(data stored in SCRATCH zone)

EMBL: AM920431

ID   AM920431; SV 1; linear; genomic DNA; STD; FUN; 3716833 BP.
XX
AC   AM920431;
XX
PR   Project:PRJEA27927;
XX
DT   01-NOV-2008 (Rel. 97, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Penicillium chrysogenum Wisconsin 54-1255 complete genome, contig Pc00c16
XX
KW   .
XX
OS   Penicillium rubens Wisconsin 54-1255
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium;
OC   Penicillium chrysogenum species complex.
XX
RN   [1]
RP   1-3716833
RA   van den Berg M.A.;
RT   ;
RL   Submitted (22-NOV-2007) to the INSDC.
RL   van den Berg M.A., DAI/INNO (624-0270), DSM Anti-Infectives, Alexander
RL   Fleminglaan 1, Delftn, 2613 AX, NETHERLANDS.
XX
RN   [2]
RP   1-3716833
RX   DOI; 10.1038/nbt.1498.
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.M.,
RA   Driessen A.J., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.H.,
RA   Joardar V., Kiel J.A., Kovalchuk A., Martin J.F., Nierman W.C.,
RA   Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.N.,
RA   Veenhuis M., von Dohren H., Wagner C., Wortman J., Bovenberg R.A.;
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum";
RL   Nat. Biotechnol. 26(10):1161-1168(2008).
XX
RN   [3]
RP   2406526-2409113
RX   PUBMED; 10572125.
RA   van de Kamp M., Pizzinini E., Vos A., van der Lende T.R., Schuurs T.A.,
RA   Newbert R.W., Turner G., Konings W.N., Driessen A.J.;
RT   "Sulfate transport in Penicillium chrysogenum: cloning and characterization
RT   of the sutA and sutB genes";
RL   J. Bacteriol. 181(23):7228-7234(1999).
XX
DR   MD5; 9f812cd78ff8ff5ed20a3fd77d3db06e.
DR   BioSample; SAMEA2272345.
DR   EnsemblGenomes-Gn; ENSRNA049575020.
DR   EnsemblGenomes-Gn; ENSRNA049575066.
DR   EnsemblGenomes-Gn; ENSRNA049575131.
DR   EnsemblGenomes-Gn; ENSRNA049575235.
DR   EnsemblGenomes-Gn; ENSRNA049575305.
DR   EnsemblGenomes-Gn; ENSRNA049575422.
DR   EnsemblGenomes-Gn; ENSRNA049575530.
DR   EnsemblGenomes-Gn; ENSRNA049575582.
DR   EnsemblGenomes-Gn; ENSRNA049575653.
DR   EnsemblGenomes-Gn; ENSRNA049575736.
DR   EnsemblGenomes-Gn; ENSRNA049575792.
DR   EnsemblGenomes-Gn; ENSRNA049575825.
DR   EnsemblGenomes-Gn; ENSRNA049575892.
DR   EnsemblGenomes-Gn; ENSRNA049575963.
DR   EnsemblGenomes-Gn; ENSRNA049576009.
DR   EnsemblGenomes-Gn; ENSRNA049576058.
DR   EnsemblGenomes-Gn; ENSRNA049576103.
DR   EnsemblGenomes-Gn; ENSRNA049641599.
DR   EnsemblGenomes-Gn; ENSRNA049641623.
DR   EnsemblGenomes-Gn; ENSRNA049641648.
DR   EnsemblGenomes-Gn; ENSRNA049641662.
DR   EnsemblGenomes-Gn; ENSRNA049641724.
DR   EnsemblGenomes-Gn; ENSRNA049641739.
DR   EnsemblGenomes-Gn; ENSRNA049641768.
DR   EnsemblGenomes-Gn; ENSRNA049641791.
DR   EnsemblGenomes-Gn; ENSRNA049641811.
DR   EnsemblGenomes-Gn; ENSRNA049641833.
DR   EnsemblGenomes-Gn; ENSRNA049641849.
DR   EnsemblGenomes-Gn; ENSRNA049641882.
DR   EnsemblGenomes-Gn; ENSRNA049641925.
DR   EnsemblGenomes-Gn; ENSRNA049641948.
DR   EnsemblGenomes-Gn; ENSRNA049641970.
DR   EnsemblGenomes-Gn; ENSRNA049641996.
DR   EnsemblGenomes-Gn; ENSRNA049642025.
DR   EnsemblGenomes-Gn; ENSRNA049642059.
DR   EnsemblGenomes-Gn; ENSRNA049642077.
DR   EnsemblGenomes-Gn; ENSRNA049642106.
DR   EnsemblGenomes-Gn; ENSRNA049642129.
DR   EnsemblGenomes-Gn; ENSRNA049642153.
DR   EnsemblGenomes-Gn; ENSRNA049642174.
DR   EnsemblGenomes-Gn; ENSRNA049642211.
DR   EnsemblGenomes-Gn; ENSRNA049642253.
DR   EnsemblGenomes-Gn; ENSRNA049642276.
DR   EnsemblGenomes-Gn; PCH_Pc16e00010.
DR   EnsemblGenomes-Gn; PCH_Pc16e00020.
DR   EnsemblGenomes-Gn; PCH_Pc16e00030.
DR   EnsemblGenomes-Gn; PCH_Pc16e00040.
DR   EnsemblGenomes-Gn; PCH_Pc16e00050.
DR   EnsemblGenomes-Gn; PCH_Pc16e00070.
DR   EnsemblGenomes-Gn; PCH_Pc16e00080.
DR   EnsemblGenomes-Gn; PCH_Pc16e00090.
DR   EnsemblGenomes-Gn; PCH_Pc16e00100.
DR   EnsemblGenomes-Gn; PCH_Pc16e00120.
DR   EnsemblGenomes-Gn; PCH_Pc16e00130.
DR   EnsemblGenomes-Gn; PCH_Pc16e00140.
DR   EnsemblGenomes-Gn; PCH_Pc16e00150.
DR   EnsemblGenomes-Gn; PCH_Pc16e00160.
DR   EnsemblGenomes-Gn; PCH_Pc16e00170.
DR   EnsemblGenomes-Gn; PCH_Pc16e00180.
DR   EnsemblGenomes-Gn; PCH_Pc16e00200.
DR   EnsemblGenomes-Gn; PCH_Pc16e00220.
DR   EnsemblGenomes-Gn; PCH_Pc16e00230.
DR   EnsemblGenomes-Gn; PCH_Pc16e00240.
DR   EnsemblGenomes-Gn; PCH_Pc16e00250.
DR   EnsemblGenomes-Gn; PCH_Pc16e00270.
DR   EnsemblGenomes-Gn; PCH_Pc16e00280.
DR   EnsemblGenomes-Gn; PCH_Pc16e00290.
DR   EnsemblGenomes-Gn; PCH_Pc16e00300.
DR   EnsemblGenomes-Gn; PCH_Pc16e00310.
DR   EnsemblGenomes-Gn; PCH_Pc16g00030.
DR   EnsemblGenomes-Gn; PCH_Pc16g00050.
DR   EnsemblGenomes-Gn; PCH_Pc16g00070.
DR   EnsemblGenomes-Gn; PCH_Pc16g00080.
DR   EnsemblGenomes-Gn; PCH_Pc16g00200.
DR   EnsemblGenomes-Gn; PCH_Pc16g00280.
DR   EnsemblGenomes-Gn; PCH_Pc16g00410.
DR   EnsemblGenomes-Gn; PCH_Pc16g00560.
DR   EnsemblGenomes-Gn; PCH_Pc16g00570.
DR   EnsemblGenomes-Gn; PCH_Pc16g00610.
DR   EnsemblGenomes-Gn; PCH_Pc16g00890.
DR   EnsemblGenomes-Gn; PCH_Pc16g01240.
DR   EnsemblGenomes-Gn; PCH_Pc16g01250.
DR   EnsemblGenomes-Gn; PCH_Pc16g01260.
DR   EnsemblGenomes-Gn; PCH_Pc16g01270.
DR   EnsemblGenomes-Gn; PCH_Pc16g01280.
DR   EnsemblGenomes-Gn; PCH_Pc16g01300.
DR   EnsemblGenomes-Gn; PCH_Pc16g01310.
DR   EnsemblGenomes-Gn; PCH_Pc16g01320.
DR   EnsemblGenomes-Gn; PCH_Pc16g01330.
DR   EnsemblGenomes-Gn; PCH_Pc16g01340.
DR   EnsemblGenomes-Gn; PCH_Pc16g01350.
DR   EnsemblGenomes-Gn; PCH_Pc16g01360.
DR   EnsemblGenomes-Gn; PCH_Pc16g01370.
DR   EnsemblGenomes-Gn; PCH_Pc16g01380.
DR   EnsemblGenomes-Gn; PCH_Pc16g01390.
DR   EnsemblGenomes-Gn; PCH_Pc16g01400.
DR   EnsemblGenomes-Gn; PCH_Pc16g01410.
DR   EnsemblGenomes-Gn; PCH_Pc16g01420.
DR   EnsemblGenomes-Gn; PCH_Pc16g01430.
DR   EnsemblGenomes-Gn; PCH_Pc16g01440.
DR   EnsemblGenomes-Gn; PCH_Pc16g01450.
DR   EnsemblGenomes-Gn; PCH_Pc16g01460.
DR   EnsemblGenomes-Gn; PCH_Pc16g01470.
DR   EnsemblGenomes-Gn; PCH_Pc16g01480.
DR   EnsemblGenomes-Gn; PCH_Pc16g01490.
DR   EnsemblGenomes-Gn; PCH_Pc16g01500.
DR   EnsemblGenomes-Gn; PCH_Pc16g01510.
DR   EnsemblGenomes-Gn; PCH_Pc16g01520.
DR   EnsemblGenomes-Gn; PCH_Pc16g01530.
DR   EnsemblGenomes-Gn; PCH_Pc16g01540.
DR   EnsemblGenomes-Gn; PCH_Pc16g01550.
DR   EnsemblGenomes-Gn; PCH_Pc16g01560.
DR   EnsemblGenomes-Gn; PCH_Pc16g01570.
DR   EnsemblGenomes-Gn; PCH_Pc16g01580.
DR   EnsemblGenomes-Gn; PCH_Pc16g01590.
DR   EnsemblGenomes-Gn; PCH_Pc16g01600.
DR   EnsemblGenomes-Gn; PCH_Pc16g01610.
DR   EnsemblGenomes-Gn; PCH_Pc16g01620.
DR   EnsemblGenomes-Gn; PCH_Pc16g01630.
DR   EnsemblGenomes-Gn; PCH_Pc16g01650.
DR   EnsemblGenomes-Gn; PCH_Pc16g01660.
DR   EnsemblGenomes-Gn; PCH_Pc16g01670.
DR   EnsemblGenomes-Gn; PCH_Pc16g01680.
DR   EnsemblGenomes-Gn; PCH_Pc16g01690.
DR   EnsemblGenomes-Gn; PCH_Pc16g01890.
DR   EnsemblGenomes-Gn; PCH_Pc16g02120.
DR   EnsemblGenomes-Gn; PCH_Pc16g02200.
DR   EnsemblGenomes-Gn; PCH_Pc16g02710.
DR   EnsemblGenomes-Gn; PCH_Pc16g02720.
DR   EnsemblGenomes-Gn; PCH_Pc16g02970.
DR   EnsemblGenomes-Gn; PCH_Pc16g03050.
DR   EnsemblGenomes-Gn; PCH_Pc16g03190.
DR   EnsemblGenomes-Gn; PCH_Pc16g03200.
DR   EnsemblGenomes-Gn; PCH_Pc16g03460.
DR   EnsemblGenomes-Gn; PCH_Pc16g03490.
DR   EnsemblGenomes-Gn; PCH_Pc16g03500.
DR   EnsemblGenomes-Gn; PCH_Pc16g03510.
DR   EnsemblGenomes-Gn; PCH_Pc16g03530.
DR   EnsemblGenomes-Gn; PCH_Pc16g03570.
DR   EnsemblGenomes-Gn; PCH_Pc16g03590.
DR   EnsemblGenomes-Gn; PCH_Pc16g03730.
DR   EnsemblGenomes-Gn; PCH_Pc16g03760.
DR   EnsemblGenomes-Gn; PCH_Pc16g03900.
DR   EnsemblGenomes-Gn; PCH_Pc16g04000.
DR   EnsemblGenomes-Gn; PCH_Pc16g04010.
DR   EnsemblGenomes-Gn; PCH_Pc16g04040.
DR   EnsemblGenomes-Gn; PCH_Pc16g04070.
DR   EnsemblGenomes-Gn; PCH_Pc16g04080.
DR   EnsemblGenomes-Gn; PCH_Pc16g04270.
DR   EnsemblGenomes-Gn; PCH_Pc16g04280.
DR   EnsemblGenomes-Gn; PCH_Pc16g04310.
DR   EnsemblGenomes-Gn; PCH_Pc16g04400.
DR   EnsemblGenomes-Gn; PCH_Pc16g04420.
DR   EnsemblGenomes-Gn; PCH_Pc16g04860.
DR   EnsemblGenomes-Gn; PCH_Pc16g05020.
DR   EnsemblGenomes-Gn; PCH_Pc16g05040.
DR   EnsemblGenomes-Gn; PCH_Pc16g05050.
DR   EnsemblGenomes-Gn; PCH_Pc16g05140.
DR   EnsemblGenomes-Gn; PCH_Pc16g05170.
DR   EnsemblGenomes-Gn; PCH_Pc16g05210.
DR   EnsemblGenomes-Gn; PCH_Pc16g05350.
DR   EnsemblGenomes-Gn; PCH_Pc16g05360.
DR   EnsemblGenomes-Gn; PCH_Pc16g05390.
DR   EnsemblGenomes-Gn; PCH_Pc16g05460.
DR   EnsemblGenomes-Gn; PCH_Pc16g05500.
DR   EnsemblGenomes-Gn; PCH_Pc16g05770.
DR   EnsemblGenomes-Gn; PCH_Pc16g05790.
DR   EnsemblGenomes-Gn; PCH_Pc16g06050.
DR   EnsemblGenomes-Gn; PCH_Pc16g06650.
DR   EnsemblGenomes-Gn; PCH_Pc16g06720.
DR   EnsemblGenomes-Gn; PCH_Pc16g06740.
DR   EnsemblGenomes-Gn; PCH_Pc16g06790.
DR   EnsemblGenomes-Gn; PCH_Pc16g06850.
DR   EnsemblGenomes-Gn; PCH_Pc16g07000.
DR   EnsemblGenomes-Gn; PCH_Pc16g07080.
DR   EnsemblGenomes-Gn; PCH_Pc16g07150.
DR   EnsemblGenomes-Gn; PCH_Pc16g07170.
DR   EnsemblGenomes-Gn; PCH_Pc16g07190.
DR   EnsemblGenomes-Gn; PCH_Pc16g07230.
DR   EnsemblGenomes-Gn; PCH_Pc16g07270.
DR   EnsemblGenomes-Gn; PCH_Pc16g07330.
DR   EnsemblGenomes-Gn; PCH_Pc16g07340.
DR   EnsemblGenomes-Gn; PCH_Pc16g07400.
DR   EnsemblGenomes-Gn; PCH_Pc16g07450.
DR   EnsemblGenomes-Gn; PCH_Pc16g07630.
DR   EnsemblGenomes-Gn; PCH_Pc16g07660.
DR   EnsemblGenomes-Gn; PCH_Pc16g07720.
DR   EnsemblGenomes-Gn; PCH_Pc16g07820.
DR   EnsemblGenomes-Gn; PCH_Pc16g08160.
DR   EnsemblGenomes-Gn; PCH_Pc16g08450.
DR   EnsemblGenomes-Gn; PCH_Pc16g08480.
DR   EnsemblGenomes-Gn; PCH_Pc16g08520.
DR   EnsemblGenomes-Gn; PCH_Pc16g08570.
DR   EnsemblGenomes-Gn; PCH_Pc16g08600.
DR   EnsemblGenomes-Gn; PCH_Pc16g09090.
DR   EnsemblGenomes-Gn; PCH_Pc16g09110.
DR   EnsemblGenomes-Gn; PCH_Pc16g09270.
DR   EnsemblGenomes-Gn; PCH_Pc16g09380.
DR   EnsemblGenomes-Gn; PCH_Pc16g09440.
DR   EnsemblGenomes-Gn; PCH_Pc16g09460.
DR   EnsemblGenomes-Gn; PCH_Pc16g09470.
DR   EnsemblGenomes-Gn; PCH_Pc16g09490.
DR   EnsemblGenomes-Gn; PCH_Pc16g09510.
DR   EnsemblGenomes-Gn; PCH_Pc16g09530.
DR   EnsemblGenomes-Gn; PCH_Pc16g09580.
DR   EnsemblGenomes-Gn; PCH_Pc16g09630.
DR   EnsemblGenomes-Gn; PCH_Pc16g09920.
DR   EnsemblGenomes-Gn; PCH_Pc16g10060.
DR   EnsemblGenomes-Gn; PCH_Pc16g10200.
DR   EnsemblGenomes-Gn; PCH_Pc16g10250.
DR   EnsemblGenomes-Gn; PCH_Pc16g10410.
DR   EnsemblGenomes-Gn; PCH_Pc16g10430.
DR   EnsemblGenomes-Gn; PCH_Pc16g10570.
DR   EnsemblGenomes-Gn; PCH_Pc16g10580.
DR   EnsemblGenomes-Gn; PCH_Pc16g10600.
DR   EnsemblGenomes-Gn; PCH_Pc16g10630.
DR   EnsemblGenomes-Gn; PCH_Pc16g10710.
DR   EnsemblGenomes-Gn; PCH_Pc16g10720.
DR   EnsemblGenomes-Gn; PCH_Pc16g10750.
DR   EnsemblGenomes-Gn; PCH_Pc16g11040.
DR   EnsemblGenomes-Gn; PCH_Pc16g11080.
DR   EnsemblGenomes-Gn; PCH_Pc16g11210.
DR   EnsemblGenomes-Gn; PCH_Pc16g11380.
DR   EnsemblGenomes-Gn; PCH_Pc16g11400.
DR   EnsemblGenomes-Gn; PCH_Pc16g11560.
DR   EnsemblGenomes-Gn; PCH_Pc16g11750.
DR   EnsemblGenomes-Gn; PCH_Pc16g11820.
DR   EnsemblGenomes-Gn; PCH_Pc16g12010.
DR   EnsemblGenomes-Gn; PCH_Pc16g12100.
DR   EnsemblGenomes-Gn; PCH_Pc16g12110.
DR   EnsemblGenomes-Gn; PCH_Pc16g12890.
DR   EnsemblGenomes-Gn; PCH_Pc16g13010.
DR   EnsemblGenomes-Gn; PCH_Pc16g13190.
DR   EnsemblGenomes-Gn; PCH_Pc16g13540.
DR   EnsemblGenomes-Gn; PCH_Pc16g13820.
DR   EnsemblGenomes-Gn; PCH_Pc16g13880.
DR   EnsemblGenomes-Gn; PCH_Pc16g14150.
DR   EnsemblGenomes-Gn; PCH_Pc16g14320.
DR   EnsemblGenomes-Gn; PCH_Pc16g14360.
DR   EnsemblGenomes-Gn; PCH_Pc16g14660.
DR   EnsemblGenomes-Gn; PCH_Pc16g14880.
DR   EnsemblGenomes-Gn; PCH_Pc16g14900.
DR   EnsemblGenomes-Gn; PCH_Pc16g14980.
DR   EnsemblGenomes-Gn; PCH_Pc16g14990.
DR   EnsemblGenomes-Gn; PCH_Pc16g15000.
DR   EnsemblGenomes-Gn; PCH_Pc16g15270.
DR   EnsemblGenomes-Gn; PCH_Pc16g15280.
DR   EnsemblGenomes-Gn; PCH_Pc16g15380.
DR   EnsemblGenomes-Tr; CAP92890.
DR   EnsemblGenomes-Tr; CAP93060.
DR   EnsemblGenomes-Tr; CAP93074.
DR   EnsemblGenomes-Tr; CAP93077.
DR   EnsemblGenomes-Tr; CAP93078.
DR   EnsemblGenomes-Tr; CAP93112.
DR   EnsemblGenomes-Tr; CAP93344.
DR   EnsemblGenomes-Tr; CAP93349.
DR   EnsemblGenomes-Tr; CAP93355.
DR   EnsemblGenomes-Tr; CAP93370.
DR   EnsemblGenomes-Tr; CAP93415.
DR   EnsemblGenomes-Tr; CAP93433.
DR   EnsemblGenomes-Tr; CAP93522.
DR   EnsemblGenomes-Tr; CAP93527.
DR   EnsemblGenomes-Tr; CAP93530.
DR   EnsemblGenomes-Tr; CAP93579.
DR   EnsemblGenomes-Tr; CAP93597.
DR   EnsemblGenomes-Tr; CAP93619.
DR   EnsemblGenomes-Tr; CAP93621.
DR   EnsemblGenomes-Tr; CAP93676.
DR   EnsemblGenomes-Tr; CAP93690.
DR   EnsemblGenomes-Tr; CAP93695.
DR   EnsemblGenomes-Tr; CAP93711.
DR   EnsemblGenomes-Tr; CAP93713.
DR   EnsemblGenomes-Tr; CAP93728.
DR   EnsemblGenomes-Tr; CAP93741.
DR   EnsemblGenomes-Tr; CAP93745.
DR   EnsemblGenomes-Tr; CAP93774.
DR   EnsemblGenomes-Tr; CAP93810.
DR   EnsemblGenomes-Tr; CAP93880.
DR   EnsemblGenomes-Tr; CAP93881.
DR   EnsemblGenomes-Tr; CAP93959.
DR   EnsemblGenomes-Tr; CAP93971.
DR   EnsemblGenomes-Tr; CAP93989.
DR   EnsemblGenomes-Tr; CAP94024.
DR   EnsemblGenomes-Tr; CAP94052.
DR   EnsemblGenomes-Tr; CAP94085.
DR   EnsemblGenomes-Tr; CAP94106.
DR   EnsemblGenomes-Tr; CAP94136.
DR   EnsemblGenomes-Tr; CAP94158.
DR   EnsemblGenomes-Tr; CAP94160.
DR   EnsemblGenomes-Tr; CAP94198.
DR   EnsemblGenomes-Tr; CAP94208.
DR   EnsemblGenomes-Tr; EFT00001517178.
DR   EnsemblGenomes-Tr; EFT00001517179.
DR   EnsemblGenomes-Tr; EFT00001517180.
DR   EnsemblGenomes-Tr; EFT00001517181.
DR   EnsemblGenomes-Tr; EFT00001517182.
DR   EnsemblGenomes-Tr; EFT00001517183.
DR   EnsemblGenomes-Tr; EFT00001517184.
DR   EnsemblGenomes-Tr; EFT00001517185.
DR   EnsemblGenomes-Tr; EFT00001517186.
DR   EnsemblGenomes-Tr; EFT00001517187.
DR   EnsemblGenomes-Tr; EFT00001517188.
DR   EnsemblGenomes-Tr; EFT00001517189.
DR   EnsemblGenomes-Tr; EFT00001517190.
DR   EnsemblGenomes-Tr; EFT00001517191.
DR   EnsemblGenomes-Tr; EFT00001517192.
DR   EnsemblGenomes-Tr; EFT00001517193.
DR   EnsemblGenomes-Tr; EFT00001517194.
DR   EnsemblGenomes-Tr; EFT00001517195.
DR   EnsemblGenomes-Tr; EFT00001517196.
DR   EnsemblGenomes-Tr; EFT00001517197.
DR   EnsemblGenomes-Tr; EFT00001517198.
DR   EnsemblGenomes-Tr; EFT00001517200.
DR   EnsemblGenomes-Tr; EFT00001517201.
DR   EnsemblGenomes-Tr; EFT00001517203.
DR   EnsemblGenomes-Tr; EFT00001517204.
DR   EnsemblGenomes-Tr; EFT00001517205.
DR   EnsemblGenomes-Tr; EFT00001517206.
DR   EnsemblGenomes-Tr; EFT00001517207.
DR   EnsemblGenomes-Tr; EFT00001517208.
DR   EnsemblGenomes-Tr; EFT00001517209.
DR   EnsemblGenomes-Tr; EFT00001517210.
DR   EnsemblGenomes-Tr; EFT00001517211.
DR   EnsemblGenomes-Tr; EFT00001517212.
DR   EnsemblGenomes-Tr; EFT00001517213.
DR   EnsemblGenomes-Tr; EFT00001517214.
DR   EnsemblGenomes-Tr; EFT00001517215.
DR   EnsemblGenomes-Tr; EFT00001517216.
DR   EnsemblGenomes-Tr; EFT00001517217.
DR   EnsemblGenomes-Tr; EFT00001517218.
DR   EnsemblGenomes-Tr; PCH_Pc16e00010-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00020-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00030-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00040-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00050-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00070-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00080-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00090-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00100-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00120-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00130-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00140-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00150-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00160-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00170-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00180-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00200-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00220-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00230-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00240-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00250-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00270-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00280-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00290-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00300-1.
DR   EnsemblGenomes-Tr; PCH_Pc16e00310-1.
DR   EnsemblGenomes-Tr; PCH_Pc16g00030.
DR   EnsemblGenomes-Tr; PCH_Pc16g00050.
DR   EnsemblGenomes-Tr; PCH_Pc16g00070.
DR   EnsemblGenomes-Tr; PCH_Pc16g00080.
DR   EnsemblGenomes-Tr; PCH_Pc16g00200.
DR   EnsemblGenomes-Tr; PCH_Pc16g00280.
DR   EnsemblGenomes-Tr; PCH_Pc16g00410.
DR   EnsemblGenomes-Tr; PCH_Pc16g00560.
DR   EnsemblGenomes-Tr; PCH_Pc16g00570.
DR   EnsemblGenomes-Tr; PCH_Pc16g00610.
DR   EnsemblGenomes-Tr; PCH_Pc16g00890.
DR   EnsemblGenomes-Tr; PCH_Pc16g01240.
DR   EnsemblGenomes-Tr; PCH_Pc16g01250.
DR   EnsemblGenomes-Tr; PCH_Pc16g01260.
DR   EnsemblGenomes-Tr; PCH_Pc16g01270.
DR   EnsemblGenomes-Tr; PCH_Pc16g01280.
DR   EnsemblGenomes-Tr; PCH_Pc16g01300.
DR   EnsemblGenomes-Tr; PCH_Pc16g01310.
DR   EnsemblGenomes-Tr; PCH_Pc16g01320.
DR   EnsemblGenomes-Tr; PCH_Pc16g01330.
DR   EnsemblGenomes-Tr; PCH_Pc16g01340.
DR   EnsemblGenomes-Tr; PCH_Pc16g01350.
DR   EnsemblGenomes-Tr; PCH_Pc16g01360.
DR   EnsemblGenomes-Tr; PCH_Pc16g01370.
DR   EnsemblGenomes-Tr; PCH_Pc16g01380.
DR   EnsemblGenomes-Tr; PCH_Pc16g01390.
DR   EnsemblGenomes-Tr; PCH_Pc16g01400.
DR   EnsemblGenomes-Tr; PCH_Pc16g01410.
DR   EnsemblGenomes-Tr; PCH_Pc16g01420.
DR   EnsemblGenomes-Tr; PCH_Pc16g01430.
DR   EnsemblGenomes-Tr; PCH_Pc16g01440.
DR   EnsemblGenomes-Tr; PCH_Pc16g01450.
DR   EnsemblGenomes-Tr; PCH_Pc16g01460.
DR   EnsemblGenomes-Tr; PCH_Pc16g01470.
DR   EnsemblGenomes-Tr; PCH_Pc16g01480.
DR   EnsemblGenomes-Tr; PCH_Pc16g01490.
DR   EnsemblGenomes-Tr; PCH_Pc16g01500.
DR   EnsemblGenomes-Tr; PCH_Pc16g01510.
DR   EnsemblGenomes-Tr; PCH_Pc16g01520.
DR   EnsemblGenomes-Tr; PCH_Pc16g01530.
DR   EnsemblGenomes-Tr; PCH_Pc16g01540.
DR   EnsemblGenomes-Tr; PCH_Pc16g01550.
DR   EnsemblGenomes-Tr; PCH_Pc16g01560.
DR   EnsemblGenomes-Tr; PCH_Pc16g01570.
DR   EnsemblGenomes-Tr; PCH_Pc16g01580.
DR   EnsemblGenomes-Tr; PCH_Pc16g01590.
DR   EnsemblGenomes-Tr; PCH_Pc16g01600.
DR   EnsemblGenomes-Tr; PCH_Pc16g01610.
DR   EnsemblGenomes-Tr; PCH_Pc16g01620.
DR   EnsemblGenomes-Tr; PCH_Pc16g01630.
DR   EnsemblGenomes-Tr; PCH_Pc16g01650.
DR   EnsemblGenomes-Tr; PCH_Pc16g01660.
DR   EnsemblGenomes-Tr; PCH_Pc16g01670.
DR   EnsemblGenomes-Tr; PCH_Pc16g01680.
DR   EnsemblGenomes-Tr; PCH_Pc16g01690.
DR   EnsemblGenomes-Tr; PCH_Pc16g01890.
DR   EnsemblGenomes-Tr; PCH_Pc16g02120.
DR   EnsemblGenomes-Tr; PCH_Pc16g02710.
DR   EnsemblGenomes-Tr; PCH_Pc16g02720.
DR   EnsemblGenomes-Tr; PCH_Pc16g02970.
DR   EnsemblGenomes-Tr; PCH_Pc16g03050.
DR   EnsemblGenomes-Tr; PCH_Pc16g03190.
DR   EnsemblGenomes-Tr; PCH_Pc16g03200.
DR   EnsemblGenomes-Tr; PCH_Pc16g03460.
DR   EnsemblGenomes-Tr; PCH_Pc16g03490.
DR   EnsemblGenomes-Tr; PCH_Pc16g03500.
DR   EnsemblGenomes-Tr; PCH_Pc16g03510.
DR   EnsemblGenomes-Tr; PCH_Pc16g03530.
DR   EnsemblGenomes-Tr; PCH_Pc16g03570.
DR   EnsemblGenomes-Tr; PCH_Pc16g03590.
DR   EnsemblGenomes-Tr; PCH_Pc16g03730.
DR   EnsemblGenomes-Tr; PCH_Pc16g03760.
DR   EnsemblGenomes-Tr; PCH_Pc16g04000.
DR   EnsemblGenomes-Tr; PCH_Pc16g04010.
DR   EnsemblGenomes-Tr; PCH_Pc16g04270.
DR   EnsemblGenomes-Tr; PCH_Pc16g04280.
DR   EnsemblGenomes-Tr; PCH_Pc16g04310.
DR   EnsemblGenomes-Tr; PCH_Pc16g04400.
DR   EnsemblGenomes-Tr; PCH_Pc16g04860.
DR   EnsemblGenomes-Tr; PCH_Pc16g05020.
DR   EnsemblGenomes-Tr; PCH_Pc16g05040.
DR   EnsemblGenomes-Tr; PCH_Pc16g05050.
DR   EnsemblGenomes-Tr; PCH_Pc16g05140.
DR   EnsemblGenomes-Tr; PCH_Pc16g05170.
DR   EnsemblGenomes-Tr; PCH_Pc16g05210.
DR   EnsemblGenomes-Tr; PCH_Pc16g05350.
DR   EnsemblGenomes-Tr; PCH_Pc16g05360.
DR   EnsemblGenomes-Tr; PCH_Pc16g05390.
DR   EnsemblGenomes-Tr; PCH_Pc16g05460.
DR   EnsemblGenomes-Tr; PCH_Pc16g05500.
DR   EnsemblGenomes-Tr; PCH_Pc16g05770.
DR   EnsemblGenomes-Tr; PCH_Pc16g05790.
DR   EnsemblGenomes-Tr; PCH_Pc16g06050.
DR   EnsemblGenomes-Tr; PCH_Pc16g06650.
DR   EnsemblGenomes-Tr; PCH_Pc16g06720.
DR   EnsemblGenomes-Tr; PCH_Pc16g07080.
DR   EnsemblGenomes-Tr; PCH_Pc16g07150.
DR   EnsemblGenomes-Tr; PCH_Pc16g07170.
DR   EnsemblGenomes-Tr; PCH_Pc16g07190.
DR   EnsemblGenomes-Tr; PCH_Pc16g07230.
DR   EnsemblGenomes-Tr; PCH_Pc16g07270.
DR   EnsemblGenomes-Tr; PCH_Pc16g07330.
DR   EnsemblGenomes-Tr; PCH_Pc16g07340.
DR   EnsemblGenomes-Tr; PCH_Pc16g07400.
DR   EnsemblGenomes-Tr; PCH_Pc16g07660.
DR   EnsemblGenomes-Tr; PCH_Pc16g07720.
DR   EnsemblGenomes-Tr; PCH_Pc16g07820.
DR   EnsemblGenomes-Tr; PCH_Pc16g08160.
DR   EnsemblGenomes-Tr; PCH_Pc16g08450.
DR   EnsemblGenomes-Tr; PCH_Pc16g08480.
DR   EnsemblGenomes-Tr; PCH_Pc16g09110.
DR   EnsemblGenomes-Tr; PCH_Pc16g09380.
DR   EnsemblGenomes-Tr; PCH_Pc16g09440.
DR   EnsemblGenomes-Tr; PCH_Pc16g09460.
DR   EnsemblGenomes-Tr; PCH_Pc16g09470.
DR   EnsemblGenomes-Tr; PCH_Pc16g09530.
DR   EnsemblGenomes-Tr; PCH_Pc16g09580.
DR   EnsemblGenomes-Tr; PCH_Pc16g09630.
DR   EnsemblGenomes-Tr; PCH_Pc16g09920.
DR   EnsemblGenomes-Tr; PCH_Pc16g10570.
DR   EnsemblGenomes-Tr; PCH_Pc16g10600.
DR   EnsemblGenomes-Tr; PCH_Pc16g10630.
DR   EnsemblGenomes-Tr; PCH_Pc16g10720.
DR   EnsemblGenomes-Tr; PCH_Pc16g11080.
DR   EnsemblGenomes-Tr; PCH_Pc16g11210.
DR   EnsemblGenomes-Tr; PCH_Pc16g11380.
DR   EnsemblGenomes-Tr; PCH_Pc16g11560.
DR   EnsemblGenomes-Tr; PCH_Pc16g11750.
DR   EnsemblGenomes-Tr; PCH_Pc16g11820.
DR   EnsemblGenomes-Tr; PCH_Pc16g12010.
DR   EnsemblGenomes-Tr; PCH_Pc16g13880.
DR   EnsemblGenomes-Tr; PCH_Pc16g14320.
DR   EnsemblGenomes-Tr; PCH_Pc16g14980.
DR   EnsemblGenomes-Tr; PCH_Pc16g14990.
DR   EnsemblGenomes-Tr; PCH_Pc16g15000.
DR   EnsemblGenomes-Tr; PCH_Pc16g15270.
DR   PR2; AM920431.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00015; U4.
DR   RFAM; RF00026; U6.
DR   RFAM; RF01499; Afu_191.
DR   RFAM; RF01502; Fungi_SRP.
DR   RFAM; RF01506; Afu_294.
DR   RFAM; RF01511; Afu_304.
DR   RFAM; RF01513; Afu_335.
DR   RFAM; RF01846; Fungi_U3.
DR   RFAM; RF01860; Afu_455.
DR   SILVA-LSU; AM920431.
