689872,689984..>691544)
FT                   /gene="Pc13g03000"
FT                   /locus_tag="PCH_Pc13g03000"
FT   CDS_pept        join(689376..689872,689984..691544)
FT                   /gene="Pc13g03000"
FT                   /locus_tag="PCH_Pc13g03000"
FT                   /note="Title: strong similarity to nucleolar protein Nulp1
FT                   - Mus musculus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03000"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91369"
FT                   /db_xref="InterPro:IPR006994"
FT                   /db_xref="UniProtKB/TrEMBL:B6H204"
FT                   /inference="similar to AA sequence:TREMBL:U94988.1"
FT                   /inference="protein motif:PFAM:PF04910"
FT                   /protein_id="CAP91369.1"
FT                   /translation="MSSRAIRKLQKLREQAQQRESDQQDESSEDEAPRPAKPKFNAFDL
FT                   LNAENEDEEEDEDEAQEEPYARIPEPEPEPTPVKPKKSNKKKKKKAVKTSDPASTPPSK
FT                   SNEADLDEIDRALKDLSTGGPTSVGTGLSTRHPPEASFPKTTSELLGIEPKFLNATNEM
FT                   RRLYSPASRGQSLAGVTLRRNILMQGKDEWPRAPSGGLGMETVKKLPSGETLYRLVHNT
FT                   AYQDVQRQFDLCVESMDPQRLIGHLQYNPYHISTLLQVSEIAKHQGDHAVSADLMERAL
FT                   FNIGRSVHSSFANRLKEGEARLDFIHAENREFWLVGWRYITNLAMKGTWRTAYEWAKLL
FT                   LSLDDSDPYCMRLLIDHLALRGREYAQFVQLCTQTRFSRDWANLPNIQCSLVMAYLRLN
FT                   KPQECRRQLQLAMSHYPWIFSRLAQELDVQHVPKQIWGKMPPTGAHELLTELYIARAKD
FT                   LWNTPEAISLIMEVADSISGEEPNEPPEITLDIARHVVLSDIAKVTTHLPNHFVAGRLS
FT                   SSDPLPPYESEAYQQQSEPTPIYAAPAGGGENWLQDLLGQINHNVRPRNVESDDGEPIG
FT                   FEDEDEDEDTEHIDIPHSRPPLRDPAALEGWLTREGLQTLRIFLTQYGVDRGNWSEVVV
FT                   DYAPLTNYLEAMAAISETARQRLLDGSIKDSLGDFAVSMLEDELAIMRGE"
FT   exon            689376..689872
FT                   /gene="Pc13g03000"
FT                   /locus_tag="PCH_Pc13g03000"
FT                   /number=1
FT   intron          689873..689983
FT                   /gene="Pc13g03000"
FT                   /locus_tag="PCH_Pc13g03000"
FT                   /number=1
FT   exon            689984..691544
FT                   /gene="Pc13g03000"
FT                   /locus_tag="PCH_Pc13g03000"
FT                   /number=2
FT   mRNA            complement(<691936..>692937)
FT                   /gene="Pc13g03010"
FT                   /locus_tag="PCH_Pc13g03010"
FT   CDS_pept        complement(691936..692937)
FT                   /gene="Pc13g03010"
FT                   /locus_tag="PCH_Pc13g03010"
FT                   /note="Title: similarity to hypothetical protein CG16717
FT                   -Drosophila melanogaster"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91370"
FT                   /db_xref="GOA:B6H205"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B6H205"
FT                   /inference="similar to AA sequence:TREMBL:AE003551.31"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /inference="protein motif:COGS:COG2129"
FT                   /inference="protein motif:COGS:COG1409"
FT                   /protein_id="CAP91370.1"
FT                   /translation="MTQNNATSTTNIKTRFLICSDTHGLDSLPGFIPSAEQHADVAIHC
FT                   GDLTTQSQLHEYKASIRLLQAIDAPLKLVIAGNHDFTMDIPMFHKKVADAQSLERELVE
FT                   QAYGYDGEARRLFEGTGITFLDEGVHSFHLQNGALLTVYASPYTPSLGDWGFQYHPDKG
FT                   HDFMIDNGSGTNTVDVVMTHGPPKGIMDYTHSGERAGSPDLFRALARARPRMHCFGHIH
FT                   EGWGAKLVTWRDRTTAMPSHLTDIDNGQSYPIAKLSDMKDRAEQSLSGDSAPMKYFATS
FT                   HCSEDAHPLNWGSQTLFVNAAIKGTPQGIYKQKENLSMQLPWAVDLELRSSA"
FT   exon            complement(691936..692937)
FT                   /gene="Pc13g03010"
FT                   /locus_tag="PCH_Pc13g03010"
FT                   /number=1
FT   mRNA            join(<693212..693575,693660..693940,693994..694164,
FT                   694221..>694535)
FT                   /gene="Pc13g03020"
FT                   /locus_tag="PCH_Pc13g03020"
FT   CDS_pept        join(693212..693575,693660..693940,693994..694164,
FT                   694221..694535)
FT                   /gene="Pc13g03020"
FT                   /locus_tag="PCH_Pc13g03020"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An03g03340 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91371"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B6H206"
FT                   /protein_id="CAP91371.1"
FT                   /translation="MASKRPRSDSPEASFSRPRRKVTEPDPPPPVPYEDSIFSVQTDVS
FT                   EFTRAANLTAMLDRIDRYTTSAERPHDEILQASLRNFLEMLPPDGCAELLKDIDSKPGD
FT                   EGLYEVFSNLYTGLRCRMMSRSKPPSITPFPNPKRGDNAEALSAKMDKPISRDRKFKTA
FT                   LLARDGYKCAVTGHFDQGRYEELGLDSPDLNPTDTQGAHIIPFSYGFWNSSQSPPPDMA
FT                   TAWEVLYRCFPALRRLRFNWEDINNLENGITMAEWIHSRFGKFRLAFEATEVPDQYDVE
FT                   IFGPIGNAYRNMIHDRITFTNHDSAKDHKLPSSILLECHYILAKILNASGMAEAFDHDF
FT                   DRWEAVKESVHSLREDGKTDIGSILGLSFLCDDIAR"
FT   exon            693212..693575
FT                   /gene="Pc13g03020"
FT                   /locus_tag="PCH_Pc13g03020"
FT                   /number=1
FT   intron          693576..693659
FT                   /gene="Pc13g03020"
FT                   /locus_tag="PCH_Pc13g03020"
FT                   /number=1
FT   exon            693660..693940
FT                   /gene="Pc13g03020"
FT                   /locus_tag="PCH_Pc13g03020"
FT                   /number=2
FT   intron          693941..693993
FT                   /gene="Pc13g03020"
FT                   /locus_tag="PCH_Pc13g03020"
FT                   /number=2
FT   exon            693994..694164
FT                   /gene="Pc13g03020"
FT                   /locus_tag="PCH_Pc13g03020"
FT                   /number=3
FT   intron          694165..694220
FT                   /gene="Pc13g03020"
FT                   /locus_tag="PCH_Pc13g03020"
FT                   /number=3
FT   exon            694221..694535
FT                   /gene="Pc13g03020"
FT                   /locus_tag="PCH_Pc13g03020"
FT                   /number=4
FT   mRNA            join(<695704..695790,695843..696441,696494..696543,
FT                   696595..696653,696712..>696861)
FT                   /gene="Pc13g03030"
FT                   /locus_tag="PCH_Pc13g03030"
FT   CDS_pept        join(695704..695790,695843..696441,696494..696543,
FT                   696595..696653,696712..696861)
FT                   /gene="Pc13g03030"
FT                   /locus_tag="PCH_Pc13g03030"
FT                   /note="Title: strong similarity to hypothetical membrane
FT                   protein YOL092w - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91372"
FT                   /db_xref="GOA:B6H207"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:B6H207"
FT                   /inference="similar to AA sequence:PIR:S57377"
FT                   /inference="protein motif:PFAM:PF04193"
FT                   /protein_id="CAP91372.1"
FT                   /translation="MEGPIPLTAREAASGLLGSVSMTCWFFLLVPQLIENYRNGNAEAI
FT                   SLLFVFVWFIGDVANLAGGLLSRLVPVIIAIAVYFCIADGVLIAQCVYYKVRNSRPEPF
FT                   HRRRSSTETPDPTTPLLGRRFSDSLASSQSRRRSSGSLRRYHAGRRESEVEGTLAKIVE
FT                   ENDYGRKAWVKNFASVVGIFLIGMAGWTIAWQTGMWVPAPLENNNGSEEATGGLVLGYF
FT                   SAACYLGARLPQIYKNYSEKSCEGLSLLFFILSLLGNLTYGAGILCHSTEKEYFLTNLP
FT                   WLIGSLGTMVEDAVIFFQFRIYAIQEPRLSAIS"
FT   exon            695704..695790
FT                   /gene="Pc13g03030"
FT                   /locus_tag="PCH_Pc13g03030"
FT                   /number=1
FT   intron          695791..695842
FT                   /gene="Pc13g03030"
FT                   /locus_tag="PCH_Pc13g03030"
FT                   /number=1
FT   exon            695843..696441
FT                   /gene="Pc13g03030"
FT                   /locus_tag="PCH_Pc13g03030"
FT                   /number=2
FT   intron          696442..696493
FT                   /gene="Pc13g03030"
FT                   /locus_tag="PCH_Pc13g03030"
FT                   /number=2
FT   exon            696494..696543
FT                   /gene="Pc13g03030"
FT                   /locus_tag="PCH_Pc13g03030"
FT                   /number=3
FT   intron          696544..696594
FT                   /gene="Pc13g03030"
FT                   /locus_tag="PCH_Pc13g03030"
FT                   /number=3
FT   exon            696595..696653
FT                   /gene="Pc13g03030"
FT                   /locus_tag="PCH_Pc13g03030"
FT                   /number=4
FT   intron          696654..696711
FT                   /gene="Pc13g03030"
FT                   /locus_tag="PCH_Pc13g03030"
FT                   /number=4
FT   exon            696712..696861
FT                   /gene="Pc13g03030"
FT                   /locus_tag="PCH_Pc13g03030"
FT                   /number=5
FT   mRNA            complement(join(<697084..697158,697184..697319,
FT                   697470..697544,697595..>697641))
FT                   /gene="Pc13g03040"
FT                   /locus_tag="PCH_Pc13g03040"
FT   CDS_pept        complement(join(697084..697158,697184..697319,
FT                   697470..697544,697595..697641))
FT                   /gene="Pc13g03040"
FT                   /locus_tag="PCH_Pc13g03040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91373"
FT                   /db_xref="UniProtKB/TrEMBL:B6H208"
FT                   /protein_id="CAP91373.1"
FT                   /translation="METGCSVYLRVITWPRILGELKTFGTLLGLSMIKVLLWPGDAVGL
FT                   VVGGSLIRCFRSQGDLSLSAPGPYGYRSVDWSSRGLINGAKNCTDNISDVYCCSFQGYA
FT                   VATPLL"
FT   exon            complement(697084..697158)
FT                   /gene="Pc13g03040"
FT                   /locus_tag="PCH_Pc13g03040"
FT                   /number=1
FT   intron          complement(697159..697183)
FT                   /gene="Pc13g03040"
FT                   /locus_tag="PCH_Pc13g03040"
FT                   /number=1
FT   exon            complement(697184..697319)
FT                   /gene="Pc13g03040"
FT                   /locus_tag="PCH_Pc13g03040"
FT                   /number=2
FT   intron          complement(697320..697469)
FT                   /gene="Pc13g03040"
FT                   /locus_tag="PCH_Pc13g03040"
FT                   /number=2
FT   exon            complement(697470..697544)
FT                   /gene="Pc13g03040"
FT                   /locus_tag="PCH_Pc13g03040"
FT                   /number=3
FT   intron          complement(697545..697594)
FT                   /gene="Pc13g03040"
FT                   /locus_tag="PCH_Pc13g03040"
FT                   /number=3
FT   exon            complement(697595..697641)
FT                   /gene="Pc13g03040"
FT                   /locus_tag="PCH_Pc13g03040"
FT                   /number=4
FT   mRNA            complement(join(<697839..697885,697943..698072,
FT                   698177..698254,698432..>698500))
FT                   /gene="Pc13g03050"
FT                   /locus_tag="PCH_Pc13g03050"
FT   CDS_pept        complement(join(697839..697885,697943..698072,
FT                   698177..698254,698432..698500))
FT                   /gene="Pc13g03050"
FT                   /locus_tag="PCH_Pc13g03050"
FT                   /note="Title: strong similarity to cytoplasmic acidic
FT                   ribosomal protein p1 - Alternaria alternata"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91374"
FT                   /db_xref="GOA:B6H209"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:B6H209"
FT                   /inference="similar to AA sequence:SWISSPROT:RLA1_ALTAL"
FT                   /inference="protein motif:PFAM:PF00428"
FT                   /inference="protein motif:COGS:COG2058"
FT                   /protein_id="CAP91374.1"
FT                   /translation="MSTAELACSYAALILADDGIEVSADKIQTLISAAKVQEVEPIWSS
FT                   IFARALEGKDIKELLTNVGSAGPAAAAPAGGAAAEAPAEAKAEEKVEEKEESDEDMGFG
FT                   LFD"
FT   exon            complement(697839..697885)
FT                   /gene="Pc13g03050"
FT                   /locus_tag="PCH_Pc13g03050"
FT                   /number=1
FT   mat_peptide     complement(join(697842..697885,697943..698072,
FT                   698177..698251))
FT                   /gene="Pc13g03050"
FT                   /locus_tag="PCH_Pc13g03050"
FT   intron          complement(697886..697942)
FT                   /gene="Pc13g03050"
FT                   /locus_tag="PCH_Pc13g03050"
FT                   /number=1
FT   exon            complement(697943..698072)
FT                   /gene="Pc13g03050"
FT                   /locus_tag="PCH_Pc13g03050"
FT                   /number=2
FT   intron          complement(698073..698176)
FT                   /gene="Pc13g03050"
FT                   /locus_tag="PCH_Pc13g03050"
FT                   /number=2
FT   exon            complement(698177..698254)
FT                   /gene="Pc13g03050"
FT                   /locus_tag="PCH_Pc13g03050"
FT                   /number=3
FT   sig_peptide     complement(join(698252..698254,698432..698500))
FT                   /gene="Pc13g03050"
FT                   /locus_tag="PCH_Pc13g03050"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(698255..698431)
FT                   /gene="Pc13g03050"
FT                   /locus_tag="PCH_Pc13g03050"
FT                   /number=3
FT   exon            complement(698432..698500)
FT                   /gene="Pc13g03050"
FT                   /locus_tag="PCH_Pc13g03050"
FT                   /number=4
FT   mRNA            join(<698964..699183,699236..699317,699372..699396,
FT                   699467..699745,699808..699974,700028..700241,
FT                   700295..700480,700528..>700683)
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT   CDS_pept        join(698964..699183,699236..699317,699372..699396,
FT                   699467..699745,699808..699974,700028..700241,
FT                   700295..700480,700528..700683)
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /note="unknown EC_number=4.2.1.2"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPAC30C2.08 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91375"
FT                   /db_xref="InterPro:IPR018810"
FT                   /db_xref="UniProtKB/TrEMBL:B6H210"
FT                   /inference="similar to AA sequence:TREMBL:SPAC30C2.8"
FT                   /protein_id="CAP91375.1"
FT                   /translation="MESPAIPVPLDPREQPILENLLRTRDALLLIKRDKSSYVKSRDVL
FT                   PLYEEVIAEVEKLNSVRKEQDRRLVHNRLDYVLDDCFQLISLLFLTVGKNNEAPAVYSL
FT                   ATTIQRLLDHLEEAGFYSSKDLNSVTKTLESTRETLERGRNTYSPALLTLLESRLQQCE
FT                   QSLAKLQKGLAVLAPPLAQTHETLVSILRSTSAVNTRSKFSASEVNALREQLKKIEKTT
FT                   KDGNFVDEEGNILAGQDDLKSLMHRCWRWTEIVLEREGKIDERFQDQYDRLLEIRNQLD
FT                   RLSVTQAWSLRETDLFVYQRKLDRIDEARVNGNFVDAEGQPADLHAQRTLLYLIRRSYA
FT                   YIYALLISSEPVSEALLPVYNQLQTLRRCLIEVKESGGVANSRELYPYSMKLNSIDNMR
FT                   VDGKFYVGPDIPEGQGSVNNLLAECYDLVWELRAAVVDEDGES"
FT   exon            698964..699183
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=1
FT   intron          699184..699235
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=1
FT   exon            699236..699317
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=2
FT   intron          699318..699371
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=2
FT   exon            699372..699396
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=3
FT   intron          699397..699466
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=3
FT   exon            699467..699745
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=4
FT   intron          699746..699807
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=4
FT   exon            699808..699974
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=5
FT   intron          699975..700027
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=5
FT   exon            700028..700241
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=6
FT   intron          700242..700294
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=6
FT   exon            700295..700480
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=7
FT   intron          700481..700527
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=7
FT   exon            700528..700683
FT                   /gene="Pc13g03060"
FT                   /locus_tag="PCH_Pc13g03060"
FT                   /number=8
FT   mRNA            complement(join(<701288..701852,702043..>702206))
FT                   /gene="Pc13g03070"
FT                   /locus_tag="PCH_Pc13g03070"
FT   CDS_pept        complement(join(701288..701852,702043..702206))
FT                   /gene="Pc13g03070"
FT                   /locus_tag="PCH_Pc13g03070"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An11g02890 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91376"
FT                   /db_xref="UniProtKB/TrEMBL:B6H211"
FT                   /protein_id="CAP91376.1"
FT                   /translation="MGSHNTSMKLPSSAKSDNNRATKFQQTPPTYEASTQNVMEKYKKQ
FT                   VQHAKTPENLIQAGLVRRTYLDITLRWIVQRRAWCEQKAKALQIRQRDMSSQDLSRLEA
FT                   YEEQIKSLSSRYWVAHRKQWIESDKLWSPSAKRALTRQRKHKDWYLSGVLREDCANRGG
FT                   CCGRSCGCCERTRMTKVNTDRVHDRGHCTTACSCCLEAHGIDGEHLDMKGVDEVHFSRD
FT                   RDPHTMRLFRGYIFYLNGME"
FT   exon            complement(701288..701852)
FT                   /gene="Pc13g03070"
FT                   /locus_tag="PCH_Pc13g03070"
FT                   /number=1
FT   intron          complement(701853..702042)
FT                   /gene="Pc13g03070"
FT                   /locus_tag="PCH_Pc13g03070"
FT                   /number=1
FT   exon            complement(702043..702206)
FT                   /gene="Pc13g03070"
FT                   /locus_tag="PCH_Pc13g03070"
FT                   /number=2
FT   mRNA            complement(<702486..>703322)
FT                   /gene="Pc13g03080"
FT                   /locus_tag="PCH_Pc13g03080"
FT   CDS_pept        complement(702486..703322)
FT                   /gene="Pc13g03080"
FT                   /locus_tag="PCH_Pc13g03080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91377"
FT                   /db_xref="UniProtKB/TrEMBL:B6H212"
FT                   /protein_id="CAP91377.1"
FT                   /translation="MQPSERLPSYEETTKVSKALVNEFISGLEAEQSRNSFLIVLLNRR
FT                   LGIDDKCKAIEDAHRIPAIEQDTDAESVEDWLRLRGMHKLAQSVCYYVHTRHSSSNRRW
FT                   CKALIEADIEIRWIVQRMIWVHQQKRNMGPQALDGYLKSLKQKYWRVHRKLWIAEDSIS
FT                   SRSAARAFAFQRQKIDWYLSSELREDCARGGGCCGRACGCCEIPRTIDELRTEGIRNRG
FT                   HCTSACSCCLDAHELDGKNIGDETTDLQGLRFDTTFTEWLPDPHTLRLLKGYVFSI"
FT   exon            complement(702486..703322)
FT                   /gene="Pc13g03080"
FT                   /locus_tag="PCH_Pc13g03080"
FT                   /number=1
FT   mRNA            complement(<704067..>704969)
FT                   /gene="Pc13g03090"
FT                   /locus_tag="PCH_Pc13g03090"
FT   CDS_pept        complement(704067..704969)
FT                   /gene="Pc13g03090"
FT                   /locus_tag="PCH_Pc13g03090"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An09g01250 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91378"
FT                   /db_xref="UniProtKB/TrEMBL:B6H213"
FT                   /protein_id="CAP91378.1"
FT                   /translation="MQASEKLPTYEESTKSPKEILMDRLKKKIEKAQKPEDLLTHLLST
FT                   DLNVEDKATLLRQAPKRIYACYHRRSAEYVEAQLREAGYGGLALYLYWCFFWYEAQPTV
FT                   PESWIKELIELDIEERWVAQRKVCIQEKLQTLQASSERPLSFEDGAKHASQLESYEEQL
FT                   KDLNKRHWALSRKKWNNRTSITSWSFSRAYDIQRSYPQWYLSFDLISDCVGRGGCCGRS
FT                   CGCCKNSRTVGGLDDGINTRGHCTTACGCCLKAHGIEDLDVGINEEIPDLRELCFEYRS
FT                   PPLMSSHSRQLLRGYAFNI"
FT   exon            complement(704067..704969)
FT                   /gene="Pc13g03090"
FT                   /locus_tag="PCH_Pc13g03090"
FT                   /number=1
FT   mRNA            complement(join(<705651..705760,705872..705897,
FT                   706028..706201,706267..706404,706469..>706893))
FT                   /gene="Pc13g03100"
FT                   /locus_tag="PCH_Pc13g03100"
FT   CDS_pept        complement(join(705651..705760,705872..705897,
FT                   706028..706201,706267..706404,706469..706893))
FT                   /exception="reasons given in citation"
FT                   /gene="Pc13g03100"
FT                   /locus_tag="PCH_Pc13g03100"
FT                   /note="putative sequencing error"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An12g03380 - Aspergillus niger [putative sequencing error]"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:B6H214"
FT                   /inference="protein motif:COGS:COG5048"
FT                   /protein_id="CAP91379.1"
FT                   /translation="KIKKILPLEYYNLAKVFLKKKLDKLPLYRPSIDXNIVLKAKVXLD
FT                   YYPLYKLSFNKLKAAKXYIIKNLDKGFIILNASLYISLILIVKKPSSRLRFYIDFRKLN
FT                   IITKKDYYLLPLINKVLXQTSKAKYFTKFNIRXSFYRIYLILGAEDLTTFRIXYRSFKY
FT                   KVILFRLINGLAIFXRFINNILXEYIDKYVVTFIDNILIYSKTLKEYHRXVREVLSYLX
FT                   KASLXVTLLKYKFTIIKTKFLRFIVSIDSIAVNLKKSGXSSYRRPYRXXKAYNPFLDSI
FT                   TSIDDLSKDIVXFXSLYIIXFNRTSYINSLPIIKXPLYSXRRSXLLYXYSIIITXYKKX
FT                   EXKLILXIVYXEXYYLSTIKITISSIXXLSIXKLYKLXSXTIKYRIRNSLLLSIYYRNR
FT                   DXSLRVLYNKIVSRFLXTINLXNTLXLSNKXTNNKRDKASSFYNSISXLNTNXERKILL
FT                   XIYYXERSYLISIIVGSX"
FT   exon            complement(705651..705760)
FT                   /gene="Pc13g03100"
FT                   /locus_tag="PCH_Pc13g03100"
FT                   /number=1
FT   intron          complement(705761..705871)
FT                   /gene="Pc13g03100"
FT                   /locus_tag="PCH_Pc13g03100"
FT                   /number=1
FT   exon            complement(705872..705897)
FT                   /gene="Pc13g03100"
FT                   /locus_tag="PCH_Pc13g03100"
FT                   /number=2
FT   intron          complement(705898..706027)
FT                   /gene="Pc13g03100"
FT                   /locus_tag="PCH_Pc13g03100"
FT                   /number=2
FT   exon            complement(706028..706201)
FT                   /gene="Pc13g03100"
FT                   /locus_tag="PCH_Pc13g03100"
FT                   /number=3
FT   intron          complement(706202..706266)
FT                   /gene="Pc13g03100"
FT                   /locus_tag="PCH_Pc13g03100"
FT                   /number=3
FT   exon            complement(706267..706404)
FT                   /gene="Pc13g03100"
FT                   /locus_tag="PCH_Pc13g03100"
FT                   /number=4
FT   intron          complement(706405..706468)
FT                   /gene="Pc13g03100"
FT                   /locus_tag="PCH_Pc13g03100"
FT                   /number=4
FT   exon            complement(706469..706893)
FT                   /gene="Pc13g03100"
FT                   /locus_tag="PCH_Pc13g03100"
FT                   /number=5
FT   mRNA            join(<708277..708321,708371..>710722)
FT                   /gene="Pc13g03110"
FT                   /locus_tag="PCH_Pc13g03110"
FT   CDS_pept        join(708277..708321,708371..710722)
FT                   /gene="Pc13g03110"
FT                   /locus_tag="PCH_Pc13g03110"
FT                   /note="unknown EC_number=4.2.1.3"
FT                   /note="Title: strong similarity to mitochondrial aconitase
FT                   hydroxylase Aco1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91380"
FT                   /db_xref="GOA:B6H215"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B6H215"
FT                   /inference="similar to AA sequence:TREMBL:SCACO1A.1"
FT                   /inference="protein motif:PFAM:PF00330"
FT                   /inference="protein motif:PFAM:PF00694"
FT                   /inference="protein motif:COGS:COG1048"
FT                   /protein_id="CAP91380.1"
FT                   /translation="MVSQLVWQRVSASRGMATRLSSQRLLARGLATEASSSRMPPYPKL
FT                   VRNLEQVRRVLGSDRALTLAEKILYAHLDNAEESLLTGTNNGRDVRGKANLKLKPDRVA
FT                   MQDASAQMALLQFMSCGLPSTAVPASIHCDHMIVGERGADTDLPASIKGNSEVFDFLES
FT                   AAKRYGIEFWPPGAGIIHQSVLENYAAPGLMMLGTDSHTPNGGGLGAIAIGVGGADAVD
FT                   ALVDAPWELKAPKILGVRLEGKLSGWASPKDIILSLAGKLTVRGGTGSIIEYHGPGVET
FT                   LSCTGMATCCNMGAEVGATTSVFPFSPSMVPYLQSTHRGHVADAAAEVAAAGPSSLLRA
FT                   DTKAEYDQLVTINLSELEPHINGPFTPDFSVPLSKFADTVREKKWPETFGAGLIGSCTN
FT                   SSYEDMTRAEDLVKQATAAGLKPKADFFITPGSEQIRATLDRDQTLNTFSEAGGVVLAN
FT                   ACGPCIGQWKRTDGVPKDEDNAIFTSYNRNFPGRNDGNRRTMNFLASPELVTALAYSGS
FT                   TTFNPMTDSLTTPDGSTFKFQPPSGFDLPSAGFEEGNPNFLPTAAVPDASAEVIVSPTS
FT                   DRLAILEPFEPFPKGDLSGLQVLYKVKGQCTTDTISAAGPWLKYKGHLPNISANTLIGA
FT                   VNAATGETNVAYDEAGNKYGIPELAEAWKERGISWLVVAEDNYGEGSAREHAALQPRYL
FT                   GGRVIVSKSFARIHETNLKKQGVVPLTFANREDYDRIDACDKVDTVGLYDVLQAGGQGE
FT                   IKLRVTKQKTGEVFDVPVQHTFSQDQCAFILAGSALNLLAKKAHS"
FT   exon            708277..708321
FT                   /gene="Pc13g03110"
FT                   /locus_tag="PCH_Pc13g03110"
FT                   /number=1
FT   intron          708322..708370
FT                   /gene="Pc13g03110"
FT                   /locus_tag="PCH_Pc13g03110"
FT                   /number=1
FT   exon            708371..710722
FT                   /gene="Pc13g03110"
FT                   /locus_tag="PCH_Pc13g03110"
FT                   /number=2
FT   mRNA            complement(join(<711621..712642,712696..>713956))
FT                   /gene="Pc13g03120"
FT                   /locus_tag="PCH_Pc13g03120"
FT   CDS_pept        complement(join(711621..712642,712696..713956))
FT                   /gene="Pc13g03120"
FT                   /locus_tag="PCH_Pc13g03120"
FT                   /note="Title: strong similarity to calcineurin responsive
FT                   zinc-finger transcription factor Crz1 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91381"
FT                   /db_xref="GOA:B6H1U9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U9"
FT                   /inference="similar to AA sequence:PIR:S62939"
FT                   /inference="protein motif:PFAM:PF00096"
FT                   /inference="protein motif:COGS:COG5048"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /inference="protein motif:COGS:COG0557"
FT                   /protein_id="CAP91381.1"
FT                   /translation="MASHDQNQGTAYCPGDMKHRSVSPSPHGQQYHDPNSGGLGVDPSM
FT                   ASYSTNPSFQNPDSSIGGAEAYAYPSYLAGAPSTQTLSPPADHSYAPTINTNNLPISQS
FT                   FETSLVNQLEHSSTGLRPMQGDENFSNMLNSNHPELDFSLYQNHSPNSASTPEYDSSLL
FT                   LDPQMHQRQSINQAINPADLVSPISNPSVSSHPSSRDQQNSSPGPMSPPGSTPGAYYTP
FT                   RHSRHTSLDPATAAYLTAQPGPDWQSVMNNVSFQGHRRAPSEVSEVSSANHSPYLSQHE
FT                   FDGIENNASPSLVPQSDPSLYDNGLGMESFTLSEQHQQGISPLHSPYISPRLMPQQGGE
FT                   MVPNNSYLTQFPSAPTDMYGMPQEDMMNMNQLNNPPGDIGQASQMAPPSINVEFAPPLR
FT                   NPTVDTSKSTADFDSLSPPAMRSRVRSKSDPYHPASRSRSPATSSTSLEPRAPASPRSL
FT                   SPVGSVGSHSRSSPSSRDPSPSRSNRRLSTSSIENRNYILDLADPQRPGAAPGEPKRIQ
FT                   KHPATFQCTLCPKRFTRAYNLRSHLRTHTDERPFVCTVCGKAFARQHDRKRHEGLHSGE
FT                   KKFVCRGELSRSGQWGCGRRFARADALGRHFRSEAGRVCIKPLLDEESQERDRVLLERQ
FT                   QQQQQSPSGHLQPIPQPLVMPNMPGMDGQSTGNFVLPAALLAQYPALQTLQWDQISAVG
FT                   DDPGDIGGRSSFDASSGGEFGFDEDDSGMGGGYGNNQGGMYGVDNSGQMLGVNPGDPGY
FT                   SDQKWTG"
FT   exon            complement(711621..712642)
FT                   /gene="Pc13g03120"
FT                   /locus_tag="PCH_Pc13g03120"
FT                   /number=1
FT   intron          complement(712643..712695)
FT                   /gene="Pc13g03120"
FT                   /locus_tag="PCH_Pc13g03120"
FT                   /number=1
FT   exon            complement(712696..713956)
FT                   /gene="Pc13g03120"
FT                   /locus_tag="PCH_Pc13g03120"
FT                   /number=2
FT   mRNA            complement(join(<715019..715747,715811..>716140))
FT                   /gene="Pc13g03130"
FT                   /locus_tag="PCH_Pc13g03130"
FT   CDS_pept        complement(join(715019..715747,715811..716140))
FT                   /gene="Pc13g03130"
FT                   /locus_tag="PCH_Pc13g03130"
FT                   /note="unknown EC_number=3.2.1.89"
FT                   /note="Title: strong similarity to arabinogalactan
FT                   endo-1,4-beta-galactosidase gal1 - Aspergillus aculeatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91382"
FT                   /db_xref="GOA:B6H1V0"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V0"
FT                   /inference="similar to AA sequence:PIR:S51494"
FT                   /inference="protein motif:COGS:COG3867"
FT                   /protein_id="CAP91382.1"
FT                   /translation="MLPHLLLAAAQLFASSSAALTYNGADISSLLVEEGKGVSYKNLAG
FT                   TPEKLETILSASGVNSVRQRIWVNPSDGSYDLDYNVKLAKRVQAQGMGTYLDLHYSDTW
FT                   ADPKSQTTPSGWSTTDIGILAGQVYDYTLDVCNTFAANKIDVDIVSIGNEIRNGLLWPL
FT                   GGTSNYNNIARLLHSAAWGVKDSKLATTPKIMIHLDNGWDSGAQSYFYDQVLAPGSGLV
FT                   STDFDYIGVSYYPFYNADATLAALKTSLTNLHSKYKKETLVVETNWPFSCPNPGYAFPT
FT                   DLKDIPFSVEGQQTFLQRLAKAVEEVGGLGIYYWEPAWVDNAGLGSSCDDNLFFAWSND
FT                   QARASLDTLGGL"
FT   exon            complement(715019..715747)
FT                   /gene="Pc13g03130"
FT                   /locus_tag="PCH_Pc13g03130"
FT                   /number=1
FT   mat_peptide     complement(join(715022..715747,715811..716086))
FT                   /gene="Pc13g03130"
FT                   /locus_tag="PCH_Pc13g03130"
FT   intron          complement(715748..715810)
FT                   /gene="Pc13g03130"
FT                   /locus_tag="PCH_Pc13g03130"
FT                   /number=1
FT   exon            complement(715811..716140)
FT                   /gene="Pc13g03130"
FT                   /locus_tag="PCH_Pc13g03130"
FT                   /number=2
FT   sig_peptide     complement(716087..716140)
FT                   /gene="Pc13g03130"
FT                   /locus_tag="PCH_Pc13g03130"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(<717368..>720892)
FT                   /gene="Pc13g03140"
FT                   /locus_tag="PCH_Pc13g03140"
FT   CDS_pept        complement(717368..720892)
FT                   /gene="Pc13g03140"
FT                   /locus_tag="PCH_Pc13g03140"
FT                   /note="unknown EC_number=2.7.1.-"
FT                   /note="Title: strong similarity to
FT                   serine/threonine-specific protein kinase ssp1p
FT                   -Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91383"
FT                   /db_xref="GOA:B6H1V1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP91383.1"
FT                   /translation="MTEIRSSQAGLEDPDQLARNRHASKNHKRNLSRSDESSQVPSASN
FT                   DHPESHPPSKSSAEQPSIITDVSEATATFRQAFPGLYGARTPSNRSSSSSLQALNEGIV
FT                   VDVRSENGSIGRTTRRASRHSDHQLPVYPDQSYASLQSQVHPTWHPPYLAEPDPLPRHS
FT                   YARGIRTAGNTPVSSPGLFSMRHSRMGTPSGSDDDVSTGSSLLHPSHLQPPKETHTAEV
FT                   DRDMVTGNKTINQYEILEELGRGEHGKVKLGQHVVTKQKVAIKIVQRYSTRRRLGKLGN
FT                   PEDKVKKEVAILKKARHPNVVSLLEVIDDPNRQKVYIVLEYVENGEIVWRKKGLREIVH
FT                   VDKLRLEREKNGIPDTPAFLEESHQFIRTAQHLRRQRERARERIEAQAADAQQGPIPAW
FT                   SLEHGAESSDEEDDESGLPIRRSSSRSIAVTDDSSPSFTQDPSLSAVEGSMYGAYSDYP
FT                   FERRSSTASSSFGYAPSEPEWSAEGDDMAFVPCLTIVEARSAFRDSVLGLEYLHYQGII
FT                   HRDIKPANLLVTSTHRVKISDFGVSYLGRPMRDEEEEQVGETDATELDDARELSKTVGT
FT                   PAFYAPELCYTGDDFVETIGSIPKITGAVDVWSLGVTLYGMIFGRLPFVSDDGYSMFQT
FT                   IVKKEVFIPRKRLVPVMDEASDSNQWNLRNDDELVYEDIDDELYDLLRRLLTKDPIKRI
FT                   TLKEIKHHPWTLHGLPNPRVWIEETDPGYQSKGKRIEVSNEEVTSAVSKVPFIQRVRSN
FT                   VAKWFGSRSKDKESRKRTSSTTPSTETLSSASSNNTFGKTSRDSRRSSLRGDEEFLRPL
FT                   KIGSQGHPLAQSVTASPVDEGDWASYFDAVQPAAAKLAAANKVATPPPAVTPRPGPPRR
FT                   AKSSMSTAESSKTVKPSGSDAPSTGRPFSIIEALGPTNFGSLFSGASRRASRGSRSRRS
FT                   SPSGESGSMHADGERCSAEPSVAVSNASAHGQVRTPGLWHEEEHPAAEQLVPSHVSRRK
FT                   RSSQLEDASPAESLNLTRDALLRRRRSDIDANEGGTLRVDYAMYSTESLLLPPINPPAN
FT                   QGCPDNTNNGLATSTSATISSSSADDFTSGMSQSASHPSIPSVISNASSLSGDGYSAKG
FT                   NNLDEVPSMLRTGETLKPLRPTSLRSSEEDESRYYCDDEDEDESEDEGLVIGKRKPPPK
FT                   AAASDIPS"
FT   exon            complement(717368..720892)
FT                   /gene="Pc13g03140"
FT                   /locus_tag="PCH_Pc13g03140"
FT                   /number=1
FT   mRNA            join(<723538..723702,723843..>724124)
FT                   /gene="Pc13g03150"
FT                   /locus_tag="PCH_Pc13g03150"
FT   CDS_pept        join(723538..723702,723843..724124)
FT                   /gene="Pc13g03150"
FT                   /locus_tag="PCH_Pc13g03150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91384"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V2"
FT                   /protein_id="CAP91384.1"
FT                   /translation="MPKAATLKTTPLMQKSPLKLKPPVGNLEMITQPLEPSKVPRKKEH
FT                   PGQQRDFKNTRCKLRRWPRESPEERGFAWLSHLVSGYGQGTVSAKKGLARLGSPSWVPT
FT                   GGYLSALELFWGWREIPPRFSVHQSGGCIIESGYCGVDGIWRTE"
FT   exon            723538..723702
FT                   /gene="Pc13g03150"
FT                   /locus_tag="PCH_Pc13g03150"
FT                   /number=1
FT   intron          723703..723842
FT                   /gene="Pc13g03150"
FT                   /locus_tag="PCH_Pc13g03150"
FT                   /number=1
FT   exon            723843..724124
FT                   /gene="Pc13g03150"
FT                   /locus_tag="PCH_Pc13g03150"
FT                   /number=2
FT   mRNA            join(<724299..724417,724513..724797,724894..724972,
FT                   725206..725272,725781..725894,725993..>726087)
FT                   /gene="Pc13g03160"
FT                   /locus_tag="PCH_Pc13g03160"
FT   CDS_pept        join(724299..724417,724513..724797,724894..724972,
FT                   725206..725272,725781..725894,725993..726087)
FT                   /gene="Pc13g03160"
FT                   /locus_tag="PCH_Pc13g03160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03160"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91385"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V3"
FT                   /protein_id="CAP91385.1"
FT                   /translation="MGPKIEPGKTAIYGDVAVDHRIREIGTQRQKNESMDRASMYVLRT
FT                   DPLILSFLSHGRVTFNIHTSGATPQRLVSVIKPIDLTLAPFSVFVIVRRCRVVVRAMLA
FT                   AVIELSLPYALELGIRVSWGAFFGDSGFDSGTRHVIKVFSRVSFHGPHPGWVHNKRQTL
FT                   VGEWDTISDHFDSLELNRADGDQSVLMHQDHSPDWLRTHPNAHPVLSDPSEITQPALAG
FT                   KCGVNDPSTCLLPDMVVTPARRLSHSLSAV"
FT   exon            724299..724417
FT                   /gene="Pc13g03160"
FT                   /locus_tag="PCH_Pc13g03160"
FT                   /number=1
FT   intron          724418..724512
FT                   /gene="Pc13g03160"
FT                   /locus_tag="PCH_Pc13g03160"
FT                   /number=1
FT   exon            724513..724797
FT                   /gene="Pc13g03160"
FT                   /locus_tag="PCH_Pc13g03160"
FT                   /number=2
FT   intron          724798..724893
FT                   /gene="Pc13g03160"
FT                   /locus_tag="PCH_Pc13g03160"
FT                   /number=2
FT   exon            724894..724972
FT                   /gene="Pc13g03160"
FT                   /locus_tag="PCH_Pc13g03160"
FT                   /number=3
FT   intron          724973..725205
FT                   /gene="Pc13g03160"
FT                   /locus_tag="PCH_Pc13g03160"
FT                   /number=3
FT   exon            725206..725272
FT                   /gene="Pc13g03160"
FT                   /locus_tag="PCH_Pc13g03160"
FT                   /number=4
FT   intron          725273..725780
FT                   /gene="Pc13g03160"
FT                   /locus_tag="PCH_Pc13g03160"
FT                   /number=4
FT   exon            725781..725894
FT                   /gene="Pc13g03160"
FT                   /locus_tag="PCH_Pc13g03160"
FT                   /number=5
FT   intron          725895..725992
FT                   /gene="Pc13g03160"
FT                   /locus_tag="PCH_Pc13g03160"
FT                   /number=5
FT   exon            725993..726087
FT                   /gene="Pc13g03160"
FT                   /locus_tag="PCH_Pc13g03160"
FT                   /number=6
FT   mRNA            complement(<727497..>728456)
FT                   /gene="Pc13g03170"
FT                   /locus_tag="PCH_Pc13g03170"
FT   CDS_pept        complement(727497..728456)
FT                   /gene="Pc13g03170"
FT                   /locus_tag="PCH_Pc13g03170"
FT                   /note="Title: strong similarity to myb-like DNA binding
FT                   protein flbD - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03170"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91386"
FT                   /db_xref="GOA:B6H1V4"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V4"
FT                   /inference="similar to AA sequence:TREMBL:EN19882.1"
FT                   /inference="protein motif:PFAM:PF00249"
FT                   /inference="protein motif:COGS:COG5147"
FT                   /inference="protein motif:COGS:COG5259"
FT                   /protein_id="CAP91386.1"
FT                   /translation="MPASHRRGPWVPEEDQLLTQLVREQGPNNWVRISQHMHYRSPKQC
FT                   RERFHQNLKPSLNREPISAEEGLMIERMVNEMGKRWAEIARRLGNRSDNAVKNWWNGSM
FT                   NRKKRGLSTPTTSRTYSGRIEAPYTRASAMSPSRSRFSSSSASSSRPSWTESIESAISE
FT                   QYSHSRRESLASSARQLSPIYTLPSINRPIETPLTSPAFSEASHATSCEPPSMVSDHNS
FT                   VCSSSPRTFPSPQLLPLPVDLRSQYEIRRPSVHVVEDSPSYPARSLESLSDMASAQRWM
FT                   GHQPTLASWHQPTDLPKSYIPKPEPVRDTRMGVNNLLN"
FT   exon            complement(727497..728456)
FT                   /gene="Pc13g03170"
FT                   /locus_tag="PCH_Pc13g03170"
FT                   /number=1
FT   mRNA            complement(join(<735512..736138,736196..737085,
FT                   737464..738806,738857..>740544))
FT                   /gene="Pc13g03180"
FT                   /locus_tag="PCH_Pc13g03180"
FT   CDS_pept        complement(join(735512..736138,736196..737085,
FT                   737464..738806,738857..740544))
FT                   /gene="Pc13g03180"
FT                   /locus_tag="PCH_Pc13g03180"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   B12K8.10 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91387"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V5"
FT                   /inference="similar to AA sequence:TREMBL:NCB12K8.1"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /inference="protein motif:COGS:COG3914"
FT                   /inference="protein motif:COGS:COG0457"
FT                   /protein_id="CAP91387.1"
FT                   /translation="MYPTVAPFPSVQPHQRIHYNTDTLNQQMYDANDQLPVHNDPSKPP
FT                   FNTIPRSRIPLPHPVQRLDPRDGSGYSSSTNMAEHTLRRKTPNGTLAAGYDGTLGDTVQ
FT                   PPAPKHILVSPMESGQFIPPQQGMQSENWQPMDQSATKQMNFPPVFKNDPAGNTIQGEV
FT                   VQDVNGTSWVRPVNYPPGVDSMLNQTLPLQPSQRYLLQNGQYVPTVLPATLQSCLGPTA
FT                   SAGTGPFGPYWPDGVYIPYRPAAFRDARFESPSPFTKQMSQPFYDLNQPTFNQAQVPLG
FT                   SHTDSGVAWGQSMPGLPTQDSLMKPLFPPRHSDQLPFHTRANRPLSGHPPPQSLNNEPT
FT                   NWSSRPLHGFQTPGPAVVVNADFKEKVLSEAHGVYVDLLATIHQARRNSVSNAAVDGYP
FT                   RFLKPSIYPKPPRQPGLDFSQAPPPDLTRHNSYPASQYDLQRQKFNAGSLRSNDPTSIP
FT                   RVQTRRPSLNQFAHSRGSDTHMLGLRDTGCPSGVSPFTRARGSLFNEGSPMSNAASALS
FT                   MLSDLCAESRWEWIDGMLLGGCLAYGLGDYHKAVRWYSRIITRDSTHVEAISNLAATML
FT                   ALDRREEASQHWLRAVQLRPSFFEAVEHLIGLLCNSHRGREAVNIIDFVQTSLRHPKDG
FT                   DCFKTDEHASEPESDAESNVSDACMYDKASFEYEDDMGQTQGIEPSSPDAKPLGFASSG
FT                   YAISGAENGRMLALVHAKGNMLYALGDNAGAAAAFEDAVLIAAGRRRHGIQSIIKQIFA
FT                   AFSSGPSNGYPQPEHDSKESILLYPDAALKTAKLVFPASGMPPGLQYVAEGISRNAATS
FT                   TTSNSLLSLAKIYQDGMSSVGSSGATRSSPGVRDILALYYLSLSLQPSPSTANNVGILL
FT                   AGIQNNPPARGSVRSNGETQHHLEIPGVVPGSGISLALAYYNYGLHLDSRHAHLYTNLG
FT                   SLLKDIGQLHAAIKMYEQAVQCDGNFDIALANLANAVKDSGKVNDAIVYYKRAVKVNPE
FT                   FAEAVCGLANALNSVCNWVGRDYPLSKYRRPQLPGALSAPNAPTVLPFHTFTCPLTAKQ
FT                   IRQISQRNGLRISTSTLRLPWLPATVFPPPSPPSPYLRVGYVSSDFNNHPLAHLMQSVF
FT                   GLHDPSRVKSYCYATTPSDKSVHRQQIEKEAPVFYDASGWSVDRLVQQIVGDGIHILVN
FT                   LNGYTRGARNEVFAARPAPIHMSFMGFAGTLGAEWCDYILADELSIPPETLSPGRRKTR
FT                   IGDRLLEEDNGEEVEDWVYGEKIVFTRDTFFCCDHRQSAPDASEKHVSWEEEQARRWRM
FT                   RKELFPKLSDDTIILGNFNQLYKVEPTTFRTWLRILARIPNAVLWLLRFPDTGEQNLRD
FT                   IAKAWAGEETASRIIFTDVAPKNTHIARAKILDLFLDTPECNAHTTATDVLWSGTPLLT
FT                   LPRYKYKMCSRMASSILSSALPSSEAGQRAREELIASSDEDYENKAIRLCLDLQYSGHE
FT                   GYARGRLTDIRQMLFRDRYKNKLFDTARWVRDLETAYEAVWAQWVNGEEGDIWL"
FT   exon            complement(735512..736138)
FT                   /gene="Pc13g03180"
FT                   /locus_tag="PCH_Pc13g03180"
FT                   /number=1
FT   intron          complement(736139..736195)
FT                   /gene="Pc13g03180"
FT                   /locus_tag="PCH_Pc13g03180"
FT                   /number=1
FT   exon            complement(736196..737085)
FT                   /gene="Pc13g03180"
FT                   /locus_tag="PCH_Pc13g03180"
FT                   /number=2
FT   intron          complement(737086..737463)
FT                   /gene="Pc13g03180"
FT                   /locus_tag="PCH_Pc13g03180"
FT                   /number=2
FT   exon            complement(737464..738806)
FT                   /gene="Pc13g03180"
FT                   /locus_tag="PCH_Pc13g03180"
FT                   /number=3
FT   intron          complement(738807..738856)
FT                   /gene="Pc13g03180"
FT                   /locus_tag="PCH_Pc13g03180"
FT                   /number=3
FT   exon            complement(738857..740544)
FT                   /gene="Pc13g03180"
FT                   /locus_tag="PCH_Pc13g03180"
FT                   /number=4
FT   mRNA            complement(join(<743574..743587,743642..744087,
FT                   744169..744202,744261..>744264))
FT                   /gene="Pc13g03190"
FT                   /locus_tag="PCH_Pc13g03190"
FT   CDS_pept        complement(join(743574..743587,743642..744087,
FT                   744169..744202,744261..744264))
FT                   /gene="Pc13g03190"
FT                   /locus_tag="PCH_Pc13g03190"
FT                   /note="Title: strong similarity to ribosomal protein of the
FT                   large subunit L12 - Mus musculus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91388"
FT                   /db_xref="GOA:B6H1V6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V6"
FT                   /inference="similar to AA sequence:PIR:JN0778"
FT                   /inference="protein motif:PFAM:PF03946"
FT                   /inference="protein motif:PFAM:PF00298"
FT                   /inference="protein motif:COGS:COG0080"
FT                   /protein_id="CAP91388.1"
FT                   /translation="MPPKFDPNEVKIIHLRVTGGEVGAQSALAPKIGPLGLSPKKIGED
FT                   IAKNTGDWKGLRVTVRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSI
FT                   PMDEIIEIARIMRTRSMAKELRGVVLEILGTAFSVGCQVDGRSPKDVSDDVKEGEIDIP
FT                   EE"
FT   exon            complement(743574..743587)
FT                   /gene="Pc13g03190"
FT                   /locus_tag="PCH_Pc13g03190"
FT                   /number=1
FT   intron          complement(743588..743641)
FT                   /gene="Pc13g03190"
FT                   /locus_tag="PCH_Pc13g03190"
FT                   /number=1
FT   exon            complement(743642..744087)
FT                   /gene="Pc13g03190"
FT                   /locus_tag="PCH_Pc13g03190"
FT                   /number=2
FT   intron          complement(744088..744168)
FT                   /gene="Pc13g03190"
FT                   /locus_tag="PCH_Pc13g03190"
FT                   /number=2
FT   exon            complement(744169..744202)
FT                   /gene="Pc13g03190"
FT                   /locus_tag="PCH_Pc13g03190"
FT                   /number=3
FT   intron          complement(744203..744260)
FT                   /gene="Pc13g03190"
FT                   /locus_tag="PCH_Pc13g03190"
FT                   /number=3
FT   exon            complement(744261..744264)
FT                   /gene="Pc13g03190"
FT                   /locus_tag="PCH_Pc13g03190"
FT                   /number=4
FT   mRNA            complement(join(<744693..744717,744771..744964,
FT                   745023..746120,746171..746644,746698..746992,
FT                   747052..747182,747241..>747333))
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT   CDS_pept        complement(join(744693..744717,744771..744964,
FT                   745023..746120,746171..746644,746698..746992,
FT                   747052..747182,747241..747333))
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /note="Title: strong similarity to secretory protein like
FT                   protein An01g04730 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03200"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91389"
FT                   /db_xref="GOA:B6H1V7"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR036174"
FT                   /db_xref="InterPro:IPR036175"
FT                   /db_xref="InterPro:IPR036180"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037364"
FT                   /db_xref="InterPro:IPR037550"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V7"
FT                   /inference="protein motif:PFAM:PF04810"
FT                   /inference="protein motif:PFAM:PF04811"
FT                   /inference="protein motif:PFAM:PF04815"
FT                   /inference="protein motif:PFAM:PF00626"
FT                   /inference="protein motif:COGS:COG5047"
FT                   /inference="protein motif:COGS:COG5028"
FT                   /protein_id="CAP91389.1"
FT                   /translation="MDYEALKDQWSDVEDRDGVRLSWNTFPSTRMEASRLVVPIAAVYT
FT                   PLKEKPDAPLLQYEPVTCKQPCRAVLNPYATVDVRARVWICPFCLSRNPLPPHYKDITE
FT                   NTIPPELHPQSTTIEYQLARPAPAPPIFVFVVDTCQEDDSLQAVKDSLIMSLSLLPPNA
FT                   LVGLITFGTMAQVHELGYTECAKSYVFRGNKEYTAKQVQEMLGLAGGMRPGAPQQQPAR
FT                   PPLGPAARFLMPVQQVEFQITNVLEQLQRDPWPVANDKRPLRCTGVALSVAVGLLESSF
FT                   QNAGGRIMAFTSGAATEGPGHVVSPELKEPIRSHHDIDRDNIKYYKKAVKFYDALAKRA
FT                   ANNGHIVDIFAGCLDQVGLLEMKNLSNYTGGHMLLTDSFTSSQFKQSFVRVFDKDAADN
FT                   LLMGFNASLEVLTTKELKVTGLIGHAISLNKKSSSVGETECGIGNTCAWKMCGMDPSSS
FT                   YGIYFEIANQGGPAAVQPGPQRGVIQFLTYYQHSSGHYHLRVTTTARPLSGPAGDPTLA
FT                   QSFDQEAAAVLMARIAVFKAEVDDGPDVLRWVDRMLIRLCSRFADYRKDDPTSFRLEKN
FT                   FTLYPQFMFHLRRSQFLQVFNNSPDETAFYRHVLNHEDTGDSLVMIQPTLDSYSLEQEG
FT                   AQPVLLDSASIQPAHILLLDTFFHILIFHGETIAEWRKAGYHEQEGYENLKMLLDQPKE
FT                   DARDLIADRFPLPRFIVCDAGGSQARFLLSKLNPSTTHTTGGYGGGVSSQTIFTDDVSL
FT                   QTFMDHLMKLAVSGTS"
FT   exon            complement(744693..744717)
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /number=1
FT   intron          complement(744718..744770)
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /number=1
FT   exon            complement(744771..744964)
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /number=2
FT   intron          complement(744965..745022)
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /number=2
FT   exon            complement(745023..746120)
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /number=3
FT   intron          complement(746121..746170)
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /number=3
FT   exon            complement(746171..746644)
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /number=4
FT   intron          complement(746645..746697)
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /number=4
FT   exon            complement(746698..746992)
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /number=5
FT   intron          complement(746993..747051)
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /number=5
FT   exon            complement(747052..747182)
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /number=6
FT   intron          complement(747183..747240)
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /number=6
FT   exon            complement(747241..747333)
FT                   /gene="Pc13g03200"
FT                   /locus_tag="PCH_Pc13g03200"
FT                   /number=7
FT   mRNA            complement(join(<748034..748798,748862..749412,
FT                   749465..>749654))
FT                   /gene="Pc13g03210"
FT                   /locus_tag="PCH_Pc13g03210"
FT   CDS_pept        complement(join(748034..748798,748862..749412,
FT                   749465..749654))
FT                   /gene="Pc13g03210"
FT                   /locus_tag="PCH_Pc13g03210"
FT                   /note="unknown EC_number=2.7.7.-"
FT                   /note="Title: strong similarity to DNA primase large
FT                   subunit Pri2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91390"
FT                   /db_xref="GOA:B6H1V8"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR016558"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V8"
FT                   /inference="similar to AA sequence:PIR:A32497"
FT                   /inference="protein motif:PFAM:PF04104"
FT                   /inference="protein motif:COGS:COG2219"
FT                   /protein_id="CAP91390.1"
FT                   /translation="MIRQDAHRIDPKRRAVIDPKKRQFATPTYKQQDYAHRLNIYEIPP
FT                   TAEITLEQFEQWAIDRLKILAEIEACSYRNKSPAETESYITPLLQKFLPLSSNTSSPSG
FT                   AADPRLKNERQKDHYSHFILRLAFSATEDLRRRFARAETMLFKFRFQKDDTREKRAFID
FT                   SLNLDWEPVGDFEKTEIAKNLLSSTPGLRGLEDETWYKVDWEKVPELVERRSIFLKKGK
FT                   AYVPGREQLSMIVAEFTARLERALELTSRALPRLDEDDRLTPILNHLSKNFGSAESVYS
FT                   EGEGYVDGSPITASSIDQLAQQHFPLCMKSLHVNLRKNNHLKHFGRLQYTLFLKGIGLS
FT                   LEECILFWRQSFKGKTDDEFNSQYKYNIRHAYGEVGGDVNRRGKGYTPYSCQKILGDSN
FT                   PGIGQTHGCPYRHYSVDNLVGFLQATGVSDKEVLRGVREDVGKMRYHIACNRVFEATHK
FT                   NEIKKVKEDGSWSQTDLDTIVHPNTYFKRSYLLKQMSKAPKDA"
FT   exon            complement(748034..748798)
FT                   /gene="Pc13g03210"
FT                   /locus_tag="PCH_Pc13g03210"
FT                   /number=1
FT   intron          complement(748799..748861)
FT                   /gene="Pc13g03210"
FT                   /locus_tag="PCH_Pc13g03210"
FT                   /number=1
FT   exon            complement(748862..749412)
FT                   /gene="Pc13g03210"
FT                   /locus_tag="PCH_Pc13g03210"
FT                   /number=2
FT   intron          complement(749413..749464)
FT                   /gene="Pc13g03210"
FT                   /locus_tag="PCH_Pc13g03210"
FT                   /number=2
FT   exon            complement(749465..749654)
FT                   /gene="Pc13g03210"
FT                   /locus_tag="PCH_Pc13g03210"
FT                   /number=3
FT   mRNA            join(<750313..750484,750554..>751146)
FT                   /gene="Pc13g03220"
FT                   /locus_tag="PCH_Pc13g03220"
FT   CDS_pept        join(750313..750484,750554..751146)
FT                   /gene="Pc13g03220"
FT                   /locus_tag="PCH_Pc13g03220"
FT                   /note="unknown EC_number=2.7.4.3"
FT                   /note="Title: strong similarity to adenylate kinase Adk2
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91391"
FT                   /db_xref="GOA:B6H1V9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028586"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V9"
FT                   /inference="similar to AA sequence:PIR:S23568"
FT                   /inference="protein motif:PFAM:PF05191"