DR   SILVA-SSU; AM920431.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3716833
FT                   /organism="Penicillium rubens Wisconsin 54-1255"
FT                   /strain="Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /clone="Pc00c16"
FT                   /db_xref="taxon:500485"
FT                   /citation=[1]
FT   rRNA            complement(1..821)
FT                   /gene="small subunit rRNA"
FT                   /locus_tag="PCH_Pc16e00010"
FT                   /product="small subunit ribosomal RNA"
FT   mRNA            complement(join(<983..1384,1486..>1629))
FT                   /gene="Pc16g00010"
FT                   /locus_tag="PCH_Pc16g00010"
FT   CDS_pept        complement(join(983..1384,1486..1629))
FT                   /gene="Pc16g00010"
FT                   /locus_tag="PCH_Pc16g00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92671"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R5"
FT                   /protein_id="CAP92671.1"
FT                   /translation="MSLSFSKKWPTLYGDFAVHGPPPYKNCPPEQFLATSTAFCIFTPQ
FT                   MGSCWGGSPTAVVSSGTQQRLIPPMTSSPRSALGPLGGHSAPGLVVMGALAELLPGASA
FT                   VVTEARGPFGARHRWSLWIDGRWPYPKPRFLEGAAPWDPPFAGVVHGVWTLHPRATCRS
FT                   LPAPSRAPGPDPLRADWC"
FT   exon            complement(983..1384)
FT                   /gene="Pc16g00010"
FT                   /locus_tag="PCH_Pc16g00010"
FT                   /number=1
FT   intron          complement(1385..1485)
FT                   /gene="Pc16g00010"
FT                   /locus_tag="PCH_Pc16g00010"
FT                   /number=1
FT   exon            complement(1486..1629)
FT                   /gene="Pc16g00010"
FT                   /locus_tag="PCH_Pc16g00010"
FT                   /number=2
FT   mRNA            join(<1904..2658,2775..>3246)
FT                   /gene="Pc16g00020"
FT                   /locus_tag="PCH_Pc16g00020"
FT   CDS_pept        join(1904..2658,2775..3246)
FT                   /gene="Pc16g00020"
FT                   /locus_tag="PCH_Pc16g00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92672"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S1"
FT                   /protein_id="CAP92672.1"
FT                   /translation="MPARAHRRAPDPLAGAVNPLPPCRGLSPMAPRGSGLALYAPLPKP
FT                   PGRWPPSTPDPPAVRRTGESVKSPYLPPRRGSSPTPPPKPRLPKPREGAPAPXXXPXAS
FT                   RLALGRPLRAPASPPPHPLHLTRRCGQLPRRANWRPTPPFPGPRSPAGRPSPRGWGRGD
FT                   RRWRTVTWGPACRGVVPRGSPCQGPHRNIPRHPGTPHATRRGHSCGPSLPQPRTVGPGS
FT                   LLHRLTDPIWGVKMQNAVQVAGNCSGGQFLCFGPAFAPPTPILDPAYLPPGPGGALATI
FT                   PAEGACSTVASTKGPASLPAWTGCPLDPRSGPRPTRRANWPIPKGTITPRGRPVYCLSS
FT                   YVPPQLKITALDSPSPPSIPLHPPHHPLHSTAMARNLQPHETHHPQFPFAALRHPPSPS
FT                   PPTTFHRNN"
FT   exon            1904..2658
FT                   /gene="Pc16g00020"
FT                   /locus_tag="PCH_Pc16g00020"
FT                   /number=1
FT   intron          2659..2774
FT                   /gene="Pc16g00020"
FT                   /locus_tag="PCH_Pc16g00020"
FT                   /number=1
FT   exon            2775..3246
FT                   /gene="Pc16g00020"
FT                   /locus_tag="PCH_Pc16g00020"
FT                   /number=2
FT   rRNA            complement(4012..4112)
FT                   /gene="25S rRNA"
FT                   /locus_tag="PCH_Pc16e00020"
FT                   /product="25S ribosomal RNA"
FT   rRNA            complement(4410..5103)
FT                   /gene="28S rRNA"
FT                   /locus_tag="PCH_Pc16e00030"
FT                   /product="28S ribosomal RNA"
FT   gap             5242..5341
FT                   /estimated_length=unknown
FT   mRNA            complement(<6169..>6855)
FT                   /gene="Pc16g00030"
FT                   /locus_tag="PCH_Pc16g00030"
FT   CDS_pept        complement(6169..6855)
FT                   /pseudo
FT                   /gene="Pc16g00030"
FT                   /locus_tag="PCH_Pc16g00030"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to protein gag - Magnaporthe
FT                   grisea [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AF314096.1"
FT   exon            complement(6169..6855)
FT                   /gene="Pc16g00030"
FT                   /locus_tag="PCH_Pc16g00030"
FT                   /number=1
FT   gap             8105..8204
FT                   /estimated_length=unknown
FT   mRNA            complement(join(<8497..8963,9015..9624,9798..10266,
FT                   10378..>10406))
FT                   /gene="Pc16g00040"
FT                   /locus_tag="PCH_Pc16g00040"
FT   CDS_pept        complement(join(8497..8963,9015..9624,9798..10266,
FT                   10378..10406))
FT                   /gene="Pc16g00040"
FT                   /locus_tag="PCH_Pc16g00040"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_89_scaffold_6.tfa_690wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92674"
FT                   /db_xref="GOA:B6H6R4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R4"
FT                   /protein_id="CAP92674.1"
FT                   /translation="MRKSWRAGVTAQIETVYHLLRPDAIEGRLPGRRRERVNYISPGPN
FT                   DVWHVDGHMKLEPFGIEIYAAIDGYSRYIVWPYVGVSARTAVSVQRQCLDVFAEYGFQP
FT                   RKIRSDRGTETVLLADTQYELRKLGDPSVQIRDCYLYGRSVDNQRIEGWWGLLSRATTG
FT                   LFHEYFKCLQRENLFVKDCIPEQVSLLAIYMPLIRCRVEAYTNQWNYHHIQSQPHRPHV
FT                   VKGKPIMNWKHADVPDLHCPINLDPTSEQGQLLQSLREDVQDWDPDEYLPPSTLTWCHQ
FT                   QLTEIGQQLVGIPFNPNDPNPALCGEPRAPYRAVYEALRERAFTHWNTGYNPILDVCIK
FT                   PHGAADWQGIGAAPANWQVADWQVTADWEVSRDFLSLINFSSSIDFSSSINFSSISSMA
FT                   APNSVLANAFVTALQQAGYTISAPATAPATAPATAPPPPYTATPYTAPPYTAPLYTAPP
FT                   YTAPPSTAPPSTPFSGLRGTVSSTRLAYQRQRGNQVAERDIPLTVTFYLQERPGETNCW
FT                   GGHVLIT"
FT   exon            complement(8497..8963)
FT                   /gene="Pc16g00040"
FT                   /locus_tag="PCH_Pc16g00040"
FT                   /number=1
FT   intron          complement(8964..9014)
FT                   /gene="Pc16g00040"
FT                   /locus_tag="PCH_Pc16g00040"
FT                   /number=1
FT   exon            complement(9015..9624)
FT                   /gene="Pc16g00040"
FT                   /locus_tag="PCH_Pc16g00040"
FT                   /number=2
FT   intron          complement(9625..9797)
FT                   /gene="Pc16g00040"
FT                   /locus_tag="PCH_Pc16g00040"
FT                   /number=2
FT   exon            complement(9798..10266)
FT                   /gene="Pc16g00040"
FT                   /locus_tag="PCH_Pc16g00040"
FT                   /number=3
FT   intron          complement(10267..10377)
FT                   /gene="Pc16g00040"
FT                   /locus_tag="PCH_Pc16g00040"
FT                   /number=3
FT   exon            complement(10378..10406)
FT                   /gene="Pc16g00040"
FT                   /locus_tag="PCH_Pc16g00040"
FT                   /number=4
FT   mRNA            join(<10876..11683,11768..12445,12560..13618,14312..14620,
FT                   14912..>16352)
FT                   /gene="Pc16g00050"
FT                   /locus_tag="PCH_Pc16g00050"
FT   CDS_pept        join(10876..11683,11768..12445,12560..13618,14312..14620,
FT                   14912..16352)
FT                   /pseudo
FT                   /gene="Pc16g00050"
FT                   /locus_tag="PCH_Pc16g00050"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to retrotransposon like
FT                   protein An10g00740 - Aspergillus niger [putative
FT                   pseudogene]"
FT                   /inference="protein motif:PFAM:PF00665"
FT   exon            10876..11683
FT                   /gene="Pc16g00050"
FT                   /locus_tag="PCH_Pc16g00050"
FT                   /number=1
FT   intron          11684..11767
FT                   /gene="Pc16g00050"
FT                   /locus_tag="PCH_Pc16g00050"
FT                   /number=1
FT   exon            11768..12445
FT                   /gene="Pc16g00050"
FT                   /locus_tag="PCH_Pc16g00050"
FT                   /number=2
FT   intron          12446..12559
FT                   /gene="Pc16g00050"
FT                   /locus_tag="PCH_Pc16g00050"
FT                   /number=2
FT   exon            12560..13618
FT                   /gene="Pc16g00050"
FT                   /locus_tag="PCH_Pc16g00050"
FT                   /number=3
FT   intron          13619..14311
FT                   /gene="Pc16g00050"
FT                   /locus_tag="PCH_Pc16g00050"
FT                   /number=3
FT   exon            14312..14620
FT                   /gene="Pc16g00050"
FT                   /locus_tag="PCH_Pc16g00050"
FT                   /number=4
FT   intron          14621..14911
FT                   /gene="Pc16g00050"
FT                   /locus_tag="PCH_Pc16g00050"
FT                   /number=4
FT   exon            14912..16352
FT                   /gene="Pc16g00050"
FT                   /locus_tag="PCH_Pc16g00050"
FT                   /number=5
FT   mRNA            complement(<16511..>17662)
FT                   /gene="Pc16g00060"
FT                   /locus_tag="PCH_Pc16g00060"
FT   CDS_pept        complement(16511..17662)
FT                   /gene="Pc16g00060"
FT                   /locus_tag="PCH_Pc16g00060"
FT                   /note="Title: similarity to retrotransposon like protein
FT                   An10g00740 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92676"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R6"
FT                   /protein_id="CAP92676.1"
FT                   /translation="MSDTGSGSGSRGESSRRLPAPQPQPVTQGTRLSEKTDVKWMKACT
FT                   LRVDGSNFVRWKREITNGLRMTRIENVVNFNLPKPKEDDPEYDTWYYWSVYTLGWISST
FT                   LDNEITTILEGSIQQFPEYADDLMKEITRIVSGDNKVLNVGAEVLKFDKLKRENYTTAK
FT                   DYIMAYQRQFNILGRYGVAPHPFAALYTMLHALREELPSVNFTFDTLKRQVPTETTMND
FT                   FGEYCKELIIESNTTTEETSPGLAKTTRSSSPSSSSRGGRGQRGRGGRIGRGNDWRKPK
FT                   EDNKVDDKGEAKDEPEEKQLRGAPPKGADIDEWAERQRCQQPQYINGTECTHCRLDGHP
FT                   AKACFHLMEEFVFDGWEPFPEVWCYATARMEKKDAKDAKDGKK"
FT   exon            complement(16511..17662)
FT                   /gene="Pc16g00060"
FT                   /locus_tag="PCH_Pc16g00060"
FT                   /number=1
FT   mRNA            <18329..>18562
FT                   /gene="Pc16g00070"
FT                   /locus_tag="PCH_Pc16g00070"
FT   CDS_pept        18329..18562
FT                   /pseudo
FT                   /gene="Pc16g00070"
FT                   /locus_tag="PCH_Pc16g00070"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical protein An02g09120
FT                   - Aspergillus niger [putative pseudogene]"
FT   exon            18329..18562
FT                   /gene="Pc16g00070"
FT                   /locus_tag="PCH_Pc16g00070"
FT                   /number=1
FT   mRNA            <19853..>21018
FT                   /gene="Pc16g00080"
FT                   /locus_tag="PCH_Pc16g00080"
FT   CDS_pept        19853..21018
FT                   /pseudo
FT                   /gene="Pc16g00080"
FT                   /locus_tag="PCH_Pc16g00080"
FT                   /note="putative pseudogene"
FT                   /note="unknown EC_number=3.1.6.14"
FT                   /note="Title: strong similarity to mucin-desulfating
FT                   sulfatase MdsA - Prevotella sp. [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AF248951.3"
FT                   /inference="protein motif:COGS:COG3119"
FT   exon            19853..21018
FT                   /gene="Pc16g00080"
FT                   /locus_tag="PCH_Pc16g00080"
FT                   /number=1
FT   mRNA            join(<22280..22495,22556..22775,22833..22901,22956..23558,
FT                   23609..>24051)
FT                   /gene="Pc16g00090"
FT                   /locus_tag="PCH_Pc16g00090"
FT   CDS_pept        join(22280..22495,22556..22775,22833..22901,22956..23558,
FT                   23609..24051)
FT                   /gene="Pc16g00090"
FT                   /locus_tag="PCH_Pc16g00090"
FT                   /note="Title: strong similarity to cytochrome P450
FT                   monooxygenase P450I - Gibberella fujikuroi"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92679"
FT                   /db_xref="GOA:B6H6R7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R7"
FT                   /inference="similar to AA sequence:TREMBL:GFP450I.1"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /inference="protein motif:COGS:COG2124"
FT                   /protein_id="CAP92679.1"
FT                   /translation="MLGYALNGSLPGDVVVAVGVILLAGYVLQFAFAVGSKLPLINQNS
FT                   ILDFGSMKSRRSYVTGAADLIKSGFAKSAKGFRLVTDNGCQVVLPPRYLNEIRNHPDMS
FT                   RDKASAKELHSHLPGFEPFREGSKDERIMHDVVLTKLTRKLGRVTEDLSKETAEVVRKY
FT                   WTDEKEWHALSLRSTITPMLARMSSRVFLGELLCRDPSWLHITINYAVHVIRATDELRQ
FT                   WPKMLRPFVNRVLPSCRMIRSDMKQALGLITPILNKRRADREAAIKAGTPPTQYNDAID
FT                   WMEDVAKGRPYNPAISQLLLSMAAIHTSADMLTQILFDIAAQPDLVKALREEIITVTRE
FT                   NGWNKISLYKLVLMDSTIKESQRLKPVAITPMRRLTTADVELSDGVFIPKDTTILVSAN
FT                   SMWDEKNYENPEKFDGYRFLKMRDVPGQQTAAQLVAPSPIHLGWGFGQHACPGRFFAAN
FT                   EMKIALCQILLKYDIKLDEKRLPQVRRFGVSMTADSTANLLIRRRQEEVSPEELGCQV"
FT   exon            22280..22495
FT                   /gene="Pc16g00090"
FT                   /locus_tag="PCH_Pc16g00090"
FT                   /number=1
FT   intron          22496..22555
FT                   /gene="Pc16g00090"
FT                   /locus_tag="PCH_Pc16g00090"
FT                   /number=1
FT   exon            22556..22775
FT                   /gene="Pc16g00090"
FT                   /locus_tag="PCH_Pc16g00090"
FT                   /number=2
FT   intron          22776..22832
FT                   /gene="Pc16g00090"
FT                   /locus_tag="PCH_Pc16g00090"
FT                   /number=2
FT   exon            22833..22901
FT                   /gene="Pc16g00090"
FT                   /locus_tag="PCH_Pc16g00090"
FT                   /number=3
FT   intron          22902..22955
FT                   /gene="Pc16g00090"
FT                   /locus_tag="PCH_Pc16g00090"
FT                   /number=3
FT   exon            22956..23558
FT                   /gene="Pc16g00090"
FT                   /locus_tag="PCH_Pc16g00090"
FT                   /number=4
FT   intron          23559..23608
FT                   /gene="Pc16g00090"
FT                   /locus_tag="PCH_Pc16g00090"
FT                   /number=4
FT   exon            23609..24051
FT                   /gene="Pc16g00090"
FT                   /locus_tag="PCH_Pc16g00090"
FT                   /number=5
FT   mRNA            complement(join(<24640..25048,25105..>25931))
FT                   /gene="Pc16g00100"
FT                   /locus_tag="PCH_Pc16g00100"
FT   CDS_pept        complement(join(24640..25048,25105..25931))
FT                   /gene="Pc16g00100"
FT                   /locus_tag="PCH_Pc16g00100"
FT                   /note="unknown EC_number=1.1.3.-"
FT                   /note="Title: strong similarity to choline monooxygenase
FT                   like protein An04g09810 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00100"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92680"
FT                   /db_xref="GOA:B6H6R8"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R8"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /inference="protein motif:COGS:COG4638"
FT                   /protein_id="CAP92680.1"
FT                   /translation="MTSTISSLFGYKPDDYGAPKAPAEPVKALPASWYRSPEIYELERR
FT                   AIFSKKWILITHKLRFEKPGDFYRFEMTGFSFVLCLNRQGNLSGFHNICRHRAFPLVSQ
FT                   DQGNSPVVSCKYHGWSYGLDGKLTKAPKDDDVPGFKKEEQSLFPVHIHVDALGFVWVNL
FT                   DSSRTPIPWEDDFQGVDTQERFREFDFGRYMFDHTWHMNGNYNWKTLADNYNECYHCSV
FT                   AHPDVAKLADLSYYYTVSKAGHIQHFSRPKQDKVKDDIKNASTYYFPNACMTVSPHFFY
FT                   LMRCVPTSVGTCSMEYEVYRNKEASDEDFEYIDSFFKRVLNEDKHLCNAAQKNLDAGVF
FT                   VNGQLHPDLESAPLFFQNTVRGLLRNHRDEEKRQNMELWPARQSSPGSATAEDINFCAE
FT                   LTCSGKYGDLEW"
FT   exon            complement(24640..25048)
FT                   /gene="Pc16g00100"
FT                   /locus_tag="PCH_Pc16g00100"
FT                   /number=1
FT   intron          complement(25049..25104)
FT                   /gene="Pc16g00100"
FT                   /locus_tag="PCH_Pc16g00100"
FT                   /number=1
FT   exon            complement(25105..25931)
FT                   /gene="Pc16g00100"
FT                   /locus_tag="PCH_Pc16g00100"
FT                   /number=2
FT   mRNA            join(<27016..27068,27211..28095,28146..>28869)
FT                   /gene="Pc16g00110"
FT                   /locus_tag="PCH_Pc16g00110"
FT   CDS_pept        join(27016..27068,27211..28095,28146..28869)
FT                   /gene="Pc16g00110"
FT                   /locus_tag="PCH_Pc16g00110"
FT                   /note="Title: weak similarity to hypothetical transcription
FT                   regulator SPAC11D3.07c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92681"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R9"
FT                   /inference="similar to AA sequence:PIR:T37518"
FT                   /protein_id="CAP92681.1"
FT                   /translation="MSFNRKRAALACTFCRSRGLCWFTIQGECPLTGVDRIDTSGGTRE
FT                   ILSRLHDIETILKAQSDQISNVAKSHIGAFAVPEASPSGLTTAPPRELPNATMPSPWLF
FT                   SGFNMQPDLPELPPLTIPVKHKTSSSYLLSLPPVKSLIGEYPTDLFFLLESRAHLPPEL
FT                   SFEKWPVPKPSVEIESDVATNLVSIFFASAHHDHPILDPGKFEDIFRRFLENGPDSSTA
FT                   SALCMVVLALGAVAASPLDAHTFLHSPPGMQYMQHAMPTLLSQSAWSLSCSLMLPQALV
FT                   LASVYFAYIVRPLQSWRLVYSATTIIQLKLSGIDTQQKESWWRESLIRLFWSCFLIECD
FT                   RLAELELPRSGLQQLTDEISLPECTNLGTMQSTCYLAEISIRRLLNRVHNSLYPNKKHG
FT                   LALSSTTFATPEEFAMDDISSISAVCDELRSQLELWHSSIPDIFRPELNFEASMQESND
FT                   RQAILRIRYFATRHIIYRPFVLFIVTHDVTSISHDIIEKAGICLESCRCYIHSTARILK
FT                   TPSQYTWTFSLSYVRWTEALPTSADKANLTDHSVPL"
FT   sig_peptide     join(27016..27068,27211..27214)
FT                   /gene="Pc16g00110"
FT                   /locus_tag="PCH_Pc16g00110"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            27016..27068
FT                   /gene="Pc16g00110"
FT                   /locus_tag="PCH_Pc16g00110"
FT                   /number=1
FT   intron          27069..27210
FT                   /gene="Pc16g00110"
FT                   /locus_tag="PCH_Pc16g00110"
FT                   /number=1
FT   exon            27211..28095
FT                   /gene="Pc16g00110"
FT                   /locus_tag="PCH_Pc16g00110"
FT                   /number=2
FT   mat_peptide     join(27215..28095,28146..28866)
FT                   /gene="Pc16g00110"
FT                   /locus_tag="PCH_Pc16g00110"
FT   intron          28096..28145
FT                   /gene="Pc16g00110"
FT                   /locus_tag="PCH_Pc16g00110"
FT                   /number=2
FT   exon            28146..28869
FT                   /gene="Pc16g00110"
FT                   /locus_tag="PCH_Pc16g00110"
FT                   /number=3
FT   mRNA            complement(join(<29128..29460,29516..30379,30437..>30616))
FT                   /gene="Pc16g00120"
FT                   /locus_tag="PCH_Pc16g00120"
FT   CDS_pept        complement(join(29128..29460,29516..30379,30437..30616))
FT                   /gene="Pc16g00120"
FT                   /locus_tag="PCH_Pc16g00120"
FT                   /note="unknown EC_number=5.1.2.2"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   RTS-beta - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92682"
FT                   /db_xref="GOA:B6H6S0"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S0"
FT                   /inference="similar to AA sequence:TREMBL:AF305057.1"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /inference="protein motif:COGS:COG4948"
FT                   /inference="protein motif:COGS:COG0148"
FT                   /protein_id="CAP92682.1"
FT                   /translation="MSAAPVHVQDITVTSFEVIDLRFPTSLDGVGSDAMHVGTNGSHPY
FT                   IRLKTNQGTLIGEGIAFSNGRGSELICMALDIFARRVVGKSMHELTRDMGKTWRYMVSD
FT                   SQYRWIGPEKSVTHLAVAGVLNAVWDLWGKILGKPVWKIVCDMDPEEVVRCIDFRYITD
FT                   VITPEESVEILKKTQKDKETRLQEALENRAVPAYTTSPGWLAFSGDRMREVLQETIAAG
FT                   YTTFKFKVGTNVEADRERLAAVREVLGYDQGHQIMIDANQVWSVPQAIEYMKRLVEFKP
FT                   VFIEEPTNPDDVLGHATIRRALKPYGVGVATGEAAQNRVTFKQLLQAEATDVCQIDAVR
FT                   LGSVNECLAVMLMALKFNVPCVPHNGAMGLTELTSHLSTIDYIAISGRKSMLENADSHR
FT                   ENLRHPSKIENAHYVTPLDPGYSTGYTHTALEKYTYPSGSFWKSDIGLEIIAQPTGGEL
FT                   "
FT   exon            complement(29128..29460)
FT                   /gene="Pc16g00120"
FT                   /locus_tag="PCH_Pc16g00120"
FT                   /number=1
FT   intron          complement(29461..29515)
FT                   /gene="Pc16g00120"
FT                   /locus_tag="PCH_Pc16g00120"
FT                   /number=1
FT   exon            complement(29516..30379)
FT                   /gene="Pc16g00120"
FT                   /locus_tag="PCH_Pc16g00120"
FT                   /number=2
FT   intron          complement(30380..30436)
FT                   /gene="Pc16g00120"
FT                   /locus_tag="PCH_Pc16g00120"
FT                   /number=2
FT   exon            complement(30437..30616)
FT                   /gene="Pc16g00120"
FT                   /locus_tag="PCH_Pc16g00120"
FT                   /number=3
FT   mRNA            join(<30942..31187,31248..>32021)
FT                   /gene="Pc16g00130"
FT                   /locus_tag="PCH_Pc16g00130"
FT   CDS_pept        join(30942..31187,31248..32021)
FT                   /gene="Pc16g00130"
FT                   /locus_tag="PCH_Pc16g00130"
FT                   /note="unknown EC_number=1.1.1.-"
FT                   /note="Title: strong similarity to ketoreductase krd
FT                   -Zygosaccharomyces rouxii"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92683"
FT                   /db_xref="GOA:B6H6S2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S2"
FT                   /inference="similar to AA sequence:TREMBL:AF178079.1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /inference="protein motif:PFAM:PF01073"
FT                   /inference="protein motif:COGS:COG1088"
FT                   /inference="protein motif:COGS:COG0451"
FT                   /inference="protein motif:COGS:COG1087"
FT                   /protein_id="CAP92683.1"
FT                   /translation="MVKFILVTGATGFIGAHIVDVLLARGIRVRGATRSLEKGDSMIKA
FT                   RPQHSGRLEFVQIDDFERPGGLVEAVQGVDGVIHTASPFTYNTRNNERELVRPAINGVR
FT                   AVLEAASTNPKIRRIVITSSFASVLDANRKGPLYFTYTGDDWNPLTYEESVDPATNAII
FT                   AYRGSKKFAELEAWKYVQEHSPKFDIVALCPPMTFGPVVHPVSHVDKLNESNLMLWKIA
FT                   NGENPLPVARVPFWIDVRDLAIAHVESLLRNEVGGKRYVPSSPERFSYGLAAKIIAEEF
FT                   PDLKTKVTQEDQVIDESCGLDGQTAAMELGYTYHLFHDTVRDLVSQTISLSERSPSCR"
FT   sig_peptide     30942..30989
FT                   /gene="Pc16g00130"
FT                   /locus_tag="PCH_Pc16g00130"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            30942..31187
FT                   /gene="Pc16g00130"
FT                   /locus_tag="PCH_Pc16g00130"
FT                   /number=1
FT   mat_peptide     join(30990..31187,31248..32018)
FT                   /gene="Pc16g00130"
FT                   /locus_tag="PCH_Pc16g00130"
FT   intron          31188..31247
FT                   /gene="Pc16g00130"
FT                   /locus_tag="PCH_Pc16g00130"
FT                   /number=1
FT   exon            31248..32021
FT                   /gene="Pc16g00130"
FT                   /locus_tag="PCH_Pc16g00130"
FT                   /number=2
FT   mRNA            join(<32657..32779,32837..33645,33713..33813,33866..34072,
FT                   34128..>34384)
FT                   /gene="Pc16g00140"
FT                   /locus_tag="PCH_Pc16g00140"
FT   CDS_pept        join(32657..32779,32837..33645,33713..33813,33866..34072,
FT                   34128..34384)
FT                   /gene="Pc16g00140"
FT                   /locus_tag="PCH_Pc16g00140"
FT                   /note="Title: strong similarity to high affinity hexose
FT                   transporter Hxt1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92684"
FT                   /db_xref="GOA:B6H6S3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S3"
FT                   /inference="similar to AA sequence:SWISSPROT:GAL2_YEAST"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP92684.1"
FT                   /translation="MAWFGYDQGVFSGVLISADFKKHFPQTKESNISGITSSCFSLGAF
FT                   FGAIFAFTLGDRLGRKKTITLGLVCNTIGAVLQIVSWHLPQLIVGRIINGFGMGLTSST
FT                   CPVYQAECSKPRVRGKLVVVGSLSNTAAFCLSNWMNYGLFFQGEALQWRFPLGFQLIFP
FT                   CIVVGALIFVPESPRWLLLQDRHEEALAVIARLEGRRKDVHDPDVTAQFLSIRSALEVE
FT                   RQSQVPMADVLMCRDKTQNLRRLLLSCGTQFMQQFSGVNALGYYLPTLLQESVGLAEEE
FT                   SRLLTAVNGTTYLFSAFCCLAIIDRFGRRKLMLYGSVTMGACYLIAAMCLKTGEGDPSR
FT                   KQQVVTTAMFFLYYFFYGTSFAKVPWVYNSEMNSLGWRTRGAAAATATNWMGGFIVTQF
FT                   TSVGVNTLHWRFYLIFAVIAWSFFPIIFCLYPETSRRTLEDMDEIFIRHPSPIVCGKQE
FT                   LTQRKRPQTFVDAERDRIMENKEFGKETAKGGTTAHYEHV"
FT   exon            32657..32779
FT                   /gene="Pc16g00140"
FT                   /locus_tag="PCH_Pc16g00140"
FT                   /number=1
FT   intron          32780..32836
FT                   /gene="Pc16g00140"
FT                   /locus_tag="PCH_Pc16g00140"
FT                   /number=1
FT   exon            32837..33645
FT                   /gene="Pc16g00140"
FT                   /locus_tag="PCH_Pc16g00140"
FT                   /number=2
FT   intron          33646..33712
FT                   /gene="Pc16g00140"
FT                   /locus_tag="PCH_Pc16g00140"
FT                   /number=2
FT   exon            33713..33813
FT                   /gene="Pc16g00140"
FT                   /locus_tag="PCH_Pc16g00140"
FT                   /number=3
FT   intron          33814..33865
FT                   /gene="Pc16g00140"
FT                   /locus_tag="PCH_Pc16g00140"
FT                   /number=3
FT   exon            33866..34072
FT                   /gene="Pc16g00140"
FT                   /locus_tag="PCH_Pc16g00140"
FT                   /number=4
FT   intron          34073..34127
FT                   /gene="Pc16g00140"
FT                   /locus_tag="PCH_Pc16g00140"
FT                   /number=4
FT   exon            34128..34384
FT                   /gene="Pc16g00140"
FT                   /locus_tag="PCH_Pc16g00140"
FT                   /number=5
FT   mRNA            <35978..>37264
FT                   /gene="Pc16g00150"
FT                   /locus_tag="PCH_Pc16g00150"
FT   CDS_pept        35978..37264
FT                   /gene="Pc16g00150"
FT                   /locus_tag="PCH_Pc16g00150"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   aos20 - Aspergillus oryzae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92685"
FT                   /db_xref="GOA:B6H6S4"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S4"
FT                   /inference="similar to AA sequence:TREMBL:AB079025.1"
FT                   /protein_id="CAP92685.1"
FT                   /translation="MVVELDTTLAELYANNGLPGPIVVDLYRTYTHIDLHDNFPRERMF
FT                   VEDEDPSTYCSEEEDLPRFKKWALNSRTIRHLPMVGPADVILYLPYNSRDNIDRALDQF
FT                   PKHQRPMVKYVDLDSPCMAKDRRMAIKDKKLVYWRPKSWMVGEDCSVPPELSYMLNDKR
FT                   FLIHPEIPTPSLEMVSLLHEDQRDYLVKLQLPFVVKFCRCSSGQGTYIATTEEERRQML
FT                   EAVRRYRERGGVDIQVSEFVGSRKPHYGVNFFVGRDESLQPCFLGATEQVVAKNGVWVG
FT                   GVIDYQAQGDLERRLRNTIAVVARTLQQYSYVGWIGIDVIFDSDDRPLVVDLNARIAAG
FT                   IGIVLFSKHFMSMGLPFAGMETVSFTGPASGIYAALSASIESGKVIVTLSAEVTDTESV
FT                   ASVVFGGRTRDDLNAVADWIRDVLRTCLN"
FT   exon            35978..37264
FT                   /gene="Pc16g00150"
FT                   /locus_tag="PCH_Pc16g00150"
FT                   /number=1
FT   mRNA            complement(join(<37863..37944,37998..38071,38137..39030,
FT                   39097..39144,39200..39244,39295..>39348))
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT   CDS_pept        complement(join(37863..37944,37998..38071,38137..39030,
FT                   39097..39144,39200..39244,39295..39348))
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT                   /note="unknown EC_number=1.1.3.-"
FT                   /note="Title: strong similarity to PRG3 protein like
FT                   protein An15g07360 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00160"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92686"
FT                   /db_xref="GOA:B6H6S5"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S5"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /inference="protein motif:COGS:COG1249"
FT                   /protein_id="CAP92686.1"
FT                   /translation="MATSLRNIIVVGGSFVGRTTAQELARIVPSTHRVLLTEPHSHFHH
FT                   LFTFPRFAIVPGQEHKAFIPYSGIFNASPNPSSHGVVQARVLSVKPTHIELDREWQGSK
FT                   DVPFDYVVVATGTRLSKPAAMDDDDKASSVEYLQKHQAGVKRSQSILIVGGGAVGVQMA
FT                   ADLKEYYPEKEVTVVQSRPRVMPNFHSGLHDLIKRRFDELGIRLITGSRVTIPPNGFPN
FT                   DGSTFDVQLTNGTTESTQFVILATGQTPNNQLVADLKSSRPDAESVVNPDNGFIRVRPT
FT                   MQFLDEQYSNLFAVGDIADTGAQKAARPGSAQAAVVAKNIQALIEGRAAEDTFAKGPGA
FT                   IHLTLGMKHNVIFRNPNTAEGQTEPWINPKDDGREDMNVEAMWERLGISVDNPRQYHL"
FT   exon            complement(37863..37944)
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT                   /number=1
FT   mat_peptide     complement(join(37866..37944,37998..38071,38137..39030,
FT                   39097..39144,39200..39235))
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT   intron          complement(37945..37997)
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT                   /number=1
FT   exon            complement(37998..38071)
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT                   /number=2
FT   intron          complement(38072..38136)
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT                   /number=2
FT   exon            complement(38137..39030)
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT                   /number=3
FT   intron          complement(39031..39096)
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT                   /number=3
FT   exon            complement(39097..39144)
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT                   /number=4
FT   intron          complement(39145..39199)
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT                   /number=4
FT   exon            complement(39200..39244)
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT                   /number=5
FT   sig_peptide     complement(join(39236..39244,39295..39348))
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(39245..39294)
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT                   /number=5
FT   exon            complement(39295..39348)
FT                   /gene="Pc16g00160"
FT                   /locus_tag="PCH_Pc16g00160"
FT                   /number=6
FT   mRNA            complement(<39905..>40996)
FT                   /gene="Pc16g00170"
FT                   /locus_tag="PCH_Pc16g00170"
FT   CDS_pept        complement(39905..40996)
FT                   /gene="Pc16g00170"
FT                   /locus_tag="PCH_Pc16g00170"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig42.tfa_450wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00170"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92687"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S7"
FT                   /protein_id="CAP92687.1"
FT                   /translation="MPGHFGQKILNTLGLNDHIHHQSSSVRLPGRPALSNDERGLSSPP
FT                   NNGTYPRLCRLSDGTILSSFTRFPDGQRSLRVAKSTDNGRTFEDFSEVTRAAGDVDNMF
FT                   LCEVAPGTILAAFRNHDTGPNGPTHFRITVCRSTDGGRVWQYASQAAEKRPPLGIWEPF
FT                   MRVGRQGEVQLYFSQEFAHNNQCTMLVISRDQGSTWTQPTCLHGDQDPLRDGMCGIAPT
FT                   FDNGREALLMVFETTRYGPFSVEALLSYDDGATWGWRHEVYRPRQGHNAGSPQIASFAD
FT                   GSMATIFMTDEDSNRVEWVKNASIKVVFAGPPVEGRVQWSSPTLVSPASSFWPGIMALD
FT                   HHNVLATYDRGGPLTKTITWHPA"
FT   exon            complement(39905..40996)
FT                   /gene="Pc16g00170"
FT                   /locus_tag="PCH_Pc16g00170"
FT                   /number=1
FT   mRNA            complement(<42245..>43294)
FT                   /gene="Pc16g00180"
FT                   /locus_tag="PCH_Pc16g00180"
FT   CDS_pept        complement(42245..43294)
FT                   /gene="Pc16g00180"
FT                   /locus_tag="PCH_Pc16g00180"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig10.tfa_220cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92688"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S9"
FT                   /protein_id="CAP92688.1"
FT                   /translation="MHFHSTLLSGLAILPVALASWPFFEHTAKLSATPYRNERPNVKVE
FT                   TLFQFPNNGSWIDNMVIRSDGNLLLTRLDTPEVWLFDTTTGNATLAYSFPNVTSCFGIS
FT                   EIDDDVFAVVVGNFSAKTFQPGPASFSVQKLDFTKSDSEENARALGSPTASEIVAMPDA
FT                   GALNGMATLSRGSNLVLIADSPKGVIWKVDTKTGDYSVALNDTTMAPAKGQGLPLGVNA
FT                   LTVLGDYVYYTGTTQMVYCRVKVDKEANPVGDFEVIASGFLPDNVEMTEDGVAYIPTAP
FT                   QNSVVRLTPSGQISLVTGGQVSTQLAGPSSVRLSKDRQILYVGTNGGQIAPVLGSFIEP
FT                   AKIVKVSFE"
FT   exon            complement(42245..43294)
FT                   /gene="Pc16g00180"
FT                   /locus_tag="PCH_Pc16g00180"
FT                   /number=1
FT   mat_peptide     complement(42248..43237)
FT                   /gene="Pc16g00180"
FT                   /locus_tag="PCH_Pc16g00180"
FT   sig_peptide     complement(43238..43294)
FT                   /gene="Pc16g00180"
FT                   /locus_tag="PCH_Pc16g00180"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(<43746..>45080)
FT                   /gene="Pc16g00190"
FT                   /locus_tag="PCH_Pc16g00190"
FT   CDS_pept        complement(43746..45080)
FT                   /gene="Pc16g00190"
FT                   /locus_tag="PCH_Pc16g00190"
FT                   /note="unknown EC_number=1.-.-.-"
FT                   /note="Title: strong similarity to NADH oxidase nadA
FT                   -Aspergillus parasiticus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92689"
FT                   /db_xref="GOA:B6H6T0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T0"
FT                   /inference="similar to AA sequence:TREMBL:AF168613.1"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /inference="protein motif:COGS:COG1902"
FT                   /protein_id="CAP92689.1"
FT                   /translation="MSPRFPSENVDVSPLGAPLQFEFSQRKASNRFLKAALTERMASWS
FT                   PADLSARGIPSQNLINLYRRWGEGQFGLILTGNIMIAYDQLESPGNMIIDLENPLSGER
FT                   FEAFKQLATAAKKHGSLIVGQVSHPGRQTFEKLQPNPVSASDVQLVMEKFGAFGKPHAA
FT                   TEEEIQDIIRRFVHVAVYLQKAGYDGIQLHSAHGYLLAQFLSQTTNKRTDKYGGSLANR
FT                   ARIIVEIAQAIRQAVSDPGFIIGIKINSVEFQEHGFTPEESKELCEILDQTNFDFVELS
FT                   GGTYEAGAFQHKRESSQKRESFFLEFADLITPALKRTRSYVTGGFCTASGMVQALKTVD
FT                   GVGLGRTITQEPRLPRELLSGSVKGAIQQKIDPQDFFKTSPAAGAQMLQIAQDEEPIDL
FT                   SCDANMEVFMKSLGEWAQQMQKDGAAMNMYGYAQLPKGQPFQSHL"
FT   exon            complement(43746..45080)
FT                   /gene="Pc16g00190"
FT                   /locus_tag="PCH_Pc16g00190"
FT                   /number=1
FT   mRNA            join(<46042..46202,46251..47143,47202..47391,47444..>47643)
FT                   /pseudo
FT                   /gene="Pc16g00200"
FT                   /locus_tag="PCH_Pc16g00200"
FT                   /note="submitted as non-pseudo"
FT   CDS_pept        join(46042..46202,46251..47143,47202..47391,47444..47643)
FT                   /pseudo
FT                   /gene="Pc16g00200"
FT                   /locus_tag="PCH_Pc16g00200"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to cutinase transcription