FT                   /inference="protein motif:PFAM:PF00406"
FT                   /inference="protein motif:COGS:COG0563"
FT                   /protein_id="CAP91391.1"
FT                   /translation="MSHTTKQLRKAARIILIGAPGVGKGTQSERLLARFPQLVSISSGD
FT                   LLRENVRRRTPLGLEAEAAMQSGNLVPDSMILNLISDDMKSKGWLLPPRTSSVQPTASS
FT                   SSSSLADTSSSHSIDSSASFILDGFPRTATQAATLDSLVPVNFVVHLITPPSVILARIA
FT                   SRWVHEPSGRVYNTDFHPPKVPGKDDVTGEPLTQREDDSLETWKQRLRKFEETSKSLLE
FT                   HYDRQRCLFRAEGNSSDEISPKLFAEVERRFC"
FT   exon            750313..750484
FT                   /gene="Pc13g03220"
FT                   /locus_tag="PCH_Pc13g03220"
FT                   /number=1
FT   intron          750485..750553
FT                   /gene="Pc13g03220"
FT                   /locus_tag="PCH_Pc13g03220"
FT                   /number=1
FT   exon            750554..751146
FT                   /gene="Pc13g03220"
FT                   /locus_tag="PCH_Pc13g03220"
FT                   /number=2
FT   mRNA            complement(join(<751439..751927,752077..>752466))
FT                   /gene="Pc13g03230"
FT                   /locus_tag="PCH_Pc13g03230"
FT   CDS_pept        complement(join(751439..751927,752077..752466))
FT                   /gene="Pc13g03230"
FT                   /locus_tag="PCH_Pc13g03230"
FT                   /note="Title: weak similarity to thermostable nuclease
FT                   Tnase nuch - Staphylococcus hyicus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91392"
FT                   /db_xref="GOA:B6H1W0"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H1W0"
FT                   /inference="similar to AA sequence:SWISSPROT:NUC_STAHY"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /inference="protein motif:COGS:COG1525"
FT                   /protein_id="CAP91392.1"
FT                   /translation="MRWPPWSSESTNDEQKQTPSSWLSSAANKPSSILDWTAFTELRTI
FT                   IPTVVLTSGILIAVRFHRRYLRRIPDAPSISSSYLRRRSIFGQVTSVGDGDNFRIFHTP
FT                   GGRMAGWGWLPWKKVPTVKKDLKDKTIHIRLAGVDAPELAHFGRPEQPFARDAHTWLTS
FT                   YLSNRRVRALVHRQDQYSRVVASVFVRRAFDFPPFRRRDVSYEMLKRGLATVYEAKIGS
FT                   EFGGDKMEKKYRKAEWWAKKRARGLWKDYRRVGSGWESPREYKNRMGMGDPLPIEKGNG
FT                   KGNGKGKIGQK"
FT   exon            complement(751439..751927)
FT                   /gene="Pc13g03230"
FT                   /locus_tag="PCH_Pc13g03230"
FT                   /number=1
FT   intron          complement(751928..752076)
FT                   /gene="Pc13g03230"
FT                   /locus_tag="PCH_Pc13g03230"
FT                   /number=1
FT   exon            complement(752077..752466)
FT                   /gene="Pc13g03230"
FT                   /locus_tag="PCH_Pc13g03230"
FT                   /number=2
FT   mRNA            <752794..>754293
FT                   /gene="Pc13g03240"
FT                   /locus_tag="PCH_Pc13g03240"
FT   CDS_pept        752794..754293
FT                   /gene="Pc13g03240"
FT                   /locus_tag="PCH_Pc13g03240"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An01g04610 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91393"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W1"
FT                   /inference="protein motif:PFAM:PF00646"
FT                   /protein_id="CAP91393.1"
FT                   /translation="MTRPKESHGVAFLPRELFWMILGYLEPNELVRCRRVSRAWNEAFS
FT                   NPAVLLALLKKLFPWTDEVKSLGTETSVEEQDQGRRLFDQVASRYNYLARGKPRSIQKY
FT                   RLCDDFGSSGDREWYQVQPWESHASHMRRFVDRQFSEALWTFENGLLVYPSADHQCLVL
FT                   MDLETDRQFMVPFIIRGKVVRRVRLQKSLLVVEWAEPKAFHWLNDSDGVHRHFASSFDV
FT                   TRGENQGWSITPRNEWKIMFLGHPLSERDRFFSSHSNTHYVIYIWQPNRSLYTADEDAP
FT                   IESLFVWDISKVSSYRPSLDPTGRLRDDSPGDSPSIVARFGFRDLEFFDIRQRGCPSIQ
FT                   RLEITDDAQAVEITENVSIQPQDEPPEIFGLPEPITTSIPLVGNGPHWRRHFEGVLPPY
FT                   RGNCSMQAESMELNGCIMKDPWFGIISQVTVLEPNLGFCLHFDTWTWVQNQATYLSIQT
FT                   PRSTITCDNWDFVGRGKIAGSEKYLMGENCNRELVVYRFDR"
FT   exon            752794..754293
FT                   /gene="Pc13g03240"
FT                   /locus_tag="PCH_Pc13g03240"
FT                   /number=1
FT   mRNA            complement(join(<755386..755454,755599..755821,
FT                   755901..755934,756042..757206,757275..>757433))
FT                   /gene="Pc13g03250"
FT                   /locus_tag="PCH_Pc13g03250"
FT   CDS_pept        complement(join(755386..755454,755599..755821,
FT                   755901..755934,756042..757206,757275..757433))
FT                   /gene="Pc13g03250"
FT                   /locus_tag="PCH_Pc13g03250"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1497_2.tfa_510wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91394"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W2"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /inference="protein motif:COGS:COG2214"
FT                   /inference="protein motif:COGS:COG0484"
FT                   /protein_id="CAP91394.1"
FT                   /translation="MSTVTVATDAYAILGVERDAKLPDINIAYKRLALKLHPDKAGNSP
FT                   ATVERFRKIQDAVEVLRDEDRRRLLDEALKKKTKRHLDPEDDIPARVFKSNYNRSSKRE
FT                   HHTHDFKWSNPFAEPAWHHRQHTFSYYYSYGTSVHMDPESAESKAKRAQFEAENVQWEN
FT                   EWLGTDPEVQKARAELRKENMRARMKRDLADMAKGQDEDTKYADFDHVVEGVLDELNFG
FT                   HEDFVHVLPEENIKTCNPADTFDTFSYEYAKKSRSGADDPIHSDRASNPQSATGSDSSF
FT                   EFTTSSDSTSYTHSANGHSNFKSTVEDFESTTDNSESTTDDSNSDAEKLINSYMVGHDS
FT                   LLPVVSFLKQKLADPHGRYTLDDLGGELNGIMLEAYCGWLEEVRLSVPNASPVTVRNDP
FT                   KFCSHHGLWYKEFGRPVCNVCNLWMPTFILTCPGCGLNACVRYFPLVWISRCCRKKKKE
FT                   RGKAASITVDSAFAHSIDFNESRSRYHFVLMHRYSDLGLTSNSHRLLILSYVPSPLTGW
FT                   TPVFVLYLARIQDPDCHYDADVVELNPRKKYN"
FT   exon            complement(755386..755454)
FT                   /gene="Pc13g03250"
FT                   /locus_tag="PCH_Pc13g03250"
FT                   /number=1
FT   intron          complement(755455..755598)
FT                   /gene="Pc13g03250"
FT                   /locus_tag="PCH_Pc13g03250"
FT                   /number=1
FT   exon            complement(755599..755821)
FT                   /gene="Pc13g03250"
FT                   /locus_tag="PCH_Pc13g03250"
FT                   /number=2
FT   intron          complement(755822..755900)
FT                   /gene="Pc13g03250"
FT                   /locus_tag="PCH_Pc13g03250"
FT                   /number=2
FT   exon            complement(755901..755934)
FT                   /gene="Pc13g03250"
FT                   /locus_tag="PCH_Pc13g03250"
FT                   /number=3
FT   intron          complement(755935..756041)
FT                   /gene="Pc13g03250"
FT                   /locus_tag="PCH_Pc13g03250"
FT                   /number=3
FT   exon            complement(756042..757206)
FT                   /gene="Pc13g03250"
FT                   /locus_tag="PCH_Pc13g03250"
FT                   /number=4
FT   intron          complement(757207..757274)
FT                   /gene="Pc13g03250"
FT                   /locus_tag="PCH_Pc13g03250"
FT                   /number=4
FT   exon            complement(757275..757433)
FT                   /gene="Pc13g03250"
FT                   /locus_tag="PCH_Pc13g03250"
FT                   /number=5
FT   mRNA            complement(join(<758380..758473,758528..758696,
FT                   758753..759327,759468..>759523))
FT                   /gene="Pc13g03260"
FT                   /locus_tag="PCH_Pc13g03260"
FT   CDS_pept        complement(join(758380..758473,758528..758696,
FT                   758753..759327,759468..759523))
FT                   /gene="Pc13g03260"
FT                   /locus_tag="PCH_Pc13g03260"
FT                   /EC_number="3.6.3.14"
FT                   /note="Title: strong similarity to gamma chain precursor of
FT                   the H+-transporting ATP synthase Atp3 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91395"
FT                   /db_xref="GOA:B6H1W3"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W3"
FT                   /inference="similar to AA sequence:PIR:S55891"
FT                   /inference="protein motif:PFAM:PF00231"
FT                   /inference="protein motif:COGS:COG0224"
FT                   /protein_id="CAP91395.1"
FT                   /translation="MFSRAVRPALRAGGAAVARPAPANAATFATLREIEGRLKSIKNIE
FT                   KITNTMKIVASTRLTRAQKAMDESRVYGKTSNTVFEQAETKPLEDKKVLLVVASSDKGL
FT                   CGGIHSGLSKATRRILADTPNADVAILGEKAKATLSRLAPEHIVLSFANVCKDIPTFAD
FT                   AQAIADQIALLPEDYASVRIIYNSFVNAQSYEPVTIEAYSEEAITQSANISSYEVDDEV
FT                   LTSLREYALANNLYWAMAEGHACEISARRNAMENASKNAGEMINKFQILYNRQRQATIT
FT                   GELVEIITGATASEDM"
FT   exon            complement(758380..758473)
FT                   /gene="Pc13g03260"
FT                   /locus_tag="PCH_Pc13g03260"
FT                   /number=1
FT   mat_peptide     complement(join(758383..758473,758528..758696,
FT                   758753..759308))
FT                   /gene="Pc13g03260"
FT                   /locus_tag="PCH_Pc13g03260"
FT   intron          complement(758474..758527)
FT                   /gene="Pc13g03260"
FT                   /locus_tag="PCH_Pc13g03260"
FT                   /number=1
FT   exon            complement(758528..758696)
FT                   /gene="Pc13g03260"
FT                   /locus_tag="PCH_Pc13g03260"
FT                   /number=2
FT   intron          complement(758697..758752)
FT                   /gene="Pc13g03260"
FT                   /locus_tag="PCH_Pc13g03260"
FT                   /number=2
FT   exon            complement(758753..759327)
FT                   /gene="Pc13g03260"
FT                   /locus_tag="PCH_Pc13g03260"
FT                   /number=3
FT   sig_peptide     complement(join(759309..759327,759468..759523))
FT                   /gene="Pc13g03260"
FT                   /locus_tag="PCH_Pc13g03260"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(759328..759467)
FT                   /gene="Pc13g03260"
FT                   /locus_tag="PCH_Pc13g03260"
FT                   /number=3
FT   exon            complement(759468..759523)
FT                   /gene="Pc13g03260"
FT                   /locus_tag="PCH_Pc13g03260"
FT                   /number=4
FT   mRNA            join(<760100..760154,760379..760605,760692..762176,
FT                   762227..762469,762535..762984,763040..>763174)
FT                   /gene="Pc13g03270"
FT                   /locus_tag="PCH_Pc13g03270"
FT   CDS_pept        join(760100..760154,760379..760605,760692..762176,
FT                   762227..762469,762535..762984,763040..763174)
FT                   /gene="Pc13g03270"
FT                   /locus_tag="PCH_Pc13g03270"
FT                   /note="unknown EC_number=5.99.1.2"
FT                   /note="Title: strong similarity to topoisomerase I CaTOP1
FT                   -Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91396"
FT                   /db_xref="GOA:B6H1W4"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="InterPro:IPR018521"
FT                   /db_xref="InterPro:IPR025834"
FT                   /db_xref="InterPro:IPR036202"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W4"
FT                   /inference="similar to AA sequence:TREMBL:CAU41342.1"
FT                   /inference="protein motif:PFAM:PF02919"
FT                   /inference="protein motif:PFAM:PF01028"
FT                   /inference="protein motif:COGS:COG3569"
FT                   /inference="protein motif:COGS:COG0457"
FT                   /inference="protein motif:COGS:COG0532"
FT                   /inference="protein motif:COGS:COG3061"
FT                   /inference="protein motif:COGS:COG3468"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP91396.1"
FT                   /translation="MSSSEDDAPLMRANGRVKVSPKSPEVVKMADSSPATNGHVDPGIS
FT                   IRFGPVEDKDVKMEDGEDALGAGKRKSRTSVGEKKSYAEAESSEEDEPLSKRRRTSVKH
FT                   EDPETDDDVPLARNGRKLPKPAETSIGDESDSDVPIERKLAVQKKKIEQTAEAKPSRKP
FT                   AAPKKEAKPAAAKKQTNGVKKEPAASKAAPKKGKAKVKEESQDAEEKDEEEEEEYRWWE
FT                   DQSKGDGTIKWTTLEHNGVVFPPEYELLPQNVKMKYDGIPITLAPEAEEVASFFGTMLN
FT                   STHNVENPVFQKNFFSDFKDVIKKSGGAKDSKGNKVDIKEFAKCDFKPIFEFYDAQREE
FT                   KRHLPPAEKKAAKALKDEQEAPYQYCIWDGRKQKVGNFRVEPPSLFRGRGEHPKTGRVK
FT                   TRVQPEQITINIGKDAKVPPPPPGHKWKEVKHDQEGTWLAMWQENINGNYKYVMLAANS
FT                   DVKGQSDFKKFEKARELKKHIEKIRKDYQKNLKHDMMVERQKATAVYLIDQFALRAGNE
FT                   KGEDEAETVGCCSLKYENVTLKPPNTVVFDFLGKDSIRFYDEVQVDLQVFKNLKIFKKA
FT                   PKKNGDEIFDRLTTSALNKHLANYMPGLTAKVFRTYNASYTMGCVLNEMNASGGTIAEK
FT                   VKAYNDANRKVAILCNHKRTVTAGHANAMEKMGERIKGLRYQKWRLKQQMLDLDPTLKK
FT                   KKGAAFFEIDEDLDKEWIEEHQAFLIEEQRNKINKKFEKDNEKRVADGEKEMKVSELEE
FT                   RLQAVKELEKKFKKENKTGKVEAEARGATVEKLENSINKIDQRVETMSVQAQDKEDNKE
FT                   VALGTSKINYIDPRLTVVFSKKYDVPIEKFFSKALREKFEWAIKSVDEDWEF"
FT   exon            760100..760154
FT                   /gene="Pc13g03270"
FT                   /locus_tag="PCH_Pc13g03270"
FT                   /number=1
FT   intron          760155..760378
FT                   /gene="Pc13g03270"
FT                   /locus_tag="PCH_Pc13g03270"
FT                   /number=1
FT   exon            760379..760605
FT                   /gene="Pc13g03270"
FT                   /locus_tag="PCH_Pc13g03270"
FT                   /number=2
FT   intron          760606..760691
FT                   /gene="Pc13g03270"
FT                   /locus_tag="PCH_Pc13g03270"
FT                   /number=2
FT   exon            760692..762176
FT                   /gene="Pc13g03270"
FT                   /locus_tag="PCH_Pc13g03270"
FT                   /number=3
FT   intron          762177..762226
FT                   /gene="Pc13g03270"
FT                   /locus_tag="PCH_Pc13g03270"
FT                   /number=3
FT   exon            762227..762469
FT                   /gene="Pc13g03270"
FT                   /locus_tag="PCH_Pc13g03270"
FT                   /number=4
FT   intron          762470..762534
FT                   /gene="Pc13g03270"
FT                   /locus_tag="PCH_Pc13g03270"
FT                   /number=4
FT   exon            762535..762984
FT                   /gene="Pc13g03270"
FT                   /locus_tag="PCH_Pc13g03270"
FT                   /number=5
FT   intron          762985..763039
FT                   /gene="Pc13g03270"
FT                   /locus_tag="PCH_Pc13g03270"
FT                   /number=5
FT   exon            763040..763174
FT                   /gene="Pc13g03270"
FT                   /locus_tag="PCH_Pc13g03270"
FT                   /number=6
FT   mRNA            complement(join(<764418..765334,765405..765566,
FT                   765624..>765669))
FT                   /gene="Pc13g03280"
FT                   /locus_tag="PCH_Pc13g03280"
FT   CDS_pept        complement(join(764418..765334,765405..765566,
FT                   765624..765669))
FT                   /gene="Pc13g03280"
FT                   /locus_tag="PCH_Pc13g03280"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1497_2.tfa_480wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91397"
FT                   /db_xref="GOA:B6H1W5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W5"
FT                   /inference="protein motif:COGS:COG1087"
FT                   /inference="protein motif:COGS:COG1088"
FT                   /protein_id="CAP91397.1"
FT                   /translation="MADAKKPAVLIVGGLGFIGRHLALYIHENNLASEVRLVDKVLPQL
FT                   AWLAPEFEEACSKDKFVQADASREQHFPRIFDRANGEQFDYVINCGGESRHSQPDDVYE
FT                   VRSYALSVALGKEIARRGIPAFIETSTAHVYKGGSTPRKETDKLAPWHKLAAWKLKAAE
FT                   ELLKVPNLQYCALRLPHVYGAYDPGYFATGICLSAVHVDLKQDLEFLHTKDLKINTLHV
FT                   KDAASALFEAAKWRAAKGFIDPKEGVVTFNVVDHNDTKQEHVANALTEVFGLKVSFIGS
FT                   LASQLAKLNLDDVLDDMNEVGLQTWAELVERANITRPGPISPFLERDIVRDQDMSIDGS
FT                   KFENETGWKPSYPNFGADSIREIVDSYKRMGWWP"
FT   exon            complement(764418..765334)
FT                   /gene="Pc13g03280"
FT                   /locus_tag="PCH_Pc13g03280"
FT                   /number=1
FT   mat_peptide     complement(join(764421..765334,765405..765543))
FT                   /gene="Pc13g03280"
FT                   /locus_tag="PCH_Pc13g03280"
FT   intron          complement(765335..765404)
FT                   /gene="Pc13g03280"
FT                   /locus_tag="PCH_Pc13g03280"
FT                   /number=1
FT   exon            complement(765405..765566)
FT                   /gene="Pc13g03280"
FT                   /locus_tag="PCH_Pc13g03280"
FT                   /number=2
FT   sig_peptide     complement(join(765544..765566,765624..765669))
FT                   /gene="Pc13g03280"
FT                   /locus_tag="PCH_Pc13g03280"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(765567..765623)
FT                   /gene="Pc13g03280"
FT                   /locus_tag="PCH_Pc13g03280"
FT                   /number=2
FT   exon            complement(765624..765669)
FT                   /gene="Pc13g03280"
FT                   /locus_tag="PCH_Pc13g03280"
FT                   /number=3
FT   mRNA            join(<766436..766624,766744..766835,766931..767018,
FT                   767108..767185,767291..767461,767565..>767630)
FT                   /gene="Pc13g03290"
FT                   /locus_tag="PCH_Pc13g03290"
FT   CDS_pept        join(766436..766624,766744..766835,766931..767018,
FT                   767108..767185,767291..767461,767565..767630)
FT                   /gene="Pc13g03290"
FT                   /locus_tag="PCH_Pc13g03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03290"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91398"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W6"
FT                   /protein_id="CAP91398.1"
FT                   /translation="MGYSEGSGCKDPRTGLQALHPIQKDGEGWDKGGALVGGPRAILRA
FT                   RHTIERRGNRQKTMSGLSSLVISGTFKSPYTDGYISSISSPGLYEPGGRMSGCGYSKAM
FT                   QPLSWSAIYQGCRHDQANFLQAGLYSPIFHFSLMGSGKVAVDGPWSHSSGGWLDWLNNE
FT                   QTIGTDTRGNIHWVTEGYLCKKNEKLAQRARVSASGGSGELRKSSTGLHPDPIRFPVYW
FT                   TIGDM"
FT   exon            766436..766624
FT                   /gene="Pc13g03290"
FT                   /locus_tag="PCH_Pc13g03290"
FT                   /number=1
FT   intron          766625..766743
FT                   /gene="Pc13g03290"
FT                   /locus_tag="PCH_Pc13g03290"
FT                   /number=1
FT   exon            766744..766835
FT                   /gene="Pc13g03290"
FT                   /locus_tag="PCH_Pc13g03290"
FT                   /number=2
FT   intron          766836..766930
FT                   /gene="Pc13g03290"
FT                   /locus_tag="PCH_Pc13g03290"
FT                   /number=2
FT   exon            766931..767018
FT                   /gene="Pc13g03290"
FT                   /locus_tag="PCH_Pc13g03290"
FT                   /number=3
FT   intron          767019..767107
FT                   /gene="Pc13g03290"
FT                   /locus_tag="PCH_Pc13g03290"
FT                   /number=3
FT   exon            767108..767185
FT                   /gene="Pc13g03290"
FT                   /locus_tag="PCH_Pc13g03290"
FT                   /number=4
FT   intron          767186..767290
FT                   /gene="Pc13g03290"
FT                   /locus_tag="PCH_Pc13g03290"
FT                   /number=4
FT   exon            767291..767461
FT                   /gene="Pc13g03290"
FT                   /locus_tag="PCH_Pc13g03290"
FT                   /number=5
FT   intron          767462..767564
FT                   /gene="Pc13g03290"
FT                   /locus_tag="PCH_Pc13g03290"
FT                   /number=5
FT   exon            767565..767630
FT                   /gene="Pc13g03290"
FT                   /locus_tag="PCH_Pc13g03290"
FT                   /number=6
FT   mRNA            complement(join(<768198..769323,769376..769661,
FT                   769716..>769875))
FT                   /gene="Pc13g03300"
FT                   /locus_tag="PCH_Pc13g03300"
FT   CDS_pept        complement(join(768198..769323,769376..769661,
FT                   769716..769875))
FT                   /gene="Pc13g03300"
FT                   /locus_tag="PCH_Pc13g03300"
FT                   /note="Title: strong similarity to dicarboxylic amino acid
FT                   permease Dip5 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03300"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91399"
FT                   /db_xref="GOA:B6H1W7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W7"
FT                   /inference="similar to AA sequence:PIR:S65298"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /inference="protein motif:COGS:COG0833"
FT                   /protein_id="CAP91399.1"
FT                   /translation="MAIEDDEKNDQHGTDIASTVSADIVPIDMSEHGTMKRALKPRHSQ
FT                   MIALGGCVGTGLFVGTGATLALGGPAFLLTAFIVLIFLVYIIVTAIVEMVAYLPVGGAS
FT                   LSYYGTRYVSKSLGFAMGWLYVYSLGILVPYEITAGALVIDYWDSPVNVAVWITVFMVL
FT                   IVGLNLLPVEYYGESEFWFSTIKVFTIIGLLVLSIVLFWGGGPKQSGILGFHYWKDPGP
FT                   INTWLADGAGGRLVAFVRTLVLSAFPFTFSPELLIATSGEMQNPRKDLGKAANRFVIRL
FT                   IVFYLGTVLAIGVICPSNDEDLVSSGSNAKASAFVVGIKHAGIHGLGSVVNAAILTTAW
FT                   SAGNAYLYMSSRALYALAISGQAPKIFLRCTNRGVPYAAVLACSSFGVLAYLNCASSSS
FT                   TVFTWFVNITNTSAFISWVCCCIVYLRFRSAYNTQGKPELPYRSWTQPYGAWFALFFFL
FT                   LLTLINGFNVFFPGQLSASSFFTAYIGIPAFMVTYAGHKLLKGRSDPLWITSDEINIWD
FT                   GLENIH"
FT   exon            complement(768198..769323)
FT                   /gene="Pc13g03300"
FT                   /locus_tag="PCH_Pc13g03300"
FT                   /number=1
FT   intron          complement(769324..769375)
FT                   /gene="Pc13g03300"
FT                   /locus_tag="PCH_Pc13g03300"
FT                   /number=1
FT   exon            complement(769376..769661)
FT                   /gene="Pc13g03300"
FT                   /locus_tag="PCH_Pc13g03300"
FT                   /number=2
FT   intron          complement(769662..769715)
FT                   /gene="Pc13g03300"
FT                   /locus_tag="PCH_Pc13g03300"
FT                   /number=2
FT   exon            complement(769716..769875)
FT                   /gene="Pc13g03300"
FT                   /locus_tag="PCH_Pc13g03300"
FT                   /number=3
FT   mRNA            <770662..>772047
FT                   /gene="Pc13g03310"
FT                   /locus_tag="PCH_Pc13g03310"
FT   CDS_pept        770662..772047
FT                   /gene="Pc13g03310"
FT                   /locus_tag="PCH_Pc13g03310"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_25_scaffold_2.tfa_490wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03310"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91400"
FT                   /db_xref="GOA:B6H1W8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W8"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /inference="protein motif:COGS:COG0006"
FT                   /protein_id="CAP91400.1"
FT                   /translation="MAILKKPQPFKKALHFSEKEFEERQQRALKLMKQEGLDGFLITKQ
FT                   ETLYYLTGYDTFGYVFFQAMYFHKDGSKKLVTRMPDLRQALYTSVLTYNDIMIRSDDAD
FT                   SNPVSLVPLVLKEFGINSSSKRIGYEPNSATLTLEVGKLLEESVAGLCTLVNHSNLFTR
FT                   ELRIVKSPAELRKIRKAAYLADFALIRTLKLAKPGAYEGDLWREIVGTVYEGGGDDPAN
FT                   ENILVSGNKAVLTRYSAGKSTIERQLTLEHAGVYKHYHACLMRTVHIGGVTALARRMFE
FT                   VNILQMEAAMAALKPGCAIEEVFEAYARVADENGFKDQRFNACGYSLGATFAPTWMDFP
FT                   MFVRGQKVIAQPGMVFFIHIILMDKATDTASSIGQTVEVTQDGCVSLSKLPFHITRKQT
FT                   IAAWKKVKKEDYGFTAEEEDKGENLRDVELSDGDVDAEDYDVEYDFSEYQPSAPPGDPT
FT                   QLV"
FT   exon            770662..772047
FT                   /gene="Pc13g03310"
FT                   /locus_tag="PCH_Pc13g03310"
FT                   /number=1
FT   mRNA            complement(<772327..>773511)
FT                   /gene="Pc13g03320"
FT                   /locus_tag="PCH_Pc13g03320"
FT   CDS_pept        complement(772327..773511)
FT                   /gene="Pc13g03320"
FT                   /locus_tag="PCH_Pc13g03320"
FT                   /EC_number="4.3.1.19"
FT                   /note="unknown EC_number=3.5.1.16"
FT                   /note="Title: strong similarity to acetylornithine
FT                   deacetylase argE - Myxococcus xanthus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03320"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91401"
FT                   /db_xref="GOA:B6H1W9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W9"
FT                   /inference="similar to AA sequence:TREMBL:AF055904.2"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /inference="protein motif:COGS:COG0624"
FT                   /inference="protein motif:COGS:COG1473"
FT                   /protein_id="CAP91401.1"
FT                   /translation="MDGLQYTTKHDVTIDDVVSLTQTMVQIDSSTPGSGSNTAGETTVA
FT                   QYICAWLQHRNIECHWIEETPGRPSVIGVVRGSGDGKSLMFNGHTDTVTLQGYDGDPLS
FT                   GHIANGRLYGRGSADMKSGMAAAMIATASAAKLNLRGDVILAAVADEECDSIGTEQVLA
FT                   AGWRADAAIVAEPTDFAIINAHKGYVLLEVDIHGIAAHGSRPDLGVDAICKAGYFLVEL
FT                   DRYSQSLPQRSPTGVEIDAPNVHVGIIRGGAEINSYPAKCTISIERRTVAGETATSVEN
FT                   ELRPILQKLASTVSDFTFELRTTCYRPPYSIASDHPFVNLVVEHAVKSTGMAPPIKSET
FT                   YWTDMALLSEAGIPGVIWGPKGCGLHSKEESVEVESIRQLADSFIAIAASYCQG"
FT   exon            complement(772327..773511)
FT                   /gene="Pc13g03320"
FT                   /locus_tag="PCH_Pc13g03320"
FT                   /number=1
FT   mRNA            join(<773968..774038,774091..775291,775343..>776188)
FT                   /gene="Pc13g03330"
FT                   /locus_tag="PCH_Pc13g03330"
FT   CDS_pept        join(773968..774038,774091..775291,775343..776188)
FT                   /gene="Pc13g03330"
FT                   /locus_tag="PCH_Pc13g03330"