FT                   factor 1 CTF1-alpha - Fusarium solani"
FT                   /inference="similar to AA sequence:SWISSPROT:CT1A_FUSSO"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:PFAM:PF04082"
FT   exon            46042..46202
FT                   /gene="Pc16g00200"
FT                   /locus_tag="PCH_Pc16g00200"
FT                   /number=1
FT   intron          46203..46250
FT                   /gene="Pc16g00200"
FT                   /locus_tag="PCH_Pc16g00200"
FT                   /number=1
FT   exon            46251..47143
FT                   /gene="Pc16g00200"
FT                   /locus_tag="PCH_Pc16g00200"
FT                   /number=2
FT   intron          47144..47201
FT                   /gene="Pc16g00200"
FT                   /locus_tag="PCH_Pc16g00200"
FT                   /number=2
FT   exon            47202..47391
FT                   /gene="Pc16g00200"
FT                   /locus_tag="PCH_Pc16g00200"
FT                   /number=3
FT   intron          47392..47443
FT                   /gene="Pc16g00200"
FT                   /locus_tag="PCH_Pc16g00200"
FT                   /number=3
FT   exon            47444..47643
FT                   /gene="Pc16g00200"
FT                   /locus_tag="PCH_Pc16g00200"
FT                   /number=4
FT   mRNA            complement(<48729..>50006)
FT                   /gene="Pc16g00210"
FT                   /locus_tag="PCH_Pc16g00210"
FT   CDS_pept        complement(48729..50006)
FT                   /gene="Pc16g00210"
FT                   /locus_tag="PCH_Pc16g00210"
FT                   /note="Title: strong similarity to formyl-CoA transferase
FT                   like protein An07g00760 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92691"
FT                   /db_xref="GOA:B6H6S6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S6"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /inference="protein motif:COGS:COG1804"
FT                   /protein_id="CAP92691.1"
FT                   /translation="MRLLSSLASRPHALSGAVQPARRSHLTWRLYSSTPAAKNRPLPLA
FT                   GVTVVSLEQAIAAPFCTRQLADLGARVIKVERPGVGDFARHYDTRVGGLASHFVWTNRS
FT                   KESLALDLKHEKDHAVLMKLLEKADVLVQNLAPGASARLGLSHEALKGEHPDLIVCDIS
FT                   GYGQDGPYRDKKAYDLLIQNEAGMLSVTGTGKEPVKVGISIADIAAGMYAYSNILSALL
FT                   QRGKDGQGCHIDISMLESMVEWMGFPMYYAFDNAPGPVPAGASHAAIYPYGPFEAGDGQ
FT                   SVMLGIQNEREWVSFCNGVLSQPDLATDPRFSSNSQRTQNRDELKSIIHDAFSKFTTTE
FT                   TIARLDEASIANATVNDMKDVWGHAQLQARDRWTKVQTPVGAIPALLPPGSTNSAGRDG
FT                   HGAQMGSVPRVGEHNEAIFAELGLSN"
FT   exon            complement(48729..50006)
FT                   /gene="Pc16g00210"
FT                   /locus_tag="PCH_Pc16g00210"
FT                   /number=1
FT   mat_peptide     complement(48732..49961)
FT                   /gene="Pc16g00210"
FT                   /locus_tag="PCH_Pc16g00210"
FT   sig_peptide     complement(49962..50006)
FT                   /gene="Pc16g00210"
FT                   /locus_tag="PCH_Pc16g00210"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<50594..51590,51683..51871,52038..52558,
FT                   52620..52700,52751..53250,53280..>53403))
FT                   /gene="Pc16g00220"
FT                   /locus_tag="PCH_Pc16g00220"
FT   CDS_pept        complement(join(50594..51590,51683..51871,52038..52558,
FT                   52620..52700,52751..53250,53280..53403))
FT                   /gene="Pc16g00220"
FT                   /locus_tag="PCH_Pc16g00220"
FT                   /note="Title: similarity to cutinase transcription factor
FT                   alpha CTF1a - Fusarium solani"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92692"
FT                   /db_xref="GOA:B6H6S8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S8"
FT                   /inference="similar to AA sequence:SWISSPROT:CT1A_FUSSO"
FT                   /protein_id="CAP92692.1"
FT                   /translation="MLRRTTRASTACSWCHHRKVRCDASILGSPCTRCRQDGRSELRLQ
FT                   KGLLSRTHLMTSIRTSSSANPLPTHQSSGSDVTTGRKSNDQHQSPNHPALTSQLRAHGL
FT                   SLDDRSTSSPQSPNVPYTEYAFVDSQQLLSLPSEDVAFLASKGCLSLPASDAIDEFARQ
FT                   YFKRIHPLVPVLDEAKFWRIYRNNQPTGAKMSLLVLQSLIFTSCPFMSLETLRQCGFND
FT                   RRDARKQLYHRAKLLFELRTEKLPHANAQGAVLLTHYISAEDPQAGSLWVTRAIEHAIL
FT                   IDAQPSLLVEDVAISLKKRLWWSILLRDRSLCIGLRRRPQVTSSFYRWSDWLSIEDFGE
FT                   ELYQSRVYDYNTKRRLFGALQGQCELAVLLTDLVSLVFTHRKIPRRLLSMIEFQGLLSR
FT                   IKTIKKSLDDAARVDLAQYAAFVVEENLFYAEDMYNNLVREISNDLRDGVDGLSLVMEY
FT                   FSVNGYANSLPLSVLGYVGMPLVLAAIDLKLSPSRQEIEVRQRRLNSLSQIIRHSETLY
FT                   DVTDFVAVGTNHILQLAYMTTQNLFLGEKTAPLLSLDGVARQDSLVRTQRQERASDESM
FT                   SPKPNRSTSWQDAFIRCPRAYLLISACVDYSLEIGRLPSASGLPEIVRDLPIARLPWTS
FT                   DIPSSDSTTSLLSQMNQVQRESYPTSVRASVEERDVLETTTIESQPEKSFTPKTAQINH
FT                   YSSPDAFPYSTTPSLVTDEQLQYINGVAGQTTCESTAPNLDFMDFGDCERVSDNTTGAC
FT                   AVSIPLELIGHMQAECRFEQAAFDYGTTLPLPVEAIDSTLFDSFFYEAFE"
FT   exon            complement(50594..51590)
FT                   /gene="Pc16g00220"
FT                   /locus_tag="PCH_Pc16g00220"
FT                   /number=1
FT   intron          complement(51591..51682)
FT                   /gene="Pc16g00220"
FT                   /locus_tag="PCH_Pc16g00220"
FT                   /number=1
FT   exon            complement(51683..51871)
FT                   /gene="Pc16g00220"
FT                   /locus_tag="PCH_Pc16g00220"
FT                   /number=2
FT   intron          complement(51872..52037)
FT                   /gene="Pc16g00220"
FT                   /locus_tag="PCH_Pc16g00220"
FT                   /number=2
FT   exon            complement(52038..52558)
FT                   /gene="Pc16g00220"
FT                   /locus_tag="PCH_Pc16g00220"
FT                   /number=3
FT   intron          complement(52559..52619)
FT                   /gene="Pc16g00220"
FT                   /locus_tag="PCH_Pc16g00220"
FT                   /number=3
FT   exon            complement(52620..52700)
FT                   /gene="Pc16g00220"
FT                   /locus_tag="PCH_Pc16g00220"
FT                   /number=4
FT   intron          complement(52701..52750)
FT                   /gene="Pc16g00220"
FT                   /locus_tag="PCH_Pc16g00220"
FT                   /number=4
FT   exon            complement(52751..53250)
FT                   /gene="Pc16g00220"
FT                   /locus_tag="PCH_Pc16g00220"
FT                   /number=5
FT   intron          complement(53251..53279)
FT                   /gene="Pc16g00220"
FT                   /locus_tag="PCH_Pc16g00220"
FT                   /number=5
FT   exon            complement(53280..53403)
FT                   /gene="Pc16g00220"
FT                   /locus_tag="PCH_Pc16g00220"
FT                   /number=6
FT   mRNA            join(<54928..55051,55111..>56228)
FT                   /gene="Pc16g00230"
FT                   /locus_tag="PCH_Pc16g00230"
FT   CDS_pept        join(54928..55051,55111..56228)
FT                   /gene="Pc16g00230"
FT                   /locus_tag="PCH_Pc16g00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92693"
FT                   /db_xref="InterPro:IPR022190"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T1"
FT                   /protein_id="CAP92693.1"
FT                   /translation="MQDPVPAAPSLRAPSAVPEDPSADIECIDLSGEDATNQDPGTSTG
FT                   LRFVDAKGNDVTNSMPAGVTQTGQLILDGVERTGQAAEMAEAIKANGGFLDWSTTADGA
FT                   FILRSVVSEKKQLAALGQTLGHNIPGVVCDGCADGSAFLTCRVAAFRDRQGVGHIVLKG
FT                   SCMNCQFKKQAPVCSIRTSQPPSALDLFRSYEPNFQWGPTSAGSAALSTSPAPPTSPTS
FT                   PTSPTSPAPSAPLGPSVRFTRQQPGRHGSQSSMSVAKRPRLPSPSLSGSGTPTLRQKSN
FT                   TGSTVHVTPRSPLAGGGPQPSTPAPIVKSNQTQREEACPQIHEILSQASPDGPHRYNSV
FT                   LSRELYEASLEARVTAECRLRRQIAQANIDVEHMNRDLDALVKDRLRMDGYVSQGADQD
FT                   PCWLGHGSSSAPGE"
FT   exon            54928..55051
FT                   /gene="Pc16g00230"
FT                   /locus_tag="PCH_Pc16g00230"
FT                   /number=1
FT   intron          55052..55110
FT                   /gene="Pc16g00230"
FT                   /locus_tag="PCH_Pc16g00230"
FT                   /number=1
FT   exon            55111..56228
FT                   /gene="Pc16g00230"
FT                   /locus_tag="PCH_Pc16g00230"
FT                   /number=2
FT   mRNA            <56975..>58183
FT                   /gene="Pc16g00240"
FT                   /locus_tag="PCH_Pc16g00240"
FT   CDS_pept        56975..58183
FT                   /gene="Pc16g00240"
FT                   /locus_tag="PCH_Pc16g00240"
FT                   /note="Title: weak similarity to hypothetical
FT                   cysteine-binding protein fliY - Haloferax volcanii"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92694"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T2"
FT                   /inference="similar to AA sequence:TREMBL:AF315625.1"
FT                   /protein_id="CAP92694.1"
FT                   /translation="MALVTAKEANEAQYPTTPRASMDEALMPGLVSKSLDRQCRKGFCD
FT                   FVDAVFPNIYYTYSTRVELPWFEIAQYDRGAGIAMQWAFRSLGTLQIGRVNGDQRQILA
FT                   SQEMYGRGLRYLVQAVKNPATVGTEDTLGAAILLGIYEAMNETGQNSWLLHSRGISHLL
FT                   RLRGAKSHASGYGRTLLLSFRGLLVYEAFTRGEACFLESEEWRSTLPETLEDEERRGTS
FT                   CGLGQLMDYAFNEIAQCPGFLAKTKSLVASSRTTDAEREDLISAINSSREVLSDVEIQI
FT                   MAGVKADHEGNKKESQAFFGLIPPSIKDASVKFTLEGVHSGIALLRQLSVVLMSDRNRQ
FT                   KAVTPWLKVDPCKNEWKLIKNAGEIAQAQKDNRLHPTGPQQQGSATIWHDRIALAMGMP
FT                   EMV"
FT   exon            56975..58183
FT                   /gene="Pc16g00240"
FT                   /locus_tag="PCH_Pc16g00240"
FT                   /number=1
FT   mRNA            complement(join(<58891..59073,59176..59386,59480..>59499))
FT                   /gene="Pc16g00250"
FT                   /locus_tag="PCH_Pc16g00250"
FT   CDS_pept        complement(join(58891..59073,59176..59386,59480..59499))
FT                   /gene="Pc16g00250"
FT                   /locus_tag="PCH_Pc16g00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92695"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T3"
FT                   /protein_id="CAP92695.1"
FT                   /translation="MATPVDRTPNGQPRFCWCPAECLAFVVATLTGRALQGPRKHRWLE
FT                   SWDAPGTRKDSQVPVSHCVFEQSYTWKTCVAKERPSIPPPGTIHHTLRVIRANLDFTWF
FT                   CRAVLANIPSQRMFQGPYTRYGDLHNMKGMKWR"
FT   exon            complement(58891..59073)
FT                   /gene="Pc16g00250"
FT                   /locus_tag="PCH_Pc16g00250"
FT                   /number=1
FT   mat_peptide     complement(join(58894..59073,59176..59304))
FT                   /gene="Pc16g00250"
FT                   /locus_tag="PCH_Pc16g00250"
FT   intron          complement(59074..59175)
FT                   /gene="Pc16g00250"
FT                   /locus_tag="PCH_Pc16g00250"
FT                   /number=1
FT   exon            complement(59176..59386)
FT                   /gene="Pc16g00250"
FT                   /locus_tag="PCH_Pc16g00250"
FT                   /number=2
FT   sig_peptide     complement(join(59305..59386,59480..59499))
FT                   /gene="Pc16g00250"
FT                   /locus_tag="PCH_Pc16g00250"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(59387..59479)
FT                   /gene="Pc16g00250"
FT                   /locus_tag="PCH_Pc16g00250"
FT                   /number=2
FT   exon            complement(59480..59499)
FT                   /gene="Pc16g00250"
FT                   /locus_tag="PCH_Pc16g00250"
FT                   /number=3
FT   mRNA            join(<59741..59858,59917..60000,60057..>60166)
FT                   /gene="Pc16g00260"
FT                   /locus_tag="PCH_Pc16g00260"
FT   CDS_pept        join(59741..59858,59917..60000,60057..60166)
FT                   /gene="Pc16g00260"
FT                   /locus_tag="PCH_Pc16g00260"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   YGR273c - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92696"
FT                   /db_xref="InterPro:IPR018809"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T4"
FT                   /inference="similar to AA sequence:PIR:S64606"
FT                   /protein_id="CAP92696.1"
FT                   /translation="MPSSLSSSEHSGSVESNHSPSNSLQTKADPNMALHEQEPTAVNLQ
FT                   PGSRDTFSLRSIQHRDREGKVITDPDLSNPTRSRFERPLDTIRSFDAAIDAHRKQQRM"
FT   exon            59741..59858
FT                   /gene="Pc16g00260"
FT                   /locus_tag="PCH_Pc16g00260"
FT                   /number=1
FT   intron          59859..59916
FT                   /gene="Pc16g00260"
FT                   /locus_tag="PCH_Pc16g00260"
FT                   /number=1
FT   exon            59917..60000
FT                   /gene="Pc16g00260"
FT                   /locus_tag="PCH_Pc16g00260"
FT                   /number=2
FT   intron          60001..60056
FT                   /gene="Pc16g00260"
FT                   /locus_tag="PCH_Pc16g00260"
FT                   /number=2
FT   exon            60057..60166
FT                   /gene="Pc16g00260"
FT                   /locus_tag="PCH_Pc16g00260"
FT                   /number=3
FT   mRNA            join(<61674..61748,61808..61845,61975..62711,62765..>63471)
FT                   /gene="Pc16g00270"
FT                   /locus_tag="PCH_Pc16g00270"
FT   CDS_pept        join(61674..61748,61808..61845,61975..62711,62765..63471)
FT                   /gene="Pc16g00270"
FT                   /locus_tag="PCH_Pc16g00270"
FT                   /note="Title: strong similarity to
FT                   glycosylphosphatidylinositol-anchored
FT                   beta(1-3)glucanosyltransferase gel3 - Aspergillus
FT                   fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92697"
FT                   /db_xref="GOA:B6H6T5"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T5"
FT                   /inference="similar to AA sequence:TREMBL:AF208040.1"
FT                   /inference="protein motif:PFAM:PF03198"
FT                   /protein_id="CAP92697.1"
FT                   /translation="MKFSLVALATLAGVAVADLDPIVIKGSKFFYSSNDTQFTTSSGYI
FT                   DPLADPTACARDVPMLAKLRTNVIRTYAINASADHSECMKLLADAGIYVISDLSQPKLS
FT                   IDRSDPTWETDLFARYTSVVDELAQYNNTIGFFAGNEVANSVNTSDSSAFVKAAVRDTK
FT                   KYIKDKGYRPMGVGYATADVADIRADMADYFNCGEADESIDFWGYNIYSWCGESTYAKS
FT                   GYKDRTEEFANYSVPVFFAEYGCNEVTPREFTDVKALYGEPMADVWSGGIVYMYFQEAN
FT                   NYGLVSVVDSTSVSTLADFKYYSSQIASVNPTGVKKASYTPTNTALRSCPTVGSSWSAE
FT                   PSPLPPVADIQLCDCMYDASACVVADSLSSTKYSKLFSTVCGYTDCSGLTANATTGEYG
FT                   AYSMCSTKQQLAFALNKYYVEQNRAADACSFAGSATVKSVTKATGTCATQMKEAGTAGT
FT                   GTITTENTGIAGSGSASSTGSSTTSSSGAISMHSSSSFGSFQVAAYIATALLAGVGMIA
FT                   L"
FT   sig_peptide     61674..61724
FT                   /gene="Pc16g00270"
FT                   /locus_tag="PCH_Pc16g00270"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            61674..61748
FT                   /gene="Pc16g00270"
FT                   /locus_tag="PCH_Pc16g00270"
FT                   /number=1
FT   mat_peptide     join(61725..61748,61808..61845,61975..62711,62765..63468)
FT                   /gene="Pc16g00270"
FT                   /locus_tag="PCH_Pc16g00270"
FT   intron          61749..61807
FT                   /gene="Pc16g00270"
FT                   /locus_tag="PCH_Pc16g00270"
FT                   /number=1
FT   exon            61808..61845
FT                   /gene="Pc16g00270"
FT                   /locus_tag="PCH_Pc16g00270"
FT                   /number=2
FT   intron          61846..61974
FT                   /gene="Pc16g00270"
FT                   /locus_tag="PCH_Pc16g00270"
FT                   /number=2
FT   exon            61975..62711
FT                   /gene="Pc16g00270"
FT                   /locus_tag="PCH_Pc16g00270"
FT                   /number=3
FT   intron          62712..62764
FT                   /gene="Pc16g00270"
FT                   /locus_tag="PCH_Pc16g00270"
FT                   /number=3
FT   exon            62765..63471
FT                   /gene="Pc16g00270"
FT                   /locus_tag="PCH_Pc16g00270"
FT                   /number=4
FT   mRNA            complement(<64000..>65000)
FT                   /pseudo
FT                   /gene="Pc16g00280"
FT                   /locus_tag="PCH_Pc16g00280"
FT                   /note="submitted as non-pseudo"
FT   CDS_pept        complement(64000..65000)
FT                   /pseudo
FT                   /gene="Pc16g00280"
FT                   /locus_tag="PCH_Pc16g00280"
FT                   /product="hypothetical protein"
FT                   /note="submitted as non-pseudo"
FT   exon            complement(64000..65000)
FT                   /gene="Pc16g00280"
FT                   /locus_tag="PCH_Pc16g00280"
FT                   /number=1
FT   mRNA            join(<65728..66138,66198..>66557)
FT                   /gene="Pc16g00290"
FT                   /locus_tag="PCH_Pc16g00290"
FT   CDS_pept        join(65728..66138,66198..66557)
FT                   /gene="Pc16g00290"
FT                   /locus_tag="PCH_Pc16g00290"
FT                   /note="Title: similarity to hypothetical protein BAB52928.1
FT                   - Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00290"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92699"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T6"
FT                   /inference="similar to AA sequence:TREMBL:AP003009.267"
FT                   /inference="protein motif:COGS:COG0596"
FT                   /inference="protein motif:COGS:COG2267"
FT                   /protein_id="CAP92699.1"
FT                   /translation="MSVNPVFVFVPGAWHTADSFDVVRDLMHNRGLATEAISTPSVGAF
FT                   PPDKGLHADIEHTHAVLKEMVEAGCQIVLVNHSYGGMVGAGAVKGLGYTERRKAGLPGG
FT                   VIMVVWMAAFVTPKGKTLMDMLGGKHAPWMVINSPDDGYCWSSDQETIFYNDMSPEAQQ
FT                   EAISKLKPHTYRSFNEPATHEPWREMPSMYMFFDKDGAISLAVQENFAQTLGNPVTYHV
FT                   DASHSAFLSVPEKVIEGLEIALKEGRQQSGIAVN"
FT   sig_peptide     65728..65784
FT                   /gene="Pc16g00290"
FT                   /locus_tag="PCH_Pc16g00290"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            65728..66138
FT                   /gene="Pc16g00290"
FT                   /locus_tag="PCH_Pc16g00290"
FT                   /number=1
FT   mat_peptide     join(65785..66138,66198..66554)
FT                   /gene="Pc16g00290"
FT                   /locus_tag="PCH_Pc16g00290"
FT   intron          66139..66197
FT                   /gene="Pc16g00290"
FT                   /locus_tag="PCH_Pc16g00290"
FT                   /number=1
FT   exon            66198..66557
FT                   /gene="Pc16g00290"
FT                   /locus_tag="PCH_Pc16g00290"
FT                   /number=2
FT   mRNA            complement(<67094..>68347)
FT                   /gene="Pc16g00300"
FT                   /locus_tag="PCH_Pc16g00300"
FT   CDS_pept        complement(67094..68347)
FT                   /gene="Pc16g00300"
FT                   /locus_tag="PCH_Pc16g00300"
FT                   /note="Title: strong similarity to mitochondrial RNA
FT                   splicing protein Mrs2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00300"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92700"
FT                   /db_xref="GOA:B6H6T7"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR039204"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T7"
FT                   /inference="similar to AA sequence:PIR:S62064"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="CAP92700.1"
FT                   /translation="MYPRTIKITLSLPRGRLSICTNAQHQFHRLSGTLRMTQPMQSIPS
FT                   CGRRGIVTLPNKSHHVIQEPDMKKEASFNQNVFNLSLALSKSRINDATELRCMVLGLDG
FT                   SVKESDIRGTRDGLAKEWGLDGRDLRNVDLVSEGIPHLLVRPSVIFISMFTLRLLVRAH
FT                   GVLLFLLPIEDCHVKVQDVFMTDLQRRLHPGSGSGLLAKLPFELRVVDAALASVIATLE
FT                   AEHVLIRREVQDSLQDSTREDVVYAVLRDLQDHRKRLVAIQQRASQFRSALREILENDE
FT                   DMATMFLTDRQAGRPHEVEDHLEVEYLLEAYYKNTDAIAESANALLGDLERTVETIHSV
FT                   LDVRRNQIMVFEAQLEICMLGFAVPTFVAGLFGMNVANFFEESTSAFVVLVAVCVMGTV
FT                   TIAKYGLWKLDKFRKLRF"
FT   exon            complement(67094..68347)
FT                   /gene="Pc16g00300"
FT                   /locus_tag="PCH_Pc16g00300"
FT                   /number=1
FT   mRNA            complement(join(<70393..70670,70732..71265,71318..71476,
FT                   71528..>72116))
FT                   /gene="Pc16g00310"
FT                   /locus_tag="PCH_Pc16g00310"
FT   CDS_pept        complement(join(70393..70670,70732..71265,71318..71476,
FT                   71528..72116))
FT                   /gene="Pc16g00310"
FT                   /locus_tag="PCH_Pc16g00310"
FT                   /note="Title: strong similarity to hypothetical
FT                   6-hydroxy-D-nicotine oxidase related protein 13E11.250
FT                   -Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00310"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92701"
FT                   /db_xref="GOA:B6H6T8"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T8"
FT                   /inference="similar to AA sequence:PIR:T48777"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /inference="protein motif:COGS:COG0277"
FT                   /protein_id="CAP92701.1"
FT                   /translation="MAKMTSIVGILMGVLTTATAASIPTGSSVAAAAALRSLGVSPPSG
FT                   NVLIGNAGYTCSLLNRVFSKNETFTVTSPYYNVLIDEAWSENCRLNASCIVTPESAQEV
FT                   SRLLQILSILRTKFAIRSGGHNTNPGFSSIGSDGVLIALEKLDRLSLSADRGTVTVGPG
FT                   NRWESVYKYLQPYNLTALGGREAVVGVGGYILGDSGGLSTFYNTHGLAIDSVTRFQVVL
FT                   PNGTIVDATPTEHADLYKGLKGGLNNFGIVTEYDLTTNPGVDIYYEIKTYTAANTPAVL
FT                   AAYATYLLDADINSNVEIQVNPSYTLVFYGYLGHVSAPTDFDSFSDIPVASTIYPPTNG
FT                   SLTELLLTIGSTGLTSEGVSYSGTFSFKVTGSTFLQDTYSTYLEAAASLPSGAVLSYVP
FT                   QGVIPNLVTQGKSQNGGNLLGLEATPQIWANIFAQFPATLSQSEVAGAVDSLLANLISS
FT                   AKSEDLFLPYIFVNDAGAKQKPLQSFGEKNIKYIDTVAKRYDPKRVMQKLQDQAYFVSE
FT                   EL"
FT   exon            complement(70393..70670)
FT                   /gene="Pc16g00310"
FT                   /locus_tag="PCH_Pc16g00310"
FT                   /number=1
FT   mat_peptide     complement(join(70396..70670,70732..71265,71318..71476,
FT                   71528..72056))
FT                   /gene="Pc16g00310"
FT                   /locus_tag="PCH_Pc16g00310"
FT   intron          complement(70671..70731)
FT                   /gene="Pc16g00310"
FT                   /locus_tag="PCH_Pc16g00310"
FT                   /number=1
FT   exon            complement(70732..71265)
FT                   /gene="Pc16g00310"
FT                   /locus_tag="PCH_Pc16g00310"
FT                   /number=2
FT   intron          complement(71266..71317)
FT                   /gene="Pc16g00310"
FT                   /locus_tag="PCH_Pc16g00310"
FT                   /number=2
FT   exon            complement(71318..71476)
FT                   /gene="Pc16g00310"
FT                   /locus_tag="PCH_Pc16g00310"
FT                   /number=3
FT   intron          complement(71477..71527)
FT                   /gene="Pc16g00310"
FT                   /locus_tag="PCH_Pc16g00310"
FT                   /number=3
FT   exon            complement(71528..72116)
FT                   /gene="Pc16g00310"
FT                   /locus_tag="PCH_Pc16g00310"
FT                   /number=4
FT   sig_peptide     complement(72057..72116)
FT                   /gene="Pc16g00310"
FT                   /locus_tag="PCH_Pc16g00310"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<72462..73015,73073..>73295)
FT                   /gene="Pc16g00320"
FT                   /locus_tag="PCH_Pc16g00320"
FT   CDS_pept        join(72462..73015,73073..73295)
FT                   /gene="Pc16g00320"
FT                   /locus_tag="PCH_Pc16g00320"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig50.tfa_320wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00320"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92702"
FT                   /db_xref="GOA:B6H6U3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U3"
FT                   /protein_id="CAP92702.1"
FT                   /translation="MGFFALEEWAAANRDYENTRAPYWHVKSVPDGFTAISGILWSISY
FT                   TLMAKKAFKDRSYAMPLHCLCLNITWEAVYGFVYGPGLLNQVVFAQWMIVDVVLFYAIL
FT                   RSAPYVWKQSPLVAQHLAGIIVVGCVICLWLHLAIAATFIPSIGRQVVFMTAWPMQVLI
FT                   NFSSIAQLLSRGNTLGHSWGIWWTRMLGTIAAACCFFWRIHYWPERFGYAWTPYGQFLL
FT                   LGSIGSDMVYAVVYIYVQRMEKQLDTLVSTKAQKAR"
FT   exon            72462..73015
FT                   /gene="Pc16g00320"
FT                   /locus_tag="PCH_Pc16g00320"
FT                   /number=1
FT   intron          73016..73072
FT                   /gene="Pc16g00320"
FT                   /locus_tag="PCH_Pc16g00320"
FT                   /number=1
FT   exon            73073..73295
FT                   /gene="Pc16g00320"
FT                   /locus_tag="PCH_Pc16g00320"
FT                   /number=2
FT   mRNA            complement(join(<73504..73791,73846..>74340))
FT                   /gene="Pc16g00330"
FT                   /locus_tag="PCH_Pc16g00330"
FT   CDS_pept        complement(join(73504..73791,73846..74340))
FT                   /gene="Pc16g00330"
FT                   /locus_tag="PCH_Pc16g00330"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An10g00180 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00330"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92703"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U4"
FT                   /protein_id="CAP92703.1"
FT                   /translation="MAPCKPRTFTAGQVPLTKFDGAISVRNLPRPPDRLFLFHGIMRPS
FT                   RGIYAKLIATGQKPPTHFHPSQWEFFRVLRGNLTIDFNGRAIHRTASDGELAVPPFTHH
FT                   VIYGTPGTEMNEVEFVVSASDPAAEQQGATVMDQPFFENWYGYQEDVFQRGEKLDFIQV
FT                   LSMFDAGGTYLSPPWWVPFRSWVGLFLGIVVGRWIGGLLGYAPFYPEWTTDWEAACETM
FT                   QQSWFQRRFADPQAQERARERFRGQLEQEASAKGGKSV"
FT   exon            complement(73504..73791)
FT                   /gene="Pc16g00330"
FT                   /locus_tag="PCH_Pc16g00330"
FT                   /number=1
FT   intron          complement(73792..73845)
FT                   /gene="Pc16g00330"
FT                   /locus_tag="PCH_Pc16g00330"
FT                   /number=1
FT   exon            complement(73846..74340)
FT                   /gene="Pc16g00330"
FT                   /locus_tag="PCH_Pc16g00330"
FT                   /number=2
FT   mRNA            join(<74801..75681,75748..>75859)
FT                   /gene="Pc16g00340"
FT                   /locus_tag="PCH_Pc16g00340"
FT   CDS_pept        join(74801..75681,75748..75859)
FT                   /gene="Pc16g00340"
FT                   /locus_tag="PCH_Pc16g00340"
FT                   /note="Title: similarity to alcohol dehydrogenase pan2 -Mus
FT                   musculus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92704"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U5"
FT                   /inference="similar to AA sequence:TREMBLNEW:BC020094.1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /inference="protein motif:COGS:COG1028"
FT                   /protein_id="CAP92704.1"
FT                   /translation="MVNIIQPKVDPLPTGIDLTGKTVVITGASAGMGLEATKQLLRLRA
FT                   STVILAVRNVAKGEACATSLRQDRRIQTHNPNPTIKVMALDVDDYHSVQRFTKQLREEI
FT                   PVVHILILNAGIGLLKLERSASGHDRTTQVNYYSNVLLIAELLPYLQAGAEKTGFPARI
FT                   SWVGSRAHEVTSLEKKAPIKPGEGVLAHMDKEEAFVPFQRYGDSKLLCVMFMYSLAPRL
FT                   DPKKVIINMMCPGMVNTNMSDVLPMHLRLIVNVVKSFRARPVEVGGWIILNSALVVGPE
FT                   SHGKFLNDKTISDKSAFIKSPAGQEIQKKLWEETIAEIGTLTPLPAEFK"
FT   exon            74801..75681
FT                   /gene="Pc16g00340"
FT                   /locus_tag="PCH_Pc16g00340"
FT                   /number=1
FT   intron          75682..75747
FT                   /gene="Pc16g00340"
FT                   /locus_tag="PCH_Pc16g00340"
FT                   /number=1
FT   exon            75748..75859
FT                   /gene="Pc16g00340"
FT                   /locus_tag="PCH_Pc16g00340"
FT                   /number=2
FT   mRNA            complement(<76039..>77334)
FT                   /gene="Pc16g00350"
FT                   /locus_tag="PCH_Pc16g00350"
FT   CDS_pept        complement(76039..77334)
FT                   /gene="Pc16g00350"
FT                   /locus_tag="PCH_Pc16g00350"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An10g00160 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92705"
FT                   /db_xref="GOA:B6H6U6"
FT                   /db_xref="InterPro:IPR032805"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U6"
FT                   /inference="similar to AA sequence:TREMBL:AF359360.8"
FT                   /protein_id="CAP92705.1"
FT                   /translation="MAETDASSWKPTTLESKPFSLDSGHYTALAFVLAVCVPQAPHGTL
FT                   LRYGLLLLQITCAVQAFLVQPPPVSDRAVLYTSGVLMGNLLARYFDRLYTTVPERTFHR
FT                   IIDSQSPEDTVRLSAPKRLFWALELFSVTRGIGWNWRVAGIPKSPVSTTRFQFAAAQLL
FT                   RWTAMYAGLHLVNVTCQVVSSNPNASPSLPGNLHIYALIVCGFAITIYSHFAILMLPLS
FT                   ALCVGLQVGPRSWQDIASWPPNFGSVREAYSIRRFWGYTWHQQLRRQAGAPGAYLISLL
FT                   PDSVTTSKQTSVRLARRYSLLMMSFVISGLIHACGTYQVTRALGLPLSDGGEMKYFTLQ
FT                   GMAIIAEDFGCWVLGIDDRGTQPGVMRRWMGYAITLSWYVWSRVQLKGVPVALAMGIED
FT                   ERGDLFAALELVRLSAAAVPGNFVATAWELIW"
FT   exon            complement(76039..77334)
FT                   /gene="Pc16g00350"
FT                   /locus_tag="PCH_Pc16g00350"
FT                   /number=1
FT   mRNA            join(<77542..77690,77743..78155,78223..78431,78491..78811,
FT                   78894..79174,79226..>79385)
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT   CDS_pept        join(77542..77690,77743..78155,78223..78431,78491..78811,
FT                   78894..79174,79226..79385)
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT                   /note="unknown EC_number=1.14.-.-"
FT                   /note="Title: strong similarity to cytochrome P450
FT                   trichodiene oxygenase TRI4 - Fusarium sporotrichioides"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00360"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92706"
FT                   /db_xref="GOA:B6H6T9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T9"
FT                   /inference="similar to AA sequence:PIR:S57337"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /inference="protein motif:COGS:COG2124"
FT                   /protein_id="CAP92706.1"
FT                   /translation="MTLLSVLPVSLWLIAAGTFAVYHAIRAVYLIFFSPLAVFPGSPWA
FT                   ALGEYWEAYWNIGLKHGRKGQTLFKLEEMHKRLGPALRMGPNEVHIYDPAFYHELYRPG
FT                   SRYYKDPSMHKVLGAPSSTLAESDPVRHKQRKAPLEPLFSKKNILSLEPMLMEHVDHCS
FT                   QRFDELFAQAKPVSMEWALKSLAMDMVSQFAFGQSLNALADPEFKSLPVRVFQQYLPSL
FT                   HVIKAFPFVRLLNSLPLWIAKRISHSVEMGHELEQFATRRIDEYMAEAAAGKTPTFPTL
FT                   MERLLIPIPEKGYAVPDKQGLRDELLTVISAGDDTTGIANTVTLFNIFNNREIHDRLLA
FT                   ELKTVMPTPDSHVSYPRLEALPYLTAVIKEGLRYSSPAASRTPRLVPPGGVRLPDGRFI
FT                   PAGTRVGMAIYHIHYNETLFENPRVFDPERWLQGPEVTAERAKFLVPFSRGSRSCLGIN
FT                   LAYMEMYMAIAYIVRRFDLDLVGTTEEDMKWDDMVVPQFHGEFMALTKRRED"
FT   sig_peptide     77542..77601
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            77542..77690
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT                   /number=1
FT   mat_peptide     join(77602..77690,77743..78155,78223..78431,78491..78811,
FT                   78894..79174,79226..79382)
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT   intron          77691..77742
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT                   /number=1
FT   exon            77743..78155
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT                   /number=2
FT   intron          78156..78222
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT                   /number=2
FT   exon            78223..78431
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT                   /number=3
FT   intron          78432..78490
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT                   /number=3
FT   exon            78491..78811
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT                   /number=4
FT   intron          78812..78893
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT                   /number=4
FT   exon            78894..79174
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT                   /number=5
FT   intron          79175..79225
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT                   /number=5
FT   exon            79226..79385
FT                   /gene="Pc16g00360"
FT                   /locus_tag="PCH_Pc16g00360"
FT                   /number=6
FT   mRNA            complement(<79583..>84934)
FT                   /gene="Pc16g00370"
FT                   /locus_tag="PCH_Pc16g00370"
FT   CDS_pept        complement(79583..84934)
FT                   /gene="Pc16g00370"
FT                   /locus_tag="PCH_Pc16g00370"
FT                   /note="Title: strong similarity to 6-methylsalicylic acid
FT                   synthase like protein An10g00140 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92707"
FT                   /db_xref="GOA:B6H6U0"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U0"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /inference="protein motif:PFAM:PF00698"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /inference="protein motif:COGS:COG3321"
FT                   /protein_id="CAP92707.1"
FT                   /translation="MITSTSSTEVLTPANGSNDSKGTTTPATSSGDPEMHEDLLRNDTH
FT                   DDVAIIGMACRVPGDVNSPSALWQFLLEKGDASGDMPSWRWDPYRQRHPRNAAVLAETT
FT                   AKGYFLNEIDQFDAAFFAVSPREAEQMDPQQRIALEVAWEALEDAGISPSRLAGSNTSV
FT                   YMGVNSDDYAKLVLEDLPNVGAHMGVGTAYCGIPSRISYLLDLMGPSVALDAACASSLV
FT                   AVHHARQAIRAGETDLAIAGGVNALLGPGLTRVLDEAGAISADGKCRSFDDSANGYGRG
FT                   EGAGVVILKRLDKAFADGDQVLAVLKGSAVASDGKTLGIMAPNAQAQLLVAQKALKEAK
FT                   VTSDSISYIEAHATSTSLGDPTETNALAEVYGVGSGRHPSDPCYIGSIKPNIGHLEAGA
FT                   GVMGLIKAVLVLRHGEVPPQANLQTLNSKIAWKENLLRPAHELVTLPRGTISRPLRAAI
FT                   ASYGYSGTVSHAIVEAFAGQSLFAERLAQIPDKGAVPVLLLLSVPQANRISATAAGLNQ
FT                   WLRDVDGAVSLATVASTLSQRRMHHRFRHAIVADSVANAIATLDDLAKDVPSRWAISDR
FT                   IGSEAGKGAVWVFSGHGAQWPDMGRELFHSSPAFGEVVRNLEPIIQAELGFSAIETLHA
FT                   GCPDRTDVIQAMTYLMHLGIAAVLEAESGPPTAVVGHSLGEAAAAVVSGALTWHEAALV
FT                   VCRRARLYREFMGEGAMALVRLSASEARASIATHPGASVAIEASPTACVVSGTVDAVQR
FT                   LTEQWREEGVDVRAVATDVPFHTPLLEKLAGPLRGALKNELHPQVPHRALYSTSLSDPR
FT                   SEVLRDAEYWVMNMVQPVLLQSTMAALVDDGFRAFVEVASHPIITHSIAETISEQTKDR
FT                   FIATPTMVRKQPALKSILAAVGRLHCFGCAVKSTDLDPTAPWSSSVPGTIWNHQSFYRA
FT                   VSGMTAAQLASTHKPPANDLLGTRTALWGTDEVLYQTRLEEDNRPFPGRHPLHGSEIVP
FT                   AAVLLRTFLRALSPRSVEEVSLQVPVVVSPAREIQVRHNTRNITITSRLEESTSNEDNS
FT                   WLVNTTATVGADATPSISHIDIAEIRKRLPQKQSDSFSVDYLASVGVSAMGFPWRVAHH
FT                   VASENEMLARVDANPDSLPGMDDLLTSVMDAATSIASTLWHSEPRLRMPTAVRRVVAVD
FT                   VATPKVVYIHCTKAQSSVDVADVIISSEEGTVLMEIQGMAFAGVEGESLSRKTTSGLVH
FT                   QISWPPAALAEEPLEFAHIAFLTADATKTHLETYQRLLKGRGISTSIHERASDLPLTTH
FT                   LSMAVVYLPQVTDQIFDTATRSCNDLVTAAQVILSFSDKPTMRLFVLTSECNLGHSALT
FT                   GLGRILHTEHPDIWGSLIDLEDPSVFPLMAMRYVRNADVIKIEDGVPRTARLRPLRSAP
FT                   PHSTIGPPTLTFSPASTYLITGGLGSLGLSVAQWMVTQGARRILLLSRRSLPPRSTWTA
FT                   SHEPGTRSIIDNILSLERLGATIHPVAIDISHPSAVTNLRSALTTLSLPPVAGVVHAAG
FT                   ILRDQLIEQITPDSFEAVLAPKIAGALALHTVFPPSSPDLDFFVLFSSCGQLLGFPGQA
FT                   SYASGNSFLDALARSRRKEGDNAISLLWTSWRGMGMGASSNGALEAELYARGITDVTPD
FT                   EAFLAWSSISGTEGADHGVVLRARPLESGEPLPHAILMDIAPRKERAVDEGNGENGEQR
FT                   KKLSGKELAEYLRIVVKKCVSTTLSIPEDEVDETVALPEMGMDSVMTVNFRMSLQQTLT
FT                   VSVGPTLVWKYPTVHHLVEHFCQVLDK"
FT   exon            complement(79583..84934)
FT                   /gene="Pc16g00370"
FT                   /locus_tag="PCH_Pc16g00370"
FT                   /number=1
FT   mRNA            join(<85399..85516,85672..>86411)
FT                   /gene="Pc16g00380"
FT                   /locus_tag="PCH_Pc16g00380"
FT   CDS_pept        join(85399..85516,85672..86411)
FT                   /gene="Pc16g00380"
FT                   /locus_tag="PCH_Pc16g00380"
FT                   /note="unknown EC_number=2.5.1.39"
FT                   /note="Title: similarity to
FT                   para-hydroxybenzoate--polyprenyltransferase ppt1p
FT                   -Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92708"
FT                   /db_xref="GOA:B6H6U1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U1"
FT                   /inference="similar to AA sequence:PIR:T38914"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /inference="protein motif:COGS:COG0109"
FT                   /inference="protein motif:COGS:COG0382"
FT                   /protein_id="CAP92708.1"
FT                   /translation="MTVSITPKPQRNVARGVWELARLHTREAWLCWYPAIWGALCISDI
FT                   CDQKLDKHVERCKVRPLPSGMISTSEAVVAFICWLPVTLAITWGTLGPAVTAGFIPVWV
FT                   LSTIYPFMKRIMPFPQVVLGAIIGGAVFPGWVGITGDLKDLDQALPLFFATASWVVYFD
FT                   VFYATQDRPDDEKIGVKSLAVLLGKNVQILLAVLGALQVLLFAVTALRADMSLIFWVLG
FT                   LGVWMVNVPWHILSLDLKDRHSGGRIFKSNIKLGLYLTGVSLLELFVVRVYDISLANMK
FT                   MELH"
FT   exon            85399..85516
FT                   /gene="Pc16g00380"
FT                   /locus_tag="PCH_Pc16g00380"
FT                   /number=1
FT   intron          85517..85671
FT                   /gene="Pc16g00380"
FT                   /locus_tag="PCH_Pc16g00380"
FT                   /number=1
FT   exon            85672..86411
FT                   /gene="Pc16g00380"
FT                   /locus_tag="PCH_Pc16g00380"
FT                   /number=2
FT   mRNA            join(<86693..86744,86795..>87762)
FT                   /gene="Pc16g00390"
FT                   /locus_tag="PCH_Pc16g00390"
FT   CDS_pept        join(86693..86744,86795..87762)
FT                   /gene="Pc16g00390"
FT                   /locus_tag="PCH_Pc16g00390"
FT                   /note="Title: similarity to hypothetical meta-cleavage
FT                   compound hydrolase gene ren71 - Streptomyces aureofaciens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00390"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92709"
FT                   /db_xref="GOA:B6H6U2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U2"
FT                   /inference="similar to AA sequence:TREMBL:AF306830.2"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /inference="protein motif:COGS:COG2159"
FT                   /inference="protein motif:COGS:COG3618"
FT                   /protein_id="CAP92709.1"
FT                   /translation="MNRIDVHHHFIPPAYVKAFNSTPGDPSGWHLPKWTPESTLSLMAS
FT                   HSTRTAILSLTAPGTSILCNFPVESANLARQINLYGSQLHQESPTRFGFFASLPHLTPE
FT                   TIPSAIEELAYALDTLQADGITLYTRYSGTGYLGHAAFAPLWEELNRRKAVVFIHPTNT
FT                   AADAQNKPEMVNPKLPQPIIDYPHETCRTAVDLITSGTISKNPDVKIILSHGGGTLPIL
FT                   ATRAANLLYDAGLTDITPEVFLEQARSFYLDLALSGNRGNLELLVGNNGFAKPGHVLYG
FT                   SDFPYAPVETINKYVGMMEEFFAQGGNKEEEVARAAAVELFPRFRIEDNKEMIPQNGL"
FT   exon            86693..86744
FT                   /gene="Pc16g00390"
FT                   /locus_tag="PCH_Pc16g00390"
FT                   /number=1
FT   intron          86745..86794
FT                   /gene="Pc16g00390"
FT                   /locus_tag="PCH_Pc16g00390"
FT                   /number=1
FT   exon            86795..87762
FT                   /gene="Pc16g00390"
FT                   /locus_tag="PCH_Pc16g00390"
FT                   /number=2
FT   mRNA            join(<88167..88269,88331..88394,88448..>89894)
FT                   /gene="Pc16g00400"
FT                   /locus_tag="PCH_Pc16g00400"
FT   CDS_pept        join(88167..88269,88331..88394,88448..89894)
FT                   /gene="Pc16g00400"
FT                   /locus_tag="PCH_Pc16g00400"
FT                   /note="unknown EC_number=1.14.-.-"
FT                   /note="Title: strong similarity to cytochrome P450 eln2
FT                   -Coprinus cinereus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92710"
FT                   /db_xref="GOA:B6H6V2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V2"
FT                   /inference="similar to AA sequence:TREMBL:AB013443.1"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /inference="protein motif:COGS:COG2124"
FT                   /protein_id="CAP92710.1"
FT                   /translation="MALLYISTVAALALVLLFLRAVLNSWRIQRKLPPGPPGLPLIGNI
FT                   HQIPAVRAHQKFTEWAKVYGGLYSFRIGPATAAVITDRGLVKELLDKRSALYSSRPVSY
FT                   VGQNLITGGDHLLVMDNNEMWRLFRKTVHQHFKASMCEKEHVKLLEAEHTQMMRDFLLY
FT                   PEKHMLHTKRTTNSIIMSLLYGIRTPSWDTPHMQELYEIMEQWSKVMETGATPPVDIFP
FT                   WLKWIPQRWLGNWVDRSVEVGSGMKALYGSFRRRAIEARRQAEQSSQSRARTFIDHVLD
FT                   LQEKASLTDNQVDFLGGVMMEGGSDTGSTMLLVMIQALVQHPEVQERARAELDAVCGED
FT                   RSPTWADFSRLPYINMVVKETMRWRPVTPLSFPHALNQDDWVNGYLLPKGTTVFLNVWG
FT                   LHHDESVFPNPERFDPSHYEGRHNLASDYAASPDYMQRDHFIYGAGRRLCPGIHLSERS
FT                   MFIGAAKLLWGFQFESEMDESGRPVAIDTDPITGYTEGFLVCPRAYKCKVSPRSAARAE
FT                   TIMREFAQAEFEVLCQYATP"
FT   sig_peptide     88167..88238
FT                   /gene="Pc16g00400"
FT                   /locus_tag="PCH_Pc16g00400"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            88167..88269
FT                   /gene="Pc16g00400"
FT                   /locus_tag="PCH_Pc16g00400"
FT                   /number=1
FT   mat_peptide     join(88239..88269,88331..88394,88448..89891)
FT                   /gene="Pc16g00400"
FT                   /locus_tag="PCH_Pc16g00400"
FT   intron          88270..88330
FT                   /gene="Pc16g00400"
FT                   /locus_tag="PCH_Pc16g00400"
FT                   /number=1
FT   exon            88331..88394
FT                   /gene="Pc16g00400"
FT                   /locus_tag="PCH_Pc16g00400"
FT                   /number=2
FT   intron          88395..88447
FT                   /gene="Pc16g00400"
FT                   /locus_tag="PCH_Pc16g00400"
FT                   /number=2
FT   exon            88448..89894
FT                   /gene="Pc16g00400"
FT                   /locus_tag="PCH_Pc16g00400"
FT                   /number=3
FT   mRNA            complement(join(<90386..90942,91058..91126,91329..92518,
FT                   92618..>93205))
FT                   /pseudo
FT                   /gene="Pc16g00410"
FT                   /locus_tag="PCH_Pc16g00410"
FT                   /note="submitted as non-pseudo"
FT   CDS_pept        complement(join(90386..90942,91058..91126,91329..92518,
FT                   92618..93205))
FT                   /pseudo
FT                   /gene="Pc16g00410"
FT                   /locus_tag="PCH_Pc16g00410"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: similarity to hypothetical transcription
FT                   activator SPAC139.03 - Schizosaccharomyces pombe"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:PFAM:PF04082"
FT   exon            complement(90386..90942)
FT                   /gene="Pc16g00410"
FT                   /locus_tag="PCH_Pc16g00410"
FT                   /number=1
FT   intron          complement(90943..91057)
FT                   /gene="Pc16g00410"
FT                   /locus_tag="PCH_Pc16g00410"
FT                   /number=1
FT   exon            complement(91058..91126)
FT                   /gene="Pc16g00410"
FT                   /locus_tag="PCH_Pc16g00410"
FT                   /number=2
FT   intron          complement(91127..91328)
FT                   /gene="Pc16g00410"
FT                   /locus_tag="PCH_Pc16g00410"
FT                   /number=2
FT   exon            complement(91329..92518)
FT                   /gene="Pc16g00410"
FT                   /locus_tag="PCH_Pc16g00410"
FT                   /number=3
FT   intron          complement(92519..92617)
FT                   /gene="Pc16g00410"
FT                   /locus_tag="PCH_Pc16g00410"
FT                   /number=3
FT   exon            complement(92618..93205)
FT                   /gene="Pc16g00410"
FT                   /locus_tag="PCH_Pc16g00410"
FT                   /number=4
FT   mRNA            join(<93753..93767,94044..94208,94371..>94586)
FT                   /gene="Pc16g00420"
FT                   /locus_tag="PCH_Pc16g00420"
FT   CDS_pept        join(93753..93767,94044..94208,94371..94586)
FT                   /gene="Pc16g00420"
FT                   /locus_tag="PCH_Pc16g00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92712"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V3"
FT                   /protein_id="CAP92712.1"
FT                   /translation="MASGQDKMQNHDYRTPTSRRLGVRYKISIAMRTLEELNVGAGYNS
FT                   FQKRIPKKASCKMAELRLGDTRFTYLFPSTSGGSVKVPPPEEAWPLIVRLVNVGFLDTG
FT                   RWPIGPFPPLKTYWHIPSSLTFLVYFS"
FT   exon            93753..93767
FT                   /gene="Pc16g00420"
FT                   /locus_tag="PCH_Pc16g00420"
FT                   /number=1
FT   intron          93768..94043
FT                   /gene="Pc16g00420"
FT                   /locus_tag="PCH_Pc16g00420"
FT                   /number=1
FT   exon            94044..94208
FT                   /gene="Pc16g00420"
FT                   /locus_tag="PCH_Pc16g00420"
FT                   /number=2
FT   intron          94209..94370
FT                   /gene="Pc16g00420"
FT                   /locus_tag="PCH_Pc16g00420"
FT                   /number=2
FT   exon            94371..94586
FT                   /gene="Pc16g00420"
FT                   /locus_tag="PCH_Pc16g00420"
FT                   /number=3
FT   mRNA            join(<95191..95608,95822..>96138)
FT                   /gene="Pc16g00430"
FT                   /locus_tag="PCH_Pc16g00430"
FT   CDS_pept        join(95191..95608,95822..96138)
FT                   /gene="Pc16g00430"
FT                   /locus_tag="PCH_Pc16g00430"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1490_3.tfa_790cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92713"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V4"
FT                   /inference="protein motif:COGS:COG0646"
FT                   /inference="protein motif:COGS:COG2040"
FT                   /protein_id="CAP92713.1"
FT                   /translation="MASQSKLPQLTSSNLFVTEGGIETTLIYRNNLDLPSFSTLPLLNT
FT                   EDGRQTISSIYQEYVNIALAHSTGVVLETRTWRGSPLWSPEIGLSIPQILDLNRTAVKI
FT                   LHDIRNKTPSTSVVISGALGPLQDAYQDSTGTVSFVDRLTENYTTYFGVNCAHPRYIIK
FT                   AVRGMHTDVRSRIGSIRGNSSLKSHDELDNSLVLDRGDISVWVREFNELLNMLPGLKVV
FT                   GGCCGTDEEHIDAIASRINSVG"
FT   exon            95191..95608
FT                   /gene="Pc16g00430"
FT                   /locus_tag="PCH_Pc16g00430"
FT                   /number=1
FT   intron          95609..95821
FT                   /gene="Pc16g00430"
FT                   /locus_tag="PCH_Pc16g00430"
FT                   /number=1
FT   exon            95822..96138
FT                   /gene="Pc16g00430"
FT                   /locus_tag="PCH_Pc16g00430"
FT                   /number=2
FT   mRNA            complement(<97348..>98151)
FT                   /gene="Pc16g00440"
FT                   /locus_tag="PCH_Pc16g00440"
FT   CDS_pept        complement(97348..98151)
FT                   /gene="Pc16g00440"
FT                   /locus_tag="PCH_Pc16g00440"
FT                   /note="Title: weak similarity to DLK-1 protein
FT                   -Caenorhabditis elegans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92714"
FT                   /db_xref="GOA:B6H6V5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V5"
FT                   /inference="similar to AA sequence:TREMBLNEW:CEF33E2.1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP92714.1"
FT                   /translation="MGAEYCPVDDDGNYIQVDTIVASGDAALVVHREDMAIKMAIVYRH
FT                   YTLEQAEENRGIIRREQEVWRRIQPDFNTPVQGIIQCLGLRGDTIEMRYMPGGTLLKWL
FT                   QHRARPSIQLQKRWFRQLAIGLHNLHQHRVIHGDILSRNILMDGSLNVAICDLGASSLM
FT                   PMDTVMADAVDAYNCSIWTDLCQLGLVFYDIATGRTTGISLYDNGGSDNSVASFPSRDM
FT                   LPALSKRLWARDIIETCWREGGYGAAGAAGILAKLDKVKAPRRRR"
FT   exon            complement(97348..98151)
FT                   /gene="Pc16g00440"
FT                   /locus_tag="PCH_Pc16g00440"
FT                   /number=1
FT   mRNA            complement(join(<99550..100455,100521..>100697))
FT                   /gene="Pc16g00450"
FT                   /locus_tag="PCH_Pc16g00450"
FT   CDS_pept        complement(join(99550..100455,100521..100697))
FT                   /gene="Pc16g00450"
FT                   /locus_tag="PCH_Pc16g00450"
FT                   /note="unknown EC_number=1.1.1.2"
FT                   /note="Title: strong similarity to alcohol dehydrogenase C
FT                   ADHC - Mycobacterium smegmatis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92715"
FT                   /db_xref="GOA:B6H6V6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V6"
FT                   /inference="similar to AA sequence:TREMBL:MSM291708.1"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /inference="protein motif:COGS:COG1064"
FT                   /inference="protein motif:COGS:COG0604"
FT                   /inference="protein motif:COGS:COG1063"
FT                   /protein_id="CAP92715.1"
FT                   /translation="MSSTDYKFEGWVGLGPEAAQGKMVWQEFEPKPWEETDVDIKVTHC
FT                   GICGSDLHTLRSGWGPTNYPCCVGHEVVGIAVRVGTQVKGDIKVGDRVGVGAQSGSCEN
FT                   KDGDCESCASGLEQHCSKMVGTYNGTYANGGKSYGGYSTYNRSPSHFVIKIPDAISSAD
FT                   AAPMLCGGITTYSPLKRNGCGPGKTVGIVGVGGLGHFAILFAKALGADRVVAISRKSDK
FT                   KEDALKLGADDFIATGEDEDWATRHASSLDLIISTASSSKMPIVQYCGLLRVHGTFIQL
FT                   GAPEDGALEIPAFVLIIKGLKLGGSLIGSPDEIREMLELAAAKGVKPWIQERPMKDANQ
FT                   AIVDMDKGDARYRYVLTNEQ"
FT   exon            complement(99550..100455)
FT                   /gene="Pc16g00450"
FT                   /locus_tag="PCH_Pc16g00450"
FT                   /number=1
FT   intron          complement(100456..100520)
FT                   /gene="Pc16g00450"
FT                   /locus_tag="PCH_Pc16g00450"
FT                   /number=1
FT   exon            complement(100521..100697)
FT                   /gene="Pc16g00450"
FT                   /locus_tag="PCH_Pc16g00450"
FT                   /number=2
FT   mRNA            join(<101051..101171,101481..101532,101633..101659,
FT                   101996..102197,102685..>102882)
FT                   /gene="Pc16g00460"
FT                   /locus_tag="PCH_Pc16g00460"
FT   CDS_pept        join(101051..101171,101481..101532,101633..101659,
FT                   101996..102197,102685..102882)
FT                   /gene="Pc16g00460"
FT                   /locus_tag="PCH_Pc16g00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92716"
FT                   /db_xref="GOA:B6H6V7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V7"
FT                   /protein_id="CAP92716.1"
FT                   /translation="MTWISTYPGDLRWLVLTCCIGVKGMPSPWFMPAYARQGKGVGILM
FT                   GFGFLKEENSRTGRKKLAQLVRLSVGRLALVPGGSAEWLPLSLSTCTACILNGVITPTR
FT                   SLFDFENIEHGQQSRQVFSARIITLSAAYGAWLDFALAFVFVICPGLAVPPTVPPYSLA
FT                   FALAHDQNPAPLLQLKVRELNKVLRHAKLGHLYPLA"
FT   sig_peptide     101051..101122
FT                   /gene="Pc16g00460"
FT                   /locus_tag="PCH_Pc16g00460"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            101051..101171
FT                   /gene="Pc16g00460"
FT                   /locus_tag="PCH_Pc16g00460"
FT                   /number=1
FT   mat_peptide     join(101123..101171,101481..101532,101633..101659,
FT                   101996..102197,102685..102879)
FT                   /gene="Pc16g00460"
FT                   /locus_tag="PCH_Pc16g00460"
FT   intron          101172..101480
FT                   /gene="Pc16g00460"
FT                   /locus_tag="PCH_Pc16g00460"
FT                   /number=1
FT   exon            101481..101532
FT                   /gene="Pc16g00460"
FT                   /locus_tag="PCH_Pc16g00460"
FT                   /number=2
FT   intron          101533..101632
FT                   /gene="Pc16g00460"
FT                   /locus_tag="PCH_Pc16g00460"
FT                   /number=2
FT   exon            101633..101659
FT                   /gene="Pc16g00460"
FT                   /locus_tag="PCH_Pc16g00460"
FT                   /number=3
FT   intron          101660..101995
FT                   /gene="Pc16g00460"
FT                   /locus_tag="PCH_Pc16g00460"
FT                   /number=3
FT   exon            101996..102197
FT                   /gene="Pc16g00460"
FT                   /locus_tag="PCH_Pc16g00460"
FT                   /number=4
FT   intron          102198..102684
FT                   /gene="Pc16g00460"
FT                   /locus_tag="PCH_Pc16g00460"
FT                   /number=4
FT   exon            102685..102882
FT                   /gene="Pc16g00460"
FT                   /locus_tag="PCH_Pc16g00460"
FT                   /number=5
FT   mRNA            join(<103308..103392,103448..103643,103715..103779,
FT                   103830..>104356)
FT                   /gene="Pc16g00470"
FT                   /locus_tag="PCH_Pc16g00470"
FT   CDS_pept        join(103308..103392,103448..103643,103715..103779,
FT                   103830..104356)
FT                   /gene="Pc16g00470"
FT                   /locus_tag="PCH_Pc16g00470"
FT                   /note="Title: similarity to adenine-repressible gene rds1p
FT                   - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92717"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V8"
FT                   /inference="similar to AA sequence:TREMBL:SPAC343.12"
FT                   /protein_id="CAP92717.1"
FT                   /translation="MKLTNIALTSAAIGLANAGLVSKRAVSDADILNYALTLEHLEASF
FT                   YEEGLKNFTQEDFVKAGMKDPFYANLKEVASDEKEHVDFLTSALKGMSLCTYNFPSADV
FT                   NGFLALASVLEGVGVSAYLGAAASIMSENYLTAAGSILTTEARHSAYLRAAVGEVPFAQ
FT                   AFDNPLGLNEVYTVASPFIASCPSSNGALPVKAFPALTMSSMDAVMTGSEVQLVAGSGF
FT                   DTSVSGIHAAFITVTGPVWTPLKSMGGGKFTVTIPEGISGQSYVVLTQGNKQATDDNIV
FT                   AGPAIVEVN"
FT   sig_peptide     103308..103361
FT                   /gene="Pc16g00470"
FT                   /locus_tag="PCH_Pc16g00470"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            103308..103392
FT                   /gene="Pc16g00470"
FT                   /locus_tag="PCH_Pc16g00470"
FT                   /number=1
FT   mat_peptide     join(103362..103392,103448..103643,103715..103779,
FT                   103830..104353)
FT                   /gene="Pc16g00470"
FT                   /locus_tag="PCH_Pc16g00470"
FT   intron          103393..103447
FT                   /gene="Pc16g00470"
FT                   /locus_tag="PCH_Pc16g00470"
FT                   /number=1
FT   exon            103448..103643
FT                   /gene="Pc16g00470"
FT                   /locus_tag="PCH_Pc16g00470"
FT                   /number=2
FT   intron          103644..103714
FT                   /gene="Pc16g00470"
FT                   /locus_tag="PCH_Pc16g00470"
FT                   /number=2
FT   exon            103715..103779
FT                   /gene="Pc16g00470"
FT                   /locus_tag="PCH_Pc16g00470"
FT                   /number=3
FT   intron          103780..103829
FT                   /gene="Pc16g00470"
FT                   /locus_tag="PCH_Pc16g00470"
FT                   /number=3
FT   exon            103830..104356
FT                   /gene="Pc16g00470"
FT                   /locus_tag="PCH_Pc16g00470"
FT                   /number=4
FT   mRNA            complement(join(<104779..104981,105319..>105400))
FT                   /gene="Pc16g00480"
FT                   /locus_tag="PCH_Pc16g00480"
FT   CDS_pept        complement(join(104779..104981,105319..105400))
FT                   /gene="Pc16g00480"
FT                   /locus_tag="PCH_Pc16g00480"
FT                   /note="Title: similarity to hypothetical protein
FT                   1465_scaffold_9.tfa_400cg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92718"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U7"
FT                   /inference="protein motif:COGS:COG0604"
FT                   /inference="protein motif:COGS:COG1063"
FT                   /inference="protein motif:COGS:COG1064"
FT                   /inference="protein motif:COGS:COG1062"
FT                   /protein_id="CAP92718.1"
FT                   /translation="MWDLEICTLGLDKSRSTGAVTALGPWFARQTVVHRSSLVKVRSDT
FT                   DLALFPPLGYGLQTAAGAILNTLNMQAGKTVAIFGLVGMSVPYWIKPGT"
FT   exon            complement(104779..104981)
FT                   /gene="Pc16g00480"
FT                   /locus_tag="PCH_Pc16g00480"
FT                   /number=1
FT   intron          complement(104982..105318)
FT                   /gene="Pc16g00480"
FT                   /locus_tag="PCH_Pc16g00480"
FT                   /number=1
FT   exon            complement(105319..105400)
FT                   /gene="Pc16g00480"
FT                   /locus_tag="PCH_Pc16g00480"
FT                   /number=2
FT   mRNA            complement(join(<105607..106012,106085..106218,
FT                   106277..>106396))
FT                   /gene="Pc16g00490"
FT                   /locus_tag="PCH_Pc16g00490"
FT   CDS_pept        complement(join(105607..106012,106085..106218,
FT                   106277..106396))
FT                   /gene="Pc16g00490"
FT                   /locus_tag="PCH_Pc16g00490"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig1493_1.tfa_820wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92719"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U8"
FT                   /protein_id="CAP92719.1"
FT                   /translation="MRIQSFALLAGATAAIAAETVSLFLIGIDEQPLEGKVIGTTDSMT
FT                   KYLIKCAAGVDSTECGLPSNGITVAQGSSTVSMAYSTGRMSIAENCNYDSVSVTCAVSL
FT                   DEEGLTTTFASAVALTEIPGGGALMPVTITGTGTEKAAPTTGASVSASTAASTGGATLT
FT                   TSASTTGGASTIESSDSSSAAATSQTESGNAAMPMITGNARWAAGGVAAALALAAL"
FT   exon            complement(105607..106012)
FT                   /gene="Pc16g00490"
FT                   /locus_tag="PCH_Pc16g00490"
FT                   /number=1
FT   mat_peptide     complement(join(105610..106012,106085..106218,
FT                   106277..106342))
FT                   /gene="Pc16g00490"
FT                   /locus_tag="PCH_Pc16g00490"
FT   intron          complement(106013..106084)
FT                   /gene="Pc16g00490"
FT                   /locus_tag="PCH_Pc16g00490"
FT                   /number=1
FT   exon            complement(106085..106218)
FT                   /gene="Pc16g00490"
FT                   /locus_tag="PCH_Pc16g00490"
FT                   /number=2
FT   intron          complement(106219..106276)
FT                   /gene="Pc16g00490"
FT                   /locus_tag="PCH_Pc16g00490"
FT                   /number=2
FT   exon            complement(106277..106396)
FT                   /gene="Pc16g00490"
FT                   /locus_tag="PCH_Pc16g00490"
FT                   /number=3
FT   sig_peptide     complement(106343..106396)
FT                   /gene="Pc16g00490"
FT                   /locus_tag="PCH_Pc16g00490"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<107077..107347,107398..107550,
FT                   107605..108001,108073..108243,108292..108629,
FT                   108693..>108823))
FT                   /gene="Pc16g00500"
FT                   /locus_tag="PCH_Pc16g00500"
FT   CDS_pept        complement(join(107077..107347,107398..107550,
FT                   107605..108001,108073..108243,108292..108629,
FT                   108693..108823))
FT                   /gene="Pc16g00500"
FT                   /locus_tag="PCH_Pc16g00500"
FT                   /note="Title: strong similarity to hypothetical membrane
FT                   protein YIL166c - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92720"
FT                   /db_xref="GOA:B6H6U9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U9"
FT                   /inference="similar to AA sequence:PIR:S50361"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /inference="protein motif:COGS:COG2271"
FT                   /protein_id="CAP92720.1"
FT                   /translation="MADQDIFDEKHRIGEQVNDSPPSESELDHIVKDWDVEESAVRRKV
FT                   DFILIPILAVAFFALQMDRGNISAVLTSTITKDLNITTNQINIGSQLLSAGIVLSEIPS
FT                   NIIMQRIGPRVWLSGQLFAWGLVATFQAFVQSYPGYLVTRILLGFCEGGFIPGALYYLS
FT                   TWYKKDETSLRTSLFFYGQMFASATSSLISAGLLQLNGTHGMEGWRWIFLVEGLITLFI
FT                   AIVFTLLVPPSAGDGRPLIAFGRWSYFTERESHIIRNRVLLDDPLKAKGHIQISGSDIW
FT                   QTIKQPRILQHVFVTLVAMSGFSGLTQYTPSMIKSLGFGAVRANALASVPVYCSMIWLI
FT                   GLSFAADKTTHRGPFVLLAITWNVISYACLRTSNPHDSQWHRYGVIAVANISYCSMHIL
FT                   NVGWLSFYCRTPQERSVAMALVVMAANCAGIAGSQIFRTSDAPKYLHGLTAICSIAGAS
FT                   WILTFVLCVQYYFRRQKAVSSDTAEAKP"
FT   exon            complement(107077..107347)
FT                   /gene="Pc16g00500"
FT                   /locus_tag="PCH_Pc16g00500"
FT                   /number=1
FT   intron          complement(107348..107397)
FT                   /gene="Pc16g00500"
FT                   /locus_tag="PCH_Pc16g00500"
FT                   /number=1
FT   exon            complement(107398..107550)
FT                   /gene="Pc16g00500"
FT                   /locus_tag="PCH_Pc16g00500"
FT                   /number=2
FT   intron          complement(107551..107604)
FT                   /gene="Pc16g00500"
FT                   /locus_tag="PCH_Pc16g00500"
FT                   /number=2
FT   exon            complement(107605..108001)
FT                   /gene="Pc16g00500"
FT                   /locus_tag="PCH_Pc16g00500"
FT                   /number=3
FT   intron          complement(108002..108072)
FT                   /gene="Pc16g00500"
FT                   /locus_tag="PCH_Pc16g00500"
FT                   /number=3
FT   exon            complement(108073..108243)
FT                   /gene="Pc16g00500"
FT                   /locus_tag="PCH_Pc16g00500"
FT                   /number=4
FT   intron          complement(108244..108291)
FT                   /gene="Pc16g00500"
FT                   /locus_tag="PCH_Pc16g00500"
FT                   /number=4
FT   exon            complement(108292..108629)
FT                   /gene="Pc16g00500"
FT                   /locus_tag="PCH_Pc16g00500"
FT                   /number=5
FT   intron          complement(108630..108692)
FT                   /gene="Pc16g00500"
FT                   /locus_tag="PCH_Pc16g00500"
FT                   /number=5
FT   exon            complement(108693..108823)
FT                   /gene="Pc16g00500"
FT                   /locus_tag="PCH_Pc16g00500"
FT                   /number=6
FT   mRNA            complement(join(<109350..109700,109752..109873,
FT                   109952..110420,110494..>111423))
FT                   /gene="Pc16g00510"
FT                   /locus_tag="PCH_Pc16g00510"
FT   CDS_pept        complement(join(109350..109700,109752..109873,
FT                   109952..110420,110494..111423))
FT                   /gene="Pc16g00510"
FT                   /locus_tag="PCH_Pc16g00510"
FT                   /note="unknown EC_number=3.1.6.1"
FT                   /note="Title: strong similarity to arylsulfatase ars-1
FT                   -Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92721"
FT                   /db_xref="GOA:B6H6V0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012083"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V0"
FT                   /inference="similar to AA sequence:PIR:T46577"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /inference="protein motif:COGS:COG3119"
FT                   /protein_id="CAP92721.1"
FT                   /translation="MDGIIRSTFPLSTLDLYNYALGSAREYVVIDSYLHPSPLHLMKLN
FT                   TALVGLIAEGVIALNLQSMQSALQSVLKHSEAEPRKPNILFIITDDQDLQLDSISYTPL
FT                   ITKHIRDQGTFFRNHFVTTALCCPSRVSLWTGRQAHNTNVTDVHPPYGGYPKFVERGFN
FT                   DDFLPLWLQGAGYDTYYTGKMFNAHTVDNYHSPHINGFNASDFLLDPYTYSYRNSTYQR
FT                   NHEPPVSHEGEHTIDVITGKALGFLDDALAGERPFFLAVSPVAPHSNVDPGNITSENFY
FT                   MSAPIPLERHEHLFQDVRIPRTANFNSDQPSGVSWVHDLPLQNQSVVDYHDHFYRSRLR
FT                   ALQGVDELVDGLVTRLEESGQLDNTYIIYTSDNGFHIGQHRLPPGKTCGFEEDIRVPLF
FT                   IRGPGVTKGYVQDAVTTHVDLAPTLFHLAGIPARDDFDGTAIPVTPEFEGERHEHVTVE
FT                   YWGSAVVEGPGGSTMIPNNTYKSVRLLGEGYNLYYSVWCNNEHELYDLSTDPYQLNNLY
FT                   PTTSHAGINETRILGRSLNQAINRLDALLMVLKSCQGVTCIQPWDVLQPVDPVSTLQHA
FT                   LNKEYDGFYGAQPQVSFDWCDSGYIVEAEGAQVPLTSRHGVSWDVWV"
FT   exon            complement(109350..109700)
FT                   /gene="Pc16g00510"
FT                   /locus_tag="PCH_Pc16g00510"
FT                   /number=1
FT   intron          complement(109701..109751)
FT                   /gene="Pc16g00510"
FT                   /locus_tag="PCH_Pc16g00510"
FT                   /number=1
FT   exon            complement(109752..109873)
FT                   /gene="Pc16g00510"
FT                   /locus_tag="PCH_Pc16g00510"
FT                   /number=2
FT   intron          complement(109874..109951)
FT                   /gene="Pc16g00510"
FT                   /locus_tag="PCH_Pc16g00510"
FT                   /number=2
FT   exon            complement(109952..110420)
FT                   /gene="Pc16g00510"
FT                   /locus_tag="PCH_Pc16g00510"
FT                   /number=3
FT   intron          complement(110421..110493)
FT                   /gene="Pc16g00510"
FT                   /locus_tag="PCH_Pc16g00510"
FT                   /number=3
FT   exon            complement(110494..111423)
FT                   /gene="Pc16g00510"
FT                   /locus_tag="PCH_Pc16g00510"
FT                   /number=4
FT   mRNA            join(<113357..113813,113886..>114283)
FT                   /gene="Pc16g00520"
FT                   /locus_tag="PCH_Pc16g00520"
FT   CDS_pept        join(113357..113813,113886..114283)
FT                   /gene="Pc16g00520"
FT                   /locus_tag="PCH_Pc16g00520"
FT                   /note="Title: similarity to hypothetical protein An07g00900
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92722"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V1"
FT                   /protein_id="CAP92722.1"
FT                   /translation="MEDADNNNDATTGAGSTPTLGRGTAKSKDWYAYLDTVRTNGTQAD
FT                   KLPKIGSFVLYKLEPPLKNKEDFDNWYNGVYKILRGYHLYRLIDKNIERPDTDVENAED
FT                   WVTLSIQVAGWLTQCIDPDIANDLTNSGERIELADDFMYQLKLYMRGEEFIDGVKQRFK
FT                   AANDLKAKLHPYIALVIMMSELEQVTEMKNAIEIKTNEMKNIKDPATEISMTDYLKICT
FT                   EMNDKAKALGVDGGMGASATKALKASRQPAPSSDGKKDKLMNAPPPGKYAKKHVEEWKN
FT                   HKT"
FT   exon            113357..113813
FT                   /gene="Pc16g00520"
FT                   /locus_tag="PCH_Pc16g00520"
FT                   /number=1
FT   intron          113814..113885
FT                   /gene="Pc16g00520"
FT                   /locus_tag="PCH_Pc16g00520"
FT                   /number=1
FT   exon            113886..114283
FT                   /gene="Pc16g00520"
FT                   /locus_tag="PCH_Pc16g00520"
FT                   /number=2
FT   mRNA            join(<114680..115923,116071..116271,116359..>116401)
FT                   /gene="Pc16g00530"
FT                   /locus_tag="PCH_Pc16g00530"
FT   CDS_pept        join(114680..115923,116071..116271,116359..116401)
FT                   /gene="Pc16g00530"
FT                   /locus_tag="PCH_Pc16g00530"
FT                   /note="Title: strong similarity to retrotransposon like
FT                   protein An10g00740 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92723"
FT                   /db_xref="GOA:B6H6W3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W3"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="CAP92723.1"
FT                   /translation="MPSRQLRTGVDWVLDSGSSWHICSNRDLFISYKAYRSDEGLGWDS
FT                   SASQRAKAEGAGDIILPIRRPDGSRYELQVQCLYKPGNRFNLLSLLAIRQQKGIRWNPD
FT                   DMIIRDENRAEIGYTFVGMNVPFIELADEPNPVIYKNQMTNQALTHQTSVQNQQFGPQQ
FT                   QANGAISYALISAELAHRRLGHIGSYKGRINKDKLGEDVDTKECFDCEPCHKAKSKKIV
FT                   SREKQARATKVGQLVYVDLHPYKPKGLSKMGKQDREHAMIITDDASRFRTTMCIAKKGE
FT                   ASPTLILWAETFKNHTGYYLMEWRFDNGTEFLHFQKWAKEKNLTVSPSSAYAHEQNGVA
FT                   EFSGHYVMQIARTMHIDGGALRELWTEACYAATYVINRLIRHGEEAPILAWRRAMNLRG
FT                   DEATNLSFLRVWYSKADVVFWEPKAPKTYDGAADFRIGETTDVMTPKTQFKLGKALFKT
FT                   ARQAAKDLGSTDIGQHVSLGEEHRVQALRDRRETPDR"
FT   exon            114680..115923
FT                   /gene="Pc16g00530"
FT                   /locus_tag="PCH_Pc16g00530"
FT                   /number=1
FT   intron          115924..116070
FT                   /gene="Pc16g00530"
FT                   /locus_tag="PCH_Pc16g00530"
FT                   /number=1
FT   exon            116071..116271
FT                   /gene="Pc16g00530"
FT                   /locus_tag="PCH_Pc16g00530"
FT                   /number=2
FT   intron          116272..116358
FT                   /gene="Pc16g00530"
FT                   /locus_tag="PCH_Pc16g00530"
FT                   /number=2
FT   exon            116359..116401
FT                   /gene="Pc16g00530"
FT                   /locus_tag="PCH_Pc16g00530"
FT                   /number=3
FT   mRNA            <117077..>118711
FT                   /gene="Pc16g00540"
FT                   /locus_tag="PCH_Pc16g00540"
FT   CDS_pept        117077..118711
FT                   /gene="Pc16g00540"
FT                   /locus_tag="PCH_Pc16g00540"
FT                   /note="Title: strong similarity to retrotransposon Tto1
FT                   -Nicotiana tabacum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92724"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="InterPro:IPR039537"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V9"
FT                   /inference="similar to AA sequence:PIR:T02206"
FT                   /protein_id="CAP92724.1"
FT                   /translation="MKSEFKDKWHEAMKVQLGKLQDAKAYEIAPRPPSGCTVLPGKWVF
FT                   DLKINKDNEVQEFRARWVICGNRQRPGFDFQESYAPVARGETMRLFLSMVAVNKMIIEQ
FT                   VDYTAAYLNAMIDDRVIYMRQLTGFETRGLDGEKKDEICLVLQALYGLRQAGHLWYETL
FT                   ANALRDMDFQPLLDEPCIWIHREKQIWILLYVDDTLIAAFKAAEIDWFKTMIPFRYKDL
FT                   GKPARFLGSSLSRNNENGAIFLNQAAYTEEVVVKSGLQDASHVYLPMKTGYKCPDITRD
FT                   PKDKDVRGQNNKDIQREQNDDDDVASWAYDKPSVSKEEASAFMEDIGELGWLADKSRPD
FT                   IAVAVNKLQRRTSAPRQEDIDALKQLIRYLKGTKNLGILLGRNGDNNDLVGYVDASYQD
FT                   CEDGKSTEAYIFFHAGSPISWNSRKEEIVARSSTSAEYVAMDGAVREAMWLYKVMKQMG
FT                   IHQDLPITIFTDSDNAHTIMKKDNFAKATKWLDARYHFVRHAVRTGIISFTLIPSAENV
FT                   ADALTKPLGREQFERMREIMMYSEGKK"
FT   exon            117077..118711
FT                   /gene="Pc16g00540"
FT                   /locus_tag="PCH_Pc16g00540"
FT                   /number=1
FT   mRNA            join(<119655..119718,119777..120797,120856..121078,
FT                   121249..121270,121513..121791,121848..121957,
FT                   122006..>122206)
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT   CDS_pept        join(119655..119718,119777..120797,120856..121078,
FT                   121249..121270,121513..121791,121848..121957,
FT                   122006..122206)
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /note="Title: similarity to hypothetical protein mg09115.1
FT                   - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00550"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92725"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W0"