FT                   /note="Title: similarity to transcription factor Arg81
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03330"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91402"
FT                   /db_xref="GOA:B6H1X0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X0"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /protein_id="CAP91402.1"
FT                   /translation="MAKLVWDLDGRQRTKPVKSISYTGCWTCRKRRIKCDERPIGCKTC
FT                   EQAKLTCAGYDVRLVWNAGPNTSRRRIRSGPYGNLRVAYPCAGEADTDGRGLDRGSCAP
FT                   MTDSEVTRALTTVEKSATCPAVTTTVGPFSVFQTQSASTRDIDHPSSPNPGDTAMGGSE
FT                   ETNQPTTNSPIIPMVDSPYQTTSELPQFPESTVDTTVPPSDVCVGGDQAETPIGTLATE
FT                   SPDDAPVVNTRTSTTTSLSNLPDYLCPTSHEIATTPRGVDVTVSQSPGWMERNDHSPWE
FT                   SAPGDLGVILFENDMALAIMEDTTAAMLMHHYMQHVVHLMQPVSHPRNPWKTVYLPLAL
FT                   HGSSQLDLPKSWNQLHSASVAVFHGVLSIAAVNLQSMEADQESLERLACHHKQRALVAL
FT                   QSTLATKSTPYKGIMAAILSLVSADIMDGGMSDHWIHLEAGIKLQASRHYAMLVSHETC
FT                   LLNNICKMLHLFGQTTLPHRTPKPWPGYDYIPRGADFYSLEPSIEFLYGITISIAGAIF
FT                   RIYRLSQYVAYYRSQGQEYPETLLEACETLADDLGSYTITSELFSTIDSSEAEAYMVDI
FT                   ARAQAKAFHNAALIYYYRSIQECARSCLHQEQQAVLAAMNEAEDLKVSFGKHTSFPAPI
FT                   TWPAFVASCEAVGEERRSWDKWWRRLEVYGMRNYHRQYATVRSIWGKLGEDETRDWREV
FT                   LDTVGLRILPV"
FT   exon            773968..774038
FT                   /gene="Pc13g03330"
FT                   /locus_tag="PCH_Pc13g03330"
FT                   /number=1
FT   intron          774039..774090
FT                   /gene="Pc13g03330"
FT                   /locus_tag="PCH_Pc13g03330"
FT                   /number=1
FT   exon            774091..775291
FT                   /gene="Pc13g03330"
FT                   /locus_tag="PCH_Pc13g03330"
FT                   /number=2
FT   intron          775292..775342
FT                   /gene="Pc13g03330"
FT                   /locus_tag="PCH_Pc13g03330"
FT                   /number=2
FT   exon            775343..776188
FT                   /gene="Pc13g03330"
FT                   /locus_tag="PCH_Pc13g03330"
FT                   /number=3
FT   mRNA            complement(join(<776417..776562,776623..777867,
FT                   777940..778027,778085..>778108))
FT                   /gene="Pc13g03340"
FT                   /locus_tag="PCH_Pc13g03340"
FT   CDS_pept        complement(join(776417..776562,776623..777867,
FT                   777940..778027,778085..778108))
FT                   /gene="Pc13g03340"
FT                   /locus_tag="PCH_Pc13g03340"
FT                   /note="unknown EC_number=1.2.1.16"
FT                   /note="Title: strong similarity to succinate-semialdehyde
FT                   dehydrogenase NAD(P)+ gabD - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91403"
FT                   /db_xref="GOA:B6H1X1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X1"
FT                   /inference="similar to AA sequence:PIR:F65045"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /inference="protein motif:COGS:COG1012"
FT                   /protein_id="CAP91403.1"
FT                   /translation="MSRALPFTLDTPSLLHKASLLDGNWVQSKSGQRFDVEDPGTGKAF
FT                   ASCPTNTVADVDAYIKSAQRSFLTYRATNPRERAKMLLNWHSLVTRSKNDIATLVVYET
FT                   GKPMAEALGEVEYALGFAWWFAGEAERIRGSIAQPSISDRRNLVIKQPIGVCVALVPWN
FT                   FPVAMIIRKAAAALAAGCTIVIKPSPETPLSVLALADLALQAGFPPGAMNVLSTDSAHT
FT                   PSVSEALCKHQLVRKVTFTGSTTVGQLIARHCSEGLKKVTLELGGNCPFIVFDDGDLDQ
FT                   ALAALMVLKWRTAGQACTHANRVYVQSGVYDRFLSMLVDATRRLRVGHGADPETTIGAL
FT                   TTKSGLVKLERHIADAVAKGGKIVLGGRPLEHLGGNFFQPTIISGMSSDMLTTQEEVFG
FT                   PLLGLYQFETEEEAVRLANDTNMGLASYFFTKDVSRTWRLLESLEAGMIGMNTGNSSAA
FT                   ESPFGGIKASGYGKEAGKEVAIEEYLIAKTGTLTVGAIASKL"
FT   exon            complement(776417..776562)
FT                   /gene="Pc13g03340"
FT                   /locus_tag="PCH_Pc13g03340"
FT                   /number=1
FT   intron          complement(776563..776622)
FT                   /gene="Pc13g03340"
FT                   /locus_tag="PCH_Pc13g03340"
FT                   /number=1
FT   exon            complement(776623..777867)
FT                   /gene="Pc13g03340"
FT                   /locus_tag="PCH_Pc13g03340"
FT                   /number=2
FT   intron          complement(777868..777939)
FT                   /gene="Pc13g03340"
FT                   /locus_tag="PCH_Pc13g03340"
FT                   /number=2
FT   exon            complement(777940..778027)
FT                   /gene="Pc13g03340"
FT                   /locus_tag="PCH_Pc13g03340"
FT                   /number=3
FT   intron          complement(778028..778084)
FT                   /gene="Pc13g03340"
FT                   /locus_tag="PCH_Pc13g03340"
FT                   /number=3
FT   exon            complement(778085..778108)
FT                   /gene="Pc13g03340"
FT                   /locus_tag="PCH_Pc13g03340"
FT                   /number=4
FT   mRNA            join(<778711..778752,778832..779263,779315..>780871)
FT                   /gene="Pc13g03350"
FT                   /locus_tag="PCH_Pc13g03350"
FT   CDS_pept        join(778711..778752,778832..779263,779315..780871)
FT                   /gene="Pc13g03350"
FT                   /locus_tag="PCH_Pc13g03350"
FT                   /note="unknown EC_number=1.4.3.6"
FT                   /note="Title: strong similarity to copper amine oxidase
FT                   AO-I - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91404"
FT                   /db_xref="GOA:B6H1Y2"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015800"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="InterPro:IPR036460"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y2"
FT                   /inference="similar to AA sequence:TREMBL:ANU31869.1"
FT                   /inference="protein motif:PFAM:PF02727"
FT                   /inference="protein motif:PFAM:PF01179"
FT                   /inference="protein motif:COGS:COG3733"
FT                   /protein_id="CAP91404.1"
FT                   /translation="MHPFDPLSPAEISEVTAIVRTHFPGQLPVFRFITLKEPAKLEMLP
FT                   FLENEHRGLPNITRPARTSRVQVVMRSDKGENQLIELLVDLDNKRVIKNEHLVGRHSYI
FT                   DADYMRLVESACLADPKVQDEIKKLKLPANSTVIVEPWAYGTDGINDMSERISMCWFYL
FT                   RLLDNPDANYYAYPLDLCAEVSEELKVTKIYYLPSSQEERISDQARPFDINRIHSTVDS
FT                   EYHPSLRPPPRNTTKPYQVVQPEGPSFSTQGNRISWEKWTMRVGFNYREGLTLHDIRYD
FT                   GRSLFYRLSLAEMFVPYGDPRAPYPRKAAFDLGSDGAGVNANNLRLGCDCLGLIKYFDA
FT                   WHNTSSGEPLKLPNVVCCHEQDDGILWKHTNFRTQNAVVARARILVLQTIITVSNYEYI
FT                   FAFQFSQDASIHYEVRATGILSTCPINIGDKVPYGTIVAPGVLAPYHQHLFCLRMDPWV
FT                   DGNVQNTLQVEESHAMPISDTNPFGVGYTTSSNNITEETGLDLDISKNRTFKIINEHSI
FT                   NPITGTPVGFKLLPSYSQMLLAHPDSYHAHRSEYAAHAVWVTRYDDEEMFPAGRHTMQS
FT                   TGGEGIHSAITRRKNDGSKTSVRNEDIVLWHTFGSTHNPRIEDWPVMPMDRMVVGIKPV
FT                   NFFTGNPGLDVPPSTQERNRSVLVNGDSDSLKSSSDTCCRL"
FT   exon            778711..778752
FT                   /gene="Pc13g03350"
FT                   /locus_tag="PCH_Pc13g03350"
FT                   /number=1
FT   intron          778753..778831
FT                   /gene="Pc13g03350"
FT                   /locus_tag="PCH_Pc13g03350"
FT                   /number=1
FT   exon            778832..779263
FT                   /gene="Pc13g03350"
FT                   /locus_tag="PCH_Pc13g03350"
FT                   /number=2
FT   intron          779264..779314
FT                   /gene="Pc13g03350"
FT                   /locus_tag="PCH_Pc13g03350"
FT                   /number=2
FT   exon            779315..780871
FT                   /gene="Pc13g03350"
FT                   /locus_tag="PCH_Pc13g03350"
FT                   /number=3
FT   mRNA            complement(join(<781313..782156,782208..782335,
FT                   782413..782513,782581..>782683))
FT                   /gene="Pc13g03360"
FT                   /locus_tag="PCH_Pc13g03360"
FT   CDS_pept        complement(join(781313..782156,782208..782335,
FT                   782413..782513,782581..782683))
FT                   /gene="Pc13g03360"
FT                   /locus_tag="PCH_Pc13g03360"
FT                   /note="Title: similarity to hypothetical protein F10M23.90
FT                   - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03360"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91405"
FT                   /db_xref="InterPro:IPR023175"
FT                   /db_xref="InterPro:IPR039431"
FT                   /db_xref="InterPro:IPR041212"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y3"
FT                   /inference="similar to AA sequence:PIR:T04798"
FT                   /inference="protein motif:PFAM:PF04652"
FT                   /protein_id="CAP91405.1"
FT                   /translation="MASNIPAGLRSADIGRFAIRATQIEKAKPVVAYWCNFHIVNQIIE
FT                   RGLHNTDDEIKLYTTNLVDKLEQFKLENPDNDTVTDTVAASAYVEQFGLEVFSRAEAAM
FT                   DANKVTKQTADTFQAAATFLELCSIWGPLDPEIAGRIKFAKFHAVRIVKAFKAGEDPNA
FT                   TNPAPKQEEEPVDDPDVQAFDESVAEQASKPRQASIEEVPDESDRFARELARKSTVDES
FT                   LHPSRTSSTPRPPPEIPSVPRNAPGAPPQSMDVDESNTGGLNLPSTPAAIGASSSVPKL
FT                   PDTPTAFQSFPPPSEGPSVSTPDPASFYDTPGASAPIPPPTAPAFVPTPAANVPVAPSP
FT                   YVPPQPSHGLDDNTVQMAQKHARWAVSALTFDDVDTAIKELRSSLKCLGAS"
FT   exon            complement(781313..782156)
FT                   /gene="Pc13g03360"
FT                   /locus_tag="PCH_Pc13g03360"
FT                   /number=1
FT   intron          complement(782157..782207)
FT                   /gene="Pc13g03360"
FT                   /locus_tag="PCH_Pc13g03360"
FT                   /number=1
FT   exon            complement(782208..782335)
FT                   /gene="Pc13g03360"
FT                   /locus_tag="PCH_Pc13g03360"
FT                   /number=2
FT   intron          complement(782336..782412)
FT                   /gene="Pc13g03360"
FT                   /locus_tag="PCH_Pc13g03360"
FT                   /number=2
FT   exon            complement(782413..782513)
FT                   /gene="Pc13g03360"
FT                   /locus_tag="PCH_Pc13g03360"
FT                   /number=3
FT   intron          complement(782514..782580)
FT                   /gene="Pc13g03360"
FT                   /locus_tag="PCH_Pc13g03360"
FT                   /number=3
FT   exon            complement(782581..782683)
FT                   /gene="Pc13g03360"
FT                   /locus_tag="PCH_Pc13g03360"
FT                   /number=4
FT   mRNA            complement(join(<782880..784784,784837..785068,
FT                   785118..785488,785542..>785586))
FT                   /gene="Pc13g03370"
FT                   /locus_tag="PCH_Pc13g03370"
FT   CDS_pept        complement(join(782880..784784,784837..785068,
FT                   785118..785488,785542..785586))
FT                   /gene="Pc13g03370"
FT                   /locus_tag="PCH_Pc13g03370"
FT                   /note="Title: strong similarity to calpain-like protease
FT                   palB - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91406"
FT                   /db_xref="GOA:B6H1Y4"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="InterPro:IPR036213"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y4"
FT                   /inference="similar to AA sequence:TREMBL:ANPALBGN.1"
FT                   /inference="protein motif:PFAM:PF04212"
FT                   /inference="protein motif:PFAM:PF00648"
FT                   /protein_id="CAP91406.1"
FT                   /translation="MSRPASTQSLISQARSAEEAIAAATSKKAALEAAINAAEHYMKAL
FT                   RLAPADDKKLLDAKCKELISKAEKIKAATDWQSAARAGPQKAFPSLRPPASTRKLTTRE
FT                   EIIILEGAKLNGYIFPPWSRAPPQDEFVYKGQLFTDTPDLHLSECQREIFAGWKRPHDL
FT                   LQTMNTAKQPYDIINPAMSASGETDLVQDVLTDCSVVASLCATTARSERGLGQHASPTL
FT                   YPCSEDKNPILSHSGKYIFRFYFNGSFRKVVIDDRLPSSKTTRSLHVIDRNNSNFLWPA
FT                   LVEKAYLKVRGGYDFPGSNSGTDLWVLTGWIPEQVFLHHDDSTSDEIWGRLYSAFWHGD
FT                   VVLTIGTGKLTELEQQGLGLVSEHDYAILDLKEVQGRRQFLLKNPWAGAEPHIQSSLTA
FT                   DLGSLGLNDKPPLSPGTFWMDCEQVLQNFENLYLNWNPGLFKYREDIHFTWDLSHGRVI
FT                   AGCFVKNPQFSISSDSGGTVWLLLGKHFKTDHQEFDTGESENETGFISIYIFQADGRRV
FT                   SLSDGALHRGPYVDSPNTLMRLEMPPKSTYTAVVSEQSLPSSAQNFTLSAFSTAPVAVA
FT                   PSLDKYLCLTKASGSWTAMTAGGNAESPRYHSNPQFSIRISEPTDVSILLETTEAELAT
FT                   HVKIFWSNGQRVSRVRSRDIIADSGDYRRGCALAETKSLDKGTYTIVCSTFAPDQFGRF
FT                   TLWISSTIPCVVQPLVSESAGRRAVLSEVGVLSPGKDRMLASLRVSRLTRIRLIARNKR
FT                   STVGLRAVAPSPVLMTVELGQGPYKEILATSEDGAHSDAASGVRVEDFDLLPSAESRRV
FT                   WIVIERIGGPGGQVEDHFEVEALAEERVEIGKWVIEDE"
FT   exon            complement(782880..784784)
FT                   /gene="Pc13g03370"
FT                   /locus_tag="PCH_Pc13g03370"
FT                   /number=1
FT   intron          complement(784785..784836)
FT                   /gene="Pc13g03370"
FT                   /locus_tag="PCH_Pc13g03370"
FT                   /number=1
FT   exon            complement(784837..785068)
FT                   /gene="Pc13g03370"
FT                   /locus_tag="PCH_Pc13g03370"
FT                   /number=2
FT   intron          complement(785069..785117)
FT                   /gene="Pc13g03370"
FT                   /locus_tag="PCH_Pc13g03370"
FT                   /number=2
FT   exon            complement(785118..785488)
FT                   /gene="Pc13g03370"
FT                   /locus_tag="PCH_Pc13g03370"
FT                   /number=3
FT   intron          complement(785489..785541)
FT                   /gene="Pc13g03370"
FT                   /locus_tag="PCH_Pc13g03370"
FT                   /number=3
FT   exon            complement(785542..785586)
FT                   /gene="Pc13g03370"
FT                   /locus_tag="PCH_Pc13g03370"
FT                   /number=4
FT   mRNA            join(<786153..786253,786317..786861,786915..787152,
FT                   787203..>787326)
FT                   /gene="Pc13g03380"
FT                   /locus_tag="PCH_Pc13g03380"
FT   CDS_pept        join(786153..786253,786317..786861,786915..787152,
FT                   787203..787326)
FT                   /gene="Pc13g03380"
FT                   /locus_tag="PCH_Pc13g03380"
FT                   /note="Title: weak similarity to peroxisomal transporter
FT                   Ant1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91407"
FT                   /db_xref="GOA:B6H1Y5"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y5"
FT                   /inference="protein motif:PFAM:PF00153"
FT                   /protein_id="CAP91407.1"
FT                   /translation="MAGQSKPALSPWGSAVAGATGAVLANAMVYPLDLVKTKLQVQVKE
FT                   KNGTVRPDNLEHYESTMDAITKIVEKEGYNGLYSGMAGALLGVASTNFAYFYWYSVVRT
FT                   LYMASAKPTQAPGTAIELSLGAVSGAVAQLFTIPVAVITTRQQTQPKGEKKGLIETGRE
FT                   VVDSEDGWSGLWRGLKASLILVVNPAITYGAYQRLKDVIFPGKNNLKPWEAFLLGAMSK
FT                   ALATIATQPLIVAKVGLQSRPPPSRNGKPFKTFGEVMKHIVDNEGLFSLFKGIGPQILK
FT                   GLLVQGLLMMTKERMELLFIVLFAYLKNIKKDKLRKAVDAAAEKAKTSMPATLK"
FT   sig_peptide     786153..786233
FT                   /gene="Pc13g03380"
FT                   /locus_tag="PCH_Pc13g03380"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            786153..786253
FT                   /gene="Pc13g03380"
FT                   /locus_tag="PCH_Pc13g03380"
FT                   /number=1
FT   mat_peptide     join(786234..786253,786317..786861,786915..787152,
FT                   787203..787323)
FT                   /gene="Pc13g03380"
FT                   /locus_tag="PCH_Pc13g03380"
FT   intron          786254..786316
FT                   /gene="Pc13g03380"
FT                   /locus_tag="PCH_Pc13g03380"
FT                   /number=1
FT   exon            786317..786861
FT                   /gene="Pc13g03380"
FT                   /locus_tag="PCH_Pc13g03380"
FT                   /number=2
FT   intron          786862..786914
FT                   /gene="Pc13g03380"
FT                   /locus_tag="PCH_Pc13g03380"
FT                   /number=2
FT   exon            786915..787152
FT                   /gene="Pc13g03380"
FT                   /locus_tag="PCH_Pc13g03380"
FT                   /number=3
FT   intron          787153..787202
FT                   /gene="Pc13g03380"
FT                   /locus_tag="PCH_Pc13g03380"
FT                   /number=3
FT   exon            787203..787326
FT                   /gene="Pc13g03380"
FT                   /locus_tag="PCH_Pc13g03380"
FT                   /number=4
FT   mRNA            complement(<788624..>788947)
FT                   /gene="Pc13g03390"
FT                   /locus_tag="PCH_Pc13g03390"
FT   CDS_pept        complement(788624..788947)
FT                   /pseudo
FT                   /gene="Pc13g03390"
FT                   /locus_tag="PCH_Pc13g03390"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical retroelement pol
FT                   polyprotein - Arabidopsis thaliana [putative pseudogene]"
FT                   /db_xref="PSEUDO:CAP91408.1"
FT                   /inference="similar to AA sequence:PIR:F84531"
FT   exon            complement(788624..788947)
FT                   /gene="Pc13g03390"
FT                   /locus_tag="PCH_Pc13g03390"
FT                   /number=1
FT   mRNA            complement(join(<790311..790504,790558..>791167))
FT                   /gene="Pc13g03400"
FT                   /locus_tag="PCH_Pc13g03400"
FT   CDS_pept        complement(join(790311..790504,790558..791167))
FT                   /gene="Pc13g03400"
FT                   /locus_tag="PCH_Pc13g03400"
FT                   /note="unknown EC_number=1.1.-.-"
FT                   /note="Title: similarity to hypothetical short chain
FT                   alcohol dehydrogenase SPCC663.06c - Schizosaccharomyces
FT                   pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91409"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z1"
FT                   /inference="similar to AA sequence:PIR:T41538"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /inference="protein motif:COGS:COG1028"
FT                   /protein_id="CAP91409.1"
FT                   /translation="MSSYAITGASKGIGREFVRQLAADTTNTVLAIVRDPESPYISELA
FT                   SKHHNVHVIKGDVTDPKSILEAASAAAAITGGKLDVLIHNSNAVDMATMSFNPTEIPFD
FT                   AQAVRAIFDPPLSTGIYGSLWTTNAFLPLIEKGIQKKIVHISSAMADLDLINKTGVSYA
FT                   VAYSVAKAGMNVQVAKYAAELGPRGIKVLALSPGWVDTWEGEKPSQVVEAEKVMLKQFQ
FT                   AAEPELKGQIQPEESVRKCLQVIERLDAETSGLLLSHNGDKQRWL"
FT   exon            complement(790311..790504)
FT                   /gene="Pc13g03400"
FT                   /locus_tag="PCH_Pc13g03400"
FT                   /number=1
FT   intron          complement(790505..790557)
FT                   /gene="Pc13g03400"
FT                   /locus_tag="PCH_Pc13g03400"
FT                   /number=1
FT   exon            complement(790558..791167)
FT                   /gene="Pc13g03400"
FT                   /locus_tag="PCH_Pc13g03400"
FT                   /number=2
FT   mRNA            join(<791379..791551,791596..792291,792341..792639,
FT                   792670..>793325)
FT                   /gene="Pc13g03410"
FT                   /locus_tag="PCH_Pc13g03410"
FT   CDS_pept        join(791379..791551,791596..792291,792341..792639,
FT                   792670..793325)
FT                   /gene="Pc13g03410"
FT                   /locus_tag="PCH_Pc13g03410"
FT                   /note="Title: similarity to cercosporin resistance protein
FT                   CRG1 - Cercospora nicotianae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91410"
FT                   /db_xref="GOA:B6H1Z2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z2"
FT                   /inference="similar to AA sequence:PIR:JC7937"
FT                   /protein_id="CAP91410.1"
FT                   /translation="MSATISAVKRRACVACTAAKAKCTPQTVNLCQRCARLGKSCTYLD
FT                   LPQTKRKRKAAPRCSRVEMLEKKVDQLTSQLTALTRQHGQTLPDTSTSNPPTNDLNSSH
FT                   DPELDSTDISELLDAAKDPSHGLDPPTSSVLEGQPSIVDRGLLSEAETERLVATFQFDL
FT                   VPKFPFVLLAHGETAVRLRNREPFLFLCIVAATIGSAHPLRKTVAEEIMNHVTSRIVAR
FT                   SERNLELLRGLLIHCAWYSYPAERYHPRLLLLAQLCVSISYDLGLHRKRSPSLDEERAL
FT                   LGTYWLSVGICGTLGRPINMKHDFRTHVCVESIAATEHLSDRWITPFIQLQSFLATMDE
FT                   VYASIEASGGSALIQVTRGSLQRQFDSVRASVEKDLSSYPSSTGVSWIPKNAIYTEIKY
FT                   VEMRLEELSLREELWIAEPESAVRTTMLMGAIQRSKELIHTVTNLPPSEIAHMTITTSA
FT                   RICAAVGYIPTAVLTLLNLITGRTDSTTEAQVQAVVDAAEYPNLVTELANALETKFEGM
FT                   SAADKETDIVGSLCSKMRLLARCYPYQIRTIVGSVPSQDARQDTSISAVHPNEVTITPQ
FT                   AWPSIYGDLGDVFPVEDIQWDSILSSFTGFS"
FT   exon            791379..791551
FT                   /gene="Pc13g03410"
FT                   /locus_tag="PCH_Pc13g03410"
FT                   /number=1
FT   intron          791552..791595
FT                   /gene="Pc13g03410"
FT                   /locus_tag="PCH_Pc13g03410"
FT                   /number=1
FT   exon            791596..792291
FT                   /gene="Pc13g03410"
FT                   /locus_tag="PCH_Pc13g03410"
FT                   /number=2
FT   intron          792292..792340
FT                   /gene="Pc13g03410"
FT                   /locus_tag="PCH_Pc13g03410"
FT                   /number=2
FT   exon            792341..792639
FT                   /gene="Pc13g03410"
FT                   /locus_tag="PCH_Pc13g03410"
FT                   /number=3
FT   intron          792640..792669
FT                   /gene="Pc13g03410"
FT                   /locus_tag="PCH_Pc13g03410"
FT                   /number=3
FT   exon            792670..793325
FT                   /gene="Pc13g03410"
FT                   /locus_tag="PCH_Pc13g03410"
FT                   /number=4
FT   mRNA            join(<794204..794350,794405..794412,794448..>795810)
FT                   /gene="Pc13g03420"
FT                   /locus_tag="PCH_Pc13g03420"
FT   CDS_pept        join(794204..794350,794405..794412,794448..795810)
FT                   /gene="Pc13g03420"
FT                   /locus_tag="PCH_Pc13g03420"
FT                   /note="unknown EC_number=5.3.4.1"
FT                   /note="Title: strong similarity to PDI related protein A
FT                   prpA - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91411"
FT                   /db_xref="GOA:B6H1Z3"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z3"
FT                   /inference="similar to AA sequence:TREMBL:AF095899.1"
FT                   /inference="protein motif:PFAM:PF00085"
FT                   /inference="protein motif:COGS:COG0526"
FT                   /inference="protein motif:COGS:COG3118"
FT                   /protein_id="CAP91411.1"
FT                   /translation="MLHSASLLLVSLLAALPVNADGLYTKNSPVIQLNPKTYNSLIANS
FT                   NYTSIVDSLPPQPSLTHPLRFYAPWCGHCKNLKPAYEKAAKNLDGLAKVAAINCDDDEN
FT                   KPFCGQMGVQGFPTLKIVTPSKKPGKPRVEDYQGARSAKGIVDAVVDRIPNHVKRATDK
FT                   DLDKWLGQNEDRPKAILFTEKGTTGALIRALAVDFLGAIDIAQVRNKESASVKKFDVTE
FT                   FPTLVLIPSADAEPKIYAGDLKKKPITEFLSQAAAPNPDASPRSASNSKPKQKSKPASK
FT                   PTSVVDDAEDLKPTASQDQDETDPSEKPVQVPIPAPPIPTLATPESVESACLTPKSGTC
FT                   VLVILPETSEPDAALPAHATEALASVAEIGHKHALRGTHLFPLYAVPAINTASKTLREA
FT                   LELADGQTVEIIALNARRGWWRRFSGADADFGAVAVESWVDAIRLGDGTKEKLPEGIVV
FT                   SVEAETESEAEVKPEAEAEVEPEAETVEAEAETKAETEEQAAEHDEL"
FT   sig_peptide     794204..794263
FT                   /gene="Pc13g03420"
FT                   /locus_tag="PCH_Pc13g03420"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            794204..794350
FT                   /gene="Pc13g03420"
FT                   /locus_tag="PCH_Pc13g03420"
FT                   /number=1
FT   mat_peptide     join(794264..794350,794405..794412,794448..795807)
FT                   /gene="Pc13g03420"
FT                   /locus_tag="PCH_Pc13g03420"
FT   intron          794351..794404
FT                   /gene="Pc13g03420"
FT                   /locus_tag="PCH_Pc13g03420"
FT                   /number=1
FT   exon            794405..794412
FT                   /gene="Pc13g03420"
FT                   /locus_tag="PCH_Pc13g03420"
FT                   /number=2
FT   intron          794413..794447
FT                   /gene="Pc13g03420"
FT                   /locus_tag="PCH_Pc13g03420"
FT                   /number=2
FT   exon            794448..795810
FT                   /gene="Pc13g03420"
FT                   /locus_tag="PCH_Pc13g03420"
FT                   /number=3
FT   mRNA            complement(join(<796139..796271,796333..>799307))
FT                   /gene="Pc13g03430"
FT                   /locus_tag="PCH_Pc13g03430"
FT   CDS_pept        complement(join(796139..796271,796333..799307))
FT                   /gene="Pc13g03430"
FT                   /locus_tag="PCH_Pc13g03430"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   Kre33 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91412"
FT                   /db_xref="GOA:B6H1Z4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR027992"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="InterPro:IPR033688"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z4"
FT                   /inference="similar to AA sequence:PIR:S55151"
FT                   /inference="protein motif:PFAM:PF05127"
FT                   /inference="protein motif:COGS:COG1444"
FT                   /protein_id="CAP91412.1"
FT                   /translation="MPRKAIDSRIPALIRNGVQEKKRSFFVVVGDHAKDVIVHLHYIMS
FT                   SVDVKQNKSVLWAYKKDLLGFTSHRKKREMKIKKEVKRGIREPNQEDPFELFITLNQIR
FT                   YVYYKETEKILGNTYGMCVLQDFEAMTPNLLARTVETVEGGGLVILLLKSMTSLKQLYT
FT                   MSMDIHSRYRTEAHDDVVARFNERFILSLGSCDSCLVVDDELNVLPISGGKSVKPLPAP
FT                   ETTDESASGTKKELKEIKESLADSKPVGPLLSLARTVDQAKALLTFVDAIAEKTLKSTV
FT                   TLTAGRGRGKSAALGVAIAAAVAHGYSNIFITSPSPENLKTLFEFIFKGFDALGYLDHV
FT                   DYTILQSTNPDFNKAVVRVNIHRNHRQTIQYIQPQDAQVLGQAELLVIDEAAAIPLPLV
FT                   RKLMGPYLVFMSSTINGYEGTGRSLSLKLIQQLREQSRTGVKTDDTDIADRSTGKSAKG
FT                   ADKNLSGRTLREITLSEPIRYAPGDSVEKWLNKVLCLDATLPKSHMNTQGCPHPSQCQL
FT                   LQVNRDTLFSFHPVSEKFLQQMMALYVASHYKNTPNDLQLMSDAPAHQLYVLVPPIDEG
FT                   ATKLPEPLCVIQVALEGRISRQSVLNSLSRGQRAGGDLIPWLVSQQFQDENFASLSGAR
FT                   IVRIATNPEYVGMGYGSRAMQLLVDFFEGKFTNLEEENIAAEEQMVRVTDEELASSSLL
FT                   DDNVHVRDIRSMPPLFGKLTERRPDVLDYVGVSYGLTPSLHKFWKRGSFVPVYLRQTPN
FT                   ELTGEHSCVMVRTLSTGEADDAWLSAYARDFHKRFLSLMSYQFGQFPSVLSLSICEAAN
FT                   SGAKKDPTFKPRTLQKADLDAAFSPFDLKRLDSYANNLLDYHVILDLVPALSDYYFANR
FT                   LDGKVSLSGVQQSILLAIGLQHKSLDDLEKELNLPSSQLLAMFLKIVRKVSTHFRNLIE
FT                   NEIEQSLPAQKVRVETSAAHDDEPEVNLQPLPISLEDELREGSKKIDEEMLAKQRALSA
FT                   ANPDGPDGSKSSKRKKIETARDIYDKEIDSKRQKMIKKGTEGRKKR"
FT   exon            complement(796139..796271)
FT                   /gene="Pc13g03430"
FT                   /locus_tag="PCH_Pc13g03430"
FT                   /number=1
FT   intron          complement(796272..796332)
FT                   /gene="Pc13g03430"
FT                   /locus_tag="PCH_Pc13g03430"
FT                   /number=1
FT   exon            complement(796333..799307)
FT                   /gene="Pc13g03430"
FT                   /locus_tag="PCH_Pc13g03430"
FT                   /number=2
FT   mRNA            join(<800677..800720,800787..800845,800908..801227,
FT                   801292..801705,801760..801912,801967..802391,
FT                   802443..>804015)
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT   CDS_pept        join(800677..800720,800787..800845,800908..801227,
FT                   801292..801705,801760..801912,801967..802391,
FT                   802443..804015)
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /note="Title: strong similarity to capsular associated
FT                   protein CAP10 - Filobasidiella neoformans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91413"
FT                   /db_xref="GOA:B6H1Z5"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z5"
FT                   /inference="similar to AA sequence:TREMBL:AF144574.1"
FT                   /protein_id="CAP91413.1"
FT                   /translation="MIQLSSDLGLKLCVGIFLLSSLFLTTSYNTTYAFDRPISTSVLVC
FT                   FLTGLTLLVWSRFVSVGSSPSSPTSKRPAIPLAEQFELPSRASTSSFALGDVETRPRAR
FT                   FQPWWIKLALLLGLCGLRIESFRQVTRNTECAPAGYAYAIPFVISLYDYWRNHRSRQVD
FT                   RYVPTQRFEKLPLQVVYSVSRRSFYYLTQSRFRGLIAAAFLSIGGLFASSFSAGTRSTY
FT                   VCPIVLHSASRLRSYRLFNLFADSIILIGITELCQIGAQFDDARRKRALTFLGTGLLGL
FT                   SLVWSVISFWVPDSSPELAGQPMLDLEYSRGAFSQSVLVVILVLSAWHMLPHFDILGVS
FT                   IIGGFVIVYFSSLSALTEPSPFPFISLTHAVLPLAASLTGTLLFLLARVVHDEEPKLYR
FT                   TNVAIQILFAVLFGISLVFAVSKHRLEDMHPIEFLISNGQIQHHNYVAQAAKSKTLGDA
FT                   VTEYRRRYNQHPPPGFDEWYRYATSRSSAIIDDFDQIYHDLLPFRALAPEHIRAMTHEL
FT                   ATNPFNDLGGIRIRNGTAMVQEGIKPTHAWMVAGAADMMKDFAKYLPDMDLVFNLNDEP
FT                   RVAVPWEKISMLNRQTGMQEMISENRVVQTWSTNREEGWAPIEPADQTNITVFTDGAWR
FT                   GVFDPYVSAVCPPSSKARSQRIWNRHDICLSCVAPHSMGQFPLDFNLASEICHQPDLAF
FT                   LHGLLISPASFKVSQELIPVFSQSALTGFNDILFPSPWNYIEKVKYQPTKEHPDPEYGH
FT                   KKNSLYWLGSTSEGVSRFGEWKGMPRQRFAHLINNNTNNQVSILLPADPKENSFRYEIM
FT                   DGSAPTSDLHLQTAVHLADPIVRCGDCDEQAAELSTAGWADFQAHWWHRFLFDLDGAGF
FT                   SGRFLPFLHSHSLPLKTGLFRQWFDSRVTSWLHFVPVDIRLHGLWSTLAYFAGVSAPAS
FT                   EENGPNAPKMRMKAHDRQGKWIAEEGRKWANTALRKEDMEIYFFRLLLEWGRLTDDQRD
FT                   VLGFGH"
FT   sig_peptide     join(800677..800720,800787..800823)
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            800677..800720
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /number=1
FT   intron          800721..800786
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /number=1
FT   exon            800787..800845
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /number=2
FT   mat_peptide     join(800824..800845,800908..801227,801292..801705,
FT                   801760..801912,801967..802391,802443..804012)
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT   intron          800846..800907
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /number=2
FT   exon            800908..801227
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /number=3
FT   intron          801228..801291
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /number=3
FT   exon            801292..801705
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /number=4
FT   intron          801706..801759
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /number=4
FT   exon            801760..801912
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /number=5
FT   intron          801913..801966
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /number=5
FT   exon            801967..802391
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /number=6
FT   intron          802392..802442
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /number=6
FT   exon            802443..804015
FT                   /gene="Pc13g03440"
FT                   /locus_tag="PCH_Pc13g03440"
FT                   /number=7
FT   mRNA            complement(join(<804565..805309,805387..805619,
FT                   805672..>805797))
FT                   /gene="Pc13g03450"
FT                   /locus_tag="PCH_Pc13g03450"
FT   CDS_pept        complement(join(804565..805309,805387..805619,
FT                   805672..805797))
FT                   /gene="Pc13g03450"
FT                   /locus_tag="PCH_Pc13g03450"
FT                   /note="unknown EC_number=3.2.1.3"
FT                   /note="Title: strong similarity to hypothetical
FT                   mixed-linked glucanase precursor related protein MLG1
FT                   -Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91414"
FT                   /db_xref="GOA:B6H1Z6"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z6"
FT                   /inference="similar to AA sequence:PIR:T48815"
FT                   /protein_id="CAP91414.1"
FT                   /translation="MHVFSTILPALALLAQVSSAAYTLRDDYGASDSFFDKFNFFTDTD
FT                   PTNGFVSYVDRSTASRNGLINTGNGVYIGVDHANIATRPGRQSVRLESTATYKHGLVIL
FT                   DLAHMPSSTCGTWPAFWMLGPNWPNNGEIDIIEGVNEQTQNQVALHTSNGCTINNSGFT
FT                   GNLETPNCYVQAPGQSANSGCVIQDGSTQSYGTGFNNVGGGVYATEWTGSAISVWFFPS
FT                   YAVPADISSGNPNPAGWGTPSARFAGGCNIDSKFNDLQIVFDITFCGDWAGSVWGSSSC
FT                   ASRAWSCVDYVQNNPTAFQESYWRVRSLKVYQDAASSKGGAEGEDVGAGDEVGVNWDPS
FT                   TWYGLSARASMKHRREHYRHKRGHGHA"
FT   exon            complement(804565..805309)
FT                   /gene="Pc13g03450"
FT                   /locus_tag="PCH_Pc13g03450"
FT                   /number=1
FT   mat_peptide     complement(join(804568..805309,805387..805619,
FT                   805672..805737))
FT                   /gene="Pc13g03450"
FT                   /locus_tag="PCH_Pc13g03450"
FT   intron          complement(805310..805386)
FT                   /gene="Pc13g03450"
FT                   /locus_tag="PCH_Pc13g03450"
FT                   /number=1
FT   exon            complement(805387..805619)
FT                   /gene="Pc13g03450"
FT                   /locus_tag="PCH_Pc13g03450"
FT                   /number=2
FT   intron          complement(805620..805671)
FT                   /gene="Pc13g03450"
FT                   /locus_tag="PCH_Pc13g03450"
FT                   /number=2
FT   exon            complement(805672..805797)
FT                   /gene="Pc13g03450"
FT                   /locus_tag="PCH_Pc13g03450"
FT                   /number=3
FT   sig_peptide     complement(805738..805797)
FT                   /gene="Pc13g03450"
FT                   /locus_tag="PCH_Pc13g03450"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<807475..811547,811601..812033,
FT                   812085..>812378))
FT                   /gene="Pc13g03460"
FT                   /locus_tag="PCH_Pc13g03460"
FT   CDS_pept        complement(join(807475..811547,811601..812033,
FT                   812085..812378))
FT                   /gene="Pc13g03460"
FT                   /locus_tag="PCH_Pc13g03460"
FT                   /note="Title: similarity to vacuolar protein
FT                   sorting-associated protein Vps8 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91415"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR025941"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z7"
FT                   /protein_id="CAP91415.1"
FT                   /translation="MAEGSEGWSREDELDLGQEDDPRQPDHGALDQTLPSPQEPAEEEL
FT                   DTIDDAEDQDSEKTARRNYLSYPETPPPRHADWTATGSVDGTGSNPDDSPSLHGSVPSS
FT                   LSSSPLALRGSPRVSPSPARRPFDLRFQSRLSSSPQSVSRAGSPFLAHLHSRQSSITSQ
FT                   LSPTPETEAEPLQGPWEVVRWTKLRKITGQAFSEIGKRNFGRPTCLAVSTSIVIGTSKG
FT                   IILVFDYQQSLKTIIGTGTPAVECGAVTSLALSADHSTVAGGHDSGDIFTWEISRSAKP
FT                   FLHIPPIPANQTETRISDGHLSGSAVIHIGFLGTRRTALVSADTRGMSFSHLATRGMGA
FT                   VGRTVKTTRILGRYPQAAAEVKRRKPSSVLAFSPLPLGNVEQPTDSLGLVAMLTPYLLV
FT                   IVSTTPVAQTQHKAPRPKEVPAHSALTGALAWFPAIRLKGKDTQTSNTKLVYCWSNVLT
FT                   VLEVSEAESDEPADKDKPPSLVFRARSRWRADEAIVAVQWLSRSVLAVFTITQRLLIIE
FT                   DYSMHVTDSVDLANRHIYHTDLFSSQLHSLVEQLDEEDDSMHGVVADAFHMSFRSYKGR
FT                   LFLLGYNEALVGNLSNWADRLLALMEAGDFIGAIRLATSYYTGESEKLTVGLPEEDVLR
FT                   QPIVQEKLLEMISASLKYAFGRNSEASNGRLENQQLEELAEVSIAACVYMSDEEFLWEE
FT                   VFNWYEEQDSAGIFLDALEPRIVDGTLRSLPPIAVKALINHFIGTHSAGRLEEIICLLD
FT                   TTTMDIDQVTTLCKQHNLYDAFIYVWNRCLMDYVGPLEELLHMIPSQPQPLVNGDYAIE
FT                   MRRQNNAMKMFPYLSFILTGRIYPTGDDMDEAEATRAKTDLYQFLFSGRVSGTVPGDTN
FT                   EADSFSQLRAMLKFDASSFMSMLNEAFEDSFLNEPESEDISTSDMLINRQYLVSILLQV
FT                   MTGDLFTPFDIIYLDMFVARNLPKYPQYILLSGTTLHQVLVRVCQYPEQEMAEDCELSA
FT                   EYLLSFYHPPDIQSMIPLFKEARFFRILKSTYRSEKQYPLLVMTYLEDPSDRDAIFTCL
FT                   QDCLRPSSGLGKKQRRDVVDVVKEHAREIAAIDVTHAARTMQDLAPDTHSTFLRVLEDD
FT                   PQKQYQYLLVLVEPQAQTADTRYSPGVENWMIERYVQLLCKYNPSHVADFVDGLRVGDI
FT                   HLEELLPSIEESGAIDAAVILLARQGQVREALDRLVAHLGTLESGLVGILQSVRDSPDS
FT                   ATTAEAIDDLIESLNKYAGVGTWLCQGQTKTAKQSRTGSTNGKRNAPTLDQPLAFDELL
FT                   WLDHIEAVVRIASNVFAFIQGNNAQISLPAQPTDSLAGESGRLTTAFRALVQQVFTALL
FT                   ASTVKSSPTTTERTDISFLRILRAFLTRAATWSPSLLELRAVLASIFSAYSYEKSLLTL
FT                   ANGMLDRDLFVHVDEVSRLRQQGWRPRGHVCEICRSRIWGPSVGEAHWSTWEARRAEVY
FT                   AHRIARRNEDGYNPSDRGKGKAADVGVGHMSHLDAGGAHGHAHVLAHREHGDRGGMSGA
FT                   NADHDHEHCHAEAGAGSSTATTVADSPPEPVVVFACRHLYHRRCVLDAISARARPAETA
FT                   FRRDHLPDWTGAELFCPTCT"
FT   exon            complement(807475..811547)
FT                   /gene="Pc13g03460"
FT                   /locus_tag="PCH_Pc13g03460"
FT                   /number=1
FT   intron          complement(811548..811600)
FT                   /gene="Pc13g03460"
FT                   /locus_tag="PCH_Pc13g03460"
FT                   /number=1
FT   exon            complement(811601..812033)
FT                   /gene="Pc13g03460"
FT                   /locus_tag="PCH_Pc13g03460"
FT                   /number=2
FT   intron          complement(812034..812084)
FT                   /gene="Pc13g03460"
FT                   /locus_tag="PCH_Pc13g03460"
FT                   /number=2
FT   exon            complement(812085..812378)
FT                   /gene="Pc13g03460"
FT                   /locus_tag="PCH_Pc13g03460"
FT                   /number=3
FT   mRNA            complement(<813346..>814896)
FT                   /gene="Pc13g03470"
FT                   /locus_tag="PCH_Pc13g03470"
FT   CDS_pept        complement(813346..814896)
FT                   /gene="Pc13g03470"
FT                   /locus_tag="PCH_Pc13g03470"
FT                   /note="unknown EC_number=2.3.1.-"
FT                   /note="Title: weak similarity to trichothecene
FT                   3-O-acetyltransferase TRI101 - Fusarium sporotrichioides"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91416"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z8"
FT                   /inference="similar to AA sequence:TREMBL:AB014491.1"
FT                   /protein_id="CAP91416.1"
FT                   /translation="MHRVPRLTRPIYIRSIQSTVIQRSRLSQRTQPSRKLDSAKMFQPY
FT                   NLTPLDQLSPPGHFTMSLTFNLVGKNRVEALQRMEDAGSCVFSKFPFLSGMVVPSTQRD
FT                   GKSNALQVRPSTAAELEECPIIVTQHHTEPTAITVDGKFNTSLMPFPVVSPPRNPSPVL
FT                   RLKAHVIEDNVHLVLCFDHRVMDGSGIFALFRTFSSFCRDLNATGPFTTTQAQEEIRQH
FT                   IEQVASTATPRDVQWTSLPTTTSEDKVPTDYGRVPIGSSHVFDAQKINILLDACNSTLQ
FT                   SLPEKYRKDLSETSLRPGLLVSALLGICSNRARLRAFPDEPHLSSDMFIVENLRKALNL
FT                   RRGYLGSTIGATQVKCDGYAHPPPESLQNIHVPESLSPVGAEDMWRVCNVAQSLQEVSG
FT                   RLDKEYTEGIIARMSREQDWSSFRPGWGVNFLVSDIKSAKPYGNFGPLGDLELFDLHFD
FT                   TQPGYCWIMPNLPSDTASPYPCWRLRWILERAAMECLSNDPLFQWASTPSTASTHAEV"
FT   exon            complement(813346..814896)
FT                   /gene="Pc13g03470"
FT                   /locus_tag="PCH_Pc13g03470"
FT                   /number=1
FT   mRNA            join(<816456..817017,817074..>817435)
FT                   /gene="Pc13g03480"
FT                   /locus_tag="PCH_Pc13g03480"
FT   CDS_pept        join(816456..817017,817074..817435)
FT                   /gene="Pc13g03480"
FT                   /locus_tag="PCH_Pc13g03480"
FT                   /note="Title: similarity to hypothetical MAP3K protein
FT                   kinase-like protein MLD14.3 - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91417"
FT                   /db_xref="GOA:B6H1Z9"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z9"
FT                   /inference="similar to AA sequence:TREMBLNEW:AB025624.3"
FT                   /protein_id="CAP91417.1"
FT                   /translation="MLAVSGTDTLVQRASQSSAYMSSPSMSTRAATCNGHSEYCTRSYS
FT                   NITFIGSHDSAFVGPLPQQNQNIDIEAQLDMGIRYLQVQTHRSVIDENVIELCHTSCLL
FT                   EDAGPLKEYLETIKNWLDANPNEVVTLLLTNGDSVPITEFGDTFSSSGISNYAYVPSEN
FT                   PLSITDWPTLGDMISSGKRLVVFLDYGADTTKVNFIQDEFAYYFETAYGVTDASFPNCS
FT                   IDRPSGAAATGRMGIVNHFLDVDVLGIKIPARHEADNTNAATGPGSIGAQAALCAGLYG
FT                   YAPNVVLADFVDKGDVITAQKNLNGL"
FT   exon            816456..817017
FT                   /gene="Pc13g03480"
FT                   /locus_tag="PCH_Pc13g03480"
FT                   /number=1
FT   intron          817018..817073
FT                   /gene="Pc13g03480"
FT                   /locus_tag="PCH_Pc13g03480"
FT                   /number=1
FT   exon            817074..817435
FT                   /gene="Pc13g03480"
FT                   /locus_tag="PCH_Pc13g03480"
FT                   /number=2
FT   mRNA            complement(<817740..>819095)
FT                   /gene="Pc13g03490"
FT                   /locus_tag="PCH_Pc13g03490"
FT   CDS_pept        complement(817740..819095)
FT                   /gene="Pc13g03490"
FT                   /locus_tag="PCH_Pc13g03490"
FT                   /note="Title: similarity to hypothetical protein Rv0272c
FT                   -Mycobacterium tuberculosis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91418"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H200"
FT                   /inference="similar to AA sequence:PIR:C70628"
FT                   /protein_id="CAP91418.1"
FT                   /translation="MKVLKSVALASLLSFTGFGQHAFASSSLKKPILHDFDDDGVDGGL
FT                   YRPSVAGPKSRIAVYIMHAEQDYTSFVACEALQERGFTVFCANNDASKSGYMSDLNFED
FT                   MMTNVNQGMTYLRNLTDIDKVVILGHSGGGAMMAAYQDIAENGASACQGSEKIYPCSDE
FT                   MDDLEPADGLILLDANYGLSTMAFLSLSPAIIDESSPSKINETLNVFNPANGFNNTRSN
FT                   YTAEFKKAFQSGAVARNNRIIKHAQERLAAIEAGNGTYSDDEPFTVPASLYIGFNNLFF
FT                   AQDTRYLAHTTHAWPLLHKNGTTTQVVRSVRVPANFKSFADQWEGGALKTTVKRYLSTF
FT                   AIRVGDDYNLRADGIDGIDYASSNLAPVASIRGVSVPLLTMGMTGHYEYLNAEKLHLAA
FT                   GSNDTTIAFVEGAQHTIDTCTACESFPGEFGNTVVTCFNHVENWLAKKGRFI"
FT   exon            complement(817740..819095)
FT                   /gene="Pc13g03490"
FT                   /locus_tag="PCH_Pc13g03490"
FT                   /number=1
FT   mat_peptide     complement(817743..819023)
FT                   /gene="Pc13g03490"
FT                   /locus_tag="PCH_Pc13g03490"
FT   sig_peptide     complement(819024..819095)
FT                   /gene="Pc13g03490"
FT                   /locus_tag="PCH_Pc13g03490"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<820323..820524,820605..820725,
FT                   820806..821151,821218..>821412))
FT                   /gene="Pc13g03500"
FT                   /locus_tag="PCH_Pc13g03500"
FT   CDS_pept        complement(join(820323..820524,820605..820725,
FT                   820806..821151,821218..821412))
FT                   /gene="Pc13g03500"
FT                   /locus_tag="PCH_Pc13g03500"
FT                   /note="Title: strong similarity to hypothetical
FT                   2-hydroxyhepta-2,4-diene-1,7-dioate isomerase BH2000
FT                   -Bacillus halodurans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91419"
FT                   /db_xref="GOA:B6H201"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B6H201"
FT                   /inference="similar to AA sequence:PIR:H83899"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /inference="protein motif:COGS:COG0179"
FT                   /protein_id="CAP91419.1"
FT                   /translation="MSLNWTNLIRFISEEDGQIHLGEVDTRKYPDIGLTVLNGERVAVN
FT                   LVKGSIFDGVVTETIMHVGRLLAPIGIEEVPIIRCMGLNYRDHATEANMPIPDVPVLFI
FT                   KPRTALNGPYPAKINVPKIAQDGSSDYEAELSIVLSKSGRDIPESEAMDYVLGYTCSND
FT                   VSARTQQFKNSQWCFSKGLDGSCPIGPVLVSPSVVGNPHNLRIKAIHNGTVVQDSNTRE
FT                   MIFDIAKTIAFLSQGTTLERGTIIMTGTGPGIGVMRNPKVVLNDGDDMRVEIENIGTLI
FT                   NKVHYE"
FT   exon            complement(820323..820524)
FT                   /gene="Pc13g03500"
FT                   /locus_tag="PCH_Pc13g03500"
FT                   /number=1
FT   intron          complement(820525..820604)
FT                   /gene="Pc13g03500"
FT                   /locus_tag="PCH_Pc13g03500"
FT                   /number=1
FT   exon            complement(820605..820725)
FT                   /gene="Pc13g03500"
FT                   /locus_tag="PCH_Pc13g03500"
FT                   /number=2
FT   intron          complement(820726..820805)
FT                   /gene="Pc13g03500"
FT                   /locus_tag="PCH_Pc13g03500"
FT                   /number=2
FT   exon            complement(820806..821151)
FT                   /gene="Pc13g03500"
FT                   /locus_tag="PCH_Pc13g03500"
FT                   /number=3
FT   intron          complement(821152..821217)
FT                   /gene="Pc13g03500"
FT                   /locus_tag="PCH_Pc13g03500"
FT                   /number=3
FT   exon            complement(821218..821412)
FT                   /gene="Pc13g03500"
FT                   /locus_tag="PCH_Pc13g03500"
FT                   /number=4
FT   mRNA            complement(join(<822041..822072,822129..822238,
FT                   822298..822532,822604..822711,822885..>823305))
FT                   /gene="Pc13g03510"
FT                   /locus_tag="PCH_Pc13g03510"
FT   CDS_pept        complement(join(822041..822072,822129..822238,
FT                   822298..822532,822604..822711,822885..823305))
FT                   /gene="Pc13g03510"
FT                   /locus_tag="PCH_Pc13g03510"
FT                   /note="unknown EC_number=1.13.11.-"
FT                   /note="Title: strong similarity to
FT                   2,3-dihydroxybiphenyl-1,2-dioxygenase bphC - Pseudomonas
FT                   stutzeri"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91420"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y7"
FT                   /inference="similar to AA sequence:PIR:JC5464"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /inference="protein motif:COGS:COG0346"
FT                   /inference="protein motif:COGS:COG2514"
FT                   /protein_id="CAP91420.1"
FT                   /translation="MTVNITPRINLVRIAHVFYTYKDLNKAHEFLLDFGFQEVKRAGKD
FT                   IYYRGTSSQPFVYCARHGEEDVFGGAAFVVESEADLVASQELPGATEIYGLSDAPGGGR
FT                   CVTFHDPIDDFPFHLVYGQTHWADEKALPQLNFNFVSPAPVHKIGHFGTCVTDFAKAFD
FT                   FYTTRFNFKPSDVYSTGKDITTFLHLDRGSELVDHHCFFFFEGPKPHVHHSSFETHDFD
FT                   TQVLGHDWLRSKGYQNCWGVGRHIMGSQIFDYWFDPSHFIIEHYVDGDLVNDEYPINRS
FT                   LASPGNLHVWGPDLPPTFLQ"
FT   exon            complement(822041..822072)
FT                   /gene="Pc13g03510"
FT                   /locus_tag="PCH_Pc13g03510"
FT                   /number=1
FT   intron          complement(822073..822128)
FT                   /gene="Pc13g03510"
FT                   /locus_tag="PCH_Pc13g03510"
FT                   /number=1
FT   exon            complement(822129..822238)
FT                   /gene="Pc13g03510"
FT                   /locus_tag="PCH_Pc13g03510"
FT                   /number=2
FT   intron          complement(822239..822297)
FT                   /gene="Pc13g03510"
FT                   /locus_tag="PCH_Pc13g03510"
FT                   /number=2
FT   exon            complement(822298..822532)
FT                   /gene="Pc13g03510"
FT                   /locus_tag="PCH_Pc13g03510"
FT                   /number=3
FT   intron          complement(822533..822603)
FT                   /gene="Pc13g03510"
FT                   /locus_tag="PCH_Pc13g03510"
FT                   /number=3
FT   exon            complement(822604..822711)
FT                   /gene="Pc13g03510"
FT                   /locus_tag="PCH_Pc13g03510"
FT                   /number=4
FT   intron          complement(822712..822884)
FT                   /gene="Pc13g03510"
FT                   /locus_tag="PCH_Pc13g03510"
FT                   /number=4
FT   exon            complement(822885..823305)
FT                   /gene="Pc13g03510"
FT                   /locus_tag="PCH_Pc13g03510"
FT                   /number=5
FT   mRNA            complement(join(<823622..825086,825134..825499,
FT                   825568..825955,826118..>826181))
FT                   /gene="Pc13g03520"
FT                   /locus_tag="PCH_Pc13g03520"
FT   CDS_pept        complement(join(823622..825086,825134..825499,
FT                   825568..825955,826118..826181))
FT                   /gene="Pc13g03520"
FT                   /locus_tag="PCH_Pc13g03520"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_84_scaffold_5.tfa_1700wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91421"
FT                   /db_xref="GOA:B6H1Y8"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y8"
FT                   /protein_id="CAP91421.1"
FT                   /translation="MVCQGFDKGISICSKAHEVTSGSLQKRRKCRRSEDTAQSRHLHLQ
FT                   SNSYNPNLCSDNNDLDVLNDESETEGLVPTDYAETVHRTKTDEGGKTQTSHLNMHDLSY
FT                   ILHPSHESTIPNPDRNRSACSNDGEKGGVRRQACAELGVSQSAMNQMIRAFFENMVAIN
FT                   IFHEPSFAEKLSNISSLCQLSALLAAIAAYSSRFIGSGTNISSLGEHRTAGKSQQQPEY
FT                   FVGLAFNYVNKALVACDDETPSLCILQALIIATHCQLTRGVRGKAWRSLGLGVAKPDNI
FT                   HQWQADEEKRRAFWAVWEMDVFASTIRQAPTAIDWGHMEILLPVDNANWFLGRPSSSCF
FT                   MDADPNQSWKALQDSGNQSPKAWFLVINSFMKIAHSISDPRRLSAMDNAGHYQPGHPTP
FT                   GLDEERCWKLEKLGNAVRCFNMALPSHLRYHDQYLAFGAPVQGRLESQRQQHCSLYNIF
FT                   VMTQLVWLMIHRHDAFRPQTRQAETNHFYPPGDGVVAGGVISSSHETECTAQRQYYDAA
FT                   DRILRIVSQSCEDHIQHISPFLSSTFWLVSAVQLVRKHFTREPANRSLIESRFDVVYMT
FT                   YRRCVEFWGTQTAMQRNLESLEEQLEARKRKMNSHESQASSAHQTSHIERHTKRKRTHQ
FT                   TVSRTTEQDYLPHLPTGRSVRNNLPEYIPETPIPLEASALPVGDSQSYVRQHPAAVDSM
FT                   AMVDMMLPPQSDRGHSSGTCMMPTSSDYFDPTVLNLGDVHDDQILDLRDFDLSGGIQDL
FT                   LAEWITY"
FT   exon            complement(823622..825086)
FT                   /gene="Pc13g03520"
FT                   /locus_tag="PCH_Pc13g03520"
FT                   /number=1
FT   intron          complement(825087..825133)
FT                   /gene="Pc13g03520"
FT                   /locus_tag="PCH_Pc13g03520"
FT                   /number=1
FT   exon            complement(825134..825499)
FT                   /gene="Pc13g03520"
FT                   /locus_tag="PCH_Pc13g03520"
FT                   /number=2
FT   intron          complement(825500..825567)
FT                   /gene="Pc13g03520"
FT                   /locus_tag="PCH_Pc13g03520"
FT                   /number=2
FT   exon            complement(825568..825955)
FT                   /gene="Pc13g03520"
FT                   /locus_tag="PCH_Pc13g03520"
FT                   /number=3
FT   intron          complement(825956..826117)
FT                   /gene="Pc13g03520"
FT                   /locus_tag="PCH_Pc13g03520"
FT                   /number=3
FT   exon            complement(826118..826181)
FT                   /gene="Pc13g03520"
FT                   /locus_tag="PCH_Pc13g03520"
FT                   /number=4
FT   mRNA            complement(join(<827132..827267,827346..827574,
FT                   827736..>827742))
FT                   /gene="Pc13g03530"
FT                   /locus_tag="PCH_Pc13g03530"
FT   CDS_pept        complement(join(827132..827267,827346..827574,
FT                   827736..827742))
FT                   /gene="Pc13g03530"
FT                   /locus_tag="PCH_Pc13g03530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91422"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y9"
FT                   /protein_id="CAP91422.1"
FT                   /translation="MIAIDKFFKYVVFPDLKTVMNQLLDFILSDRRLQIDFDHATYKSI
FT                   VKALRGQNNFMDLAFEAILPEIKGFQGKLITTQDLHKDSPNTIVEFGISKEPEYVASSA
FT                   IRDSEISDQDDLMDLPRPR"