FT                   /protein_id="CAP92725.1"
FT                   /translation="MLGLFRASLIAPLLTVWICCSNAFAANCSSTWIKSVADADKLRQN
FT                   CRIVYGHVGIGPFADNGTVHINLDGVEMIAGTLGESPLMQSDDVTQPYYTLSSSSLEVV
FT                   DAVEIGYYGTKVVNLSLPSLKSARDYFEVGKRAYNLTYLDISSLNFAPSITLSPPNLTT
FT                   LHHTGLRNVTAMSIDAMKIDSLDSLTDNQLNMSQVFIQGPFPNVNEIAIGFISAKHLHI
FT                   NDNSSLTLGGSSTTAMTIKELSLHGITDLKRSAQLQTLKVDTLKLSSSISITDLEIPFD
FT                   DLRSLNIQQRWETHPMKSITLPPKAVDWTGGFDLDIVGAPDLNLTSIYGVNDKGNHVQT
FT                   WYWPKNVSRIRISDVTVGNAFFDPFVAQQKGPWDSQFPPSAVRSFGVSPSVNSSFNCTP
FT                   FVELQSMGRLPDVPFMCDDSKPPTSGVPVHLPIPLSLVILLNVVDSTYLLQQPTSLHHG
FT                   NKNLKAKRATKNDALNKHITRTCKKSVKWKGKTRMLSGSPDYGIWYGEEEDLDLNVVIM
FT                   EAKRPNSASEGVPQALAYMGCVHKQRKDLGKADTTVYGISTDAMNFTFMKLDNKSQWSF
FT                   KLVGVVANGFEQVLGLLVYLMTKAALMSPASSRHASRRAQQGSGGSELSFDHDPENYDQ
FT                   MDIA"
FT   sig_peptide     join(119655..119718,119777..119787)
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            119655..119718
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /number=1
FT   intron          119719..119776
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /number=1
FT   exon            119777..120797
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /number=2
FT   mat_peptide     join(119788..120797,120856..121078,121249..121270,
FT                   121513..121791,121848..121957,122006..122203)
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT   intron          120798..120855
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /number=2
FT   exon            120856..121078
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /number=3
FT   intron          121079..121248
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /number=3
FT   exon            121249..121270
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /number=4
FT   intron          121271..121512
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /number=4
FT   exon            121513..121791
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /number=5
FT   intron          121792..121847
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /number=5
FT   exon            121848..121957
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /number=6
FT   intron          121958..122005
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /number=6
FT   exon            122006..122206
FT                   /gene="Pc16g00550"
FT                   /locus_tag="PCH_Pc16g00550"
FT                   /number=7
FT   mRNA            complement(<123639..>125285)
FT                   /gene="Pc16g00560"
FT                   /locus_tag="PCH_Pc16g00560"
FT   CDS_pept        complement(123639..125285)
FT                   /pseudo
FT                   /gene="Pc16g00560"
FT                   /locus_tag="PCH_Pc16g00560"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to transposase Tan1
FT                   -Aspergillus niger"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT                   /inference="protein motif:PFAM:PF05225"
FT                   /inference="protein motif:PFAM:PF03184"
FT   exon            complement(123639..125285)
FT                   /gene="Pc16g00560"
FT                   /locus_tag="PCH_Pc16g00560"
FT                   /number=1
FT   mRNA            <125314..>129012
FT                   /gene="Pc16g00570"
FT                   /locus_tag="PCH_Pc16g00570"
FT   CDS_pept        125314..129012
FT                   /pseudo
FT                   /gene="Pc16g00570"
FT                   /locus_tag="PCH_Pc16g00570"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig42.tfa_140wg - Aspergillus fumigatus"
FT                   /inference="protein motif:COGS:COG2801"
FT   exon            125314..129012
FT                   /gene="Pc16g00570"
FT                   /locus_tag="PCH_Pc16g00570"
FT                   /number=1
FT   mRNA            complement(join(<129619..129810,129863..129912,
FT                   130029..130352,130406..>130685))
FT                   /gene="Pc16g00580"
FT                   /locus_tag="PCH_Pc16g00580"
FT   CDS_pept        complement(join(129619..129810,129863..129912,
FT                   130029..130352,130406..130685))
FT                   /gene="Pc16g00580"
FT                   /locus_tag="PCH_Pc16g00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00580"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92728"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W1"
FT                   /protein_id="CAP92728.1"
FT                   /translation="MPSSKKVTKRSSDSRSLLHRILVAIYDFTGRMIDQEQLESTADEI
FT                   EKALDKNYPTLAISSLFINDIEKIIKLKWTRKDTELADLRPMECPPVLVQQIDKITRAL
FT                   GRSHPSEENGRWILNSLLLEAYEIATVICPHAAQPLNIQAERGWKYGPVKWHRRKYFLT
FT                   GRPDYGVWYGEEEAVSLNVVIVEAKRELGGMEQALGYMASNGYDFVFLKIDNDSKWSDR
FT                   KITTRDGNYDEVLGVLVHMFTKAAVMSPAHSKEPPRQQQSSGESAATKLSVQEDVEMAG
FT                   "
FT   exon            complement(129619..129810)
FT                   /gene="Pc16g00580"
FT                   /locus_tag="PCH_Pc16g00580"
FT                   /number=1
FT   intron          complement(129811..129862)
FT                   /gene="Pc16g00580"
FT                   /locus_tag="PCH_Pc16g00580"
FT                   /number=1
FT   exon            complement(129863..129912)
FT                   /gene="Pc16g00580"
FT                   /locus_tag="PCH_Pc16g00580"
FT                   /number=2
FT   intron          complement(129913..130028)
FT                   /gene="Pc16g00580"
FT                   /locus_tag="PCH_Pc16g00580"
FT                   /number=2
FT   exon            complement(130029..130352)
FT                   /gene="Pc16g00580"
FT                   /locus_tag="PCH_Pc16g00580"
FT                   /number=3
FT   intron          complement(130353..130405)
FT                   /gene="Pc16g00580"
FT                   /locus_tag="PCH_Pc16g00580"
FT                   /number=3
FT   exon            complement(130406..130685)
FT                   /gene="Pc16g00580"
FT                   /locus_tag="PCH_Pc16g00580"
FT                   /number=4
FT   mRNA            join(<131067..131269,131330..131493,131588..131829,
FT                   131889..>132059)
FT                   /gene="Pc16g00590"
FT                   /locus_tag="PCH_Pc16g00590"
FT   CDS_pept        join(131067..131269,131330..131493,131588..131829,
FT                   131889..132059)
FT                   /gene="Pc16g00590"
FT                   /locus_tag="PCH_Pc16g00590"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   contig1495_2.tfa_430wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00590"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92729"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W2"
FT                   /protein_id="CAP92729.1"
FT                   /translation="MSDNTRPPQPSSLITQRSCADFQDLESFKDCLASIAQVKEHHEFV
FT                   LLDIPRDWADIVFEVLDEVVSARKMYNSRTDVLRVLTMPTAIQNCIQPWLYNQLFNWGI
FT                   TGAITPSEENMIHGEAGTKPDFLFMIRGRLLPTVAVESGWSDPMPRLQDDLNMLLVGGD
FT                   GSIKVVIIIKWSRHAPNRVSGVAELYKCDRNGIPVRDQREVIFPHNPTTGNQQLVIKRR
FT                   DLLGSGHGNPAGSLFFDLDLLRDFASRALGRMNLVPA"
FT   exon            131067..131269
FT                   /gene="Pc16g00590"
FT                   /locus_tag="PCH_Pc16g00590"
FT                   /number=1
FT   intron          131270..131329
FT                   /gene="Pc16g00590"
FT                   /locus_tag="PCH_Pc16g00590"
FT                   /number=1
FT   exon            131330..131493
FT                   /gene="Pc16g00590"
FT                   /locus_tag="PCH_Pc16g00590"
FT                   /number=2
FT   intron          131494..131587
FT                   /gene="Pc16g00590"
FT                   /locus_tag="PCH_Pc16g00590"
FT                   /number=2
FT   exon            131588..131829
FT                   /gene="Pc16g00590"
FT                   /locus_tag="PCH_Pc16g00590"
FT                   /number=3
FT   intron          131830..131888
FT                   /gene="Pc16g00590"
FT                   /locus_tag="PCH_Pc16g00590"
FT                   /number=3
FT   exon            131889..132059
FT                   /gene="Pc16g00590"
FT                   /locus_tag="PCH_Pc16g00590"
FT                   /number=4
FT   mRNA            join(<132601..133028,133090..133357,133409..133659,
FT                   134166..134325,134407..>134532)
FT                   /gene="Pc16g00600"
FT                   /locus_tag="PCH_Pc16g00600"
FT   CDS_pept        join(132601..133028,133090..133357,133409..133659,
FT                   134166..134325,134407..134532)
FT                   /gene="Pc16g00600"
FT                   /locus_tag="PCH_Pc16g00600"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An01g00310 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00600"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92730"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W5"
FT                   /protein_id="CAP92730.1"
FT                   /translation="MTPTSSPSPKIKDVVVNILHTLKSIDHAHLTKSEIQRLGVSVDIF
FT                   DPNDEDSSDEDSLDPETQWLFKPISKEDIKPWKISPSEAKAVQSSLDIPELVRASQHRP
FT                   DWDVTGATQEVLHFITTQFDFRRKSKTPLRDTFGWNDIDFDEFAGGNVGLLFSIGGKFR
FT                   GVDTPGWRTGLIEEWWDGEDLAGPSVRLIICTDSNGKEGNLLLSELGSIAQVVAFRRNQ
FT                   PGFETYRLFPVLLISLFGPRHGRIIQACYDRRSNKFELRISRVFCFVTKEDAVFDTFLR
FT                   FTASYPPEIANPQFSRLARATLSQRPLAHRPARRGRDDNPMEPEAPLSEAYQDTGYYDD
FT                   MGPAYGDYDPGVRDGAFDDGGGYYDDDDRINHHVCAVRSRLFESKNKLFRHLPNCDTAA
FT                   QPAGDQAGHCR"
FT   exon            132601..133028
FT                   /gene="Pc16g00600"
FT                   /locus_tag="PCH_Pc16g00600"
FT                   /number=1
FT   intron          133029..133089
FT                   /gene="Pc16g00600"
FT                   /locus_tag="PCH_Pc16g00600"
FT                   /number=1
FT   exon            133090..133357
FT                   /gene="Pc16g00600"
FT                   /locus_tag="PCH_Pc16g00600"
FT                   /number=2
FT   intron          133358..133408
FT                   /gene="Pc16g00600"
FT                   /locus_tag="PCH_Pc16g00600"
FT                   /number=2
FT   exon            133409..133659
FT                   /gene="Pc16g00600"
FT                   /locus_tag="PCH_Pc16g00600"
FT                   /number=3
FT   intron          133660..134165
FT                   /gene="Pc16g00600"
FT                   /locus_tag="PCH_Pc16g00600"
FT                   /number=3
FT   exon            134166..134325
FT                   /gene="Pc16g00600"
FT                   /locus_tag="PCH_Pc16g00600"
FT                   /number=4
FT   intron          134326..134406
FT                   /gene="Pc16g00600"
FT                   /locus_tag="PCH_Pc16g00600"
FT                   /number=4
FT   exon            134407..134532
FT                   /gene="Pc16g00600"
FT                   /locus_tag="PCH_Pc16g00600"
FT                   /number=5
FT   mRNA            complement(join(<134978..135999,136050..136268,
FT                   136320..136402,136456..136592,136641..>136818))
FT                   /pseudo
FT                   /gene="Pc16g00610"
FT                   /locus_tag="PCH_Pc16g00610"
FT                   /note="submitted as non-pseudo"
FT   CDS_pept        complement(join(134978..135999,136050..136268,
FT                   136320..136402,136456..136592,136641..136818))
FT                   /pseudo
FT                   /gene="Pc16g00610"
FT                   /locus_tag="PCH_Pc16g00610"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to hypothetical membrane
FT                   protein YMR088c - Saccharomyces cerevisiae"
FT                   /inference="similar to AA sequence:PIR:S54464"
FT                   /inference="protein motif:COGS:COG0477"
FT   exon            complement(134978..135999)
FT                   /gene="Pc16g00610"
FT                   /locus_tag="PCH_Pc16g00610"
FT                   /number=1
FT   intron          complement(136000..136049)
FT                   /gene="Pc16g00610"
FT                   /locus_tag="PCH_Pc16g00610"
FT                   /number=1
FT   exon            complement(136050..136268)
FT                   /gene="Pc16g00610"
FT                   /locus_tag="PCH_Pc16g00610"
FT                   /number=2
FT   intron          complement(136269..136319)
FT                   /gene="Pc16g00610"
FT                   /locus_tag="PCH_Pc16g00610"
FT                   /number=2
FT   exon            complement(136320..136402)
FT                   /gene="Pc16g00610"
FT                   /locus_tag="PCH_Pc16g00610"
FT                   /number=3
FT   intron          complement(136403..136455)
FT                   /gene="Pc16g00610"
FT                   /locus_tag="PCH_Pc16g00610"
FT                   /number=3
FT   exon            complement(136456..136592)
FT                   /gene="Pc16g00610"
FT                   /locus_tag="PCH_Pc16g00610"
FT                   /number=4
FT   intron          complement(136593..136640)
FT                   /gene="Pc16g00610"
FT                   /locus_tag="PCH_Pc16g00610"
FT                   /number=4
FT   exon            complement(136641..136818)
FT                   /gene="Pc16g00610"
FT                   /locus_tag="PCH_Pc16g00610"
FT                   /number=5
FT   mRNA            complement(join(<137184..137825,137878..138515,
FT                   138563..138659,138706..138992,139044..>139275))
FT                   /gene="Pc16g00620"
FT                   /locus_tag="PCH_Pc16g00620"
FT   CDS_pept        complement(join(137184..137825,137878..138515,
FT                   138563..138659,138706..138992,139044..139275))
FT                   /gene="Pc16g00620"
FT                   /locus_tag="PCH_Pc16g00620"
FT                   /note="unknown EC_number=3.2.1.3"
FT                   /note="Title: strong similarity to glucan
FT                   1,4-alpha-glucosidase glaA - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92732"
FT                   /db_xref="GOA:B6H6W4"
FT                   /db_xref="InterPro:IPR000165"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR008291"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR034836"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W4"
FT                   /inference="similar to AA sequence:PIR:ALASGR"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /inference="protein motif:PFAM:PF00686"
FT                   /inference="protein motif:COGS:COG3387"
FT                   /inference="protein motif:COGS:COG3408"
FT                   /protein_id="CAP92732.1"
FT                   /translation="MAPRFWTALWALTLGHAVVATPQILAPRATGSLDTWLASETVVAR
FT                   QGILDNIGSAGAHAANAKPGVVLASPSTSDPDYYYTWTRDSALVFKNLVDMFRSGDSAL
FT                   LEVIEEYISSQAYIQTVSNPSGGLSGGGGLGEPKFNADETAFTGSWGRPQRDGPALRAT
FT                   ALISFGQWLIDNGYTTYATDIVWPVVRNDLSYVSQYWNQTGFDLWEEVSGSSFFTVAAQ
FT                   HRALVEGSTFASQVGSSCLYCDSQAPQVLCFLQSFWTGSYILANFGGGRSGKDANTLLG
FT                   SIHTFDPEAGCDDTTFQPCSARALANHKVVTDSFRSIYSVNSGIAAGKAVSVGRYPEDS
FT                   YYNGNPWYLCTLAAAEQLYDAIYTWNRIGSLTITSVSLSFFKDLYSSAATGTYSSSSDT
FT                   YSSIVAAVKEYADGYVSIVEKYAASSGSLSEQFSKSDGSQLSARDLTWSYAALLTANER
FT                   RNAIVPAPWGETSASSVPGQCQYTSAIGTYSSATNTAWPTTLTSGSGSVTTTKTTTTTS
FT                   KPTTTSCTTPTTVAVTFNVIATTEYGQNIKLAGSISQLGSWSPSSAVALSASKYTTSNH
FT                   LWFVTVTLPVGTSFSYKYIQVASDGTIKWESDPNQSYTVPATCGTTAVTVSDTWR"
FT   exon            complement(137184..137825)
FT                   /gene="Pc16g00620"
FT                   /locus_tag="PCH_Pc16g00620"
FT                   /number=1
FT   mat_peptide     complement(join(137187..137825,137878..138515,
FT                   138563..138659,138706..138992,139044..139215))
FT                   /gene="Pc16g00620"
FT                   /locus_tag="PCH_Pc16g00620"
FT   intron          complement(137826..137877)
FT                   /gene="Pc16g00620"
FT                   /locus_tag="PCH_Pc16g00620"
FT                   /number=1
FT   exon            complement(137878..138515)
FT                   /gene="Pc16g00620"
FT                   /locus_tag="PCH_Pc16g00620"
FT                   /number=2
FT   intron          complement(138516..138562)
FT                   /gene="Pc16g00620"
FT                   /locus_tag="PCH_Pc16g00620"
FT                   /number=2
FT   exon            complement(138563..138659)
FT                   /gene="Pc16g00620"
FT                   /locus_tag="PCH_Pc16g00620"
FT                   /number=3
FT   intron          complement(138660..138705)
FT                   /gene="Pc16g00620"
FT                   /locus_tag="PCH_Pc16g00620"
FT                   /number=3
FT   exon            complement(138706..138992)
FT                   /gene="Pc16g00620"
FT                   /locus_tag="PCH_Pc16g00620"
FT                   /number=4
FT   intron          complement(138993..139043)
FT                   /gene="Pc16g00620"
FT                   /locus_tag="PCH_Pc16g00620"
FT                   /number=4
FT   exon            complement(139044..139275)
FT                   /gene="Pc16g00620"
FT                   /locus_tag="PCH_Pc16g00620"
FT                   /number=5
FT   sig_peptide     complement(139216..139275)
FT                   /gene="Pc16g00620"
FT                   /locus_tag="PCH_Pc16g00620"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<140375..140533,140588..140626,140677..140792,
FT                   140844..140952,141001..141229,141274..141436,
FT                   141484..141630,141686..141926,141976..>142644)
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT   CDS_pept        join(140375..140533,140588..140626,140677..140792,
FT                   140844..140952,141001..141229,141274..141436,
FT                   141484..141630,141686..141926,141976..142644)
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /note="unknown EC_number=3.2.1.1"
FT                   /note="Title: strong similarity to alpha-amylase precursor
FT                   amy - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00630"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92733"
FT                   /db_xref="GOA:B6H6W6"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR015340"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR034836"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W6"
FT                   /inference="similar to AA sequence:TREMBL:AB008370.1"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /inference="protein motif:PFAM:PF00686"
FT                   /inference="protein motif:COGS:COG0366"
FT                   /protein_id="CAP92733.1"
FT                   /translation="MKKVIFTATILLWQMVMGLTPAEWRSQSIYFLLTDRFGRTDNSVT
FT                   ANCNVDDRAYCGGTWQGIINQLDYIQGMGFTAIWITPVTKQLPQDTGYGMAYHGYWQQD
FT                   IYDVNDHHGTSDDLLALSKALHARGMYLMVDVVANHMGYAGAGNTVDYSVFTPFSSSSY
FT                   FHPYCLISNYNDQSNVENCWLGDTTVSLPDLDTTQNSVQTIWNDWIADLVTKYSIDGLR
FT                   IDTVKHVQKSFWPGFNDAAGVYAVGEIFDGNPAYTCDYQNYMDGVLNYPIYYPLLRAFQ
FT                   SSSGSISDLYNMVGTVASSCADSTLLGNFIENHDNPRFPSYTSDYSQAKNVISFLFLSD
FT                   GIPIVYAGQEQHYSGGHDPANREAVWLSGYSTTAELYQHIATTNKIRKAAVAADSSYIT
FT                   SKNVPFYQDSHTLAMKKGSGSSPVITVLSNAGSSGSSYTLYLGGSGYSSGTKLMEMHTC
FT                   TSITVDSSGKIAVPMVSGLPRVLIPASSVSNSGLCGSSVPSATATQTTTATTTGAGCTQ
FT                   ATALPVLFKELVTTVYGQDIYISGSISQLGNWDTSQAIALSSSSYTASNPLWQTTITLP
FT                   VGTTFQYKFLKKTTGSSTVTWESDPNRSYTVPTGCTGATATVAASWK"
FT   sig_peptide     140375..140428
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            140375..140533
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=1
FT   mat_peptide     join(140429..140533,140588..140626,140677..140792,
FT                   140844..140952,141001..141229,141274..141436,
FT                   141484..141630,141686..141926,141976..142641)
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT   intron          140534..140587
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=1
FT   exon            140588..140626
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=2
FT   intron          140627..140676
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=2
FT   exon            140677..140792
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=3
FT   intron          140793..140843
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=3
FT   exon            140844..140952
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=4
FT   intron          140953..141000
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=4
FT   exon            141001..141229
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=5
FT   intron          141230..141273
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=5
FT   exon            141274..141436
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=6
FT   intron          141437..141483
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=6
FT   exon            141484..141630
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=7
FT   intron          141631..141685
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=7
FT   exon            141686..141926
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=8
FT   intron          141927..141975
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=8
FT   exon            141976..142644
FT                   /gene="Pc16g00630"
FT                   /locus_tag="PCH_Pc16g00630"
FT                   /number=9
FT   mRNA            complement(<142868..>144571)
FT                   /gene="Pc16g00640"
FT                   /locus_tag="PCH_Pc16g00640"
FT   CDS_pept        complement(142868..144571)
FT                   /gene="Pc16g00640"
FT                   /locus_tag="PCH_Pc16g00640"
FT                   /note="unknown EC_number=3.1.1.3"
FT                   /note="Title: strong similarity to triacylglycerol lipase
FT                   Lip4 - Candida rugosa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00640"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92734"
FT                   /db_xref="GOA:B6H6W7"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W7"
FT                   /inference="similar to AA sequence:PIR:JN0552"
FT                   /inference="protein motif:PFAM:PF00135"
FT                   /inference="protein motif:COGS:COG2272"
FT                   /inference="protein motif:COGS:COG0657"
FT                   /inference="protein motif:COGS:COG1506"
FT                   /protein_id="CAP92734.1"
FT                   /translation="MPSILKLILLFALPLVWAVPAQRRAPSANPTVIISKPETTVVGST
FT                   GLNKIDQFNGIPFALPPTGSLRLKPPQPIQTSLGTIQATSAARSCPQFSFSTDEKDLPS
FT                   SIIAKLINIPLFQEITNAGEDCLTLDVRRPSGTQADAKLPVLVWIFGGGFEQGATTSYD
FT                   GSHIVTSSVKLGMPVIFVAMNYRLGGFGFMPGAEIRKDGSANLGLRDQRLALQWVADNI
FT                   AAFGGDPSKVTIWGESAGAISVFDQMAMYDGDNIYNGVPLFRSAIMNSGSIVPANPVDG
FT                   TKGQTVYDTVVKNAGCSGVSDTLACLRHLDYTKFLNAANSVPGILGYNSVAESYLPRPD
FT                   GTILTQSPDQLVIQGKYASVPFIIGDQEDEGTIFALYQSNLTTTDDIVDYLQNLYFFDA
FT                   SRQQLESLVATYQDIKEDGSPFRTGSLNNWYPQYKRLAAILGDLSFTLTRRVFLNYAKK
FT                   VRPDVPSWSYLSTYDHGLPFLGTFHGSDVLQVFHGILQNYGSKAIHSYYLSFVYDQDPN
FT                   TRACDYMDWPQWANNQSLMEFSIDRGGLLPDNFRQDSYNQIMADPPAFYI"
FT   exon            complement(142868..144571)
FT                   /gene="Pc16g00640"
FT                   /locus_tag="PCH_Pc16g00640"
FT                   /number=1
FT   mat_peptide     complement(142871..144517)
FT                   /gene="Pc16g00640"
FT                   /locus_tag="PCH_Pc16g00640"
FT   sig_peptide     complement(144518..144571)
FT                   /gene="Pc16g00640"
FT                   /locus_tag="PCH_Pc16g00640"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<144728..144838,144960..145038,145126..145289,
FT                   145687..145857,145967..146102,146196..146283,
FT                   146378..146438,146490..146651,146746..>147063)
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT   CDS_pept        join(144728..144838,144960..145038,145126..145289,
FT                   145687..145857,145967..146102,146196..146283,
FT                   146378..146438,146490..146651,146746..147063)
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00650"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92735"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W8"
FT                   /protein_id="CAP92735.1"
FT                   /translation="MDRFHNSIPQARRASVRPIEFRYPFGFGTRYVLPTNEGRGHEDAT
FT                   VLDMAIHREGSRVTERNARVKGALRGITLLFSANGQRDIESDVTERTPWLGFALLSGFI
FT                   SANLLRMKLKQAVATFAMVPSHLKNWQDTAAFSADDNGITLESIESIESIVVMQSPFDR
FT                   YQSSLLATTFERAPGELLEIFRLLPVKVDELDMGIIKANDHYVDDVELLIDSPYLAPKD
FT                   AHGWADRCNNKCDRSGFLSRPANIGAARAPGLVVPRIDQNTSEKPNRPGLPLKVLISHF
FT                   GALGVTNKIGLSNNVFMTKLSAWLGGNGLNIFVKLGRDDQDRAVSQPSLSKKSFSRGKS
FT                   TKVPSPVPPGHLRAPQGTMTDLHSMKGNRSFTKTLSKTARTGCQSILEGSQADLQENLE
FT                   GILGVWEGTIMMILARSIHIRERAIGANWY"
FT   exon            144728..144838
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=1
FT   intron          144839..144959
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=1
FT   exon            144960..145038
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=2
FT   intron          145039..145125
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=2
FT   exon            145126..145289
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=3
FT   intron          145290..145686
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=3
FT   exon            145687..145857
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=4
FT   intron          145858..145966
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=4
FT   exon            145967..146102
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=5
FT   intron          146103..146195
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=5
FT   exon            146196..146283
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=6
FT   intron          146284..146377
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=6
FT   exon            146378..146438
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=7
FT   intron          146439..146489
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=7
FT   exon            146490..146651
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=8
FT   intron          146652..146745
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=8
FT   exon            146746..147063
FT                   /gene="Pc16g00650"
FT                   /locus_tag="PCH_Pc16g00650"
FT                   /number=9
FT   mRNA            join(<149167..149461,149516..149650,149707..150298,
FT                   150351..150505,150557..>151233)
FT                   /gene="Pc16g00660"
FT                   /locus_tag="PCH_Pc16g00660"
FT   CDS_pept        join(149167..149461,149516..149650,149707..150298,
FT                   150351..150505,150557..151233)
FT                   /gene="Pc16g00660"
FT                   /locus_tag="PCH_Pc16g00660"
FT                   /note="Title: strong similarity to peptide transporter PTR2
FT                   - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92736"
FT                   /db_xref="GOA:B6H6W9"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W9"
FT                   /inference="similar to AA sequence:SWISSPROT:PT2A_ARATH"
FT                   /inference="protein motif:PFAM:PF00854"
FT                   /inference="protein motif:COGS:COG3104"
FT                   /protein_id="CAP92736.1"
FT                   /translation="MNASDPAEVAEIAKSKAISHNISADEKVPVVDDLTIDNAPPVRAG
FT                   SIEGDDYALEKTAPTDEELATLRRVAGKLPAAAYSVAFVELCERFSYYGTTAVFVNFIQ
FT                   RPLPDQSTTGALVPGVSDWSNESPGALGMGQQASTGLTLFNSFWSYIMPLFGAIVADQY
FT                   WGRYRTIMSAIACALVGHVILIVSAIPQVIENQKGAAACFSIGLVIMGVGTGGFKSNIS
FT                   PLIAEQYTDDRPYVTTLASGERVIVDPAATVARIYLYFYMMINIGSFVGQVAMVYAERY
FT                   VGFWLSYLLPTAMFCLCPAVLLLFKKNYVLTPPSGSIYGKALKVWGLALKGNWSLNPVR
FT                   WFQKSDKDIWAAAKPSHFGDNKPAWMDFDDAWVDEVRRGLMACRVFLWYPLYWLAYNQM
FT                   LNNLTSQAATMKLGGVPNDIINNLNPISLIVFIPIFDHIIYPGIRKMGFHFTPLKRITA
FT                   GFIMAALSMVVAAVTQHYIYKLGPCGSNANHCIEVEKQYTNISVWVQALTYIMGGISEI
FT                   LASVTSLEYAYTKAPKNMRSLVQAVALLMNAFSSAIGQAFIGLAKDPLLVWNYTVVAIL
FT                   AFVGGVGFWATNYKLDAEEDAMNMLPDSSFTPHAAEDEERK"
FT   exon            149167..149461
FT                   /gene="Pc16g00660"
FT                   /locus_tag="PCH_Pc16g00660"
FT                   /number=1
FT   intron          149462..149515
FT                   /gene="Pc16g00660"
FT                   /locus_tag="PCH_Pc16g00660"
FT                   /number=1
FT   exon            149516..149650
FT                   /gene="Pc16g00660"
FT                   /locus_tag="PCH_Pc16g00660"
FT                   /number=2
FT   intron          149651..149706
FT                   /gene="Pc16g00660"
FT                   /locus_tag="PCH_Pc16g00660"
FT                   /number=2
FT   exon            149707..150298
FT                   /gene="Pc16g00660"
FT                   /locus_tag="PCH_Pc16g00660"
FT                   /number=3
FT   intron          150299..150350
FT                   /gene="Pc16g00660"
FT                   /locus_tag="PCH_Pc16g00660"
FT                   /number=3
FT   exon            150351..150505
FT                   /gene="Pc16g00660"
FT                   /locus_tag="PCH_Pc16g00660"
FT                   /number=4
FT   intron          150506..150556
FT                   /gene="Pc16g00660"
FT                   /locus_tag="PCH_Pc16g00660"
FT                   /number=4
FT   exon            150557..151233
FT                   /gene="Pc16g00660"
FT                   /locus_tag="PCH_Pc16g00660"
FT                   /number=5
FT   mRNA            join(<153944..154439,154828..>155231)
FT                   /gene="Pc16g00670"
FT                   /locus_tag="PCH_Pc16g00670"
FT   CDS_pept        join(153944..154439,154828..155231)
FT                   /gene="Pc16g00670"
FT                   /locus_tag="PCH_Pc16g00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92737"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X0"
FT                   /protein_id="CAP92737.1"
FT                   /translation="MTDSQVTKEATAPKKSVTMTRFSAHEKEQMKSGNRTAYVALPKNV
FT                   KAKRATKNDALNKHSVPTERGSPSRVGPSPTTLGALRGSSRRRRKPSRMKYSPTRSNLV
FT                   PRKRFLIEEQMFGNTIGPRKRIVFEKPPGFTKMDVLFREFYHQVLARGLVGPVPLLPVP
FT                   AHRYKSLTMTRFSANEKEQMKAGNRTAYVALPKNLKARRASKNDALNKHIWRTYKKLEL
FT                   EAVLQSGDSYFAVVLKTPENRDRALETLRAKKVRLDSEVVSLQVMPFGVPDEAANTVWT
FT                   VRGWYGDTAEKIAGAIRT"
FT   exon            153944..154439
FT                   /gene="Pc16g00670"
FT                   /locus_tag="PCH_Pc16g00670"
FT                   /number=1
FT   intron          154440..154827
FT                   /gene="Pc16g00670"
FT                   /locus_tag="PCH_Pc16g00670"
FT                   /number=1
FT   exon            154828..155231
FT                   /gene="Pc16g00670"
FT                   /locus_tag="PCH_Pc16g00670"
FT                   /number=2
FT   mRNA            join(<157270..157357,157411..157904,157967..>158308)
FT                   /gene="Pc16g00680"
FT                   /locus_tag="PCH_Pc16g00680"
FT   CDS_pept        join(157270..157357,157411..157904,157967..158308)
FT                   /gene="Pc16g00680"
FT                   /locus_tag="PCH_Pc16g00680"
FT                   /note="Title: strong similarity to lipase - Penicillium
FT                   allii"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00680"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92738"
FT                   /db_xref="GOA:B6H6X1"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X1"
FT                   /inference="similar to AA sequence:TREMBLNEW:AY303124.1"
FT                   /inference="protein motif:PFAM:PF01764"
FT                   /inference="protein motif:COGS:COG3675"
FT                   /inference="protein motif:COGS:COG5153"
FT                   /inference="protein motif:COGS:COG0596"
FT                   /protein_id="CAP92738.1"
FT                   /translation="MTGPMICRVLAVLSLGMIVNASPVQLARRAISSELLERFTLFSQF
FT                   AALSACDQNINHTGQSLTCDYGTCPLVAADNTTVINAFHSDHGPTGYIALDHTRELIVL
FT                   AFRGTVSKSDGDTDLDIALTPIDEVCTGCRAHHGFWVYWSAVASQATSRLRDATSAYPG
FT                   YTLSVVGHSLGGGISALAGTVLRTQGFNLDIWTFGGPKPGNMKLAEFITNQQAPNSIYR
FT                   ATHTTDPIPKVPINLPFLDWSQPSPEYWITQATGVQVTPDGVQYVEGINSKEGNAGSDR
FT                   DLRWPNPEHGWYFGNMSACATPIDAS"
FT   sig_peptide     157270..157332
FT                   /gene="Pc16g00680"
FT                   /locus_tag="PCH_Pc16g00680"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            157270..157357
FT                   /gene="Pc16g00680"
FT                   /locus_tag="PCH_Pc16g00680"
FT                   /number=1
FT   mat_peptide     join(157333..157357,157411..157904,157967..158305)
FT                   /gene="Pc16g00680"
FT                   /locus_tag="PCH_Pc16g00680"
FT   intron          157358..157410
FT                   /gene="Pc16g00680"
FT                   /locus_tag="PCH_Pc16g00680"
FT                   /number=1
FT   exon            157411..157904
FT                   /gene="Pc16g00680"
FT                   /locus_tag="PCH_Pc16g00680"
FT                   /number=2
FT   intron          157905..157966
FT                   /gene="Pc16g00680"
FT                   /locus_tag="PCH_Pc16g00680"
FT                   /number=2
FT   exon            157967..158308
FT                   /gene="Pc16g00680"
FT                   /locus_tag="PCH_Pc16g00680"
FT                   /number=3
FT   mRNA            complement(<158480..>159982)
FT                   /gene="Pc16g00690"
FT                   /locus_tag="PCH_Pc16g00690"
FT   CDS_pept        complement(158480..159982)
FT                   /gene="Pc16g00690"
FT                   /locus_tag="PCH_Pc16g00690"
FT                   /note="unknown EC_number=1.14.13.22"
FT                   /note="Title: strong similarity to cyclohexanone
FT                   monooxygenase like protein An03g06700 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00690"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92739"
FT                   /db_xref="GOA:B6H6X2"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X2"
FT                   /inference="protein motif:PFAM:PF00743"
FT                   /inference="protein motif:COGS:COG2072"
FT                   /protein_id="CAP92739.1"
FT                   /translation="MNGLNGINENHFDVIIVGAGISGINAAYRVQDQLPGYTYTILEAR
FT                   ADLGGTWDLFKYPGIRSDSDLFTFGFQFNPWSRDNPIAEGSAIKQYVRDTAAKYGIDQH
FT                   IRYNHRLSSADWSSDENTWSLSVNHNDSEQTYTARYVIFGTGYYNYKDPLKADIPGLDA
FT                   FQGQIVHPQFWPENLQYKDKKIVIIGSGATAITLLPNLADHAARVTMLQRSPTYILSVP
FT                   NRSASRWLSYLLPNSVYCKLQRMIWIYTTRIFFLFCQRFPNFSRWLLKLNVRKQLPNHI
FT                   PYDPHFKPRYNPWDQRLCVCPDGDLFRSLRQGKADVKTDTIREVTKNGILLNSGEELDA
FT                   DIIITATGLRLQIAGGSALSVDGTKLDIGDKYLWNGVMLQDLPNASFVIGYTNASWTLG
FT                   SDATAQFICRLLKKLESQKSVAAIPRLKEKDAATLQDRPLLNLQSTYVSVAQRTLPKAA
FT                   DRGPWQPRDHYIKDLKFAQSGDIDTGLEFVQGPNLRLRPKMS"
FT   exon            complement(158480..159982)
FT                   /gene="Pc16g00690"
FT                   /locus_tag="PCH_Pc16g00690"
FT                   /number=1
FT   mRNA            join(<160585..160948,161013..>161737)
FT                   /gene="Pc16g00700"
FT                   /locus_tag="PCH_Pc16g00700"
FT   CDS_pept        join(160585..160948,161013..161737)
FT                   /gene="Pc16g00700"
FT                   /locus_tag="PCH_Pc16g00700"
FT                   /note="unknown EC_number=3.1.1.-"
FT                   /note="Title: weak similarity to acetyl-hydrolase chnC
FT                   -Acinetobacter sp."