FT   exon            complement(827132..827267)
FT                   /gene="Pc13g03530"
FT                   /locus_tag="PCH_Pc13g03530"
FT                   /number=1
FT   intron          complement(827268..827345)
FT                   /gene="Pc13g03530"
FT                   /locus_tag="PCH_Pc13g03530"
FT                   /number=1
FT   exon            complement(827346..827574)
FT                   /gene="Pc13g03530"
FT                   /locus_tag="PCH_Pc13g03530"
FT                   /number=2
FT   intron          complement(827575..827735)
FT                   /gene="Pc13g03530"
FT                   /locus_tag="PCH_Pc13g03530"
FT                   /number=2
FT   exon            complement(827736..827742)
FT                   /gene="Pc13g03530"
FT                   /locus_tag="PCH_Pc13g03530"
FT                   /number=3
FT   mRNA            complement(join(<828420..829278,829339..829952,
FT                   830046..830194,830239..830337,830381..>830504))
FT                   /gene="Pc13g03540"
FT                   /locus_tag="PCH_Pc13g03540"
FT   CDS_pept        complement(join(828420..829278,829339..829952,
FT                   830046..830194,830239..830337,830381..830504))
FT                   /gene="Pc13g03540"
FT                   /locus_tag="PCH_Pc13g03540"
FT                   /note="Title: strong similarity to 1,2-dichlorophenol
FT                   hydroxylase tfdB - Pseudomonas putida"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91423"
FT                   /db_xref="GOA:B6H1Z0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z0"
FT                   /inference="similar to AA sequence:PIR:JC5013"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /inference="protein motif:PFAM:PF01360"
FT                   /inference="protein motif:COGS:COG0654"
FT                   /protein_id="CAP91423.1"
FT                   /translation="MSSTAQATNSDKVEDHGLDTEFLIVGAGPAGAALACFLGSHARRA
FT                   QGHYDQQRGRDSKYPSRTHYQYGSTWYVTECLRDIGLYEELQKLGSTGEDHMQHTRWCH
FT                   SMAGEEYARIHSWGNDPRRKGDYELASPCEPFDLPQTVMEPVLVRHAALKGFKCRFDTT
FT                   LISFNEEKTGLITATIRDEISKNEYYIRTKYLLGADGARSQVVKQLNLPLAVLPRQGMA
FT                   INVLVRTDLSHLVKNRTGNLHWVMQPDREHPNFGWMGIVRMVKPWSEWMFILFPDRSYN
FT                   RSQGQPSTEEYQKRVQEFIGDDTPAEILDISTWYINEIVAEKYSEGNIFCLGDAVHRHP
FT                   PLNGLGSNTCIQDAFNLAWKLAYVHKGLASPSLLSTYSSERQPVGHSIITRANQAYRDH
FT                   FHVWEALGMLPTDLSERKQILEELRSATPQGSNRRRALHAAIKHTSHEFHGLGIKMNQH
FT                   YQGQGIYMADEPHPYDQVGRAGEDKVLYHGPSTYPGSRLPHVWLNKATPGEAISMIDIA
FT                   GHGVFTVFTGIGGGVWKEAAVAVAEKLSVPIRACSIGFRQDWEDVYFEWGSVRGVEESG
FT                   AVLVRPDRFVAWRASEALQDCEACEGKLLTVMRSILGF"
FT   exon            complement(828420..829278)
FT                   /gene="Pc13g03540"
FT                   /locus_tag="PCH_Pc13g03540"
FT                   /number=1
FT   intron          complement(829279..829338)
FT                   /gene="Pc13g03540"
FT                   /locus_tag="PCH_Pc13g03540"
FT                   /number=1
FT   exon            complement(829339..829952)
FT                   /gene="Pc13g03540"
FT                   /locus_tag="PCH_Pc13g03540"
FT                   /number=2
FT   intron          complement(829953..830045)
FT                   /gene="Pc13g03540"
FT                   /locus_tag="PCH_Pc13g03540"
FT                   /number=2
FT   exon            complement(830046..830194)
FT                   /gene="Pc13g03540"
FT                   /locus_tag="PCH_Pc13g03540"
FT                   /number=3
FT   intron          complement(830195..830238)
FT                   /gene="Pc13g03540"
FT                   /locus_tag="PCH_Pc13g03540"
FT                   /number=3
FT   exon            complement(830239..830337)
FT                   /gene="Pc13g03540"
FT                   /locus_tag="PCH_Pc13g03540"
FT                   /number=4
FT   intron          complement(830338..830380)
FT                   /gene="Pc13g03540"
FT                   /locus_tag="PCH_Pc13g03540"
FT                   /number=4
FT   exon            complement(830381..830504)
FT                   /gene="Pc13g03540"
FT                   /locus_tag="PCH_Pc13g03540"
FT                   /number=5
FT   mRNA            complement(<831174..>832496)
FT                   /gene="Pc13g03550"
FT                   /locus_tag="PCH_Pc13g03550"
FT   CDS_pept        complement(831174..832496)
FT                   /gene="Pc13g03550"
FT                   /locus_tag="PCH_Pc13g03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03550"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91424"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U6"
FT                   /protein_id="CAP91424.1"
FT                   /translation="MPPKSSTRKGGKKGMSHTLSPDPSSSPIRKKQKGTPSAIRDRANS
FT                   SSRSGIPKLEPSSGAHPPSEYWNQLTDFQRDFLDGAMQETVSNLYDLGAEIKAETSSPA
FT                   PSSIINDENESQYSLGTPVPGPIPAPFPYTVDDLTLCHAPTADPTGYPIFVSRNGRWDW
FT                   YYLSSNTKTTETPANGTSNGNTTNTKSEFANDLCLSPNQFPCTKDDTTLCPCPNPGPNS
FT                   AYSPTFSSQNGRWEWIFLPSNTDTESSPPKVKMEDIPEANPRVQRPSNPLSTTFSATDL
FT                   DHFVFHGLQDSDDDENIIERARTENIELAKTVKHVKFFMNNSHDKHFVPFQVPALIGYE
FT                   NWEPWLAGMYLLFRQHSVWPVVTAELEPLPPGHNLHLWYNRMLDCAVALIYANVSDVVR
FT                   NTHCLMSTLHDDDPDELMAHLYAHYAEPDLTHPPHEESELD"
FT   exon            complement(831174..832496)
FT                   /gene="Pc13g03550"
FT                   /locus_tag="PCH_Pc13g03550"
FT                   /number=1
FT   mRNA            complement(join(<833003..833144,833218..833429,
FT                   833481..833713,833765..833987,834034..835057,
FT                   835111..835349,835402..835453,835699..>835715))
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT   CDS_pept        complement(join(833003..833144,833218..833429,
FT                   833481..833713,833765..833987,834034..835057,
FT                   835111..835349,835402..835453,835699..835715))
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /note="unknown EC_number=3.4.14.-"
FT                   /note="Title: strong similarity to dipeptidyl-peptidase V
FT                   DPP V - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03560"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91425"
FT                   /db_xref="GOA:B6H1U7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U7"
FT                   /inference="similar to AA sequence:PIR:T09631"
FT                   /inference="protein motif:COGS:COG1506"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP91425.1"
FT                   /translation="MPTSSLQLIAAPRRSDAIPNPSGEVALFSTSEYSFETHATSSWWS
FT                   LLDLETGKVTQLTNDSNVSELTWLGSTDSGLLYINGTNAEIPGGTEIWVSDTSDFANSA
FT                   YKAASLPAPLSGLKTAITKSGDINFLVYGESWPNGTAYNKELVAAPLSSARIHDSIYVR
FT                   HWDTWLTTRFNAIFSGTLKKKRAGPGATSAYTSSGSLKNLVAGVKNLESPYPPFGDASD
FT                   YDISSNGKLVAFKSKAPELPRANHTASYIYVVPHDGSKKAVAINGPDSPGTPKDIKGDS
FT                   SSPVFSPDGRRIAYLQMEDISYESDRRTVYVYTIDSKDTIRTLAKDWDRSPGAIKWTAD
FT                   GKSLVLNTEDSARSRLFLLPADAGDDFKPKNFTDGGSVAAYYGLPNGEYLVSSSAIHTS
FT                   RTVYTAKPDEGVTGVIFSANEVDPALKNLDPSGVDEFYYKGNWTDIHSWIIYPSDFDKS
FT                   KSYPLLFYIHGGPQGSWGDSWSTRWNYKVFADQGYVVIAPNPTGSTGFGDKLTDEIANN
FT                   WGSYPYDDLVKCWEHVRDNFDFIDTSRGVAAGASYGGFMINWIQGNPLGREFKALASHD
FT                   GTFVADAKVSTEELWFMQHEFNGTFWDNRENYRRFDPSAPEHIKQFATPQLIIHSDLDY
FT                   RLPISEGLALFNILQERGVPSRLLSFPDENHWVINKENSLVWHQQVLGWLNKYSGIDTP
FT                   GSVNLDDTTIPVVDYNPQL"
FT   exon            complement(833003..833144)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=1
FT   intron          complement(833145..833217)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=1
FT   exon            complement(833218..833429)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=2
FT   intron          complement(833430..833480)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=2
FT   exon            complement(833481..833713)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=3
FT   intron          complement(833714..833764)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=3
FT   exon            complement(833765..833987)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=4
FT   intron          complement(833988..834033)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=4
FT   exon            complement(834034..835057)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=5
FT   intron          complement(835058..835110)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=5
FT   exon            complement(835111..835349)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=6
FT   intron          complement(835350..835401)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=6
FT   exon            complement(835402..835453)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=7
FT   intron          complement(835454..835698)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=7
FT   exon            complement(835699..835715)
FT                   /gene="Pc13g03560"
FT                   /locus_tag="PCH_Pc13g03560"
FT                   /number=8
FT   mRNA            complement(join(<836240..836785,836835..837065,
FT                   837165..>839109))
FT                   /gene="Pc13g03570"
FT                   /locus_tag="PCH_Pc13g03570"
FT   CDS_pept        complement(join(836240..836785,836835..837065,
FT                   837165..839109))
FT                   /exception="reasons given in citation"
FT                   /gene="Pc13g03570"
FT                   /locus_tag="PCH_Pc13g03570"
FT                   /note="putative sequencing error"
FT                   /note="unknown EC_number=6.5.1.1"
FT                   /note="Title: strong similarity to DNA ligase cdc17p
FT                   -Schizosaccharomyces pombe [putative sequencing error]"
FT                   /db_xref="GOA:B6H1U5"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U5"
FT                   /inference="similar to AA sequence:PIR:A29066"
FT                   /inference="protein motif:PFAM:PF04675"
FT                   /inference="protein motif:PFAM:PF01068"
FT                   /inference="protein motif:PFAM:PF04679"
FT                   /inference="protein motif:COGS:COG1793"
FT                   /protein_id="CAP91426.1"
FT                   /translation="MPPIRSQSSTNSTEQEGRILLAIQAFKNGDITSVALAARTYKVPR
FT                   TTLRHRLSGVQHRAISRANSHKLTQIEEESLEKWILSIDARGSAPRPSTIREMANLLLE
FT                   KRGTTPVLSVSDKWVYNFINRHPLLSSRFSRRYNYERAKCEDPKIITEWFNLIQKTILX
FT                   FGIDPDNIYNFNKTGFAIGLTATAKVITRSEYYGRRTLLXPRNREXVTIIECTNATSXA
FT                   LPPCMIFKGKVFIESSTASRRTSDLRLVLIDRPLMKLDFALKKLFIPTTSLRTKGGYRL
FT                   LILNGHRSHLTPRFDEICEENKIILICMPPHSSYLLXPLDIGCFTVLKRSYGRMVKIKM
FT                   RNGINHIDKLDFLEVYPLARIEAFKSETIKNSFRVAGLVPFTPERVISKLNIRLRTPTP
FT                   PPSRGSDWDPKTPSNYIQLEKQASSIKVLLRIRSKSPLSPLNSAINQVLKAYQITMQSA
FT                   ALLEKEVSDLRAENEKKKQKRTRSIRTIVHEGDLLVQEVRELRSEPFKAQVARINNYRE
FT                   RVSEGLRPPPQAGRACGICRKPGHRRETCPDR"
FT   exon            complement(836240..836785)
FT                   /gene="Pc13g03570"
FT                   /locus_tag="PCH_Pc13g03570"
FT                   /number=1
FT   intron          complement(836786..836834)
FT                   /gene="Pc13g03570"
FT                   /locus_tag="PCH_Pc13g03570"
FT                   /number=1
FT   exon            complement(836835..837065)
FT                   /gene="Pc13g03570"
FT                   /locus_tag="PCH_Pc13g03570"
FT                   /number=2
FT   intron          complement(837066..837164)
FT                   /gene="Pc13g03570"
FT                   /locus_tag="PCH_Pc13g03570"
FT                   /number=2
FT   exon            complement(837165..839109)
FT                   /gene="Pc13g03570"
FT                   /locus_tag="PCH_Pc13g03570"
FT                   /number=3
FT   mRNA            join(<839678..839710,839764..843140,843230..>843257)
FT                   /gene="Pc13g03580"
FT                   /locus_tag="PCH_Pc13g03580"
FT   CDS_pept        join(839678..839710,839764..843140,843230..843257)
FT                   /gene="Pc13g03580"
FT                   /locus_tag="PCH_Pc13g03580"
FT                   /note="Title: similarity to hypothetical protein
FT                   SPCC622.13c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03580"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91427"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U8"
FT                   /inference="similar to AA sequence:PIR:T41493"
FT                   /protein_id="CAP91427.1"
FT                   /translation="MDNLRQESFKQLRAPCVELSSVGLRFRGNQASAADVARVLDPVHN
FT                   CLKELARNNTLDEKLAEYAFFPLSHIFNETQRLPARCLESAIHCLRILVADGWRQRLSP
FT                   AMGKQLIILLTLIVGGSPNKAEEKQLPKPKVSEELCIAGFDCLSAIFTVLKGAVPERTI
FT                   YHEIGTATVVDQTVYILLEGIVDDRLDELCLAAAKALQALYARVTDRVVLASIMPRTVS
FT                   ALAKILRPSTQTRRSYKLLETSLQILTELLRAVLNDRVASEVSPPELGSDKVALDEAWL
FT                   KATTTQIKLALANVVQVRRHQRPEVQSAIQDLCLMVIEECQTTLSESLPIMVETVVVLA
FT                   DKEDEGVNEAYRNLTHLATTYPAVLDSLKESLHTWLTSFPRIMQGNDETAKQWGLRQIS
FT                   TVFQILSQVQSGSDLLTSGLASGLCDSVGAVVKQNTNSLQPLASMDAGFNWEVLSTDAR
FT                   SKVFPPIILEHQSQQQTLKDLRSMITRLNLSESGNEITRSIVNRMHTTSGGSAIAPFWL
FT                   AMTFLRDTTTETASFDDFISLDHIEGSISLTGRGGMIEELYYISINILNELSVDGTGDW
FT                   RTSALALESVALQAQQLGEAFRPELMDALYPTLQLLASQNPNLQRHAMTCLNILTSACN
FT                   YPDTSTMIIENVDYLVNSVALKLNTFDVSPYPPQVLFMMVKLCGARLIPYLDDLVDSVF
FT                   GILDLYHGYPKLVEMMFKTLAAVVEEGARKPSLLTIDEGKGNGSHDTRKSQYQNLSISS
FT                   IAADIANRKAKRHAEDALADADGKIPHPKKPWSETYDKPPPEPSIEELLDQAESEEPPL
FT                   PPPKEPEDAEKPLTKTHALLLHIVKSIPSHLTSPSPYLRRSLLSILIDVLPALSQNETS
FT                   FLPLINELWPTVASRVIFPSSQANETSKSLIATPSTESTRKPETPDHQEEIFVTVTACE
FT                   AMEAMCKGAGDFMATRVETEFPRWDRLYRRVWEKVRADAEAANERRARSQATTVPGAVA
FT                   KPGDMASTLHLALSSSLSLSPSTPGSKFFTPHHRLWRALISLFTTVLSHVRLPLEVGDR
FT                   ICEMLCGWIALFVGPEYYFISSRTSMSVDDSASGESMVSVEDAIRAMEAWNVDLTWFAF
FT                   MRHRLGPDVVTTGATDLPFNGDGEPVRLAEYLSADDMD"
FT   exon            839678..839710
FT                   /gene="Pc13g03580"
FT                   /locus_tag="PCH_Pc13g03580"
FT                   /number=1
FT   intron          839711..839763
FT                   /gene="Pc13g03580"
FT                   /locus_tag="PCH_Pc13g03580"
FT                   /number=1
FT   exon            839764..843140
FT                   /gene="Pc13g03580"
FT                   /locus_tag="PCH_Pc13g03580"
FT                   /number=2
FT   intron          843141..843229
FT                   /gene="Pc13g03580"
FT                   /locus_tag="PCH_Pc13g03580"
FT                   /number=2
FT   exon            843230..843257
FT                   /gene="Pc13g03580"
FT                   /locus_tag="PCH_Pc13g03580"
FT                   /number=3
FT   mRNA            complement(<843458..>844699)
FT                   /gene="Pc13g03590"
FT                   /locus_tag="PCH_Pc13g03590"
FT   CDS_pept        complement(843458..844699)
FT                   /gene="Pc13g03590"
FT                   /locus_tag="PCH_Pc13g03590"
FT                   /note="Title: strong similarity to translation initiation
FT                   factor Eif-5 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03590"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91428"
FT                   /db_xref="GOA:B6H1X3"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X3"
FT                   /inference="similar to AA sequence:PIR:A46699"
FT                   /inference="protein motif:PFAM:PF01873"
FT                   /inference="protein motif:PFAM:PF02020"
FT                   /inference="protein motif:COGS:COG1601"
FT                   /inference="protein motif:COGS:COG1326"
FT                   /protein_id="CAP91428.1"
FT                   /translation="MATVNIRRDITDPFYRYKMEKLQAKVEGKGNGIKTVVVNLNSVAQ
FT                   SLSRPPAYLIKYFGFELGAQANAKPSDDRWIINGSHDAPKLQDYLDGFISKFVLCKKCK
FT                   NPETDVIIKDERITLDCKACGQRSDVDPRLKLSTFIVRNQPKGGKKEKKKSRREREKEK
FT                   AANGEEASPGDSQNSENGEDEDLAIEANSDDEVTRQAQAIEAEKEIKDDEWAVDVSEEA
FT                   VKARAKDLPSDLKRALVIEDGDDEGADGPSSYEQLGSWIVDTAAEKGGVTNVTDVEIYM
FT                   KAKEFGIENKHKTVAVLAQSIFDEKIAKQIEGRAGLLKKLITSDRHEKAFLGGTERFVG
FT                   QDHPELVAQVPAILLGYYQNDLVSEETLKAWGAKTSKKYVDISTSKKIHKAARPFIEWL
FT                   ENAESDEESEEESE"
FT   exon            complement(843458..844699)
FT                   /gene="Pc13g03590"
FT                   /locus_tag="PCH_Pc13g03590"
FT                   /number=1
FT   mRNA            join(<845721..845820,845875..846024,846101..846236,
FT                   846294..846701,846753..847129,847183..847283,
FT                   847339..>847593)
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT   CDS_pept        join(845721..845820,845875..846024,846101..846236,
FT                   846294..846701,846753..847129,847183..847283,
FT                   847339..847593)
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /note="unknown EC_number=2.5.1.3"
FT                   /note="unknown EC_number=2.7.1.50"
FT                   /note="Title: strong similarity to thiamin-phosphate
FT                   pyrophosphorylase/hydroxyethylthiazole kinase Thi6
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03600"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91429"
FT                   /db_xref="GOA:B6H1X4"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X4"
FT                   /inference="similar to AA sequence:PIR:A55145"
FT                   /inference="protein motif:PFAM:PF02581"
FT                   /inference="protein motif:PFAM:PF02110"
FT                   /inference="protein motif:COGS:COG2145"
FT                   /protein_id="CAP91429.1"
FT                   /translation="MTVDLSLYLVTDSTPAILKGRDLCTVVESALQGGVTVVQYRDKTN
FT                   DTGVQVETARKLHRVTKKYNVPLLINDRVDVALAIGAEGFTEAKKLLPENAIIGISTSS
FT                   VEEAKKATADGADYIGIGTMFATPTKTNTKSVIGTAGTQVILDAIKDSPIGTVSIGGIN
FT                   HSNVQRVLYQSQSPKKALDGVAIVSAIVGADDPKASAEHFVELIRNPPRFAQIANPPRA
FT                   NEAEALLNEVPQIIRKMVEVHPLVHNMINFVVSNFVANVALSIGASPIMSPYGDEATDL
FT                   CKFDGALLINMGTLTSESVSNYVKAIKAYNDRGNPVVYDPVGAAATHIRRNAVAQLMAG
FT                   GYFDLIKGNEGEIRQVWGSSAVQQRGVDSGPSTLDGNQKATLARDLARRERNVVLLTGA
FT                   TDYLSDGERVIAVENGHPYLGQVTGTGCAIGTISGCFLAAHRSDRLLAVLSGILMYEIA
FT                   AENAAAKEYVRGPGSFVPAFVDELYAIRTAAANGDDSWFAGRAKVHEVKL"
FT   exon            845721..845820
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /number=1
FT   intron          845821..845874
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /number=1
FT   exon            845875..846024
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /number=2
FT   intron          846025..846100
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /number=2
FT   exon            846101..846236
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /number=3
FT   intron          846237..846293
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /number=3
FT   exon            846294..846701
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /number=4
FT   intron          846702..846752
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /number=4
FT   exon            846753..847129
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /number=5
FT   intron          847130..847182
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /number=5
FT   exon            847183..847283
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /number=6
FT   intron          847284..847338
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /number=6
FT   exon            847339..847593
FT                   /gene="Pc13g03600"
FT                   /locus_tag="PCH_Pc13g03600"
FT                   /number=7
FT   mRNA            join(<847843..848062,848101..>848633)
FT                   /gene="Pc13g03610"
FT                   /locus_tag="PCH_Pc13g03610"
FT   CDS_pept        join(847843..848062,848101..848633)
FT                   /gene="Pc13g03610"
FT                   /locus_tag="PCH_Pc13g03610"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   AAF47250.1 - Drosophila melanogaster"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03610"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91430"
FT                   /db_xref="GOA:B6H1X9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X9"
FT                   /inference="similar to AA sequence:TREMBL:AE003464.59"
FT                   /inference="protein motif:COGS:COG1335"
FT                   /inference="protein motif:COGS:COG1535"
FT                   /protein_id="CAP91430.1"
FT                   /translation="MAVTTRASRTRKKPPNFTMQVTNIKPGNPALLYAKPPVSIKRYPL
FT                   KAKADSPSNTVSATSKKNSAMESTNSPNSNQPNSVSTTEKMLRAASTLQIPVFITTQNR
FT                   AKLGNTVTELQQHLNGPHIRADVDKTLFSMITADIEKLIPAPDSTPLDVIIVGIETHIC
FT                   VTQTTLDLLERGHRVYILVDGVSSINPEERGIALARLRDAGAVVTSSESVLFEILGDAA
FT                   HESFRTVSGLVKETKETTKGALGVFSKI"
FT   exon            847843..848062
FT                   /gene="Pc13g03610"
FT                   /locus_tag="PCH_Pc13g03610"
FT                   /number=1
FT   intron          848063..848100
FT                   /gene="Pc13g03610"
FT                   /locus_tag="PCH_Pc13g03610"
FT                   /number=1
FT   exon            848101..848633
FT                   /gene="Pc13g03610"
FT                   /locus_tag="PCH_Pc13g03610"
FT                   /number=2
FT   mRNA            complement(<848773..>849897)
FT                   /gene="Pc13g03620"
FT                   /locus_tag="PCH_Pc13g03620"
FT   CDS_pept        complement(848773..849897)
FT                   /gene="Pc13g03620"
FT                   /locus_tag="PCH_Pc13g03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91431"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y0"
FT                   /protein_id="CAP91431.1"
FT                   /translation="MARLLDLPAELILAIIDYLQVDTKEASLLFDRLGYDQVYSPEPPL
FT                   SVSRLHSFLLANCRLNSLLQPLLYRDIFVRRNVQLKQLSRSLQNNPSLKEHIISATLPW
FT                   HSSMHGTLNGISHFFWFNNLRTLTIYGFCDWDSLKFDDSLIGTSSVECLRLIACGAHEQ
FT                   PLTTLLSWPVALKTLYYGIDKREWRLNYLFQLKRTLWTRAAFMRALQRQKATLVELTLA
FT                   RSWDDEDYLRNGPHLDLSEFTSLKTLRICHTFLGVNSHTPYEAWEGLPHSLEVLEVSYD
FT                   DTDRALFVWANYKYDRFVLHLINHKRTYRTHLHTVIIHSTEKVHDLETGEKRPIGLLTW
FT                   PSLTREAESAGIELKMGLGYEDAPTTRKVTFPSP"
FT   exon            complement(848773..849897)
FT                   /gene="Pc13g03620"
FT                   /locus_tag="PCH_Pc13g03620"
FT                   /number=1
FT   mRNA            complement(join(<850750..852158,852216..>852414))
FT                   /gene="Pc13g03630"
FT                   /locus_tag="PCH_Pc13g03630"
FT   CDS_pept        complement(join(850750..852158,852216..852414))
FT                   /gene="Pc13g03630"
FT                   /locus_tag="PCH_Pc13g03630"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig31_part_i.tfa_1060wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03630"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91432"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X2"
FT                   /protein_id="CAP91432.1"
FT                   /translation="MDAQYPFASRDDIWRVFDELKELHIAQYEQGERLAQLERRRDDDA
FT                   RLRSPWCPVSPFPQSAGAIAPDPTFPSPPDAFKGFDQGHHSAMASSAVGFDAEDEPRRG
FT                   ASRANSVRFDESAIHGNGQASRSSNDLPLRTGSGLSTHPLLERTFSHQSDGRLSSSGHS
FT                   HHSARTNSLRLNTTRLLGTTPIESPLIPPPGLFLLGPVPSIIRCWLTDTFTNGSLLYAA
FT                   VCSGSYVSTLGLSMVREFGMENMIVRESDVQYIKLPLYLPEALIHPSSSRPGTPTHQVP
FT                   TVTIRFVVREIDVGDGSIQIIIGSDVMRAHNADILFSQDKLIMVDDDHNRVSVPLVRPE
FT                   KDSVFKSLCTYPGTSDSGVILGPPTNGNPSVGIIGRPANVPQKPASAPPSARLPGSENI
FT                   DPHKSHLQNSQAHAHISAETRPASAHPPTPEPTKTEDMSCWSSWRRDPKRSTTTQKPAD
FT                   KREMKVFRTGKSASHANSTTSVSAPGSATAEQADKSSVPFTSVHHPTTPSDRHGTLNPV
FT                   GGASAFGWLNSPHHNASS"
FT   exon            complement(850750..852158)
FT                   /gene="Pc13g03630"
FT                   /locus_tag="PCH_Pc13g03630"
FT                   /number=1
FT   intron          complement(852159..852215)
FT                   /gene="Pc13g03630"
FT                   /locus_tag="PCH_Pc13g03630"
FT                   /number=1
FT   exon            complement(852216..852414)
FT                   /gene="Pc13g03630"
FT                   /locus_tag="PCH_Pc13g03630"
FT                   /number=2
FT   mRNA            join(<854373..854487,854564..854703,854820..>855062)
FT                   /gene="Pc13g03640"
FT                   /locus_tag="PCH_Pc13g03640"
FT   CDS_pept        join(854373..854487,854564..854703,854820..855062)
FT                   /gene="Pc13g03640"
FT                   /locus_tag="PCH_Pc13g03640"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_104_scaffold_7.tfa_640cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03640"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91433"
FT                   /db_xref="GOA:B6H1X5"
FT                   /db_xref="InterPro:IPR009332"
FT                   /db_xref="InterPro:IPR038427"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X5"
FT                   /protein_id="CAP91433.1"
FT                   /translation="MDPTTPSDWPPSDLSSSSEDNKKNAPTMDSRPTAKELLDRVDYDI
FT                   SQLLQRFENIIAIAAKKFDGTSHVDAAVEAFQIDVESTALIRAAEDLLALHRLMKELWL
FT                   FGKLDTLGEDERDIQRREKLEEDVKAIQKALDGGLLMPSSEEPDKPEKSEDTEKHRAVP
FT                   EA"
FT   exon            854373..854487
FT                   /gene="Pc13g03640"
FT                   /locus_tag="PCH_Pc13g03640"
FT                   /number=1
FT   intron          854488..854563