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00700"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92740"
FT                   /db_xref="GOA:B6H6X3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X3"
FT                   /inference="similar to AA sequence:TREMBL:AB006902.8"
FT                   /inference="protein motif:COGS:COG0657"
FT                   /protein_id="CAP92740.1"
FT                   /translation="MSITKITKVTKVKLSLKEKLDFFPAVVSIVIAYIYALLTGLRRSE
FT                   RQAKSLSLHLGYAVFRKATARLTTTQMQYILPPSHKIYERHSKKTGRLPESVELGDGAL
FT                   GHWVGDRNADNVLVWFHGGGFGLPANMGYFKFYAQLLRDLKASGKSVAVFSLTYTLAPI
FT                   AVYPTQLRQAVNCLRYILSQPNRDPATVFLGGDSAGGNLVGGVLSHLAHPHAEIDSLQL
FT                   HSNLGGAVMIAPWTLLEKDFPEIEIYHGGDIITTAVAGPWSAAYIGAGKRDYYTDLSTA
FT                   PADWFTTFPVNSVLITAGGNEIMLPLIQDFAAKFKEGFENVELFVGHRECHVAPIYHLE
FT                   LGNATKTEQGKKVEAVLAELMV"
FT   exon            160585..160948
FT                   /gene="Pc16g00700"
FT                   /locus_tag="PCH_Pc16g00700"
FT                   /number=1
FT   intron          160949..161012
FT                   /gene="Pc16g00700"
FT                   /locus_tag="PCH_Pc16g00700"
FT                   /number=1
FT   exon            161013..161737
FT                   /gene="Pc16g00700"
FT                   /locus_tag="PCH_Pc16g00700"
FT                   /number=2
FT   mRNA            complement(join(<162027..162312,162368..>163086))
FT                   /gene="Pc16g00710"
FT                   /locus_tag="PCH_Pc16g00710"
FT   CDS_pept        complement(join(162027..162312,162368..163086))
FT                   /gene="Pc16g00710"
FT                   /locus_tag="PCH_Pc16g00710"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig50.tfa_130wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00710"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92741"
FT                   /db_xref="GOA:B6H6X4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /inference="protein motif:COGS:COG1028"
FT                   /protein_id="CAP92741.1"
FT                   /translation="MSTLNLITQYTQTALSHLPEPAQDLLHHPTAQKAIGVLAALTLLR
FT                   ITNRFLSKRTLQNWTSNQPWIPARELILLTGGCSGIGKQVMEDLARTGVRVIILDINEP
FT                   TFSLPANVTFYKANITSSADIAQVANTIRENHGDPTVLVNNAGIGHEGTILDEPEEKIR
FT                   QTFEVNTLSHFLMVKEFLPAMVKANHGHVVTIASMASFVALGEIVDYCCSKASALAFHE
FT                   GLRQELKYWYNAPNVRTSVVHPFWVRTPMIKMLTDHEAHLKQPIMTPQVVSDAICKQIL
FT                   TQTSGQVILPASQSVARLVRAMPTWMQEGVRTFASGALRRMRIAQQAEKEAQA"
FT   exon            complement(162027..162312)
FT                   /gene="Pc16g00710"
FT                   /locus_tag="PCH_Pc16g00710"
FT                   /number=1
FT   intron          complement(162313..162367)
FT                   /gene="Pc16g00710"
FT                   /locus_tag="PCH_Pc16g00710"
FT                   /number=1
FT   exon            complement(162368..163086)
FT                   /gene="Pc16g00710"
FT                   /locus_tag="PCH_Pc16g00710"
FT                   /number=2
FT   mRNA            join(<163768..163887,164023..164462,164524..164908,
FT                   164986..>165600)
FT                   /gene="Pc16g00720"
FT                   /locus_tag="PCH_Pc16g00720"
FT   CDS_pept        join(163768..163887,164023..164462,164524..164908,
FT                   164986..165600)
FT                   /gene="Pc16g00720"
FT                   /locus_tag="PCH_Pc16g00720"
FT                   /note="unknown EC_number=1.14.14.1"
FT                   /note="Title: strong similarity to cytochrome P450 protein
FT                   like protein An03g06720 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00720"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92742"
FT                   /db_xref="GOA:B6H6X5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X5"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /inference="protein motif:COGS:COG2124"
FT                   /protein_id="CAP92742.1"
FT                   /translation="MALGDSVLAVGAFTLAEAYFLQRTILTDTTFQRICLSALGGSHVE
FT                   LVFDSPRGTKPLQWMKTVPNEGLIHMRDTFNRSYVIPTNHQALLDVMSTNTYDFEKPWR
FT                   MRNFLARIIGFGMITSEGAAHKKQRKALTPAFNIKNIRSMYSLMWSKTGQLLDELEKEI
FT                   KVQPMDGTGPEDQEGKIEMSEWASRLTLDIIGPIAMGRDFGSLQNKRNKVADSFAKILE
FT                   PTKEKMAFLMMNFALPQWMARRVPWRQNDVLNAETAYLRSTCDEIVREKRASLAGSKVS
FT                   AQDLEADILGTMMLGGDFSDTELVDQMLTFLAAGHETTASALTWACYLLHLHPEYQTRL
FT                   RDEIRSKIPSGNSPITYQDLESLPLLNGVCQEVLRLYPTVPTTIRESVRNTVIAGKYIP
FT                   KGTRVVLCPWAINRSPLFWGENGEEFVPERWIDTDKNGHCIPNNNGGASTNFAQITFLH
FT                   GQRSCIGKDFARAELRCAVAGVVGRFLFEMQDPKQEIHVAGAVTIKPVEGMHLRMRRID
FT                   EW"
FT   sig_peptide     163768..163821
FT                   /gene="Pc16g00720"
FT                   /locus_tag="PCH_Pc16g00720"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            163768..163887
FT                   /gene="Pc16g00720"
FT                   /locus_tag="PCH_Pc16g00720"
FT                   /number=1
FT   mat_peptide     join(163822..163887,164023..164462,164524..164908,
FT                   164986..165597)
FT                   /gene="Pc16g00720"
FT                   /locus_tag="PCH_Pc16g00720"
FT   intron          163888..164022
FT                   /gene="Pc16g00720"
FT                   /locus_tag="PCH_Pc16g00720"
FT                   /number=1
FT   exon            164023..164462
FT                   /gene="Pc16g00720"
FT                   /locus_tag="PCH_Pc16g00720"
FT                   /number=2
FT   intron          164463..164523
FT                   /gene="Pc16g00720"
FT                   /locus_tag="PCH_Pc16g00720"
FT                   /number=2
FT   exon            164524..164908
FT                   /gene="Pc16g00720"
FT                   /locus_tag="PCH_Pc16g00720"
FT                   /number=3
FT   intron          164909..164985
FT                   /gene="Pc16g00720"
FT                   /locus_tag="PCH_Pc16g00720"
FT                   /number=3
FT   exon            164986..165600
FT                   /gene="Pc16g00720"
FT                   /locus_tag="PCH_Pc16g00720"
FT                   /number=4
FT   mRNA            complement(join(<165956..166756,166819..167313,
FT                   167388..>167600))
FT                   /gene="Pc16g00730"
FT                   /locus_tag="PCH_Pc16g00730"
FT   CDS_pept        complement(join(165956..166756,166819..167313,
FT                   167388..167600))
FT                   /gene="Pc16g00730"
FT                   /locus_tag="PCH_Pc16g00730"
FT                   /note="Title: similarity to fluconazole resistance
FT                   transporter Flr1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00730"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92743"
FT                   /db_xref="GOA:B6H6X6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X6"
FT                   /inference="similar to AA sequence:PIR:S45860"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP92743.1"
FT                   /translation="MEKADSQHQHIESANSNQMESGKQCDFYVEDRITHLSEGHRQYIL
FT                   AKHGTLDLEPIPDMTDTDPYNWPQWRKNLNLTLVAFHAMMGTFTASSIQSVFENISEDL
FT                   DVSMQRTSYLVSLFIAVLGGAPLFWRPLCNRYGRRPIFLISLICSLVGNVGCAKSPSYA
FT                   TMGLCRAITAFFISPAAAIGSAVVAETFFRKDRARCMGAWTVMVTLGVPAAPFIFGFVA
FT                   LRVGYRWIYYILAIVNAVQFVLYFFFGSESLYVRSNVPPDNVIAAKRSLFRFRRIDPTP
FT                   LKLWDFFQPLIYVMKPCVIIPAVAYAMIFLWGGIVLTIEISQVYPAKFGLNTQQVGLQF
FT                   LGIIIGSVVGEQIGGFISDRWMLIRQKRTGEPSPPEYRLWLSYIGHALTICGIVVFAIE
FT                   IRDSGGAWTIAPVIGTAIGACGNQIVTTVDITYAVDCYREDAASVGVFITFVRQTWGFI
FT                   GPFWFPEMFEIVGWAGGAGIAVALIVGVSVIPTILVQWRGAGWR"
FT   exon            complement(165956..166756)
FT                   /gene="Pc16g00730"
FT                   /locus_tag="PCH_Pc16g00730"
FT                   /number=1
FT   intron          complement(166757..166818)
FT                   /gene="Pc16g00730"
FT                   /locus_tag="PCH_Pc16g00730"
FT                   /number=1
FT   exon            complement(166819..167313)
FT                   /gene="Pc16g00730"
FT                   /locus_tag="PCH_Pc16g00730"
FT                   /number=2
FT   intron          complement(167314..167387)
FT                   /gene="Pc16g00730"
FT                   /locus_tag="PCH_Pc16g00730"
FT                   /number=2
FT   exon            complement(167388..167600)
FT                   /gene="Pc16g00730"
FT                   /locus_tag="PCH_Pc16g00730"
FT                   /number=3
FT   mRNA            complement(join(<168345..168728,168781..169026,
FT                   169080..169253,169309..169476,169525..>169866))
FT                   /gene="Pc16g00740"
FT                   /locus_tag="PCH_Pc16g00740"
FT   CDS_pept        complement(join(168345..168728,168781..169026,
FT                   169080..169253,169309..169476,169525..169866))
FT                   /gene="Pc16g00740"
FT                   /locus_tag="PCH_Pc16g00740"
FT                   /note="unknown EC_number=3.2.1.67"
FT                   /note="Title: strong similarity to exo-alpha
FT                   1,4-polygalacturonase PGX1 - Cochliobolus carbonum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92744"
FT                   /db_xref="GOA:B6H6X7"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X7"
FT                   /inference="similar to AA sequence:SWISSPROT:PGLX_COCCA"
FT                   /inference="protein motif:PFAM:PF00295"
FT                   /inference="protein motif:COGS:COG5434"
FT                   /protein_id="CAP92744.1"
FT                   /translation="MKFLAIGALLLSTVSALATEHIIKGAQIIPASDKAGLKKIGAHGH
FT                   HKHHDRRTVTIRSSKSDTDDISDDFLWGIKAANHGGRLLLQKGKTYVIGKKLDLSFLDD
FT                   IEVQLEGEVKFTDDIDYWQANHFYYSFQRSITFWVWGGQDIKIFGKGTLNGNGQEWYNA
FT                   FAGMEILDPDNVFYRPVLFVTDNATRVSVEGITQLNSPCWTNFFVRTKDVSFDDVYINS
FT                   FSTNASALPKNTDGFDSFNVDGLRVTNTRVDVGDDCFAPKPNTTNIFVQNLWCNNTHGV
FT                   SMGSIGQYPGVEDIIEHAWIENVTLVNGQNGVRLKAWAGPDVGFGRINNITYKDVRVEN
FT                   TDSPIVLDQCYFNIDAATCAEYPSSVNFTNINFENIYGTSSGKNGKVVADLTCSPNSVC
FT                   TDIHLSDIDITSPAGGPPIVTCDGIDGDVGVECQSSSA"
FT   exon            complement(168345..168728)
FT                   /gene="Pc16g00740"
FT                   /locus_tag="PCH_Pc16g00740"
FT                   /number=1
FT   mat_peptide     complement(join(168348..168728,168781..169026,
FT                   169080..169253,169309..169476,169525..169818))
FT                   /gene="Pc16g00740"
FT                   /locus_tag="PCH_Pc16g00740"
FT   intron          complement(168729..168780)
FT                   /gene="Pc16g00740"
FT                   /locus_tag="PCH_Pc16g00740"
FT                   /number=1
FT   exon            complement(168781..169026)
FT                   /gene="Pc16g00740"
FT                   /locus_tag="PCH_Pc16g00740"
FT                   /number=2
FT   intron          complement(169027..169079)
FT                   /gene="Pc16g00740"
FT                   /locus_tag="PCH_Pc16g00740"
FT                   /number=2
FT   exon            complement(169080..169253)
FT                   /gene="Pc16g00740"
FT                   /locus_tag="PCH_Pc16g00740"
FT                   /number=3
FT   intron          complement(169254..169308)
FT                   /gene="Pc16g00740"
FT                   /locus_tag="PCH_Pc16g00740"
FT                   /number=3
FT   exon            complement(169309..169476)
FT                   /gene="Pc16g00740"
FT                   /locus_tag="PCH_Pc16g00740"
FT                   /number=4
FT   intron          complement(169477..169524)
FT                   /gene="Pc16g00740"
FT                   /locus_tag="PCH_Pc16g00740"
FT                   /number=4
FT   exon            complement(169525..169866)
FT                   /gene="Pc16g00740"
FT                   /locus_tag="PCH_Pc16g00740"
FT                   /number=5
FT   sig_peptide     complement(169819..169866)
FT                   /gene="Pc16g00740"
FT                   /locus_tag="PCH_Pc16g00740"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<169977..170051,170143..>170487)
FT                   /gene="Pc16g00750"
FT                   /locus_tag="PCH_Pc16g00750"
FT   CDS_pept        join(169977..170051,170143..170487)
FT                   /gene="Pc16g00750"
FT                   /locus_tag="PCH_Pc16g00750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00750"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92745"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X8"
FT                   /protein_id="CAP92745.1"
FT                   /translation="MAPTLFPRLPMSGERHGQGEEISPPAMESFLRISPRVSDKREDAE
FT                   RQDEPNELRRWVIQIPNCYGRVLWPGFIFPRLGLISAWRVGFFHQSAAQFVIQRSRRGL
FT                   AVFPGWGDCRGLLSSGFQFSLDIVFVVAGAQSWME"
FT   exon            169977..170051
FT                   /gene="Pc16g00750"
FT                   /locus_tag="PCH_Pc16g00750"
FT                   /number=1
FT   intron          170052..170142
FT                   /gene="Pc16g00750"
FT                   /locus_tag="PCH_Pc16g00750"
FT                   /number=1
FT   exon            170143..170487
FT                   /gene="Pc16g00750"
FT                   /locus_tag="PCH_Pc16g00750"
FT                   /number=2
FT   mRNA            complement(join(<170767..170966,171063..171352,
FT                   171416..>171420))
FT                   /gene="Pc16g00760"
FT                   /locus_tag="PCH_Pc16g00760"
FT   CDS_pept        complement(join(170767..170966,171063..171352,
FT                   171416..171420))
FT                   /gene="Pc16g00760"
FT                   /locus_tag="PCH_Pc16g00760"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An11g09050 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00760"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92746"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X9"
FT                   /protein_id="CAP92746.1"
FT                   /translation="MSALFTTLGLRAPDQPPANHASALLMVNWFFAYILSSPRGAKIRM
FT                   GLDHNANPREDLTTYGEAAVQSGKITRRTLDKLKRQTSAHANAQEGYTLFVAAILVSLY
FT                   AGLPNETINTVGVWYSVSRVAYHLLYCNVESHSLSFLRSAAWWSGNISCLYALVQASKE
FT                   L"
FT   exon            complement(170767..170966)
FT                   /gene="Pc16g00760"
FT                   /locus_tag="PCH_Pc16g00760"
FT                   /number=1
FT   mat_peptide     complement(join(170770..170966,171063..171249))
FT                   /gene="Pc16g00760"
FT                   /locus_tag="PCH_Pc16g00760"
FT   intron          complement(170967..171062)
FT                   /gene="Pc16g00760"
FT                   /locus_tag="PCH_Pc16g00760"
FT                   /number=1
FT   exon            complement(171063..171352)
FT                   /gene="Pc16g00760"
FT                   /locus_tag="PCH_Pc16g00760"
FT                   /number=2
FT   sig_peptide     complement(join(171250..171352,171416..171420))
FT                   /gene="Pc16g00760"
FT                   /locus_tag="PCH_Pc16g00760"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(171353..171415)
FT                   /gene="Pc16g00760"
FT                   /locus_tag="PCH_Pc16g00760"
FT                   /number=2
FT   exon            complement(171416..171420)
FT                   /gene="Pc16g00760"
FT                   /locus_tag="PCH_Pc16g00760"
FT                   /number=3
FT   mRNA            join(<173745..173926,173981..174008,174058..174684,
FT                   174754..>175296)
FT                   /gene="Pc16g00770"
FT                   /locus_tag="PCH_Pc16g00770"
FT   CDS_pept        join(173745..173926,173981..174008,174058..174684,
FT                   174754..175296)
FT                   /gene="Pc16g00770"
FT                   /locus_tag="PCH_Pc16g00770"
FT                   /note="unknown EC_number=4.1.1.15"
FT                   /note="Title: strong similarity to glutamate decarboxylase
FT                   like protein An08g08840 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00770"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92747"
FT                   /db_xref="GOA:B6H6Y0"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y0"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /inference="protein motif:COGS:COG0076"
FT                   /inference="protein motif:COGS:COG0520"
FT                   /inference="protein motif:COGS:COG1104"
FT                   /protein_id="CAP92747.1"
FT                   /translation="MGSIEELPKLSGQSKCSYVYGSRFAARPLPSHQLPDGGMPKDVAY
FT                   QLIKDDLTLDGQPILNLASFVTTYMEDEALKLLAESANKNIIDHEEYPKSVEIEHRCLN
FT                   ILADLFHSPVSDGAPTAFGTSCIGSSEAIMIATLAMKKRWEINRKAQGKDASNPNLIMS
FT                   SGVQVCWEKAARYFDIAEKLVPCTETRYVIDPVQAVDMVDENTIGICAILGTTYTGQYE
FT                   DVQAISELLIKKGLDTPIHVDAASGGFVAPFVNPDLVWDFKLPNVVSINVSGHKYGLVY
FT                   PGIGWALWRSPEYLPEELVFNIDYLGAEQLNFTMNFSKPASHIIAQYYQLIRLGRSGYT
FT                   SIMKNLTRTADYLTSQLREMGFVIMSEGGGRGLPVVAFRLGSTQNAFLDEWALARKLRE
FT                   RGWIVPAYTMAADCETMGMMRVVVRTDFSMGRCMSLVQDVRDSLGALAGLEIQNIQRYQ
FT                   A"
FT   exon            173745..173926
FT                   /gene="Pc16g00770"
FT                   /locus_tag="PCH_Pc16g00770"
FT                   /number=1
FT   intron          173927..173980
FT                   /gene="Pc16g00770"
FT                   /locus_tag="PCH_Pc16g00770"
FT                   /number=1
FT   exon            173981..174008
FT                   /gene="Pc16g00770"
FT                   /locus_tag="PCH_Pc16g00770"
FT                   /number=2
FT   intron          174009..174057
FT                   /gene="Pc16g00770"
FT                   /locus_tag="PCH_Pc16g00770"
FT                   /number=2
FT   exon            174058..174684
FT                   /gene="Pc16g00770"
FT                   /locus_tag="PCH_Pc16g00770"
FT                   /number=3
FT   intron          174685..174753
FT                   /gene="Pc16g00770"
FT                   /locus_tag="PCH_Pc16g00770"
FT                   /number=3
FT   exon            174754..175296
FT                   /gene="Pc16g00770"
FT                   /locus_tag="PCH_Pc16g00770"
FT                   /number=4
FT   mRNA            complement(<175996..>177183)
FT                   /gene="Pc16g00780"
FT                   /locus_tag="PCH_Pc16g00780"
FT   CDS_pept        complement(175996..177183)
FT                   /gene="Pc16g00780"
FT                   /locus_tag="PCH_Pc16g00780"
FT                   /note="Title: similarity to hypothetical protein An03g00300
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00780"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92748"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y1"
FT                   /protein_id="CAP92748.1"
FT                   /translation="MDPFAKLPTEIICHILDSCCDFTSLEGLQQISPRMKEAFSGWFKN
FT                   VTETVLRNCSLTSPGLHRYFTLLASILSRSFTPQALLEELASWDHRPRRRIICLSTTHS
FT                   LAAVQQTVNIAAKIHVTACACLQHFMSRLESAEPRRPMASGVNVVDWVNGGLPPPKGGE
FT                   LIQFDVDPPSWIETYRTHRALWKLELFHQIHNAATNRWLWSTCDLNNFTKQYLKWCQCR
FT                   EGIEELPTISECVVDLCSSKPTILSHLASYLVAIPSPTDLTIQACWPLPNIQNTRVDEK
FT                   WRRSPKFRNCRNPMLRYFNVLRVTEEGRSHHALWTANFKAFRRLGIPLWDRWRLYQMKL
FT                   VGQSRSVLSPRGNLVGGGSERTEWSHGIVAYVWFSLAEEGDLSVQYIKNEDWRRQ"
FT   exon            complement(175996..177183)
FT                   /gene="Pc16g00780"
FT                   /locus_tag="PCH_Pc16g00780"
FT                   /number=1
FT   mRNA            complement(join(<179358..181154,181204..>181800))
FT                   /gene="Pc16g00790"
FT                   /locus_tag="PCH_Pc16g00790"
FT   CDS_pept        complement(join(179358..181154,181204..181800))
FT                   /gene="Pc16g00790"
FT                   /locus_tag="PCH_Pc16g00790"
FT                   /note="Title: similarity to hypothetical transcription
FT                   activator SPAC139.03 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00790"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92749"
FT                   /db_xref="GOA:B6H6Y2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y2"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP92749.1"
FT                   /translation="MENNDHSSLDHEEIESQSRTTQRRRRPPLSCTVCRKRKLKCDRSL
FT                   PCRQCVRSKTTAQCVFVGTQPGIVSDSSQRMSPPQLPYGGGEEQPGRKSGMFVFDSKLG
FT                   PNPTSNRVSKRGRSDELSELRSRLRVLETSLGKPSHLQTPETSVCDVFSEVDTANSSEN
FT                   VGVDDRVRYLPDSSFRGKKAKTRYFGRSHYTTTVSFFKDIGAFMRRDRCRGEGKDKEYT
FT                   EMKKFKTELWSRETQDHQRAFREQAFKLNEMVPQRNVADHLLQLYLDTFETTYRILHTP
FT                   TFLRQYADYWANTQPTDMAFVAQLLAVMAAGSCFYVPRPGQDDRDIFQKPAMKWIMAVQ
FT                   SYISCTFVSPDIDFRMLQTQTLLLVARLGVASDGDVAWASAGSLIRSAMTMGLHRDPTR
FT                   FRKARPFYSELRRRLWATVVELDLKISLDRGVPPSVDLDECDCDPPSNWDDSDLIPDME
FT                   NDPSPLSTALYTQNFYQTLLIKTLPLRYRIAKKINSLRFNLSYDDALRMGDELSRSIQR
FT                   ASSLFEDNAPSIAPGESGRHRFAQSIHLFIMRKFLLALHRPFSLSVVRLPKCSYSRKIC
FT                   LEESLGILSQMELPLSTEDVLYPHITQLGSGMFCDETFHAAITACVELSLQANEMSASA
FT                   TSGMDGVNSSVLMSMIQSQQGVMMQAVERTADNFGRRIGPDGKGCKPFFFLNIILASVK
FT                   SRVKGEDPLCNVDTASKRSIRICRAILNGLTYQEAKISVDNRPFQVGTSVCRYVSVIPN
FT                   VPVQTSVPSGTTPASKTPSDIDPASLLSTDFSDFTVGYCSSDAV"
FT   exon            complement(179358..181154)
FT                   /gene="Pc16g00790"
FT                   /locus_tag="PCH_Pc16g00790"
FT                   /number=1
FT   intron          complement(181155..181203)
FT                   /gene="Pc16g00790"
FT                   /locus_tag="PCH_Pc16g00790"
FT                   /number=1
FT   exon            complement(181204..181800)
FT                   /gene="Pc16g00790"
FT                   /locus_tag="PCH_Pc16g00790"
FT                   /number=2
FT   mRNA            complement(join(<182527..182670,182730..183072,
FT                   183143..184445,184497..185313,185365..186688,
FT                   186750..>187189))
FT                   /gene="Pc16g00800"
FT                   /locus_tag="PCH_Pc16g00800"
FT   CDS_pept        complement(join(182527..182670,182730..183072,
FT                   183143..184445,184497..185313,185365..186688,
FT                   186750..187189))
FT                   /gene="Pc16g00800"
FT                   /locus_tag="PCH_Pc16g00800"
FT                   /note="Title: weak similarity to ATP-binding cassette
FT                   multidrug transport protein atrB - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00800"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92750"
FT                   /db_xref="GOA:B6H6Y3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034001"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /inference="protein motif:COGS:COG1132"
FT                   /inference="protein motif:COGS:COG0842"
FT                   /protein_id="CAP92750.1"
FT                   /translation="MPAPLHPHLKHTSSFATEKHNNEPPRVQVSHEDEDALADIHQTLT
FT                   AQTQPDPKYPEPHSSFDKFLEEQVQGKKPANLGVCFQSLSTWGDGDSHADVKTFSTALW
FT                   RTLTLQDIYEWTIQPWIAKKKPEEGRPLIRDFSGVVQSGEIMLVLGRPGAGCSTFLRTI
FT                   AGHHSSFLGVTGSIDYSGLSPDEVRKHYRGAVAYVPEDDVHFPTLTVRQTLEFALQSKT
FT                   PKRYRERIPRYLEIYGRVFGMSHTMNTLVGNEYIRGVSGGERKRISIIESLATDSSVAC
FT                   WDNSTRGLDASSALDYARSLRIMTDTCGKATLLTLYQASDAIYELVDKVLLIDEGRMLY
FT                   QGPANEAKRYFEDLGYECADMQTTSDFLTSITLPERRRFRAGWEHRAPKGPIELEAAFR
FT                   QSAAFSKIETDVESYEDQKLTGRSSAYPADSECDSVEVFKNTVHSDKSRFVSSKSPYTI
FT                   SLFRQVVLCAKRQMWQLKGHLGPLYVKLISCVVYGLLIGSMFYDQPQTTEGMYSRGGVL
FT                   FYSSILLAWLQMSELEEAMQGRDILSRQKKFAFVRPSAVCLARVLSDMVITAVLTFLYL
FT                   IVMYFLSGLRSDAGPFFIDALFIYACTVCLTAQFRVFAALSQNFEVALRYCGVSVMFCI
FT                   VFGGYVLSVDKMIQDVPWVGWLAYTTPALYTYEAVMAAEFHNVNFTCAAASIIPSGSEY
FT                   TDLAYQTCAYAGSQIGSTVVNGDDYLAVKYGFYYSNVWRNFGILCLFTVAFIGITCWLS
FT                   EVLEWELDSAGPIQYKGSRKLFKREKKVQSDEEKSPVSVDSSAPPAGHETKHDQTLTAT
FT                   ESTFSWSDLELNVQIGKETRKLLDGVCGYCKPGSLTALVGASGAGKSTLLTALTQRESP
FT                   GTLSGSLFVDNRSIDQSFNRQIGYCQQMDIHDESSTIKEALQFSALLRQSREVPTAEKL
FT                   AYVETVIHTLDLVELQDAVIGSLDIEKKKRVTIGVELCARPKLLLFLDEPTSGLDSQGA
FT                   TSIVALLRRLANQGLAVLCTIHQANQQQFEEVSATHSDQESILTGSQFDRVLALSPGGS
FT                   TYYFGPVGESGHAIFEYFARHGNVPENVTNAADFLIEVVVGGMKASGNQTNWPAIWRNS
FT                   EEFAEVKNEIASIRSDKNTRSPSLAPTPPPISQQIKLLTQRTCRQFWRTAEYPYSRLYS
FT                   SFLHALINGLTYLQIGNSTTDLQSKAFSCFLVLMLVPEFINAISMRFILNRDIWLAREG
FT                   PSGVYGWVAFCTAQIISEIPYSVIGGVVFFVLYYFMVGLPLGFAAGYCFLMFFLFFLFA
FT                   TSWGQWIAALSSDSMIAATLMPFFIIMCELFNGILRPQSQMPAFWKYTMYYATPFTYWI
FT                   GGVLTSVLRGTPVVCSQSELTIFESPPNTTCSEYADAWLNAKGVGYLSNPDGMGECGYC
FT                   EYSFGDDYLTGLGLDSSKIWPYFGIFLAFTITNYLMVYLLVYVRSVMKPFWRSK"
FT   exon            complement(182527..182670)
FT                   /gene="Pc16g00800"
FT                   /locus_tag="PCH_Pc16g00800"
FT                   /number=1
FT   intron          complement(182671..182729)
FT                   /gene="Pc16g00800"
FT                   /locus_tag="PCH_Pc16g00800"
FT                   /number=1
FT   exon            complement(182730..183072)
FT                   /gene="Pc16g00800"
FT                   /locus_tag="PCH_Pc16g00800"
FT                   /number=2
FT   intron          complement(183073..183142)
FT                   /gene="Pc16g00800"
FT                   /locus_tag="PCH_Pc16g00800"
FT                   /number=2
FT   exon            complement(183143..184445)
FT                   /gene="Pc16g00800"
FT                   /locus_tag="PCH_Pc16g00800"
FT                   /number=3
FT   intron          complement(184446..184496)
FT                   /gene="Pc16g00800"
FT                   /locus_tag="PCH_Pc16g00800"
FT                   /number=3
FT   exon            complement(184497..185313)
FT                   /gene="Pc16g00800"
FT                   /locus_tag="PCH_Pc16g00800"
FT                   /number=4
FT   intron          complement(185314..185364)
FT                   /gene="Pc16g00800"
FT                   /locus_tag="PCH_Pc16g00800"
FT                   /number=4
FT   exon            complement(185365..186688)
FT                   /gene="Pc16g00800"
FT                   /locus_tag="PCH_Pc16g00800"
FT                   /number=5
FT   intron          complement(186689..186749)
FT                   /gene="Pc16g00800"
FT                   /locus_tag="PCH_Pc16g00800"
FT                   /number=5
FT   exon            complement(186750..187189)
FT                   /gene="Pc16g00800"
FT                   /locus_tag="PCH_Pc16g00800"
FT                   /number=6
FT   mRNA            complement(join(<187665..187689,187719..187751,
FT                   187806..187857,188047..188124,188202..188352,
FT                   188422..188520,188550..>188693))
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT   CDS_pept        complement(join(187665..187689,187719..187751,
FT                   187806..187857,188047..188124,188202..188352,
FT                   188422..188520,188550..188693))
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00810"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92751"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y4"
FT                   /protein_id="CAP92751.1"
FT                   /translation="MAPNSLTLSTSSSPTARPNSFPSFFSPFRFPVPCFPRPSSSSSTT
FT                   PGLSTHNIYPALHRVLPALHVHDPWTSTGAQEDGALSVIEGLHFAEEERGEGEEGKFEA
FT                   ETRSLELGALNWIGKLSWDIILEMRELELLCIICTEEKKTDILLSYHRHLRHQCIRICH
FT                   GRIRVECSISRLLRLASTYLATPYSVNYTG"
FT   exon            complement(187665..187689)
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /number=1
FT   intron          complement(187690..187718)
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /number=1
FT   exon            complement(187719..187751)
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /number=2
FT   intron          complement(187752..187805)
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /number=2
FT   exon            complement(187806..187857)
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /number=3
FT   intron          complement(187858..188046)
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /number=3
FT   exon            complement(188047..188124)
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /number=4
FT   intron          complement(188125..188201)
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /number=4
FT   exon            complement(188202..188352)
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /number=5
FT   intron          complement(188353..188421)
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /number=5
FT   exon            complement(188422..188520)
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /number=6
FT   intron          complement(188521..188549)
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /number=6
FT   exon            complement(188550..188693)
FT                   /gene="Pc16g00810"
FT                   /locus_tag="PCH_Pc16g00810"
FT                   /number=7
FT   mRNA            complement(join(<188951..188989,189043..189683,
FT                   189752..>190220))
FT                   /gene="Pc16g00820"
FT                   /locus_tag="PCH_Pc16g00820"
FT   CDS_pept        complement(join(188951..188989,189043..189683,
FT                   189752..190220))
FT                   /gene="Pc16g00820"
FT                   /locus_tag="PCH_Pc16g00820"
FT                   /note="unknown EC_number=2.4.1.-"
FT                   /note="Title: similarity to alphaN-acetylglucosamine
FT                   transferase GNT1 - Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00820"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92752"
FT                   /db_xref="GOA:B6H700"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR030518"
FT                   /db_xref="UniProtKB/TrEMBL:B6H700"
FT                   /inference="protein motif:COGS:COG5597"
FT                   /protein_id="CAP92752.1"
FT                   /translation="MPPNKPTFPYRRSSNASEDDFFDIPDEPCLSIVKRQLRHVRTWIA
FT                   VALIILFILWQRRERPPPPPLPHIHYDEVDWSRFAYTQYATNEVYMCNCLMVFEALHRL
FT                   GSKADRVLFYPEEWDLIVEDDYDRVSQLLLEAKLKYNVMLIPIKIEGVQDPSTAGSRAS
FT                   WDTSTAKLMAFGEHEYDRVIHLDSDVILLQTMDELFFLPPTTAAMPRAYWLLPEKLLSS
FT                   LLVVIEPSLREYLALTDATTLAQNGQVDMNLTDHRYDMELLNRRYGDSAMVLPHRQYGL
FT                   LSGEFRKKDHRNFLGNDDEVWDPDHVLAQAKFVHFSDWPLPKPWIMWPQEMLAEEQPKC
FT                   DNNPGTPQESGCRDREIWKMLYDKYRRQRKDVCKLLSYPAPV"
FT   exon            complement(188951..188989)
FT                   /gene="Pc16g00820"
FT                   /locus_tag="PCH_Pc16g00820"
FT                   /number=1
FT   intron          complement(188990..189042)
FT                   /gene="Pc16g00820"
FT                   /locus_tag="PCH_Pc16g00820"
FT                   /number=1
FT   exon            complement(189043..189683)
FT                   /gene="Pc16g00820"
FT                   /locus_tag="PCH_Pc16g00820"
FT                   /number=2
FT   intron          complement(189684..189751)
FT                   /gene="Pc16g00820"
FT                   /locus_tag="PCH_Pc16g00820"
FT                   /number=2
FT   exon            complement(189752..190220)
FT                   /gene="Pc16g00820"
FT                   /locus_tag="PCH_Pc16g00820"
FT                   /number=3
FT   tRNA            190623..190714
FT                   /gene="tRNA-Val (AAC)"
FT                   /locus_tag="PCH_Pc16e00040"
FT                   /product="transfer RNA-Val (AAC)"
FT                   /inference="profile:tRNAscan:1.4"
FT   tRNA            complement(191226..191317)
FT                   /gene="tRNA-Val (AAC)"
FT                   /locus_tag="PCH_Pc16e00050"
FT                   /product="transfer RNA-Val (AAC)"
FT                   /inference="profile:tRNAscan:1.4"
FT   mRNA            complement(join(<191452..191568,191856..192267,
FT                   192339..192406,192461..192675,192731..192839,
FT                   192887..193157,193209..193381,193440..193465,
FT                   193534..>193573))
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT   CDS_pept        complement(join(191452..191568,191856..192267,
FT                   192339..192406,192461..192675,192731..192839,
FT                   192887..193157,193209..193381,193440..193465,
FT                   193534..193573))
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig_1_108_scaffold_7.tfa_310cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00830"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92753"
FT                   /db_xref="GOA:B6H701"
FT                   /db_xref="UniProtKB/TrEMBL:B6H701"
FT                   /protein_id="CAP92753.1"
FT                   /translation="MDIPNPGEGDVNIGTSTFQACWILTAIVGVALLFRYAIKIWVRWA
FT                   LPEVTAPGRIWGTEDLLFFVAWGFDITHMVFIQMSANWGLGRHFFYLTAEERLNSMKWD
FT                   FLSQPLAVASAMVSRAGMMWFLLTCFAASDKKIRLSIIICAVVQVVVNMVTIVQIIVQC
FT                   GPNPYQTTNRVQYFHYMWTPLPEDGSVKCQSPTVQTTVGFVQGGFNTVIDYFLAVLAAV
FT                   ELWQFFLRTLHRNPETSFWSQFCKISATVRSRRIWQTITLSGPLILSGCASIVKTYKLK
FT                   SLGDRHDFTYNIVTFVLWVNILLASCAPVARLFLRSFVDHRREGRTHGYWSRSRSTDHK
FT                   EPETELKRRANAKEQWLDSATATNMTITCAHDEENPPTGWSEHGHERSISQVSKAEMPE
FT                   HIDDGRVTVKTDIVVQIDDGRSISSGGTRLLPDGGESHSYRAPVNDTQQAANSVYMIIS
FT                   DQARLLSSSSLWAKGVIE"
FT   exon            complement(191452..191568)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=1
FT   intron          complement(191569..191855)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=1
FT   exon            complement(191856..192267)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=2
FT   intron          complement(192268..192338)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=2
FT   exon            complement(192339..192406)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=3
FT   intron          complement(192407..192460)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=3
FT   exon            complement(192461..192675)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=4
FT   intron          complement(192676..192730)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=4
FT   exon            complement(192731..192839)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=5
FT   intron          complement(192840..192886)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=5
FT   exon            complement(192887..193157)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=6
FT   intron          complement(193158..193208)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=6
FT   exon            complement(193209..193381)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=7
FT   intron          complement(193382..193439)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=7
FT   exon            complement(193440..193465)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=8
FT   intron          complement(193466..193533)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=8
FT   exon            complement(193534..193573)
FT                   /gene="Pc16g00830"
FT                   /locus_tag="PCH_Pc16g00830"
FT                   /number=9
FT   mRNA            complement(join(<194477..195257,195334..195460,
FT                   195526..195540,195594..195741,195792..>195887))
FT                   /gene="Pc16g00840"
FT                   /locus_tag="PCH_Pc16g00840"
FT   CDS_pept        complement(join(194477..195257,195334..195460,
FT                   195526..195540,195594..195741,195792..195887))
FT                   /gene="Pc16g00840"
FT                   /locus_tag="PCH_Pc16g00840"
FT                   /note="unknown EC_number=2.1.1.110"
FT                   /note="Title: similarity to O-methyltransferase A omtA
FT                   -Aspergillus parasiticus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00840"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92754"
FT                   /db_xref="GOA:B6H6Z8"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z8"
FT                   /inference="similar to AA sequence:SWISSPROT:OMTA_ASPPA"
FT                   /inference="protein motif:PFAM:PF00891"
FT                   /inference="protein motif:COGS:COG0500"
FT                   /inference="protein motif:COGS:COG2226"
FT                   /inference="protein motif:COGS:COG2890"