FT                   /gene="Pc13g03640"
FT                   /locus_tag="PCH_Pc13g03640"
FT                   /number=1
FT   exon            854564..854703
FT                   /gene="Pc13g03640"
FT                   /locus_tag="PCH_Pc13g03640"
FT                   /number=2
FT   intron          854704..854819
FT                   /gene="Pc13g03640"
FT                   /locus_tag="PCH_Pc13g03640"
FT                   /number=2
FT   exon            854820..855062
FT                   /gene="Pc13g03640"
FT                   /locus_tag="PCH_Pc13g03640"
FT                   /number=3
FT   mRNA            <855551..>856378
FT                   /gene="Pc13g03650"
FT                   /locus_tag="PCH_Pc13g03650"
FT   CDS_pept        855551..856378
FT                   /gene="Pc13g03650"
FT                   /locus_tag="PCH_Pc13g03650"
FT                   /note="unknown EC_number=1.5.1.3"
FT                   /note="Title: similarity to dihydrofolate reductase DHFR
FT                   -Pneumocystis carinii"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03650"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91434"
FT                   /db_xref="GOA:B6H1X6"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X6"
FT                   /inference="similar to AA sequence:TREMBL:AF322062.1"
FT                   /inference="protein motif:PFAM:PF00186"
FT                   /inference="protein motif:COGS:COG0262"
FT                   /protein_id="CAP91434.1"
FT                   /translation="MPPHNPHHLPSLTLIVATTPIRTASTTTKEEITRLGIGLNGTLPW
FT                   PRIKTDMSFFARVTSRPPTPGTTNAIIMGRKTYDSVPGSLRPLAKRINVVITRDTSGSV
FT                   RESVTTELGNMRRKIAAKAAQTQATNSEKGTFDPPKEAAPADPMTDAIVTPSLGAALET
FT                   LDSVYAAQGKLGKIFVIGGAEIYNATLNMGAEELRGRPVRVVMTNVVRKGAVGASASFE
FT                   CDTFFPLDGLHEKNGWRAVSPREVSEWVGEEVDGEWKTDGDVEVQMVGYEKST"
FT   sig_peptide     855551..855619
FT                   /gene="Pc13g03650"
FT                   /locus_tag="PCH_Pc13g03650"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            855551..856378
FT                   /gene="Pc13g03650"
FT                   /locus_tag="PCH_Pc13g03650"
FT                   /number=1
FT   mat_peptide     855620..856375
FT                   /gene="Pc13g03650"
FT                   /locus_tag="PCH_Pc13g03650"
FT   mRNA            complement(join(<856651..856809,856866..857252,
FT                   857306..858506,858657..>859495))
FT                   /gene="Pc13g03660"
FT                   /locus_tag="PCH_Pc13g03660"
FT   CDS_pept        complement(join(856651..856809,856866..857252,
FT                   857306..858506,858657..859495))
FT                   /gene="Pc13g03660"
FT                   /locus_tag="PCH_Pc13g03660"
FT                   /note="Title: strong similarity to chloride channel 3 clcn3
FT                   - Mus musculus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91435"
FT                   /db_xref="GOA:B6H1X7"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X7"
FT                   /inference="similar to AA sequence:TREMBL:AF029347.1"
FT                   /inference="protein motif:PFAM:PF00654"
FT                   /inference="protein motif:COGS:COG0038"
FT                   /protein_id="CAP91435.1"
FT                   /translation="MPRSLPKTSFASREQEDTENTRSAQTAPPSPSAYRRSQSYLSETH
FT                   TEYQSLDPPLEITEATSLLGPQAARRRGPRRSYTSTSGVSGTGPDSLRHVLAAGSLRRT
FT                   RNHSRANSMGRRVSRRGSIDGDGEPASLPPSTKDNLTASAFLDERTWYDQFTSTDWVHD
FT                   SIADGARLRLLRQRKDVRGRLLAAFDGAQGWILVALIGCITASIAYFVDVTEGSVFDLK
FT                   EGFCTTQFFRNKRTCCEGLATCDAWRPWSRIFSPSGTERQWVDFVIFVIWVVTLALISP
FT                   PHGTLPNYPPRPAMIYYSAAGSGVAEVKVINSGFVLHGYMGLKTLVIKTIGLIFSVSSG
FT                   LSLGKEGPYVHIATCVGNISCRLFDKYNQNDGKRREVLSASAASGVAVAFGAPIGGVLF
FT                   SLEEVSYYFPPKTLFRTFFCCIAATLSLKFLNPYGTGKIVLFEVRYLSDWQIFEIFIFI
FT                   LLGIMGGAAGALFIKASSLWARSFRRIPAIKRWPMFEVFLVALFTGLVSFWNRYTSLPV
FT                   TELLFELASPCESDVESTGLCPRTDGILEIVQDLLVAFVIKSFLTIITFGIKVPAGIYV
FT                   PSMVVGGLMGRIVGHLIQYWALRHPTFFLFDSCPAVAGIESCVTPGVYALIAAGATMCG
FT                   VTRLSVTLPVILFELTGSLNHVLPFSLSVLCAKWTADAIEPRSIYDLLTDMNSYPFLDS
FT                   KLQPTTDAVLGDIVRPVRKNRIIDISASPFLPATELRLKLEHLLMAGELDSGLPILCDG
FT                   VLAGLIPAPDLEYALDTLGDEEENTICLMTMDASTVLYDSDNEDAEQVDFSRYIDPAPI
FT                   ALDVHSPIDLVYQCFAKLGLRYLCVTQNGKYAGLVHKKAFVKFMKENSD"
FT   exon            complement(856651..856809)
FT                   /gene="Pc13g03660"
FT                   /locus_tag="PCH_Pc13g03660"
FT                   /number=1
FT   intron          complement(856810..856865)
FT                   /gene="Pc13g03660"
FT                   /locus_tag="PCH_Pc13g03660"
FT                   /number=1
FT   exon            complement(856866..857252)
FT                   /gene="Pc13g03660"
FT                   /locus_tag="PCH_Pc13g03660"
FT                   /number=2
FT   intron          complement(857253..857305)
FT                   /gene="Pc13g03660"
FT                   /locus_tag="PCH_Pc13g03660"
FT                   /number=2
FT   exon            complement(857306..858506)
FT                   /gene="Pc13g03660"
FT                   /locus_tag="PCH_Pc13g03660"
FT                   /number=3
FT   intron          complement(858507..858656)
FT                   /gene="Pc13g03660"
FT                   /locus_tag="PCH_Pc13g03660"
FT                   /number=3
FT   exon            complement(858657..859495)
FT                   /gene="Pc13g03660"
FT                   /locus_tag="PCH_Pc13g03660"
FT                   /number=4
FT   mRNA            join(<862510..862642,862707..862746,862796..862874,
FT                   862950..863340,863394..>863527)
FT                   /gene="Pc13g03670"
FT                   /locus_tag="PCH_Pc13g03670"
FT   CDS_pept        join(862510..862642,862707..862746,862796..862874,
FT                   862950..863340,863394..863527)
FT                   /gene="Pc13g03670"
FT                   /locus_tag="PCH_Pc13g03670"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig31_part_i.tfa_1050wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91436"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X8"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /inference="protein motif:COGS:COG2755"
FT                   /inference="protein motif:COGS:COG3240"
FT                   /protein_id="CAP91436.1"
FT                   /translation="MAAIEKGNEDAFKPYDQFLLFGDSITQMGCNQELGFAFHAALQES
FT                   YSRKLDVINRGLAGYTTAHAVKVFDKFFPSPQTANVRFMTIFFGANDACVPTHDQHVPL
FT                   DQYKKNLKTIIQHPATRAQNPRLMLITPPPVNEYQIEEFDASKNTPFPSRTASFTKSYA
FT                   LAACEVGASLNVPVVDLWSAFMKITGWKEGDPLIGARDVPRNDKLASLLTDGLHLTPAG
FT                   NRIVYDEIMKVVQANWPDQTPETLPMVFPAWGDAPK"
FT   exon            862510..862642
FT                   /gene="Pc13g03670"
FT                   /locus_tag="PCH_Pc13g03670"
FT                   /number=1
FT   intron          862643..862706
FT                   /gene="Pc13g03670"
FT                   /locus_tag="PCH_Pc13g03670"
FT                   /number=1
FT   exon            862707..862746
FT                   /gene="Pc13g03670"
FT                   /locus_tag="PCH_Pc13g03670"
FT                   /number=2
FT   intron          862747..862795
FT                   /gene="Pc13g03670"
FT                   /locus_tag="PCH_Pc13g03670"
FT                   /number=2
FT   exon            862796..862874
FT                   /gene="Pc13g03670"
FT                   /locus_tag="PCH_Pc13g03670"
FT                   /number=3
FT   intron          862875..862949
FT                   /gene="Pc13g03670"
FT                   /locus_tag="PCH_Pc13g03670"
FT                   /number=3
FT   exon            862950..863340
FT                   /gene="Pc13g03670"
FT                   /locus_tag="PCH_Pc13g03670"
FT                   /number=4
FT   intron          863341..863393
FT                   /gene="Pc13g03670"
FT                   /locus_tag="PCH_Pc13g03670"
FT                   /number=4
FT   exon            863394..863527
FT                   /gene="Pc13g03670"
FT                   /locus_tag="PCH_Pc13g03670"
FT                   /number=5
FT   mRNA            complement(join(<863785..863820,863919..863954,
FT                   864010..864180,864234..864312,864365..864661,
FT                   864714..864790,864845..864867,864926..>864935))
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT   CDS_pept        complement(join(863785..863820,863919..863954,
FT                   864010..864180,864234..864312,864365..864661,
FT                   864714..864790,864845..864867,864926..864935))
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /note="Title: similarity to hypothetical protein BAA90629.1
FT                   - Oryza sativa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03680"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91437"
FT                   /db_xref="GOA:B6H1Y1"
FT                   /db_xref="InterPro:IPR006973"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y1"
FT                   /inference="similar to AA sequence:TREMBL:AP001129.24"
FT                   /inference="protein motif:PFAM:PF04889"
FT                   /protein_id="CAP91437.1"
FT                   /translation="MTTAHRPTFDPAQGKEALRGPAYHQRLLPAHTHLKVRQPGQGGEA
FT                   DAHLSPRDLRAELLQAEAAHFAKKNGVPVEQPAIAESSVPKRQLEAAPEDGIDGDIKEE
FT                   DPEAKRRRILEETRDIDADSDGSEEDSSDEDSDDDEAAELMRELEKIKKERLEQKEKEE
FT                   RERALEEEEQREVDIARGNPLLNSQDFNMKRRWDDDVVFKNQARGTENRDGKEFVNDLL
FT                   RSDFHKRFMISVLEGFQLSE"
FT   exon            complement(863785..863820)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=1
FT   intron          complement(863821..863918)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=1
FT   exon            complement(863919..863954)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=2
FT   intron          complement(863955..864009)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=2
FT   exon            complement(864010..864180)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=3
FT   intron          complement(864181..864233)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=3
FT   exon            complement(864234..864312)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=4
FT   intron          complement(864313..864364)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=4
FT   exon            complement(864365..864661)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=5
FT   intron          complement(864662..864713)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=5
FT   exon            complement(864714..864790)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=6
FT   intron          complement(864791..864844)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=6
FT   exon            complement(864845..864867)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=7
FT   intron          complement(864868..864925)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=7
FT   exon            complement(864926..864935)
FT                   /gene="Pc13g03680"
FT                   /locus_tag="PCH_Pc13g03680"
FT                   /number=8
FT   mRNA            join(<865194..865357,865417..865536,865596..>866205)
FT                   /gene="Pc13g03690"
FT                   /locus_tag="PCH_Pc13g03690"
FT   CDS_pept        join(865194..865357,865417..865536,865596..866205)
FT                   /gene="Pc13g03690"
FT                   /locus_tag="PCH_Pc13g03690"
FT                   /note="Title: strong similarity to 75-kD autoantigen PM-Sc1
FT                   - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03690"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91438"
FT                   /db_xref="GOA:B6H218"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR033100"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:B6H218"
FT                   /inference="similar to AA sequence:TREMBL:HSAUTOANT.1"
FT                   /inference="protein motif:PFAM:PF01138"
FT                   /inference="protein motif:COGS:COG2123"
FT                   /inference="protein motif:COGS:COG1185"
FT                   /protein_id="CAP91438.1"
FT                   /translation="MSKEAQLSIAERDFILEALRENVRLDGRQPDDYRPLNISFGEEYG
FT                   HVNLQLGKTNIIVRISAEVTKPREDRPFDGLFNINLELTAMGSPAWESGRTNDIEAYAT
FT                   NTLDRIIRHSNALDTESLCILKGVSCWSIRADVHVIDYDGNITDAACIAIMAGLQHFRR
FT                   PDAVVRDGRVIVYGVEQRVPVALNITHKPLSVTFHTFNDSKHVIVDATLKEEQAAEGDL
FT                   VIGINSAGDVCYLSKYAGAPADAMVIVKKTNVAWEKVKEINAAVEKVLQADLAKRAKIG
FT                   MADESRAENDRLVQIE"
FT   exon            865194..865357
FT                   /gene="Pc13g03690"
FT                   /locus_tag="PCH_Pc13g03690"
FT                   /number=1
FT   intron          865358..865416
FT                   /gene="Pc13g03690"
FT                   /locus_tag="PCH_Pc13g03690"
FT                   /number=1
FT   exon            865417..865536
FT                   /gene="Pc13g03690"
FT                   /locus_tag="PCH_Pc13g03690"
FT                   /number=2
FT   intron          865537..865595
FT                   /gene="Pc13g03690"
FT                   /locus_tag="PCH_Pc13g03690"
FT                   /number=2
FT   exon            865596..866205
FT                   /gene="Pc13g03690"
FT                   /locus_tag="PCH_Pc13g03690"
FT                   /number=3
FT   mRNA            join(<866999..869928,869983..870286,870337..>871185)
FT                   /gene="Pc13g03700"
FT                   /locus_tag="PCH_Pc13g03700"
FT   CDS_pept        join(866999..869928,869983..870286,870337..871185)
FT                   /gene="Pc13g03700"
FT                   /locus_tag="PCH_Pc13g03700"
FT                   /EC_number="3.6.3.8"
FT                   /note="Title: strong similarity to transport ATPase Drs2
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03700"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91439"
FT                   /db_xref="GOA:B6H219"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B6H219"
FT                   /inference="similar to AA sequence:PIR:S51995"
FT                   /inference="protein motif:COGS:COG0474"
FT                   /protein_id="CAP91439.1"
FT                   /translation="MASGRPPGSHPAAGRDDDLLLDSGPMYSTGQGPPVNDEHLLERYN
FT                   IDDSEQPYAQTQPRPSVSYDNFVGSSVQQGATRHNVASGPAHPPVNPGLHSNDPYSSGT
FT                   RDRTYSQTSGLDNYRRYSLDDFDDGHSGYYDLDADEDRIASSHHVRKANERNSVLGLGG
FT                   GFMGKAKYMFGMGSSQYSEMDLPLTESGARRATVGSDASPAPPPKQRKKFRASDLNIFS
FT                   RKVDPSTLGPRMIQLNNPPANATHKFVSNFVSTAKYNIFTFIPKFLFEQFSKYANLFFL
FT                   FTAVLQQIPNVSPTNRYTTIVPLAIVLAVSAIKELVEDYKRRMSDRGLNYSKTQVLKGS
FT                   SFHEAKWVDVVVGDIVRVESEQPFPADLVLLASSEPEGLCYIETANLDGETNLKVKQAI
FT                   PETAHLVSPSDLSRLSGRVRSEQPNSSLYTYEATLTMNAGGGEKELPLAPDQLLLRGAT
FT                   LRNTPWIHGIVVFSGHETKLMRNATATPIKRTAVERTVNIQILMLVSILIVLSVISSVG
FT                   DLAIRKTRSSTLAYLGYGGSVKLVKQFFMDIFTYWVLYSNLVPISLFVTIEIVKYFQAF
FT                   LINSDLDIYYDKTDTPAICRTSSLVEELGQIEYIFSDKTGTLTCNMMEFKQVSIAGVQY
FT                   GDDVPEDRRATVEDGAEIGIHDFKTLKKNLQSHPSQNAIREFLTLLATCHTVIPERNSE
FT                   DPNVIKYQAASPDEGALVDGAASLGFRFTNRRPRSVIFEVGGQELEYELLAVCEFNSTR
FT                   KRMSTIFRCPDGKVRVYCKGADTVILERLHPDNPTVEATLQHLEEYASDGLRTLCLAMR
FT                   EVPENEFQQWHQIYDKASTTVDGNRADELDKAAELIEKDFYLLGATAIEDRLQDGVPDT
FT                   IHTLQTAGIKIWVLTGDRQETAINIGMSCKLISEDMTLLIINEETSEATRDSLQKKMDA
FT                   VQSQISAGDSEPLALVIDGRSLTFALEKDMEKLFLDLAVICKAVVCCRVSPLQKALVVK
FT                   LVKRHKKALLLAIGDGANDVSMIQAAHVGVGISGVEGLQAARSADVAIGQFRFLRKLLL
FT                   VHGAWSYSRISRVILYSYYKNITLYMTQFWYSFQNAFSGEVIYESWTLSFYNVLFTVLP
FT                   PFAMGIFDQFISARLLDRYPQLYQLGQRGIFFKKHSFWAWILNGFFHSLILYIVSELLY
FT                   YWDLPMENGHVAGHWVWGESLYTAVLGTVLGKAALITNVWTKYTFIAIPGSMALWLIFL
FT                   PAYGYAAPALGFSREYYGTIPVLFKSPIFYLMAIVLPCICLLRDYAWKYAKRMYYPQQY
FT                   HHVQEIQKYNVQDYRPRMEQFQKAIRKVRQVQRMRKQRGYAFSQADDGGQMRVLNAYDT
FT                   TRSRGRYGEMASSRPMA"
FT   exon            866999..869928
FT                   /gene="Pc13g03700"
FT                   /locus_tag="PCH_Pc13g03700"
FT                   /number=1
FT   intron          869929..869982
FT                   /gene="Pc13g03700"
FT                   /locus_tag="PCH_Pc13g03700"
FT                   /number=1
FT   exon            869983..870286
FT                   /gene="Pc13g03700"
FT                   /locus_tag="PCH_Pc13g03700"
FT                   /number=2
FT   intron          870287..870336
FT                   /gene="Pc13g03700"
FT                   /locus_tag="PCH_Pc13g03700"
FT                   /number=2
FT   exon            870337..871185
FT                   /gene="Pc13g03700"
FT                   /locus_tag="PCH_Pc13g03700"
FT                   /number=3
FT   mRNA            complement(<871784..>873772)
FT                   /gene="Pc13g03710"
FT                   /locus_tag="PCH_Pc13g03710"
FT   CDS_pept        complement(871784..873772)
FT                   /gene="Pc13g03710"
FT                   /locus_tag="PCH_Pc13g03710"
FT                   /note="unknown EC_number=2.7.7.7"
FT                   /note="Title: similarity to DNA polymerase lambda POL
FT                   lambda - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03710"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91440"
FT                   /db_xref="GOA:B6H216"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR018944"
FT                   /db_xref="InterPro:IPR022312"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR028207"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:B6H216"
FT                   /inference="similar to AA sequence:TREMBL:AF161019.1"
FT                   /inference="protein motif:COGS:COG1796"
FT                   /inference="protein motif:COGS:COG1204"
FT                   /protein_id="CAP91440.1"
FT                   /translation="MIAWPDSSLKDKTEHVSIFSSQPPIFILPMHLSLEELDEVEGRVI
FT                   DYGGRLTYDIAEAGLVLGKVGRAKRAALELRTRGVWTEELIPSSASKSTGGAEPPVKRR
FT                   RTAQYDGTKDVPVEIIDLSTGSEGEDGTTNQHGSPKHPIPEGEAKAIKDSITVLKLEWL
FT                   DASITSGKCVSQDSFVVYRGRKIPSPPPTTGAENKQNLLQKSNQIIERAKQDAGLPTPR
FT                   TPPPDHIHARRSREPPDGYSQRHRPTLYRQTTSEHEKEVENAPPQPDWVRDHVVYACLR
FT                   SAPLHPPNEDFISQLVKIRRIRELTLDEIGVRAYSTSIAALAAYPHPIQRPSEILALPG
FT                   CNAKIADLFFQFQQHGGCEHTDDDGNVAAAEALETDPMLRVLNSFYQIWGVGAKTARDF
FT                   YQRGWRDLDDIVEHGWDTLSRVQQIGVKFYEEFLEGVPRAESEGIASVIRDHAGRVRGE
FT                   EGNGIECVIVGGYRRGKELSGDVDIVVSHRDDAVTRNLVVDVVASLEAERYITHTLALH
FT                   LTSSLREQQTLPFDGDDRRKFDTLDKALVVWQDPDFDDTTPGHNEHQGKKKNPNIHRRV
FT                   DIIISPWRTVGCAVLGWSGDMTFERDLRRYAKKARSLKFDSSGVRDRVSGRQVDLERDG
FT                   ETWEEREKLVMEGLGIGWRPPEERCSR"
FT   exon            complement(871784..873772)
FT                   /gene="Pc13g03710"
FT                   /locus_tag="PCH_Pc13g03710"
FT                   /number=1
FT   mRNA            join(<874634..874792,874874..874910,874995..875048,
FT                   875103..875219,875371..875411,875513..875561,
FT                   875633..875698,875827..875978,875996..876064,
FT                   876095..876236,876298..876347,876367..876469,
FT                   876548..876687,876776..876809,876850..876907,
FT                   876978..877559,877617..877716,877807..877924,
FT                   878484..878696,878780..878842,878922..878968,
FT                   879058..879132,879180..>879557)
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT   CDS_pept        join(874634..874792,874874..874910,874995..875048,
FT                   875103..875219,875371..875411,875513..875561,
FT                   875633..875698,875827..875978,875996..876064,
FT                   876095..876236,876298..876347,876367..876469,
FT                   876548..876687,876776..876809,876850..876907,
FT                   876978..877559,877617..877716,877807..877924,
FT                   878484..878696,878780..878842,878922..878968,
FT                   879058..879132,879180..879557)
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03720"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91441"
FT                   /db_xref="UniProtKB/TrEMBL:B6H217"
FT                   /protein_id="CAP91441.1"
FT                   /translation="MSLRAGRGYNASMVASKRCEESTGKTHLTKKVDKATCVQVGPRGF
FT                   TRGLIGNMLANLLACPEADYDQPTDCPEGKACHGQARCDQPAVFPEAKRTDTVRLEVVD
FT                   RSGFVDQRADCRVAEDGHDWKWLNGVPRLIEVAADRPKAEARRSQTRSGVLVAQPADCP
FT                   EPKARHAQTGSAEARHGQTGSGGSWLIGVGIEVVDWGVLTHQPADCPKAEARHGQTGGW
FT                   LIGPADCPEAEARHGQTGSGGSWSIESADCPEAKARHGQTGSGGSWSIEVVDWGVLTDQ
FT                   SADCPEAKARHGQTAEARHGQTGSGGSWLIVVVDWGLVDWGLVDWGVLTDQPTDCPEAE
FT                   ARHGQAGPPRSDWGLVDWGWLTDQPADCPEAEAEARHGQTGSGGSWLIGVGIELTHRPN
FT                   AEARHVLIDQSADCPEAEARHGQTGLPIVLKPRPATVRLIVGDLTAWLGSLIAQPADCP
FT                   EAEARHGQTGSGGSWLVEVGIEVVDLGVLTHQPADCPEAEARHGQTGSGGSWLVEVGIE
FT                   VVDLGVLTHQPADCPEAEARHGQTGSGGSWLIGVGIEVVDWGVLTHQPADCPEAEARHG
FT                   QTGSGGSWLIGVGIEVVDWGVLTDQSADCPEAEARHGQTGSGRSPPRSDWEWFIGGWLI
FT                   EMDRVVDRRVHRGSAMIPKKQRRDSFPASATGLVRSSTHCEPKEPLGLITLEFSPATGL
FT                   VRSSTHCEPKEPLGLITLEFSPGMKIERNSGSTRHSSLEGDRGGQCSWWMVLRHDQDGR
FT                   SMVEGDHGGMTTMEGPWWMGSWWKVSMVDGMTKMEGPWWMGSWWKGSKVQGGWGQGPRS
FT                   MLGRVMMEGPEVTVVEGGILKSGGGISEKKKRCGGEKERRRENLGKRGYLYFFQWLKDR
FT                   KALGSATSSDKMGRNAGEPIETRRDTRNLPGRSFPTGPGCLLGYIHPWTCRGYAMEDIW
FT                   ILRTVHFENTNQIILARM"
FT   exon            874634..874792
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=1
FT   intron          874793..874873
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=1
FT   exon            874874..874910
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=2
FT   intron          874911..874994
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=2
FT   exon            874995..875048
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=3
FT   intron          875049..875102
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=3
FT   exon            875103..875219
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=4
FT   intron          875220..875370
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=4
FT   exon            875371..875411
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=5
FT   intron          875412..875512
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=5
FT   exon            875513..875561
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=6
FT   intron          875562..875632
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=6
FT   exon            875633..875698
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=7
FT   intron          875699..875826
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=7
FT   exon            875827..875978
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=8
FT   intron          875979..875995
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=8
FT   exon            875996..876064
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=9
FT   intron          876065..876094
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=9
FT   exon            876095..876236
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=10
FT   intron          876237..876297
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=10
FT   exon            876298..876347
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=11
FT   intron          876348..876366
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=11
FT   exon            876367..876469
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=12
FT   intron          876470..876547
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=12
FT   exon            876548..876687
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=13
FT   intron          876688..876775
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=13
FT   exon            876776..876809
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=14
FT   intron          876810..876849
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=14
FT   exon            876850..876907
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=15
FT   intron          876908..876977
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=15
FT   exon            876978..877559
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=16
FT   intron          877560..877616
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=16
FT   exon            877617..877716
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=17
FT   intron          877717..877806
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=17
FT   exon            877807..877924
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=18
FT   intron          877925..878483
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=18
FT   exon            878484..878696
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=19
FT   intron          878697..878779
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=19
FT   exon            878780..878842
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=20
FT   intron          878843..878921
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=20
FT   exon            878922..878968
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=21
FT   intron          878969..879057
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=21
FT   exon            879058..879132
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=22
FT   intron          879133..879179
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=22
FT   exon            879180..879557
FT                   /gene="Pc13g03720"