FT                   /protein_id="CAP92754.1"
FT                   /translation="MPLLTRLASLLGLSSPAPAVPPGAALAATVTVPASLGFVPVAIHF
FT                   DLFNILVSHGGPATADEISATCNARIKARGENEPELSTRLASDTLYIMAGLGLVERVAE
FT                   DCFTANAITNHMVAMPSAQHGALHFTTEGLMAGAFLMKKLQDTRFAYPFADADGPLQYA
FT                   YRLMGQPELAEQHTYSIMETQGRMDSFNHFMVGKFLKFGTFPERVKSMGYDLDAALAGD
FT                   NSTGTRTGSATMVDIGGGRGELLLEVQAMYPHLGAEDLIVQEFNADIDSVPGVRLMEWN
FT                   YKEQDEQPVRGACVYALQHILHNLPDLDAVALLQKISRAMAPGSRVLIIEYAKNLNYTS
FT                   LHASMIALFGGRERSSVEWRQMAGLCGLQVTFEVYVRAGESLVEMRRK"
FT   exon            complement(194477..195257)
FT                   /gene="Pc16g00840"
FT                   /locus_tag="PCH_Pc16g00840"
FT                   /number=1
FT   mat_peptide     complement(join(194480..195257,195334..195460,
FT                   195526..195540,195594..195741,195792..195806))
FT                   /gene="Pc16g00840"
FT                   /locus_tag="PCH_Pc16g00840"
FT   intron          complement(195258..195333)
FT                   /gene="Pc16g00840"
FT                   /locus_tag="PCH_Pc16g00840"
FT                   /number=1
FT   exon            complement(195334..195460)
FT                   /gene="Pc16g00840"
FT                   /locus_tag="PCH_Pc16g00840"
FT                   /number=2
FT   intron          complement(195461..195525)
FT                   /gene="Pc16g00840"
FT                   /locus_tag="PCH_Pc16g00840"
FT                   /number=2
FT   exon            complement(195526..195540)
FT                   /gene="Pc16g00840"
FT                   /locus_tag="PCH_Pc16g00840"
FT                   /number=3
FT   intron          complement(195541..195593)
FT                   /gene="Pc16g00840"
FT                   /locus_tag="PCH_Pc16g00840"
FT                   /number=3
FT   exon            complement(195594..195741)
FT                   /gene="Pc16g00840"
FT                   /locus_tag="PCH_Pc16g00840"
FT                   /number=4
FT   intron          complement(195742..195791)
FT                   /gene="Pc16g00840"
FT                   /locus_tag="PCH_Pc16g00840"
FT                   /number=4
FT   exon            complement(195792..195887)
FT                   /gene="Pc16g00840"
FT                   /locus_tag="PCH_Pc16g00840"
FT                   /number=5
FT   sig_peptide     complement(195807..195887)
FT                   /gene="Pc16g00840"
FT                   /locus_tag="PCH_Pc16g00840"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<196604..196803,196872..197021,197084..197253,
FT                   197307..197331,197383..197678,197736..>197779)
FT                   /gene="Pc16g00850"
FT                   /locus_tag="PCH_Pc16g00850"
FT   CDS_pept        join(196604..196803,196872..197021,197084..197253,
FT                   197307..197331,197383..197678,197736..197779)
FT                   /gene="Pc16g00850"
FT                   /locus_tag="PCH_Pc16g00850"
FT                   /note="Title: similarity to polyamine transport protein
FT                   Tpo4 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00850"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92755"
FT                   /db_xref="GOA:B6H6Z9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z9"
FT                   /inference="similar to AA sequence:PIR:S67175"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP92755.1"
FT                   /translation="MEKPSPVYFTHEMAASASSSLGTHELKECDNNSDVEARDPLNPRN
FT                   WSSARKTMLFVSLMTSSLLADGAMVWGGTLVTDQAMEWDISIAHSATSMNYGILLQGFG
FT                   GIFAVPLIEAYGRLPIWLWPQVITMFMVLGATLSNDWSTFTTFRSLQGLFGTVPQVIGL
FT                   PIIHDMYTSAEWPRMINIWGTTFLVGPFLGPAIAGYIGAGSDWRTSFGVLTAIYGVSTV
FT                   MVILFGYETYHTPGRTTNQSRIASYFGIGNTLLPKGTTLRYWSRTVAVYVFKFPLLMTG
FT                   IAILVTFTWPIGK"
FT   exon            196604..196803
FT                   /gene="Pc16g00850"
FT                   /locus_tag="PCH_Pc16g00850"
FT                   /number=1
FT   intron          196804..196871
FT                   /gene="Pc16g00850"
FT                   /locus_tag="PCH_Pc16g00850"
FT                   /number=1
FT   exon            196872..197021
FT                   /gene="Pc16g00850"
FT                   /locus_tag="PCH_Pc16g00850"
FT                   /number=2
FT   intron          197022..197083
FT                   /gene="Pc16g00850"
FT                   /locus_tag="PCH_Pc16g00850"
FT                   /number=2
FT   exon            197084..197253
FT                   /gene="Pc16g00850"
FT                   /locus_tag="PCH_Pc16g00850"
FT                   /number=3
FT   intron          197254..197306
FT                   /gene="Pc16g00850"
FT                   /locus_tag="PCH_Pc16g00850"
FT                   /number=3
FT   exon            197307..197331
FT                   /gene="Pc16g00850"
FT                   /locus_tag="PCH_Pc16g00850"
FT                   /number=4
FT   intron          197332..197382
FT                   /gene="Pc16g00850"
FT                   /locus_tag="PCH_Pc16g00850"
FT                   /number=4
FT   exon            197383..197678
FT                   /gene="Pc16g00850"
FT                   /locus_tag="PCH_Pc16g00850"
FT                   /number=5
FT   intron          197679..197735
FT                   /gene="Pc16g00850"
FT                   /locus_tag="PCH_Pc16g00850"
FT                   /number=5
FT   exon            197736..197779
FT                   /gene="Pc16g00850"
FT                   /locus_tag="PCH_Pc16g00850"
FT                   /number=6
FT   mRNA            join(<197921..198189,198249..>198504)
FT                   /gene="Pc16g00860"
FT                   /locus_tag="PCH_Pc16g00860"
FT   CDS_pept        join(197921..198189,198249..198504)
FT                   /gene="Pc16g00860"
FT                   /locus_tag="PCH_Pc16g00860"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig17.tfa_50cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00860"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92756"
FT                   /db_xref="GOA:B6H6Z7"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z7"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP92756.1"
FT                   /translation="MWYVFSHPRYLRILTIFPGWAFGHFFNGWIFKRHSSTWRTELRLH
FT                   GVWFPIGSLASGLLTYGLTMHFGKHWIGIAIGWIMVNIGMVATIVAISAYALEKYPEKA
FT                   TCVSAILNMWRTCGGFAVGYFQPAWIQRNGLGLVFGIQAAIVCVAVVLTITPVFLWEQK
FT                   RRLRVGDEAEA"
FT   exon            197921..198189
FT                   /gene="Pc16g00860"
FT                   /locus_tag="PCH_Pc16g00860"
FT                   /number=1
FT   intron          198190..198248
FT                   /gene="Pc16g00860"
FT                   /locus_tag="PCH_Pc16g00860"
FT                   /number=1
FT   exon            198249..198504
FT                   /gene="Pc16g00860"
FT                   /locus_tag="PCH_Pc16g00860"
FT                   /number=2
FT   mRNA            complement(join(<198629..198691,198771..198907,
FT                   198994..>199132))
FT                   /gene="Pc16g00870"
FT                   /locus_tag="PCH_Pc16g00870"
FT   CDS_pept        complement(join(198629..198691,198771..198907,
FT                   198994..199132))
FT                   /gene="Pc16g00870"
FT                   /locus_tag="PCH_Pc16g00870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00870"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92757"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z3"
FT                   /protein_id="CAP92757.1"
FT                   /translation="MARNKAKKGSVIAVPEPNQFDTASALIVDNPSSRNDSVEPLNGTN
FT                   GDSCPTGSVIACGTLHSEAMIGCVECWLVGEGSGGEDQGYLIKFEIDGEQRTRTCSDRQ
FT                   PDCGLIVA"
FT   exon            complement(198629..198691)
FT                   /gene="Pc16g00870"
FT                   /locus_tag="PCH_Pc16g00870"
FT                   /number=1
FT   intron          complement(198692..198770)
FT                   /gene="Pc16g00870"
FT                   /locus_tag="PCH_Pc16g00870"
FT                   /number=1
FT   exon            complement(198771..198907)
FT                   /gene="Pc16g00870"
FT                   /locus_tag="PCH_Pc16g00870"
FT                   /number=2
FT   intron          complement(198908..198993)
FT                   /gene="Pc16g00870"
FT                   /locus_tag="PCH_Pc16g00870"
FT                   /number=2
FT   exon            complement(198994..199132)
FT                   /gene="Pc16g00870"
FT                   /locus_tag="PCH_Pc16g00870"
FT                   /number=3
FT   mRNA            <199246..>200643
FT                   /gene="Pc16g00880"
FT                   /locus_tag="PCH_Pc16g00880"
FT   CDS_pept        199246..200643
FT                   /gene="Pc16g00880"
FT                   /locus_tag="PCH_Pc16g00880"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   CAC41653.1 - Ustilago maydis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00880"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92758"
FT                   /db_xref="GOA:B6H6Z4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z4"
FT                   /inference="similar to AA sequence:TREMBL:UMA315579.1"
FT                   /protein_id="CAP92758.1"
FT                   /translation="MSSSPRRWLFVGFPILTFCFIYYLFRLPESNPSILNNSEELSQAG
FT                   GEPILVGGQKQERPPPPPPKEETLEEKCGHLLHALDDVMVVIRTGATESLEKIPVHLRT
FT                   TLQCVPHFAIFSDYEETINGVRTYDVLRNISETTMNHEPEFDIYRRLQEVGREGLTEAE
FT                   WGDDTNGPLGKVNNPSWKLDKWKFLPMIDEALEVMPDAKWYVFLEADTYMVWPNLINWL
FT                   AHLNPDRQYYLGSPMQIGETLFGYGGAGIVLSSWTMNLLHEYQIEAKEDLEAMTAHEWA
FT                   GDCALARALQGVKVDLTWAWPMMMTSRPWEIDHFSEGYGRQPWCYPVISYHHMAPKDIE
FT                   EMWEFDRAFFASGKNALMLHADVYQKLIYDGTFSARDDWDNLSGIQIDFAAGTIPTVEV
FT                   CAEVCARNDECLQYSFNHADGVCKHASTTFAGVATNGTQSGWITSRVNKLLRAFQSSCH
FT                   EVQYIFD"
FT   exon            199246..200643
FT                   /gene="Pc16g00880"
FT                   /locus_tag="PCH_Pc16g00880"
FT                   /number=1
FT   mRNA            join(<202591..202723,202820..>204200)
FT                   /pseudo
FT                   /gene="Pc16g00890"
FT                   /locus_tag="PCH_Pc16g00890"
FT                   /note="submitted as non-pseudo"
FT   CDS_pept        join(202591..202723,202820..204200)
FT                   /pseudo
FT                   /gene="Pc16g00890"
FT                   /locus_tag="PCH_Pc16g00890"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   PA2063 - Pseudomonas aeruginosa"
FT                   /inference="similar to AA sequence:PIR:D83387"
FT                   /inference="protein motif:COGS:COG3673"
FT   exon            202591..202723
FT                   /gene="Pc16g00890"
FT                   /locus_tag="PCH_Pc16g00890"
FT                   /number=1
FT   intron          202724..202819
FT                   /gene="Pc16g00890"
FT                   /locus_tag="PCH_Pc16g00890"
FT                   /number=1
FT   exon            202820..204200
FT                   /gene="Pc16g00890"
FT                   /locus_tag="PCH_Pc16g00890"
FT                   /number=2
FT   mRNA            complement(join(<204745..204988,205057..>205250))
FT                   /gene="Pc16g00900"
FT                   /locus_tag="PCH_Pc16g00900"
FT   CDS_pept        complement(join(204745..204988,205057..205250))
FT                   /gene="Pc16g00900"
FT                   /locus_tag="PCH_Pc16g00900"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig10.tfa_380cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00900"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92760"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z5"
FT                   /protein_id="CAP92760.1"
FT                   /translation="MKFTVFSLLLSASAALATPFVERDSSIQISDFWARASAGSSATMH
FT                   FVVTDPNYPDDTPTDCNLIWSYGSSPKESARCNNSQYYIRFPEGAVDFNRFTLELERVS
FT                   GPIAENGQVLLRSGTQWSCVDNPESGVHLSCSYDGVLSMPV"
FT   exon            complement(204745..204988)
FT                   /gene="Pc16g00900"
FT                   /locus_tag="PCH_Pc16g00900"
FT                   /number=1
FT   mat_peptide     complement(join(204748..204988,205057..205199))
FT                   /gene="Pc16g00900"
FT                   /locus_tag="PCH_Pc16g00900"
FT   intron          complement(204989..205056)
FT                   /gene="Pc16g00900"
FT                   /locus_tag="PCH_Pc16g00900"
FT                   /number=1
FT   exon            complement(205057..205250)
FT                   /gene="Pc16g00900"
FT                   /locus_tag="PCH_Pc16g00900"
FT                   /number=2
FT   sig_peptide     complement(205200..205250)
FT                   /gene="Pc16g00900"
FT                   /locus_tag="PCH_Pc16g00900"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<205697..206029,206081..206302,206357..>207571)
FT                   /gene="Pc16g00910"
FT                   /locus_tag="PCH_Pc16g00910"
FT   CDS_pept        join(205697..206029,206081..206302,206357..207571)
FT                   /gene="Pc16g00910"
FT                   /locus_tag="PCH_Pc16g00910"
FT                   /note="unknown EC_number=2.7.1.-"
FT                   /note="Title: similarity to protein kinase Rad53
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00910"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92761"
FT                   /db_xref="GOA:B6H6Z6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z6"
FT                   /inference="similar to AA sequence:PIR:A39616"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /inference="protein motif:COGS:COG0457"
FT                   /protein_id="CAP92761.1"
FT                   /translation="MAQIPDLIRDSKLETYFLPDCTVETVHRFQESDSASGQRLVTRLE
FT                   HWRRQRRVGNGGFGTVWLEECIKAGRPGGTQDGTVRAVKQIDMDTRFGSIEYNRELEAI
FT                   AKFSHSRYERCFVKSFGWYEGPGQLFIAMEYLETGDLFAYLYQKPLPPLPEAEAKEIAY
FT                   QILDGLCMMHENGFAHRDLKPNNILIKSHPPDKWWIKLADFGITKRIEESHGQSTTIKG
FT                   TPRYFAPEIWGFAERGSAYAIDIWAVGEIVFEILTKKPAFATPGLLAGYKAKQDFPVIM
FT                   LTDAGIRQPGVDFVLSLMCPRPNDRMTATSAISDAWIQSPMLQPLGSTKAIEGEPRVPS
FT                   PATIMTDVSTSWTTRTYSEAPGDVSHDISSSTTTVELVNAARDKTIVPQENNLTLTLAF
FT                   RAADFRSQHRAGDSFYRQKRYKEAEIEFRRVLQGREETLGYDHEDTLYSAHALGLSLHP
FT                   QKCYEEAETVFRRALHGRDRVLVHNHEETLYSTYRLGLTLYHQEQYKVAAPMFRQAFLG
FT                   REKTLGYDHRHTLCSAYWLGLSFYRQKRYKEAETMLRRTLQGREKTLGHDHEETVNARE
FT                   CMDRAHARALGLE"
FT   exon            205697..206029
FT                   /gene="Pc16g00910"
FT                   /locus_tag="PCH_Pc16g00910"
FT                   /number=1
FT   intron          206030..206080
FT                   /gene="Pc16g00910"
FT                   /locus_tag="PCH_Pc16g00910"
FT                   /number=1
FT   exon            206081..206302
FT                   /gene="Pc16g00910"
FT                   /locus_tag="PCH_Pc16g00910"
FT                   /number=2
FT   intron          206303..206356
FT                   /gene="Pc16g00910"
FT                   /locus_tag="PCH_Pc16g00910"
FT                   /number=2
FT   exon            206357..207571
FT                   /gene="Pc16g00910"
FT                   /locus_tag="PCH_Pc16g00910"
FT                   /number=3
FT   mRNA            join(<209148..209365,209439..210052,210119..210368,
FT                   210433..210555,210622..>211183)
FT                   /gene="Pc16g00920"
FT                   /locus_tag="PCH_Pc16g00920"
FT   CDS_pept        join(209148..209365,209439..210052,210119..210368,
FT                   210433..210555,210622..211183)
FT                   /gene="Pc16g00920"
FT                   /locus_tag="PCH_Pc16g00920"
FT                   /note="Title: strong similarity to ferrioxamine B permease
FT                   Sit1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00920"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92762"
FT                   /db_xref="GOA:B6H6Y5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y5"
FT                   /inference="similar to AA sequence:PIR:S50524"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP92762.1"
FT                   /translation="MEKTNVSDQVTPATTSRDAEKMGEFDVHQGVDKPSDEASMSDRDS
FT                   RDFQGGVQRVRAITSAWSTKTLVLMFILLYLVSFVDALLSTVETSLNPYITSSFGKHGL
FT                   LTVVSVLSTILGGSSKLTLAKIIDVWGRVEGFLIMLVLVAIGLIMKATCKNIEMYTAAH
FT                   TLYWVGHIGLTYVVDIMLADMTSLRNRMIMLGLNGTPGIASTFAGPKIAALFYANLDFH
FT                   WAFGAFAIMQVGVCIPVAVVMLFMQRRAEKSGALEKTYSGRNWWQSIAHYVIEFDVVGI
FT                   ILVTAVFTLILLPFSIAPYGPKGWATGYIIAMEVLGVACIPAFYVWERYAPVQFLPWKY
FT                   LKQPTMIGSCMLYGVMFISVFTWNSYFSSYLQVVNRLDITSANYVLNAFSLTSYIFSPI
FT                   FGLVIRWTGDFRWTAMAGIPIFLLGTALLIPFRAPDTHVGLLTMVQILVGLGSCMFTVC
FT                   GQIAVMAIVTHQEIAVVLAIWGLFGSIGAGVGSAIAGGMWNNMFLKELTERLPLESKHL
FT                   AATIYSNIVTQMKYADGTPEREAIVGAYADIQRKMVIVGVCFVPLCIVCTWFWRNVNVK
FT                   KLQKEQTSGNVW"
FT   exon            209148..209365
FT                   /gene="Pc16g00920"
FT                   /locus_tag="PCH_Pc16g00920"
FT                   /number=1
FT   intron          209366..209438
FT                   /gene="Pc16g00920"
FT                   /locus_tag="PCH_Pc16g00920"
FT                   /number=1
FT   exon            209439..210052
FT                   /gene="Pc16g00920"
FT                   /locus_tag="PCH_Pc16g00920"
FT                   /number=2
FT   intron          210053..210118
FT                   /gene="Pc16g00920"
FT                   /locus_tag="PCH_Pc16g00920"
FT                   /number=2
FT   exon            210119..210368
FT                   /gene="Pc16g00920"
FT                   /locus_tag="PCH_Pc16g00920"
FT                   /number=3
FT   intron          210369..210432
FT                   /gene="Pc16g00920"
FT                   /locus_tag="PCH_Pc16g00920"
FT                   /number=3
FT   exon            210433..210555
FT                   /gene="Pc16g00920"
FT                   /locus_tag="PCH_Pc16g00920"
FT                   /number=4
FT   intron          210556..210621
FT                   /gene="Pc16g00920"
FT                   /locus_tag="PCH_Pc16g00920"
FT                   /number=4
FT   exon            210622..211183
FT                   /gene="Pc16g00920"
FT                   /locus_tag="PCH_Pc16g00920"
FT                   /number=5
FT   mRNA            complement(join(<211736..214177,214249..>214323))
FT                   /gene="Pc16g00930"
FT                   /locus_tag="PCH_Pc16g00930"
FT   CDS_pept        complement(join(211736..214177,214249..214323))
FT                   /gene="Pc16g00930"
FT                   /locus_tag="PCH_Pc16g00930"
FT                   /note="Title: strong similarity to regulator protein qutA
FT                   -Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00930"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92763"
FT                   /db_xref="GOA:B6H6Y6"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y6"
FT                   /inference="similar to AA sequence:PIR:A26983"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP92763.1"
FT                   /translation="MDEGSDKAPRRKRVSRACDRCRSKKDKCDGIRPTCSACQASGQSC
FT                   SYDPHAKKRGLPEGYVRGLEKLWALSICNIDGFEDTMLAMLGNTAESTGRREKLMSVWS
FT                   DDSASESLHESWKTSRLFGALEKMLSNSDTPGLATGKRSRNPQDDGSDGQWGFRVARTS
FT                   TPLDPGAPRVVEPFAASPGVKRARLSKESDGRGTAASPHTLQLPPQTSQLLDIYFAVTH
FT                   SWFPVVAKHNILRASYLYANTPLSIATASPGSGDHAALWAILSYTITQSRTHSRAGPAG
FT                   TVALAKEYYAVSRNLIPTEKERYEPGHIQALLLLTLVNMGLEDWTAAWLLSGQAVRMAI
FT                   AMGLGSVSDSRRSDELRQGKAVFLGCFVVDSLLSFRLSRSPAMPPSDITAVGLLEEDGL
FT                   EEWNSWVDVLPPTGAPQGSKNPPRRGPLLALSCFNRLVELASVLNKISRHVSSGYNMAT
FT                   FAQQLVMELKQWDDCLPLGCRLIGPESIYPERHSALLPHQSYLGLTYVATLLWLYLQLI
FT                   SGEQGLHRSQRPATEGAKKLLYRGLSMLTQHLENFSMCGFPPLFELSLRTMAEQAFRLR
FT                   SIVDSSDTFPFARWTDEFRQKTAAFVSVWPAYGSLVSAVERWQHSKDVVGGLSTFPGAV
FT                   GRPFSGAPMADSMQYPGGARSLPQNGEGDYTSSILGISMPVDGQSLTPKDTVMENTDLG
FT                   MMDVSPHHPREGRSVLLDKITPRSRADSMYAAASAQHQQPQPQTPDSGASNPMIPGNIT
FT                   SAGDIDAIFKDLAYLDTTEWSTNREAGLKDFGFLDDSTFQAFCHDPDRLGASQPLVHPP
FT                   SIADIWPPPGFFPETFQEVPEESMGG"
FT   exon            complement(211736..214177)
FT                   /gene="Pc16g00930"
FT                   /locus_tag="PCH_Pc16g00930"
FT                   /number=1
FT   intron          complement(214178..214248)
FT                   /gene="Pc16g00930"
FT                   /locus_tag="PCH_Pc16g00930"
FT                   /number=1
FT   exon            complement(214249..214323)
FT                   /gene="Pc16g00930"
FT                   /locus_tag="PCH_Pc16g00930"
FT                   /number=2
FT   mRNA            complement(<215273..>216325)
FT                   /gene="Pc16g00940"
FT                   /locus_tag="PCH_Pc16g00940"
FT   CDS_pept        complement(215273..216325)
FT                   /gene="Pc16g00940"
FT                   /locus_tag="PCH_Pc16g00940"
FT                   /note="Title: strong similarity to differentially expressed
FT                   protein Sh3yl1 - Mus musculus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00940"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92764"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y7"
FT                   /inference="similar to AA sequence:GENPEPT:BC061488.1"
FT                   /inference="protein motif:PFAM:PF04366"
FT                   /inference="protein motif:COGS:COG2930"
FT                   /protein_id="CAP92764.1"
FT                   /translation="MWNKTKTYGKKGFDKGWDALDKLGAPVNRLSNKLGSEAFWPMTLD
FT                   KESEKVARILRSFCKDGVYVEDSPPVALPPGNRKENQIDRPRGKQKVLKKIPKEVIRDA
FT                   KGLVIFTAMRTGLWVSGASGSGVLIARMPETGEWSAPSGILMHTAGVGFLVGADIYDCV
FT                   MVINTYEALEAFYNVRVTLGSEVTVAAGPIGIGGVLESEVHKRRAPIWTYVKSRGFYAG
FT                   MQVDGSIIIERNDENERFYGRKVPVKDIMSGQVRTNAPGARMLTHTVHSAQGDSHFDRV
FT                   PTGVQAPTGPTPSDFAPGDLPEYSAQPPMMSGVNAAPHGPYAAPNNAPYADTHWAPNGM
FT                   NYGPGSGKQD"
FT   exon            complement(215273..216325)
FT                   /gene="Pc16g00940"
FT                   /locus_tag="PCH_Pc16g00940"
FT                   /number=1
FT   mRNA            <216712..>217245
FT                   /gene="Pc16g00950"
FT                   /locus_tag="PCH_Pc16g00950"
FT   CDS_pept        216712..217245
FT                   /gene="Pc16g00950"
FT                   /locus_tag="PCH_Pc16g00950"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1441_scaffold_7.tfa_50cg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00950"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92765"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y8"
FT                   /protein_id="CAP92765.1"
FT                   /translation="MRNKRQVFLSLHHRNSLSLGGNRQRFGYAAYHWGILISSKGPSRP
FT                   DCYAFDVSNGVVLDPVHRVNLNEEGNWHFREKVNDPDQDSLLGRVMIGKVPHEVTYAQI
FT                   RDLLESIPLPQRDALPEQNCVTWTRAAIRKLQENGLAEQFDLNRFMDESLAFADQRLHT
FT                   RSTPTSINYTTRPM"
FT   exon            216712..217245
FT                   /gene="Pc16g00950"
FT                   /locus_tag="PCH_Pc16g00950"
FT                   /number=1
FT   mRNA            join(<218357..220588,220652..>220924)
FT                   /gene="Pc16g00960"
FT                   /locus_tag="PCH_Pc16g00960"
FT   CDS_pept        join(218357..220588,220652..220924)
FT                   /gene="Pc16g00960"
FT                   /locus_tag="PCH_Pc16g00960"
FT                   /note="Title: strong similarity to negative regulator qa-1S
FT                   - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00960"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92766"
FT                   /db_xref="GOA:B6H6Y9"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y9"
FT                   /inference="similar to AA sequence:PIR:S04255"
FT                   /inference="protein motif:PFAM:PF01202"
FT                   /inference="protein motif:PFAM:PF01487"
FT                   /inference="protein motif:PFAM:PF01488"
FT                   /inference="protein motif:COGS:COG0710"
FT                   /inference="protein motif:COGS:COG0169"
FT                   /protein_id="CAP92766.1"
FT                   /translation="MLDPKPTIPPTADAKSDIPACATKESSSPMLRPEAAPRTFAPDAS
FT                   LVLIGIRGCGKRSLGFVAATALKRRFITEDHYFREVTGITRQEYLKQYGSQEFQRRDIE
FT                   VLKMMLDNHRTGCVVECGLASLTRPVQDHLRRYARSNPVVHLLRDIDRIQQLLGLEDQA
FT                   VRLFREGDPMHRICSNFEFYNLEDRTRTSDDGSPDRRSADYSFKLQEVKEDFTRFVQFI
FT                   TGLDVNYSSYDSPFVLLETPPELRSFTHAIFVRSSDLIVDNVNLTELESGGDAIELCVD
FT                   RWSPDMAATISKQVSVLRRNARTPVILSVDVSCIGTGSPEPATSSSRLYFDILEHGLRL
FT                   GVEYLVVDLTQDRSGLAATIRSRGNTKIIGQQVFEPSSPTTWDSAGCVAVYDEAEKLGC
FT                   QLVRLLRVATKREENAAVIEFSNKIRSLPGDHPPLIAYNIGSLGRTSQVFNSILTAVTH
FT                   PAITQSAENKHDPQITSRDAVRALFQSYVLDPLKFYIYGENVAYSLSPAMHNAAHQHCG
FT                   MGHTYSIPDSPSLAVLDRLGRDPHFGGSSVVQPWRVQVYQKLASKSRHAEAIGAINTIM
FT                   PLRGHEDGTMFPLQEQASRRNQAGRVLGWYGENTDWVGIMTCIRRHLSPRNAISAKTTG
FT                   LVIGAGGMARAAIYAMLRLGCRKIFIYNRTQSRAEEVARHFNSWASSQVDSTEVVRVLQ
FT                   SLQEDWPAGVAQPSLIASCVPADPDRDEPPANFEMPVQWLGSPTGGVILELAYKPLDTP
FT                   LLRQMRRVRSETGRPWVLSDGLENVTEQGIAQFELMTGRKAPRRLMTYEVLRNYVGDNG
FT                   RFDEKTIQARLDGVGSPMTGKE"
FT   exon            218357..220588
FT                   /gene="Pc16g00960"
FT                   /locus_tag="PCH_Pc16g00960"
FT                   /number=1
FT   intron          220589..220651
FT                   /gene="Pc16g00960"
FT                   /locus_tag="PCH_Pc16g00960"
FT                   /number=1
FT   exon            220652..220924
FT                   /gene="Pc16g00960"
FT                   /locus_tag="PCH_Pc16g00960"
FT                   /number=2
FT   mRNA            join(<221215..221309,221366..>222101)
FT                   /gene="Pc16g00970"
FT                   /locus_tag="PCH_Pc16g00970"
FT   CDS_pept        join(221215..221309,221366..222101)
FT                   /gene="Pc16g00970"
FT                   /locus_tag="PCH_Pc16g00970"
FT                   /note="Title: similarity to hypothetical protein B14D6.5
FT                   -Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00970"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92767"
FT                   /db_xref="GOA:B6H6Z0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z0"
FT                   /inference="similar to AA sequence:PIR:T49505"
FT                   /protein_id="CAP92767.1"
FT                   /translation="MPGFSPEQPDSITATWKKRKWDHEESRTLARPPTYVPSYRVDRPE
FT                   YDGSCSLPLSRHPDGTDISFRPRCLPRKRRHVQGPYLTLPSHQHQHQHQLQQPHGLQHQ
FT                   QSPTHLSPNIYGTPNQDPYSPPVSPKTLVPLHYPTQQSASPSALRPCHICHRRPTTRQV
FT                   LDAYADCDLCHERACFICLRQCDSASCGGAFGLSKDSSIHMHMHSGSTDDASYDASEAA
FT                   RRKICSGCAVEEVTDTGAEIVRCLDCVRGAGSWAAATIPSDWALDDMQHEDMTG"
FT   exon            221215..221309
FT                   /gene="Pc16g00970"
FT                   /locus_tag="PCH_Pc16g00970"
FT                   /number=1
FT   intron          221310..221365
FT                   /gene="Pc16g00970"
FT                   /locus_tag="PCH_Pc16g00970"
FT                   /number=1
FT   exon            221366..222101
FT                   /gene="Pc16g00970"
FT                   /locus_tag="PCH_Pc16g00970"
FT                   /number=2
FT   mRNA            complement(join(<222684..223252,223311..>223815))
FT                   /gene="Pc16g00980"
FT                   /locus_tag="PCH_Pc16g00980"
FT   CDS_pept        complement(join(222684..223252,223311..223815))
FT                   /gene="Pc16g00980"
FT                   /locus_tag="PCH_Pc16g00980"
FT                   /note="Title: strong similarity to hypothetical 32.0k
FT                   protein - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00980"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92768"
FT                   /db_xref="GOA:B6H6Z1"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="InterPro:IPR038887"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z1"
FT                   /inference="similar to AA sequence:PIR:JC4256"
FT                   /inference="protein motif:COGS:COG0020"
FT                   /protein_id="CAP92768.1"
FT                   /translation="MVSQRDREILRDDLRARGTKLSAAERESLLKGYLPDPAELGTKPA
FT                   PQPTASERRKAQRKTPIRTFLKSQTHYLAYAFTHIIFGIVVRLLQAYHAVVDRIFAIVY
FT                   HHHRTPELIRKDVKNLKRLPQHLSTILTLRKEDDALAVLMDEVAELAAWSSCSGISQLS
FT                   VYEKSGVLKSCIPTLHQIITTKLASYYGTPSHQPILQVFAPHHPVHRSAPISNTTDNTA
FT                   QHQTLTILLLSSTDGRETLVDLTKTLAEMSQNGKLSPEDITPDLVDAEISEITTQPLSM
FT                   DPSLPDTVLKPEPDLLLVFGPFLKLDGYPPWQLRLTEMYCTGGRSHGLSGDGEAVEYQG
FT                   YMRGLWHFAGAQMRFGR"
FT   exon            complement(222684..223252)
FT                   /gene="Pc16g00980"
FT                   /locus_tag="PCH_Pc16g00980"
FT                   /number=1
FT   intron          complement(223253..223310)
FT                   /gene="Pc16g00980"
FT                   /locus_tag="PCH_Pc16g00980"
FT                   /number=1
FT   exon            complement(223311..223815)
FT                   /gene="Pc16g00980"
FT                   /locus_tag="PCH_Pc16g00980"
FT                   /number=2
FT   mRNA            <224209..>226896
FT                   /gene="Pc16g00990"
FT                   /locus_tag="PCH_Pc16g00990"
FT   CDS_pept        224209..226896
FT                   /gene="Pc16g00990"
FT                   /locus_tag="PCH_Pc16g00990"
FT                   /note="Title: strong similarity to exocytosis protein Sec10
FT                   - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g00990"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92769"
FT                   /db_xref="GOA:B6H6Z2"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="InterPro:IPR033960"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z2"
FT                   /inference="similar to AA sequence:PIR:S68482"
FT                   /protein_id="CAP92769.1"
FT                   /translation="MDNASINTSSARTVFPQGPSFTLEDFSSRDFIVKEFIESLSDAAI
FT                   SSRRSLAGLAGAANQPFDPKPLIRTFESAQRRLSELSGDLELRENELSAAVRRAEAQHG
FT                   QNLNTLGQKLRHTIENFQQLDTSLNAPGRENPAGTGNMAVETGKRLEELDRQRRRALDA
FT                   HFLIQCWDGVCNRGEISLLESLRRSGTGEAKVRSAHIARQLLRISQRLDPQSWQEHRVR
FT                   PNGGYGNSSSSEDLSESSTPRRNTREIIEKFSETLEKDLLKQFDDFYRKANFDGMRDCA
FT                   TVLQDFNGGASVIALFVNQHQFFIERSQLVTEEVGGDPESWEKLADPDAELPGVESSLQ
FT                   SLIDEVKVVVQDESAIIRRAFPYYEQVLGKFLQRVFQQSIQQRLEMVLEKAAGVSSLAF
FT                   LRCLQSSRGYIGALIEDLKSHGLTEHPEPVSSQTAILLDQQLEELFVPYFVGSSYIERE
FT                   KRTLEELFNAVLFKFTSYHARRKKAATTFMASLSRAGSELLSTTRDAFISRLDSPEVSP
FT                   IQRKVLLGVAKVGDTLETTRLTEIKLTEEDGQPNLGDAKRMLKWLAEAVGRGLELSVNS
FT                   DTPKDVSALLNLLLLAMGEGYVDVCLDAALEAATSQESSKAEPDFSYLFSARTTISITT
FT                   LMVMCIHAVLLPLSAASITTRRDMEKRTSQTTSRIEDKINTIEQKTIDATFAWVSRLLS
FT                   GQKKNDFRPRESDNTAWLEMLHTPVRSIQHSTLKKALLIPRQTCASITSFLTRLHNIAR
FT                   TSLPSSGANVRQVLTEIALGIRGLLLEHFKRFSVSGPGGLMVTKDMTQYADLFRSWDID
FT                   EETKGPGGALDVLLEVGSLFVIGPEALRERIRGGAASGTTGGSGGPGRNPTQEGKLSVQ
FT                   EVRAYVSRREDSNTFAMQQVLNAL"
FT   exon            224209..226896
FT                   /gene="Pc16g00990"
FT                   /locus_tag="PCH_Pc16g00990"
FT                   /number=1
FT   mRNA            join(<227898..227942,228073..228194,228252..228277,
FT                   228319..228375,228412..228455,228591..228716,
FT                   228844..228869,229059..229122,229168..229179,
FT                   229657..229696,229817..229959,229994..>230056)
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT   CDS_pept        join(227898..227942,228073..228194,228252..228277,
FT                   228319..228375,228412..228455,228591..228716,
FT                   228844..228869,229059..229122,229168..229179,
FT                   229657..229696,229817..229959,229994..230056)
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01000"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92770"
FT                   /db_xref="UniProtKB/TrEMBL:B6H702"
FT                   /protein_id="CAP92770.1"
FT                   /translation="MDSYCRLCPPLITTLLVGVEWKNVLQHGDVLSSTYNRNGAKEKRG
FT                   AIIQDRQRVELIPVRPRSHIITRTSQKVLELARTVIIQSYRFTSSKTGGGPPSLSIPSL
FT                   ESVHSLVSGPSAPTIRDLHVCGLLSRVPGQFGFTDPRFSMLFFIFESPTLDQEQANYLA
FT                   EYYLPTSLLPWAGRHSPGELPILEVRDLEGLKWPHRITYSASYGTSSFGTDSHPHYNYE
FT                   IEYHQPTRDKQLEEGTMAITTLDFCGSYGSSSA"
FT   exon            227898..227942
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=1
FT   intron          227943..228072
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=1
FT   exon            228073..228194
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=2
FT   intron          228195..228251
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=2
FT   exon            228252..228277
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=3
FT   intron          228278..228318
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=3
FT   exon            228319..228375
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=4
FT   intron          228376..228411
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=4
FT   exon            228412..228455
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=5
FT   intron          228456..228590
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=5
FT   exon            228591..228716
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=6
FT   intron          228717..228843
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=6
FT   exon            228844..228869
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=7
FT   intron          228870..229058
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=7
FT   exon            229059..229122
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=8
FT   intron          229123..229167
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=8
FT   exon            229168..229179
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=9
FT   intron          229180..229656
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=9
FT   exon            229657..229696
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=10
FT   intron          229697..229816
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=10
FT   exon            229817..229959
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=11
FT   intron          229960..229993
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=11
FT   exon            229994..230056
FT                   /gene="Pc16g01000"
FT                   /locus_tag="PCH_Pc16g01000"
FT                   /number=12
FT   mRNA            join(<230820..231078,231170..231551,231603..232521,
FT                   232582..>233070)
FT                   /gene="Pc16g01010"
FT                   /locus_tag="PCH_Pc16g01010"
FT   CDS_pept        join(230820..231078,231170..231551,231603..232521,
FT                   232582..233070)
FT                   /gene="Pc16g01010"
FT                   /locus_tag="PCH_Pc16g01010"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An01g12020 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92771"
FT                   /db_xref="GOA:B6H703"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6H703"
FT                   /inference="protein motif:COGS:COG1215"
FT                   /inference="protein motif:COGS:COG0463"
FT                   /protein_id="CAP92771.1"
FT                   /translation="MAEENPRKSIVEDVFIPKELLTTAKFNSPWELARWEQSLPDNDRI
FT                   ISLPEPRTSSNRPLSLSALRSVARPKSAIRSRGRSDPPAFQGTFDYFEKPATFEPPSPI
FT                   PEKGQVTPVQNALLSPQPLSKTSSQTISSEQSHLQEVYEKAKLRGVAIQRKHWVRLLFE
FT                   YSIYALLVLFVYFVLVGMPLWKGAVWWLYWVVRTKFVITGGYAIIIGLAALYAFCPLLI
FT                   LFEKDPPAPDSESESESPDLENNISKVKSTALLIPCYKSASIVGATLEAALKIFPKENI
FT                   FVIANGNSKTPLDNTEEVCKPYGVNHLWVPIGSKIVAQFVGCYAAKDFENAVLIDDDCL
FT                   LPPNFPIVSDRLKKNVKCIGYTIKSVGPNSSKGTFCQQAQDLEYKMSGLQRDFFGKFGS
FT                   ATFPHGAISLWNIEFLKQTFHEHPGFSVSEDWFFGDACRRLGGRITMCSQVFVETETPA
FT                   SVFWSGSGGSRGGFGEMTIFQQRFKRWNFFFVVGVYYDLKYILTSWKLGWWEFGAKLCV