FT                   /locus_tag="PCH_Pc13g03720"
FT                   /number=23
FT   mRNA            complement(join(<879564..880189,880251..880396,
FT                   880460..880738,880789..880874,880930..881002,
FT                   881071..881081,881135..>881341))
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT   CDS_pept        complement(join(879564..880189,880251..880396,
FT                   880460..880738,880789..880874,880930..881002,
FT                   881071..881081,881135..881341))
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /note="Title: strong similarity to high affinity nickel
FT                   transporter - Ralstonia eutropha"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03730"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91442"
FT                   /db_xref="GOA:B6H220"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:B6H220"
FT                   /inference="similar to AA sequence:TREMBL:AF261712.1"
FT                   /inference="protein motif:PFAM:PF03824"
FT                   /inference="protein motif:COGS:COG3376"
FT                   /protein_id="CAP91442.1"
FT                   /translation="MSGFNELVDTDLRGLDSDRKWSLQPLLRSAERSHSKMPGIRKIPL
FT                   RAIGIIAFIALLNIIVWVAAAIVLSYHHSLVSTAALAYSLGLRHAFDADHISAIDLMTR
FT                   RLLATGQKPVTVGTFFSLGHSTIVIITSIVVAATAAAVSERFDSFSTVGGIIGTSVSAA
FT                   FLILLGLMNAYILYKLVKQMEKVFNLPEGHEDEAWKIEGGGILFSVLKKMFKLIDRSWK
FT                   MYPLGILFGLGFDTSSEIALLGISSIEAAKGTSFWVILILPALFTAGMCLLDTIDGALM
FT                   FSLYIQPAANFLPQKPTSDVSDTSSTATDPDELPQSQDNHRDPVAFLYYSIVLTTLTVI
FT                   VAIVIGIIQLLTLILNVTDAKGKFWDGVQVAGDYYDAIGGGICGCFIVFGLLSVLVYKP
FT                   WRRWMDQRHGKHVANDVERYTDDDISRGDAPGYGAIVTETSRTQHEGTATEVTGKGPAS
FT                   RVAVKETGESRLEDHIM"
FT   exon            complement(879564..880189)
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /number=1
FT   intron          complement(880190..880250)
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /number=1
FT   exon            complement(880251..880396)
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /number=2
FT   intron          complement(880397..880459)
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /number=2
FT   exon            complement(880460..880738)
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /number=3
FT   intron          complement(880739..880788)
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /number=3
FT   exon            complement(880789..880874)
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /number=4
FT   intron          complement(880875..880929)
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /number=4
FT   exon            complement(880930..881002)
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /number=5
FT   intron          complement(881003..881070)
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /number=5
FT   exon            complement(881071..881081)
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /number=6
FT   intron          complement(881082..881134)
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /number=6
FT   exon            complement(881135..881341)
FT                   /gene="Pc13g03730"
FT                   /locus_tag="PCH_Pc13g03730"
FT                   /number=7
FT   mRNA            complement(join(<882466..882759,882922..>883629))
FT                   /gene="Pc13g03740"
FT                   /locus_tag="PCH_Pc13g03740"
FT   CDS_pept        complement(join(882466..882759,882922..883629))
FT                   /gene="Pc13g03740"
FT                   /locus_tag="PCH_Pc13g03740"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig31_part_i.tfa_960wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91443"
FT                   /db_xref="UniProtKB/TrEMBL:B6H221"
FT                   /protein_id="CAP91443.1"
FT                   /translation="MGGMRLPRPTGIYVPSSPRTLTNDMISPPLSPEFSFDSETVTPSL
FT                   LPALEYISSKLQQRMMHVTLLIGRGKPYPTGQPSDLMIIPIHTIEPQAWRVLERAIAKA
FT                   SKKFSLGPGWTDAISRSQYERQANDHLVKQSILQNEVIFSQEGLTLLNMDRIYTFKRRM
FT                   CILSTRPFSRNNEQSMSSCIRLLHRIVADFSGRPFSKAFFHRIYEQLDVPDEQLTAVAV
FT                   AYKNVHNQDAIILPPKVERVLLKPKADPIPIRVKAERHREVKRSPIQTVRGRRHPPPSM
FT                   RGHNKRGPKTPLSASDVTPITRNEWNILVSQDIRVQPKVTKWTPSPTVLAAA"
FT   exon            complement(882466..882759)
FT                   /gene="Pc13g03740"
FT                   /locus_tag="PCH_Pc13g03740"
FT                   /number=1
FT   intron          complement(882760..882921)
FT                   /gene="Pc13g03740"
FT                   /locus_tag="PCH_Pc13g03740"
FT                   /number=1
FT   exon            complement(882922..883629)
FT                   /gene="Pc13g03740"
FT                   /locus_tag="PCH_Pc13g03740"
FT                   /number=2
FT   mRNA            complement(join(<885456..885589,885669..885816,
FT                   885890..>886021))
FT                   /gene="Pc13g03750"
FT                   /locus_tag="PCH_Pc13g03750"
FT   CDS_pept        complement(join(885456..885589,885669..885816,
FT                   885890..886021))
FT                   /gene="Pc13g03750"
FT                   /locus_tag="PCH_Pc13g03750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03750"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91444"
FT                   /db_xref="UniProtKB/TrEMBL:B6H222"
FT                   /protein_id="CAP91444.1"
FT                   /translation="MSAKLNPGEMCLFGVWAFEPRRFAYGSANPYLSWRVCAWPGRIKN
FT                   WPGVAQVALVSRLSEQRYIRGVKASSISATYLQNIFWHTPSAEEVDIPVGMPSINSKFL
FT                   NPFATFATSFCTGECPNAHCSETKSDGGDKRQG"
FT   exon            complement(885456..885589)
FT                   /gene="Pc13g03750"
FT                   /locus_tag="PCH_Pc13g03750"
FT                   /number=1
FT   intron          complement(885590..885668)
FT                   /gene="Pc13g03750"
FT                   /locus_tag="PCH_Pc13g03750"
FT                   /number=1
FT   exon            complement(885669..885816)
FT                   /gene="Pc13g03750"
FT                   /locus_tag="PCH_Pc13g03750"
FT                   /number=2
FT   intron          complement(885817..885889)
FT                   /gene="Pc13g03750"
FT                   /locus_tag="PCH_Pc13g03750"
FT                   /number=2
FT   exon            complement(885890..886021)
FT                   /gene="Pc13g03750"
FT                   /locus_tag="PCH_Pc13g03750"
FT                   /number=3
FT   mRNA            join(<887007..887163,887214..887271,887338..887344,
FT                   887397..887557,887607..>888936)
FT                   /gene="Pc13g03760"
FT                   /locus_tag="PCH_Pc13g03760"
FT   CDS_pept        join(887007..887163,887214..887271,887338..887344,
FT                   887397..887557,887607..888936)
FT                   /gene="Pc13g03760"
FT                   /locus_tag="PCH_Pc13g03760"
FT                   /note="Title: strong similarity to dicarboxylic amino acid
FT                   permease Dip5 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03760"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91445"
FT                   /db_xref="GOA:B6H232"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B6H232"
FT                   /inference="similar to AA sequence:PIR:S65298"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /inference="protein motif:COGS:COG0833"
FT                   /protein_id="CAP91445.1"
FT                   /translation="MEKSIKAEEYPDHTVAREFSEDGKIEQGQSGLNDPNHVELHRALK
FT                   ARHITMIAIGGAIGTGLIIGTGEALAKAGPGAILISYAWVGFIVFLVMCALGEMAAWLP
FT                   LPSGFTGYAVRFVDPALGFTLGWTYWFKYIILSPNQMTAGAMVISYWIPPEKVNAGVWI
FT                   TIFLVIVVAINYFGVKFFGEFEFWLSSFKVIVILGIILMSFILMLGGGPDHDRKGFRYW
FT                   KEPGAFNTYKMDGAPGRFLAFWSTMVSATFAYLGTELVGVTVGEAQNPRKTIPRAIKLT
FT                   FYRILVFYVTSVLLVGTLVPYNSPKLLFALSDDNKKKGSAAASPFVVAIELAAIPILPH
FT                   ILNACILLFVFSAANSDLYIATRTIYGLAREGKAPKIFARTDRRGVPVPALAISSIIAL
FT                   LGYMNVSSDSKTVFKYFVNLVTIFGLLTWISILVTHIYFVRARKAQGVPEESLAYKAPL
FT                   GVAGSYFALGFCILIAFTKNFDVFIHNPKTYGNFDYKNFITAYLGIPLYLIMIFGYKFA
FT                   TGSKGVDPMTADLFTGKDEIDREEALYLARKEAETEKHNNAGWFYRTFVSWLF"
FT   exon            887007..887163
FT                   /gene="Pc13g03760"
FT                   /locus_tag="PCH_Pc13g03760"
FT                   /number=1
FT   intron          887164..887213
FT                   /gene="Pc13g03760"
FT                   /locus_tag="PCH_Pc13g03760"
FT                   /number=1
FT   exon            887214..887271
FT                   /gene="Pc13g03760"
FT                   /locus_tag="PCH_Pc13g03760"
FT                   /number=2
FT   intron          887272..887337
FT                   /gene="Pc13g03760"
FT                   /locus_tag="PCH_Pc13g03760"
FT                   /number=2
FT   exon            887338..887344
FT                   /gene="Pc13g03760"
FT                   /locus_tag="PCH_Pc13g03760"
FT                   /number=3
FT   intron          887345..887396
FT                   /gene="Pc13g03760"
FT                   /locus_tag="PCH_Pc13g03760"
FT                   /number=3
FT   exon            887397..887557
FT                   /gene="Pc13g03760"
FT                   /locus_tag="PCH_Pc13g03760"
FT                   /number=4
FT   intron          887558..887606
FT                   /gene="Pc13g03760"
FT                   /locus_tag="PCH_Pc13g03760"
FT                   /number=4
FT   exon            887607..888936
FT                   /gene="Pc13g03760"
FT                   /locus_tag="PCH_Pc13g03760"
FT                   /number=5
FT   mRNA            complement(join(<889594..890787,890839..>891213))
FT                   /gene="Pc13g03770"
FT                   /locus_tag="PCH_Pc13g03770"
FT   CDS_pept        complement(join(889594..890787,890839..891213))
FT                   /gene="Pc13g03770"
FT                   /locus_tag="PCH_Pc13g03770"
FT                   /note="unknown EC_number=3.4.17.-"
FT                   /note="Title: strong similarity to Ecm14 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03770"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91446"
FT                   /db_xref="GOA:B6H233"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H233"
FT                   /inference="similar to AA sequence:PIR:S48976"
FT                   /inference="protein motif:PFAM:PF00246"
FT                   /inference="protein motif:COGS:COG2866"
FT                   /inference="protein motif:COGS:COG3608"
FT                   /protein_id="CAP91446.1"
FT                   /translation="MRLFSPILVASTLIPLISAVPAGSSITPPPPLQPSYFTHSSPRPW
FT                   ARLRDWIIGSIWDIDHKHRSSKHSSPPSNIHDRYGSDVVLRFHLRQPDEAEALASASQV
FT                   LFLDIWAITSEFVDIRLADDMIPSLLDLLPLTLRTSYTPLMDNLADEIYASYPSRHRSD
FT                   SDFKSGLASAELKTISNCDLFFQEYQPLSVITQWMRLMASMFSSHVRMTSVGVSYEGRD
FT                   IPALRLGTSHNTETTSGPRKTILIVGGSHAREWISTSTVTYVAYSLITHYGYSPAVTRL
FT                   LHEYDWVLIPTINPDGYVYSWESDRLWRKNRQPTGLPLCPGVDLDRAWDYEWDGESTRS
FT                   NPCSENYAGAEPFEALESQRLAQWAQNQTAHGGAEIVGFLDLHSYSQQILYPYSYSCSS
FT                   VPPTLESLEELALGLAKAIRQTSHESYDVTSACEGILTQGAAAGITSGGSALDWFYHKL
FT                   HTRFSYQIKLRDRGSYGFLLPSEHIVPTGKEIFRALLTFGKFVWGEEASDISLEDMTGD
FT                   QIPLN"
FT   exon            complement(889594..890787)
FT                   /gene="Pc13g03770"
FT                   /locus_tag="PCH_Pc13g03770"
FT                   /number=1
FT   mat_peptide     complement(join(889597..890787,890839..891156))
FT                   /gene="Pc13g03770"
FT                   /locus_tag="PCH_Pc13g03770"
FT   intron          complement(890788..890838)
FT                   /gene="Pc13g03770"
FT                   /locus_tag="PCH_Pc13g03770"
FT                   /number=1
FT   exon            complement(890839..891213)
FT                   /gene="Pc13g03770"
FT                   /locus_tag="PCH_Pc13g03770"
FT                   /number=2
FT   sig_peptide     complement(891157..891213)
FT                   /gene="Pc13g03770"
FT                   /locus_tag="PCH_Pc13g03770"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<892017..892383,892452..>896281)
FT                   /gene="Pc13g03780"
FT                   /locus_tag="PCH_Pc13g03780"
FT   CDS_pept        join(892017..892383,892452..896281)
FT                   /gene="Pc13g03780"
FT                   /locus_tag="PCH_Pc13g03780"
FT                   /note="Title: strong similarity to hypothetical Sec76
FT                   domain protein - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03780"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91447"
FT                   /db_xref="GOA:B6H234"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="InterPro:IPR035999"
FT                   /db_xref="UniProtKB/TrEMBL:B6H234"
FT                   /inference="similar to AA sequence:PIR:T38419"
FT                   /inference="protein motif:PFAM:PF01369"
FT                   /inference="protein motif:COGS:COG5307"
FT                   /protein_id="CAP91447.1"
FT                   /translation="MHWKGLRLVADGKRQSTMEPQGQSRRSEHLPRPYPPAEPRLSESI
FT                   PRTPGLSESVNPELPAPDDNGSNHGVAQPDFAGPSSDRSSVRHKRFSFMRLRHASDPQL
FT                   SKSYVRAGQDTPPVPSLPPPKIITTAPTSQELDQPVKQRPRLSFRPSSRKQSMEEMSRR
FT                   SMEQPAKPRRRGQGSTDSQVTDSTLAMSQSITEEPGRLSTNSLRGNPQPNDSQRSSVID
FT                   PRFSESSRSDQSYGDQTITRSISPRDGQSATAAKRFRMPRLKRTRSPLFPLPPKVSHPT
FT                   GVVDNRPKFAPADTPKSETLDGHDHVSPLPSPSRSTVGLAASSNVTPLFRNDSTNSARS
FT                   VRSNPSLKNRGRSSTMGSLAENHDDLSIPPYLASSARTSTSTSGRKSFGDMFNITQRLR
FT                   QNSSPPSPRHGSPTIGGASTPISKQELPTIPKREESDTPASYLTRLEENIPRGMIAGVL
FT                   AQSDEEFYKVCLRKYMRTFSYFGDPLDMSIRKLLMEVELPKETQQIDRFVQAFADRYHE
FT                   CNPGIFTAPDNAYFIAFSLLILHTDVFNKNNKRKMQKADYVKISRSEGISEDILECFYE
FT                   NISYTPFIRVEDANLPDRHLAKPRRTLFKSTSSENLARIAREPVDPYSLILEGKLGSLR
FT                   PSLKDVMDLEDTYNHFGTAGPPDMDALHQAFTKSGILQIISLRSRPDAFMPASLGSPLD
FT                   SNPGLVDIKVAKVGLLWRKDPKKKKARSPWQEWGAILTFSQLYFFRNVNWVRSLMAQHE
FT                   AYVKNGRRGTLVFKPPLAEFKPDNIVSTGDTVALLDSSYKKHKHAFIFVRHNALEETFL
FT                   ASTESEMNDWLAHLNYAAAFRTTGVRTKGMIATNYEGQRYRKSQRLSSISSQKSHQSTD
FT                   IEPHSPSIDTDIVAEFVAARQQLMSQKIRERNEKLAMSQKQLDDLLQNARHLQVLTPLH
FT                   ARARENVIMAAGRLSAKIKWVRQDIWRSKCYRQVLLRDLGEDEEAVESRVGSVAEPTPS
FT                   HSDGARLASLSGPSVTSEPSVEKAGSIVHTVSSADTPEPNMAQTEQPSEAGLLPKPSND
FT                   ELRRPSIPGSATSADIARVGRRRSAVALPERAKSYSPDPATIKLEREASVLSRASRWDG
FT                   ASLASRTSKLTTPVSFDDGEERVLREAGLLELPASPSTQKDDETASNGLPGKDTEGETN
FT                   PKDKSDRPSRVRRSLHRTLRDSHAHRTHSHSKKKRGSVSSIGQEEDDQVSGDGEVLPRK
FT                   APSFTVHGKKASIVTFGSEWQNMPPEERLKLRKPTPHEESRVSDPAILDSGESIMTDRS
FT                   PERPHSARRMSTATGLSVRTSDDPADFTDAQEEQEEQPEEDIGAPGSPVVTSLPTPHPL
FT                   DTQHTPYSPSSTIYGHLSAPRHDGSPSPSPSSTSISERIVDTPSSENLREQAVGA"
FT   exon            892017..892383
FT                   /gene="Pc13g03780"
FT                   /locus_tag="PCH_Pc13g03780"
FT                   /number=1
FT   intron          892384..892451
FT                   /gene="Pc13g03780"
FT                   /locus_tag="PCH_Pc13g03780"
FT                   /number=1
FT   exon            892452..896281
FT                   /gene="Pc13g03780"
FT                   /locus_tag="PCH_Pc13g03780"
FT                   /number=2
FT   mRNA            join(<897002..897553,897635..897890,897948..>898279)
FT                   /gene="Pc13g03790"
FT                   /locus_tag="PCH_Pc13g03790"
FT   CDS_pept        join(897002..897553,897635..897890,897948..898279)
FT                   /gene="Pc13g03790"
FT                   /locus_tag="PCH_Pc13g03790"
FT                   /note="Title: similarity to hypothetical protein T25B24.3
FT                   -Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03790"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91448"
FT                   /db_xref="GOA:B6H235"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016818"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027370"
FT                   /db_xref="UniProtKB/TrEMBL:B6H235"
FT                   /inference="similar to AA sequence:PIR:F96641"
FT                   /protein_id="CAP91448.1"
FT                   /translation="MAHSKRNTSLPHFTSYERGLLRSTWGTKRSAIGRDSFLSFGSCRL
FT                   CLQPARAPVVACASNGDLFCRECAISDLLAQRQEIKRLEKERDEARKRIAGDEERSLAE
FT                   MKERDLRDFELVSMGLENKGGSGVGTKRKAEESEALEKFKAREVEVDGKRKRVFELGEE
FT                   EMARVAGEEKERLRKELKMEKSSSKSALPSFWVPSLTPNTDANEIAANKTVKLTPVCPG
FT                   STDESRHSYSLKSLVEVNFTEEKASDGTVSRVCPSCKKNLSNGLKAMLTKPCGHVICSP
FT                   CVTKFMIPHDHHIPDPHASKEEQEKNAALHGQVLCYVCETDVTAKSTPDGNGSGNNKKS
FT                   KKKDKDAIQPGLVEVSSEGTGFASKGGNMGKKTGVAFQC"
FT   exon            897002..897553
FT                   /gene="Pc13g03790"
FT                   /locus_tag="PCH_Pc13g03790"
FT                   /number=1
FT   intron          897554..897634
FT                   /gene="Pc13g03790"
FT                   /locus_tag="PCH_Pc13g03790"
FT                   /number=1
FT   exon            897635..897890
FT                   /gene="Pc13g03790"
FT                   /locus_tag="PCH_Pc13g03790"
FT                   /number=2
FT   intron          897891..897947
FT                   /gene="Pc13g03790"
FT                   /locus_tag="PCH_Pc13g03790"
FT                   /number=2
FT   exon            897948..898279
FT                   /gene="Pc13g03790"
FT                   /locus_tag="PCH_Pc13g03790"
FT                   /number=3
FT   mRNA            complement(<898483..>899466)
FT                   /gene="Pc13g03800"
FT                   /locus_tag="PCH_Pc13g03800"
FT   CDS_pept        complement(898483..899466)
FT                   /gene="Pc13g03800"
FT                   /locus_tag="PCH_Pc13g03800"
FT                   /note="unknown EC_number=3.1.30.-"
FT                   /note="Title: strong similarity to precursor of
FT                   mitochondrial nuclease Nuc1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03800"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91449"
FT                   /db_xref="GOA:B6H231"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:B6H231"
FT                   /inference="similar to AA sequence:PIR:NCBYN1"
FT                   /inference="protein motif:PFAM:PF01223"
FT                   /inference="protein motif:COGS:COG1864"
FT                   /protein_id="CAP91449.1"
FT                   /translation="MSKATLAVIAAASAATGAGVTALLFSGKPSKPQQETLSPTPTTQN
FT                   PKVPVPSTIPSPTLASKLATGPVDAAGILQYGFPGPIADELSSLPLHGAYDRRTRNPSW
FT                   VAEHITPESLRMNNADRKRSTFFEDTTIPAMFRAKLSDYFRSGYDRGHQVPAADAKWSQ
FT                   DAMDGTFALSNMSPQVGEGFNRDYWAHFENFCRDLAKRYPSVRIVTGPLYLPHRDPDGK
FT                   WRVNYEVIGNPPNVAVPTHFYKVIYAEDGTNSPTSKVALGAFVLPNARIANDKRLTDFE
FT                   VPLEAVERASGLEFGSKLDLSRRRRLCQEVSCSITVREFNNANKRS"
FT   exon            complement(898483..899466)
FT                   /gene="Pc13g03800"
FT                   /locus_tag="PCH_Pc13g03800"
FT                   /number=1
FT   mat_peptide     complement(898486..899400)
FT                   /gene="Pc13g03800"
FT                   /locus_tag="PCH_Pc13g03800"
FT   sig_peptide     complement(899401..899466)
FT                   /gene="Pc13g03800"
FT                   /locus_tag="PCH_Pc13g03800"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<900139..900190,900239..900369,900420..901039,
FT                   901191..>901775)
FT                   /pseudo
FT                   /gene="Pc13g03810"
FT                   /locus_tag="PCH_Pc13g03810"
FT                   /note="submitted as non-pseudo"
FT   CDS_pept        join(900139..900190,900239..900369,900420..901039,
FT                   901191..901775)
FT                   /pseudo
FT                   /gene="Pc13g03810"
FT                   /locus_tag="PCH_Pc13g03810"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig31_part_i.tfa_890cg - Aspergillus fumigatus"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /inference="protein motif:COGS:COG0428"
FT   sig_peptide     join(900139..900190,900239..900288)
FT                   /gene="Pc13g03810"
FT                   /locus_tag="PCH_Pc13g03810"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            900139..900190
FT                   /gene="Pc13g03810"
FT                   /locus_tag="PCH_Pc13g03810"
FT                   /number=1
FT   intron          900191..900238
FT                   /gene="Pc13g03810"
FT                   /locus_tag="PCH_Pc13g03810"
FT                   /number=1
FT   exon            900239..900369
FT                   /gene="Pc13g03810"
FT                   /locus_tag="PCH_Pc13g03810"
FT                   /number=2
FT   mat_peptide     join(900289..900369,900420..901039,901191..901772)
FT                   /gene="Pc13g03810"
FT                   /locus_tag="PCH_Pc13g03810"
FT   intron          900370..900419
FT                   /gene="Pc13g03810"
FT                   /locus_tag="PCH_Pc13g03810"
FT                   /number=2
FT   exon            900420..901039
FT                   /gene="Pc13g03810"
FT                   /locus_tag="PCH_Pc13g03810"
FT                   /number=3
FT   intron          901040..901190
FT                   /gene="Pc13g03810"
FT                   /locus_tag="PCH_Pc13g03810"
FT                   /number=3
FT   exon            901191..901775
FT                   /gene="Pc13g03810"
FT                   /locus_tag="PCH_Pc13g03810"
FT                   /number=4
FT   mRNA            complement(join(<902381..902470,902515..902619,
FT                   902888..>903013))
FT                   /gene="Pc13g03820"
FT                   /locus_tag="PCH_Pc13g03820"
FT   CDS_pept        complement(join(902381..902470,902515..902619,
FT                   902888..903013))
FT                   /gene="Pc13g03820"
FT                   /locus_tag="PCH_Pc13g03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03820"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91451"
FT                   /db_xref="UniProtKB/TrEMBL:B6H223"
FT                   /protein_id="CAP91451.1"
FT                   /translation="MLKLPTSGRPTAWSATTTSRLACQFRFSASYMAAGWLEDSAIAPP
FT                   RGDALSVDEICSVGTPWCKESDKVNYDPDSKQRNVVTARVLPIMTYHVPDIVLGRWQNL
FT                   TA"
FT   exon            complement(902381..902470)
FT                   /gene="Pc13g03820"
FT                   /locus_tag="PCH_Pc13g03820"
FT                   /number=1
FT   intron          complement(902471..902514)
FT                   /gene="Pc13g03820"
FT                   /locus_tag="PCH_Pc13g03820"
FT                   /number=1
FT   exon            complement(902515..902619)
FT                   /gene="Pc13g03820"
FT                   /locus_tag="PCH_Pc13g03820"
FT                   /number=2
FT   intron          complement(902620..902887)
FT                   /gene="Pc13g03820"
FT                   /locus_tag="PCH_Pc13g03820"
FT                   /number=2
FT   exon            complement(902888..903013)
FT                   /gene="Pc13g03820"
FT                   /locus_tag="PCH_Pc13g03820"
FT                   /number=3
FT   mRNA            join(<903427..904204,904234..>904370)
FT                   /gene="Pc13g03830"
FT                   /locus_tag="PCH_Pc13g03830"
FT   CDS_pept        join(903427..904204,904234..904370)
FT                   /gene="Pc13g03830"
FT                   /locus_tag="PCH_Pc13g03830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03830"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91452"
FT                   /db_xref="UniProtKB/TrEMBL:B6H224"
FT                   /protein_id="CAP91452.1"
FT                   /translation="MNGQLPPYYALETILSELSEVPELSGFIVVKDNELNAIEKPAETI
FT                   TIIDFYRYSTAILDYVKSSNTDSLALHTEALDSWGTEIICILLTNLHAKSVPSPFCALL
FT                   SGFPFTKTWNRFVEYYLADPGVEFPREKFPDAKALAEATLRQFSRRNLRAVTRFGVGAI
FT                   IRPVEATYQDEFYRSLHTVLGYAMNVTSEWSPDGVGRIDFRLSSVRWGIELLREGDRLH
FT                   DHCQRFTTDGAYGKWIQQGLLEDWLVIDCRTSSPRSYAGTAHASIEIPDTKLWRAVFAP
FT                   DFSDVEVRDQYNQVVVDRFALTE"
FT   exon            903427..904204
FT                   /gene="Pc13g03830"
FT                   /locus_tag="PCH_Pc13g03830"
FT                   /number=1
FT   intron          904205..904233
FT                   /gene="Pc13g03830"
FT                   /locus_tag="PCH_Pc13g03830"
FT                   /number=1
FT   exon            904234..904370
FT                   /gene="Pc13g03830"
FT                   /locus_tag="PCH_Pc13g03830"
FT                   /number=2
FT   mRNA            complement(join(<904935..907582,907667..909970,
FT                   910023..>910473))
FT                   /gene="Pc13g03840"
FT                   /locus_tag="PCH_Pc13g03840"
FT   CDS_pept        complement(join(904935..907582,907667..909970,
FT                   910023..910473))
FT                   /gene="Pc13g03840"
FT                   /locus_tag="PCH_Pc13g03840"
FT                   /note="Title: weak similarity to beta transducin-like
FT                   protein het-e1 - Podospora anserina"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc13g03840"
FT                   /db_xref="EnsemblGenomes-Tr:CAP91453"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6H225"
FT                   /inference="similar to AA sequence:PIR:T18521"
FT                   /protein_id="CAP91453.1"
FT                   /translation="MVSSTAISCVEGFKSKESDQVIGRNVDAAFVTYAKRFSTHWNCVV
FT                   DAHTAKLVQDSPLIYSSPELGSLRQFLGVQDRPLQFILDSRAHSLAEGSFEWFNNTLYD
FT                   FSVGSSPAMLVSGGPGSGKSALAQWAVERLQQSAEHDSWNVIPYTIRADIPVATLPLRI
FT                   LKGVLHQMLDHSVSDKQTQEAILAEVARAAQGAIDGAGDDAVEASLWRGIRAGLATNIQ
FT                   YMFVVDGIDQIRGGHANAVAYLDRFCEILSEQNAGSKMIAFTRPLTSKVSSKGVHQLTL
FT