FT                   FQEVYETLIYLFAPFILPISFIVRPSFCGMLLGVTIAMYILNVIIFNEIHLRLKKERVD
FT                   WKVLLFYYTFYKIALTVVNVFSCYWSLYKYARYFAQRHPKVIEDRDAVEVILSLEKESI
FT                   SRRTSVEDDVIPLDGALGRGVGRKLTLTKVQTGKRKMTEESEKGGWV"
FT   exon            230820..231078
FT                   /gene="Pc16g01010"
FT                   /locus_tag="PCH_Pc16g01010"
FT                   /number=1
FT   intron          231079..231169
FT                   /gene="Pc16g01010"
FT                   /locus_tag="PCH_Pc16g01010"
FT                   /number=1
FT   exon            231170..231551
FT                   /gene="Pc16g01010"
FT                   /locus_tag="PCH_Pc16g01010"
FT                   /number=2
FT   intron          231552..231602
FT                   /gene="Pc16g01010"
FT                   /locus_tag="PCH_Pc16g01010"
FT                   /number=2
FT   exon            231603..232521
FT                   /gene="Pc16g01010"
FT                   /locus_tag="PCH_Pc16g01010"
FT                   /number=3
FT   intron          232522..232581
FT                   /gene="Pc16g01010"
FT                   /locus_tag="PCH_Pc16g01010"
FT                   /number=3
FT   exon            232582..233070
FT                   /gene="Pc16g01010"
FT                   /locus_tag="PCH_Pc16g01010"
FT                   /number=4
FT   mRNA            join(<234899..234943,235350..>236765)
FT                   /gene="Pc16g01020"
FT                   /locus_tag="PCH_Pc16g01020"
FT   CDS_pept        join(234899..234943,235350..236765)
FT                   /gene="Pc16g01020"
FT                   /locus_tag="PCH_Pc16g01020"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   B16B8.140 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92772"
FT                   /db_xref="UniProtKB/TrEMBL:B6H704"
FT                   /inference="similar to AA sequence:TREMBLNEW:BX842634.14"
FT                   /protein_id="CAP92772.1"
FT                   /translation="MSEDFESLPPAVRRKFFSNVERLRIRLAQSDHGSPTCSTSNYQTD
FT                   NRVYRAPRLGDYHSRGLRTGSRKRGLEKRSSPSKKLRKPGSLQLAYLAAQADSQCFHSL
FT                   PAKIQQKLFSPEERRRLRNAYRQSLIYDAADEAYRRDSGRDSRKSRPSIDTHPSQTIVP
FT                   VVQPSTAFYSDSDSDDEDPNMDQTFHDSFRWLDEDGDLDLSLDEYHAHVADAATKKRTR
FT                   PSFRRSLSFSNHLRKTLEITPTSTRGLPPVSQSQPLTPLSNRTSESRPSSNHRFQHGPK
FT                   SSTSSIDPCAQYYQDPDARLKLRVYLASPQKFDEAIEFGFPSLDQNNKENIGPEPTTPK
FT                   PSSPKFTLVDWDFGTFFEDDDGTMVGSPGGSVENEPIRSPVLTQRDAPRPSMESSALFQ
FT                   RRQSWLPGAKGVPQRLPGNREMTLKMTLTRPDLRTDSPTPPASSKEKEDPLRLAELPPA
FT                   DRSQSIWDSDLDERGVVRKMWRKLRRRV"
FT   exon            234899..234943
FT                   /gene="Pc16g01020"
FT                   /locus_tag="PCH_Pc16g01020"
FT                   /number=1
FT   intron          234944..235349
FT                   /gene="Pc16g01020"
FT                   /locus_tag="PCH_Pc16g01020"
FT                   /number=1
FT   exon            235350..236765
FT                   /gene="Pc16g01020"
FT                   /locus_tag="PCH_Pc16g01020"
FT                   /number=2
FT   mRNA            join(<237423..241267,241326..>241950)
FT                   /gene="Pc16g01030"
FT                   /locus_tag="PCH_Pc16g01030"
FT   CDS_pept        join(237423..241267,241326..241950)
FT                   /gene="Pc16g01030"
FT                   /locus_tag="PCH_Pc16g01030"
FT                   /note="Title: strong similarity to carboxypeptidase
FT                   Y-sorting protein like protein An03g06880 - Aspergillus
FT                   niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92773"
FT                   /db_xref="GOA:B6H711"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031777"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H711"
FT                   /protein_id="CAP92773.1"
FT                   /translation="MIPRWLLLTLSLLLVWASHPAAAKGNEPNIVTHELDAPPADLFYF
FT                   HGTNTILYRDRRSLTAHVSFDGGEEWETVKGNDGTIEGTVDLIWRHPFDDNRAYILGEN
FT                   GKHWITTDQAKSWRPFQVDVLPFASMRSFPLEFNGWDPKKVIFMGLDCTILGCLPQTFY
FT                   TTDDFETVKPLREMTLQCMWAASRPQFALDIDMPKSTGDRILCVVPGLKGPFEHTRTER
FT                   LIYSDSFFKDDAEGTEAKLDHGKPLSGVSLQIRSVSKYIVARLQSRGTQEQALYVSDDS
FT                   NVWHRAEFGKHRIEEDAYTILESTNYSIQIDVQTTWQDNRMGSLFSSNSNGTYFTQNIE
FT                   HTNEDLNGLVDFERVTGIHGITIVNTVKNWEEAKKSDSNKKKLISSISFDDGRTFQPLK
FT                   ADKDELHLHSMTTYAALHEMPLPDHRMFSSPAPGLVMGVGNTGGHLEDYSKGDLYVSDN
FT                   AGLTWRRALKGPHRYEFGDQGGVITAVLDSSQTDKVQFSIDHGKEWESISLGQKIRPLF
FT                   LVSTPDSTSLKFLLVGTSSDDTTKTLMFFIDFDGLHERECGSGDLEEWTARLNEKGEPD
FT                   CLMGQKQFFQRRKANADCFIKKEFAISGPEFQLCKCSAEDFECDYNFVRSEDRKECVPA
FT                   VPLTPPAGKCKDPSDKYMGPSGWRLIPGNACIREGGEDLEREIERSCSNVTGPPLITDG
FT                   KPRAGKPQTISAKWTNYFYLERQASNNGVDETIMMLTDKYELHVSRDHGRNWKQIHPDE
FT                   KFIEMVQHPYFSDTAFFLTDGKRVYYTINHGDSFHFFDAPSVPNKEYIRKLAFHEKFQD
FT                   SLIWIGHKDCEGKNCRSQAYVTDKRGASWEPMLIGIADGGCNFGYQEGRNNSEKLVICE
FT                   QYKDEEKNNNRQLVISDDYFSTMEVKFENIARSATKNGFEVVAWYEGDQKEYLNASVSV
FT                   DGRTYANAHFPFNIKVPQYTVLPSSPHALFLLVMVNGGGERSFGSLVKSNSNGTYFVQS
FT                   LEGLNVNDRGYTDYDELQGLEGVAIANVVSNREEVLNKGAAKKLRTMITHNDGGQWMLL
FT                   APPSKDVDGKNFDCSVTEGKGTEKCALHFHGYTERRDYRDTLYSGSAIGLMLALGNVGE
FT                   HLTSASEADTYLTRDGGISWTQVKKGQYMWEFGAAGSVIVLVSDRKATKVVHYTLDEGM
FT                   SWHEFQFAEKELVIDDISTVPSDTSKKFLLWGIDGGKRVIVTLDFSGIWSRDCNDDESD
FT                   YYNWAPTHPFQEENCIFGHVEEYHRKKPAAECWNAWREPHIHSIGRNCTCTRADFECDY
FT                   NYEIQTDGSCGLVPGLQPQDHVAQCSQDPDKVEYWEPTGYRRIPQTTCEGGLLLDQDVS
FT                   KPCPNKEEEYQKKHGISGTGLFFAIVTPIAVAVAVGWYAYTHWDGKFGQIRLGDSGGSQ
FT                   SWLSRDSMLVAVPVALIAGIVAVAQSLPLLVKSLARSSSGLFGRRGMQRPYATRGSFAA
FT                   RRGDYSSVVDDEDELLGADDFDDEEDQA"
FT   sig_peptide     237423..237491
FT                   /gene="Pc16g01030"
FT                   /locus_tag="PCH_Pc16g01030"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            237423..241267
FT                   /gene="Pc16g01030"
FT                   /locus_tag="PCH_Pc16g01030"
FT                   /number=1
FT   mat_peptide     join(237492..241267,241326..241947)
FT                   /gene="Pc16g01030"
FT                   /locus_tag="PCH_Pc16g01030"
FT   intron          241268..241325
FT                   /gene="Pc16g01030"
FT                   /locus_tag="PCH_Pc16g01030"
FT                   /number=1
FT   exon            241326..241950
FT                   /gene="Pc16g01030"
FT                   /locus_tag="PCH_Pc16g01030"
FT                   /number=2
FT   mRNA            complement(join(<242314..242512,242581..242666,
FT                   242787..242920,243017..>243092))
FT                   /gene="Pc16g01040"
FT                   /locus_tag="PCH_Pc16g01040"
FT   CDS_pept        complement(join(242314..242512,242581..242666,
FT                   242787..242920,243017..243092))
FT                   /gene="Pc16g01040"
FT                   /locus_tag="PCH_Pc16g01040"
FT                   /note="unknown EC_number=3.5.4.5"
FT                   /note="Title: strong similarity to cytidine deaminase -Homo
FT                   sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92774"
FT                   /db_xref="GOA:B6H713"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B6H713"
FT                   /inference="similar to AA sequence:TREMBL:BC054036.1"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /inference="protein motif:COGS:COG0295"
FT                   /protein_id="CAP92774.1"
FT                   /translation="MAHTITAQELTTLSTKAIDAKATAYCPYSKFRVGACILTASGEFI
FT                   TGANVENASYPVGTCAERVTIGAAIVAGHRDFKALAVATDIKPAASPCGMCRQFIREFT
FT                   SPSFPVYMYDGEGNHKVMTMEEVGFLSFFSFLFGYISVLYLVDSLLISPVAPRLFRPQP
FT                   S"
FT   exon            complement(242314..242512)
FT                   /gene="Pc16g01040"
FT                   /locus_tag="PCH_Pc16g01040"
FT                   /number=1
FT   intron          complement(242513..242580)
FT                   /gene="Pc16g01040"
FT                   /locus_tag="PCH_Pc16g01040"
FT                   /number=1
FT   exon            complement(242581..242666)
FT                   /gene="Pc16g01040"
FT                   /locus_tag="PCH_Pc16g01040"
FT                   /number=2
FT   intron          complement(242667..242786)
FT                   /gene="Pc16g01040"
FT                   /locus_tag="PCH_Pc16g01040"
FT                   /number=2
FT   exon            complement(242787..242920)
FT                   /gene="Pc16g01040"
FT                   /locus_tag="PCH_Pc16g01040"
FT                   /number=3
FT   intron          complement(242921..243016)
FT                   /gene="Pc16g01040"
FT                   /locus_tag="PCH_Pc16g01040"
FT                   /number=3
FT   exon            complement(243017..243092)
FT                   /gene="Pc16g01040"
FT                   /locus_tag="PCH_Pc16g01040"
FT                   /number=4
FT   mRNA            join(<243613..243667,243720..>244396)
FT                   /gene="Pc16g01050"
FT                   /locus_tag="PCH_Pc16g01050"
FT   CDS_pept        join(243613..243667,243720..244396)
FT                   /gene="Pc16g01050"
FT                   /locus_tag="PCH_Pc16g01050"
FT                   /note="unknown EC_number=3.1.2.15"
FT                   /note="Title: strong similarity to ubiquitin thiolesterase
FT                   L3 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92775"
FT                   /db_xref="GOA:B6H714"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR036959"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B6H714"
FT                   /inference="similar to AA sequence:PIR:A40085"
FT                   /inference="protein motif:PFAM:PF01088"
FT                   /protein_id="CAP92775.1"
FT                   /translation="MFNLGVQVINGQKTFIPLENNPEVHTHLCKNLGVSPSLTFHDILS
FT                   TTPEMLSWIPRPVNALILLCDKPIYLAARSRVEHSIPEYLGSGADEPVLWMKQTIGHAC
FT                   GLMALLHVVTNLENGKYVLAGSELEKIVKRAVGLGPVERARLLYDSRFLEEAHMDAASE
FT                   GSSIVPLPQEECGFHFIAFVKKDGKVWELNGGMNGPLLRGELEGDLLGEEGLDMTVREF
FT                   LSAADTEVHRGMSIIAVNNTM"
FT   exon            243613..243667
FT                   /gene="Pc16g01050"
FT                   /locus_tag="PCH_Pc16g01050"
FT                   /number=1
FT   intron          243668..243719
FT                   /gene="Pc16g01050"
FT                   /locus_tag="PCH_Pc16g01050"
FT                   /number=1
FT   exon            243720..244396
FT                   /gene="Pc16g01050"
FT                   /locus_tag="PCH_Pc16g01050"
FT                   /number=2
FT   mRNA            join(<244675..244911,244973..>245623)
FT                   /gene="Pc16g01060"
FT                   /locus_tag="PCH_Pc16g01060"
FT   CDS_pept        join(244675..244911,244973..245623)
FT                   /gene="Pc16g01060"
FT                   /locus_tag="PCH_Pc16g01060"
FT                   /note="Title: strong similarity to hypothetical protein 4
FT                   -Streptomyces coelicolor"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92776"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H715"
FT                   /inference="similar to AA sequence:PIR:S18542"
FT                   /inference="protein motif:COGS:COG1088"
FT                   /inference="protein motif:COGS:COG1087"
FT                   /inference="protein motif:COGS:COG0451"
FT                   /protein_id="CAP92776.1"
FT                   /translation="MTSILVTGATGKQGGSLINNLLKKNASFKILAVTRDINSASAKEL
FT                   AQKSSSITLIQGNLDDPAAIFKNAERVWGVFSVQTTNPRNDDERRQGIALIDESIKQGV
FT                   KHFVYSSVDRGGEKSDRNPTAIPHFIFKHEIEKHLMEKAKGTDMQWTILRPVAFFENFT
FT                   PDYFGKVFTTAWQMTLKGKPLQLIATSDIGFFAARAFMNTGESKNRAFSLAGDELTFEQ
FT                   MSEIFKDLTGKNVPTTFRIPVWLMMAAVKDLGVMFRWFRDEGYGADVPAVKRLNPSLKT
FT                   FGDWLKEDSQFETL"
FT   exon            244675..244911
FT                   /gene="Pc16g01060"
FT                   /locus_tag="PCH_Pc16g01060"
FT                   /number=1
FT   intron          244912..244972
FT                   /gene="Pc16g01060"
FT                   /locus_tag="PCH_Pc16g01060"
FT                   /number=1
FT   exon            244973..245623
FT                   /gene="Pc16g01060"
FT                   /locus_tag="PCH_Pc16g01060"
FT                   /number=2
FT   mRNA            complement(join(<245744..247219,247276..>247671))
FT                   /gene="Pc16g01070"
FT                   /locus_tag="PCH_Pc16g01070"
FT   CDS_pept        complement(join(245744..247219,247276..247671))
FT                   /gene="Pc16g01070"
FT                   /locus_tag="PCH_Pc16g01070"
FT                   /note="Title: similarity to hypothetical transcription
FT                   activator SPAC139.03 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92777"
FT                   /db_xref="GOA:B6H709"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H709"
FT                   /inference="similar to AA sequence:PIR:T37604"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP92777.1"
FT                   /translation="MSDVERNISASSSGQLNKRSCLRCSQRKVRCDKVHPCSICVKAGV
FT                   QCTFPGPKRTRQTLNRPPVSELLTRLKHLEEEVEQLRSTRCHPDTDHTDLDDDPNLQKT
FT                   VKKTELLVLKEGKSRYVSDEASVALGQKISELRDIIESPSDDEPYSLDATYNPTILVEG
FT                   GILGDHDFTWSLDYFRLHYFQPARMDALWRTYQENVAPLIVILHQATMARIVQDACAGS
FT                   DLSPSDEALLFSVCYAAVASMKAHICPSVLDVDRDTAIQDCRRAVSQGLRRANFISSQS
FT                   LSALQAAVLFLLCYRVGGDTRLVWAESAVVIRVAQAQGVHRDGRNFALPPFETEMRRRL
FT                   WWHICMLDMLSSGDQGVDTQIRPEMFDTQFPSNIDDDDIALCMTDWPLPKTGFTNITIC
FT                   IMTCQIMTGILWPRQCGYSDMSTHDRENLVTALGKRLHEQYIDHFNLDIPIHWVVATVV
FT                   RLQLSKAWLATQFQSGASDVKSFRHDDRVFETALELAQFSYLLHTNEGTPQWSWLCTSF
FT                   KEWHVVAFILSELCLRPLSPETDHAWDVVTKIYSSWQHDMPRTDAMLQKPLDRLMARTA
FT                   ASRASRQEQDGQAPFSQEALSDEFLGLGDTDSGLLFSGLDWLSGSLF"
FT   exon            complement(245744..247219)
FT                   /gene="Pc16g01070"
FT                   /locus_tag="PCH_Pc16g01070"
FT                   /number=1
FT   intron          complement(247220..247275)
FT                   /gene="Pc16g01070"
FT                   /locus_tag="PCH_Pc16g01070"
FT                   /number=1
FT   exon            complement(247276..247671)
FT                   /gene="Pc16g01070"
FT                   /locus_tag="PCH_Pc16g01070"
FT                   /number=2
FT   mRNA            complement(join(<248410..249270,249327..>249425))
FT                   /gene="Pc16g01080"
FT                   /locus_tag="PCH_Pc16g01080"
FT   CDS_pept        complement(join(248410..249270,249327..249425))
FT                   /gene="Pc16g01080"
FT                   /locus_tag="PCH_Pc16g01080"
FT                   /note="Title: weak similarity to hypothetical mitochondrial
FT                   transport protein Arg11 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92778"
FT                   /db_xref="GOA:B6H710"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:B6H710"
FT                   /inference="protein motif:PFAM:PF00153"
FT                   /protein_id="CAP92778.1"
FT                   /translation="MAAEHAIISEPMELPSLPPNQGLEAMKDIIFGSSAGMAGKLIEYP
FT                   FDTVKVRLQSQPEHLPLRYTGPLDCFRQSFRADGLRGLYRGISAPMTGAAVETSCLFFS
FT                   YRLIQDALRATVYPGVEHLPFVALIASGALSGSVTSLVLTPIELVKCRMQVPAESAGLK
FT                   PGPVAIVAGIFRHEGLAGFWRGQMGTLIRETGGSAAWFGGYEGVSSLFRKYNKSDPQFT
FT                   SDSLPIHQQMIAGATAGISYNFLFYPADTIKSRMQTVDISQLPVHAQQQTFWGETKALW
FT                   KQQGLKGMYRGCGITCARSAPSSAFIFTVYEGLRQYFG"
FT   exon            complement(248410..249270)
FT                   /gene="Pc16g01080"
FT                   /locus_tag="PCH_Pc16g01080"
FT                   /number=1
FT   intron          complement(249271..249326)
FT                   /gene="Pc16g01080"
FT                   /locus_tag="PCH_Pc16g01080"
FT                   /number=1
FT   exon            complement(249327..249425)
FT                   /gene="Pc16g01080"
FT                   /locus_tag="PCH_Pc16g01080"
FT                   /number=2
FT   gap             249792..249891
FT                   /estimated_length=unknown
FT   mRNA            join(<250273..250327,250416..250561,250731..>250871)
FT                   /gene="Pc16g01090"
FT                   /locus_tag="PCH_Pc16g01090"
FT   CDS_pept        join(250273..250327,250416..250561,250731..250871)
FT                   /gene="Pc16g01090"
FT                   /locus_tag="PCH_Pc16g01090"
FT                   /note="Title: similarity to hypothetical coiled-coil
FT                   protein cgrA - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92779"
FT                   /db_xref="GOA:B6H712"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniProtKB/TrEMBL:B6H712"
FT                   /inference="similar to AA sequence:TREMBL:AF146189.2"
FT                   /inference="protein motif:PFAM:PF03879"
FT                   /protein_id="CAP92779.1"
FT                   /translation="MSTSTATPVAPPTGMRKNGKNWHGTKKAFRPTAGLTSYAKRQELK
FT                   KHNDAVKELEREMKEEQEAERKARIQRIKDRREAKEEKLRYEKMAEKMHHKRLDRLKRR
FT                   EKRNKLLSS"
FT   exon            250273..250327
FT                   /gene="Pc16g01090"
FT                   /locus_tag="PCH_Pc16g01090"
FT                   /number=1
FT   intron          250328..250415
FT                   /gene="Pc16g01090"
FT                   /locus_tag="PCH_Pc16g01090"
FT                   /number=1
FT   exon            250416..250561
FT                   /gene="Pc16g01090"
FT                   /locus_tag="PCH_Pc16g01090"
FT                   /number=2
FT   intron          250562..250730
FT                   /gene="Pc16g01090"
FT                   /locus_tag="PCH_Pc16g01090"
FT                   /number=2
FT   exon            250731..250871
FT                   /gene="Pc16g01090"
FT                   /locus_tag="PCH_Pc16g01090"
FT                   /number=3
FT   mRNA            join(<251292..251932,252003..>252732)
FT                   /gene="Pc16g01100"
FT                   /locus_tag="PCH_Pc16g01100"
FT   CDS_pept        join(251292..251932,252003..252732)
FT                   /gene="Pc16g01100"
FT                   /locus_tag="PCH_Pc16g01100"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An03g06840 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01100"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92780"
FT                   /db_xref="GOA:B6H705"
FT                   /db_xref="UniProtKB/TrEMBL:B6H705"
FT                   /protein_id="CAP92780.1"
FT                   /translation="MEPPYKYAPFSTSRAASATFPSTQTPTRSQDQNQQASGLQSKSED
FT                   FSRFSSQESRQTDRRKSRRSRRNGSDDRQISPKGEHRIGPSPSPRSQEPSTFDSLRSNR
FT                   HKYSKSRDLRFPNPMSHLTSSASARGLLPTWSGGKDKDREGDDGLLRPITRETTRSRWG
FT                   SESTTAMSDGRKGNMLDTPGQHEQLAPICRHEILSMDDLEKVKKRRKLGEEYLRSALTS
FT                   IGTLATDVTRRLDYTYYNLLEKITALNSTISSFQDLSDSASTLLNDFEHETADLDQDIR
FT                   KQLNDLKGFEPQIQKADALEQRMKAGRQRVEELGKRLETVRHEIDNWEQRETEWQTRTS
FT                   RRLRIFWGIVISALLVLVLALVLQNWPQFWSPHPEASRLTASNHSSPSVPPQSEAWDEV
FT                   LGLAGRGSGSDAGPARYPTNLADRREGLDKAGPTSTVRSGHDAAAAKHDALSVLDEL"
FT   exon            251292..251932
FT                   /gene="Pc16g01100"
FT                   /locus_tag="PCH_Pc16g01100"
FT                   /number=1
FT   intron          251933..252002
FT                   /gene="Pc16g01100"
FT                   /locus_tag="PCH_Pc16g01100"
FT                   /number=1
FT   exon            252003..252732
FT                   /gene="Pc16g01100"
FT                   /locus_tag="PCH_Pc16g01100"
FT                   /number=2
FT   mRNA            complement(join(<252899..253323,253427..253514,
FT                   253736..253755,253822..>253879))
FT                   /gene="Pc16g01110"
FT                   /locus_tag="PCH_Pc16g01110"
FT   CDS_pept        complement(join(252899..253323,253427..253514,
FT                   253736..253755,253822..253879))
FT                   /gene="Pc16g01110"
FT                   /locus_tag="PCH_Pc16g01110"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   B24P7.10 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92781"
FT                   /db_xref="GOA:B6H706"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005873"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:B6H706"
FT                   /inference="similar to AA sequence:PIR:T50946"
FT                   /inference="protein motif:PFAM:PF01253"
FT                   /inference="protein motif:COGS:COG0023"
FT                   /protein_id="CAP92781.1"
FT                   /translation="MAEVETAPVVQARHVVYCGVCTLPPEYCEFGGTAKKCEEWLKENE
FT                   SDLWDKLYSEDALNANLSTLSVSAQERAAKDAAKKEAKAAANEARDSERKAASKILIKR
FT                   VERNKRKFVTVVIGLEVFGLENKKIAKDLGKKFATGSSVTRSPAGIEEITVQGDVSDDL
FT                   REWLLEIHGKQIPASNIELIEDKKKKKSEAPMV"
FT   exon            complement(252899..253323)
FT                   /gene="Pc16g01110"
FT                   /locus_tag="PCH_Pc16g01110"
FT                   /number=1
FT   intron          complement(253324..253426)
FT                   /gene="Pc16g01110"
FT                   /locus_tag="PCH_Pc16g01110"
FT                   /number=1
FT   exon            complement(253427..253514)
FT                   /gene="Pc16g01110"
FT                   /locus_tag="PCH_Pc16g01110"
FT                   /number=2
FT   intron          complement(253515..253735)
FT                   /gene="Pc16g01110"
FT                   /locus_tag="PCH_Pc16g01110"
FT                   /number=2
FT   exon            complement(253736..253755)
FT                   /gene="Pc16g01110"
FT                   /locus_tag="PCH_Pc16g01110"
FT                   /number=3
FT   intron          complement(253756..253821)
FT                   /gene="Pc16g01110"
FT                   /locus_tag="PCH_Pc16g01110"
FT                   /number=3
FT   exon            complement(253822..253879)
FT                   /gene="Pc16g01110"
FT                   /locus_tag="PCH_Pc16g01110"
FT                   /number=4
FT   mRNA            join(<254050..254274,254497..254562,254811..>254933)
FT                   /gene="Pc16g01120"
FT                   /locus_tag="PCH_Pc16g01120"
FT   CDS_pept        join(254050..254274,254497..254562,254811..254933)
FT                   /gene="Pc16g01120"
FT                   /locus_tag="PCH_Pc16g01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92782"
FT                   /db_xref="UniProtKB/TrEMBL:B6H707"
FT                   /protein_id="CAP92782.1"
FT                   /translation="MAAVSSGRLSQSGSYVVLNCSLWDHVTCSARNGFFNLTPSPDFWT
FT                   NVTHHDIAYHCQSLLCPTSPEWRGHVPYPPTGFRQLACVIKTLGSEAGEDRVVSSSSSR
FT                   YKGSEHKYLARAVITGLRFASTASPKNQEGFGQ"
FT   exon            254050..254274
FT                   /gene="Pc16g01120"
FT                   /locus_tag="PCH_Pc16g01120"
FT                   /number=1
FT   intron          254275..254496
FT                   /gene="Pc16g01120"
FT                   /locus_tag="PCH_Pc16g01120"
FT                   /number=1
FT   exon            254497..254562
FT                   /gene="Pc16g01120"
FT                   /locus_tag="PCH_Pc16g01120"
FT                   /number=2
FT   intron          254563..254810
FT                   /gene="Pc16g01120"
FT                   /locus_tag="PCH_Pc16g01120"
FT                   /number=2
FT   exon            254811..254933
FT                   /gene="Pc16g01120"
FT                   /locus_tag="PCH_Pc16g01120"
FT                   /number=3
FT   mRNA            complement(join(<255485..255629,255741..255807,
FT                   255852..255863,255928..255931,256094..>256195))
FT                   /gene="Pc16g01130"
FT                   /locus_tag="PCH_Pc16g01130"
FT   CDS_pept        complement(join(255485..255629,255741..255807,
FT                   255852..255863,255928..255931,256094..256195))
FT                   /gene="Pc16g01130"
FT                   /locus_tag="PCH_Pc16g01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92783"
FT                   /db_xref="UniProtKB/TrEMBL:B6H708"
FT                   /protein_id="CAP92783.1"
FT                   /translation="MTVPGFLGGFWGIGGIGEVKGKKANNKFGFKEDQEVLYLDHLDRT
FT                   INRFFSTGYASGFLVGIFEDGYYKLPTYVTGIIYGIIGVSREPGPEPMHQGLSTLVFER
FT                   ESDPF"
FT   exon            complement(255485..255629)
FT                   /gene="Pc16g01130"
FT                   /locus_tag="PCH_Pc16g01130"
FT                   /number=1
FT   intron          complement(255630..255740)
FT                   /gene="Pc16g01130"
FT                   /locus_tag="PCH_Pc16g01130"
FT                   /number=1
FT   exon            complement(255741..255807)
FT                   /gene="Pc16g01130"
FT                   /locus_tag="PCH_Pc16g01130"
FT                   /number=2
FT   intron          complement(255808..255851)
FT                   /gene="Pc16g01130"
FT                   /locus_tag="PCH_Pc16g01130"
FT                   /number=2
FT   exon            complement(255852..255863)
FT                   /gene="Pc16g01130"
FT                   /locus_tag="PCH_Pc16g01130"
FT                   /number=3
FT   intron          complement(255864..255927)
FT                   /gene="Pc16g01130"
FT                   /locus_tag="PCH_Pc16g01130"
FT                   /number=3
FT   exon            complement(255928..255931)
FT                   /gene="Pc16g01130"
FT                   /locus_tag="PCH_Pc16g01130"
FT                   /number=4
FT   intron          complement(255932..256093)
FT                   /gene="Pc16g01130"
FT                   /locus_tag="PCH_Pc16g01130"
FT                   /number=4
FT   exon            complement(256094..256195)
FT                   /gene="Pc16g01130"
FT                   /locus_tag="PCH_Pc16g01130"
FT                   /number=5
FT   mRNA            join(<256421..257010,257089..>258076)
FT                   /gene="Pc16g01140"
FT                   /locus_tag="PCH_Pc16g01140"
FT   CDS_pept        join(256421..257010,257089..258076)
FT                   /gene="Pc16g01140"
FT                   /locus_tag="PCH_Pc16g01140"
FT                   /note="Title: weak similarity to negative regulatory
FT                   protein Hex2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92784"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniProtKB/TrEMBL:B6H716"
FT                   /protein_id="CAP92784.1"
FT                   /translation="MTTLLTPRETHSPFSDPLRCPTGPTAQRYFLEDHAIPRKSPMQDD
FT                   YRARDSSPVASNLPSALPSPGFAPIPEQLAYASTLNSLSPENELALPSYDTESLHNPKG
FT                   PEDVSDASTDSHPPSWTLQAPSADDTLIEDEPSRHVDYLSHDWKEEDIWSSWRYVTSRR
FT                   NDYSNGVRLENASWRTWAKAKHNLKTVSPESLNWLKDCDVTWLYGPLKSSVERATSLSP
FT                   PPSRLETPNSYLDRKPILKKKTASEAILQRSLSQHTLLQHAGAILKAQEAENNWARPPF
FT                   PRSNTDLDHLHHRTGSSTYSLGGTLTASSSSGMTSPSERRHIHFNNEVVQCIAVEAKGY
FT                   EDDWPATFEDEPSSDDGVVLMRQISSRSSLSNCTTPRNSFNDGKTIAPLPSTTLKYRGD
FT                   PPGAQTILDRWSTPTRTLSPTPSVETIRPSEPSGQSEPSEPSANFLLDECEDPSLDFTG
FT                   NYPDRDRAWFIEDDPASGRPLRLTASGMIMPEGESESPSSSILDRVVDTVNTARDIAHV
FT                   IWNVGWRR"
FT   exon            256421..257010
FT                   /gene="Pc16g01140"
FT                   /locus_tag="PCH_Pc16g01140"
FT                   /number=1
FT   intron          257011..257088
FT                   /gene="Pc16g01140"
FT                   /locus_tag="PCH_Pc16g01140"
FT                   /number=1
FT   exon            257089..258076
FT                   /gene="Pc16g01140"
FT                   /locus_tag="PCH_Pc16g01140"
FT                   /number=2
FT   mRNA            join(<258658..258924,259016..260390,260471..>260925)
FT                   /gene="Pc16g01150"
FT                   /locus_tag="PCH_Pc16g01150"
FT   CDS_pept        join(258658..258924,259016..260390,260471..260925)
FT                   /gene="Pc16g01150"
FT                   /locus_tag="PCH_Pc16g01150"
FT                   /note="Title: similarity to hypothetical protein CG5336
FT                   -Drosophila melanogaster"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92785"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR006816"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024574"
FT                   /db_xref="UniProtKB/TrEMBL:B6H717"
FT                   /inference="similar to AA sequence:TREMBL:AE003635.6"
FT                   /inference="protein motif:PFAM:PF04727"
FT                   /protein_id="CAP92785.1"
FT                   /translation="METVNVAELVERLGSDEDAVRKMAVFKLQGNIGDPSFADIFIAEG
FT                   GLVRLRYLTLHASGNTLAYSLASFSRLLDVDKGWECVDQELVERIVELIVTHPLVNILR
FT                   GAMSILVSIVSHPYTGNRTSQVNNFGFRALKPAIAIYPQFLEMLVSRLSSADHALCANA
FT                   LQLINSLMRDSITHDPEAEWPKFIQKLQDLGVIRAVYVLMQDSALQDLAHPLLEFQSLT
FT                   KVLLRKWRDIPVNQEKPEHRRALKGIYLASNPEKNSDEATENGDSARPSRRHHPEKWRR
FT                   LGFETESPAGEFYEVGFLGMMDLADYVRSHGDEFQNMLLEHSTKPSRQRCPIARASLAV
FT                   TSILYEHFEVEKSDMDDTKTYLISESRTGFDKLFQPLLLHWTRLHVAGLQAFFRLWKAT
FT                   AAEEEDLDKLIELVRILIGSVVGGAARIKDVQDVEEELADFEYHRLRGLQMELLELTYE
FT                   DAWGQHLRQVREELHHEALQFVKEQRIRSLLQGSWFALDSHPKSESGPVQKSTATYQYA
FT                   QLSHNRRYLHFGQFDLMGDRPPELDTLPEKIDLSIVSSVVSNVSTNPDHSSTATVKTAP
FT                   RQPTTKITIHGYVPSTATGHGKGHSHARSGSRTTQKEVVLLTLRPSSHIIASEWLDGLL
FT                   MLLNQQPITAETSKLIDLVSDYGLKIRLLNVRFDDATFAGEAPQVPARDGLDEDYYYDV
FT                   FGGV"
FT   exon            258658..258924
FT                   /gene="Pc16g01150"
FT                   /locus_tag="PCH_Pc16g01150"
FT                   /number=1
FT   intron          258925..259015
FT                   /gene="Pc16g01150"
FT                   /locus_tag="PCH_Pc16g01150"
FT                   /number=1
FT   exon            259016..260390
FT                   /gene="Pc16g01150"
FT                   /locus_tag="PCH_Pc16g01150"
FT                   /number=2
FT   intron          260391..260470
FT                   /gene="Pc16g01150"
FT                   /locus_tag="PCH_Pc16g01150"
FT                   /number=2
FT   exon            260471..260925
FT                   /gene="Pc16g01150"
FT                   /locus_tag="PCH_Pc16g01150"
FT                   /number=3
FT   mRNA            join(<261254..261985,262052..>263821)
FT                   /gene="Pc16g01160"
FT                   /locus_tag="PCH_Pc16g01160"
FT   CDS_pept        join(261254..261985,262052..263821)
FT                   /gene="Pc16g01160"
FT                   /locus_tag="PCH_Pc16g01160"
FT                   /note="Title: strong similarity to protein involved in cell
FT                   cycle control rad17p - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01160"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92786"
FT                   /db_xref="GOA:B6H718"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6H718"
FT                   /inference="similar to AA sequence:PIR:S60090"
FT                   /inference="protein motif:PFAM:PF03215"
FT                   /inference="protein motif:COGS:COG0465"
FT                   /inference="protein motif:COGS:COG0466"
FT                   /protein_id="CAP92786.1"
FT                   /translation="MDGRPPKRQRRSKDSKDEPKIKPKRKPVISDSSSPIEPTEPFALS
FT                   SRPKPSYSRGTTPSTRPPSYSPSPNKKTEASPNQGPKSKSLHSFFQPATEGQRWAPQKT
FT                   EKQSLPPVRGTVDVDLIEDDYDSYDEIFTQHLANERAGMGLTAMSSSQIRQSAPKPAPK
FT                   PKAKAQVKPPRKTTKRFLLSTDRGDGTAKEPLAAQPANEPDRRPWAQRFAPANLGELAV
FT                   HKKKVSDVQHWLEDAFAGRRSERLLVLRGPAGSGKTTTVSLLSESLGYDIVEWKNPPVS
FT                   EFGARDYQSVSAHFEEFLGRGNKFGGLDLEDASELDSQKEEKPRDQRILLIEEFPTMLG
FT                   RASSALTAFRTSLQRYLAASANDHVRGSSGSNHPPIVIIVSETLLGSASSISDNMTVHR
FT                   LLGPTIYNHPGTTILDFNSIAPTFMHKALRSILDREARTSRRMQIPGPGVIDSISEIGD
FT                   IRSAISSLEFLCLKGDDTGRWGGNVAKTKKARGEVALTAMEKESLKMITQREASLGMFH
FT                   AVGKIVYNKRMDPSLIEGDVEILPPPPDYLRHYARPKASQVLVNDLADETGTDVSTFIS
FT                   ALHENYIPSCDGDDFTDCFNDCIDALSDSDILSADHRPGPGARAGIGTGITSFGSGVDV
FT                   LRQEEMSFQVAARGLLFALPYPVKRRVGPGAGRSRAGDAYKMFYPASLRLWREAEEIDG
FT                   LIDSWMNRSLDPFGQQQHLSQNGSDLSGVSSWKSLQVGRSASAYSKDKGDIPSVVTMMP
FT                   RHDLLLHQLPYMAAIRRQDPDCWQLDKITSIRVNQNLRDGIDDMEESPVPGSRMKSSSS
FT                   NGVGPRLAEEKLILSDDDIVD"
FT   exon            261254..261985
FT                   /gene="Pc16g01160"
FT                   /locus_tag="PCH_Pc16g01160"
FT                   /number=1
FT   intron          261986..262051
FT                   /gene="Pc16g01160"
FT                   /locus_tag="PCH_Pc16g01160"
FT                   /number=1
FT   exon            262052..263821
FT                   /gene="Pc16g01160"
FT                   /locus_tag="PCH_Pc16g01160"
FT                   /number=2
FT   mRNA            join(<264059..264320,264498..265182,265258..>265546)
FT                   /gene="Pc16g01170"
FT                   /locus_tag="PCH_Pc16g01170"
FT   CDS_pept        join(264059..264320,264498..265182,265258..265546)
FT                   /gene="Pc16g01170"
FT                   /locus_tag="PCH_Pc16g01170"
FT                   /note="Title: strong similarity to UPD-GlcNAc transporter
FT                   MNN2-2 - Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01170"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92787"
FT                   /db_xref="GOA:B6H719"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/TrEMBL:B6H719"
FT                   /inference="similar to AA sequence:TREMBL:AF106080.2"
FT                   /protein_id="CAP92787.1"
FT                   /translation="MLNDHEPSKRGPDDSYLINRTRVSVNPSGNTNFASKSRSRKSDEP
FT                   NYAQLKKDAPGLIAAAAHAAVPSWTSMVLMVSLIFGGCCANVELIRRPPSHIPNQIRSM
FT                   HTGPLITFAQFVLCALFTIPSFLSPSAGPRALFLNRRAIPLRSWVVYTAYFVSVNLLNN
FT                   WAFAYKISVPLHIILRSAGPVASMVIGYLYNGKRYSRGQIASVGMLTVGVAAAAIADAQ
FT                   SKGVSIHIDSDTADTATTVTGFTILALAMVLSAFQGIYADRLYATYGRDHWKEALFYSH
FT                   ALSLPLFLTSCPQLLGQWRVVASSPSLLSHLDSGWALLTQLPVQVAYLAMNALTQYLCI
FT                   RGVHLLSAKSSSLTVTIFLNVRKLVSLLLSIYLFGNHLAGGVLVGAALVFVGGGLYGFE
FT                   GARLRRVAKKAQ"
FT   exon            264059..264320
FT                   /gene="Pc16g01170"
FT                   /locus_tag="PCH_Pc16g01170"
FT                   /number=1
FT   intron          264321..264497
FT                   /gene="Pc16g01170"
FT                   /locus_tag="PCH_Pc16g01170"
FT                   /number=1
FT   exon            264498..265182
FT                   /gene="Pc16g01170"
FT                   /locus_tag="PCH_Pc16g01170"
FT                   /number=2
FT   intron          265183..265257
FT                   /gene="Pc16g01170"
FT                   /locus_tag="PCH_Pc16g01170"
FT                   /number=2
FT   exon            265258..265546
FT                   /gene="Pc16g01170"
FT                   /locus_tag="PCH_Pc16g01170"
FT                   /number=3
FT   mRNA            complement(join(<265835..266149,266211..268190,
FT                   268278..>268376))
FT                   /gene="Pc16g01180"
FT                   /locus_tag="PCH_Pc16g01180"
FT   CDS_pept        complement(join(265835..266149,266211..268190,
FT                   268278..268376))
FT                   /gene="Pc16g01180"
FT                   /locus_tag="PCH_Pc16g01180"
FT                   /note="Title: strong similarity to dynamin-related protein
FT                   Dnm1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92788"
FT                   /db_xref="GOA:B6H720"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:B6H720"
FT                   /inference="similar to AA sequence:PIR:S64742"
FT                   /inference="protein motif:PFAM:PF00350"
FT                   /inference="protein motif:PFAM:PF01031"
FT                   /inference="protein motif:PFAM:PF02212"
FT                   /inference="protein motif:COGS:COG0699"
FT                   /inference="protein motif:COGS:COG0486"
FT                   /protein_id="CAP92788.1"
FT                   /translation="MTSLGEDLLVTVNKLQDLVFNTIGNDSLDLPQIVVVGSQSSGKSS
FT                   VLENIVGRDFLPRGSGIVTRRPLILQLINVPSERDDKPETDEIHIPHTAASVAGQHEWA
FT                   EFHHLPGRKFDDFGQVKQEIEAETARIAGSNKGINRQPINLKIFSPHVLNLTLVDLPGL
FT                   TKVPIGDQPSDIEKQTRTLILEYIAKPNSIILAVSPANVDLVNSEALKLARQVDAMGRR
FT                   TIGVLSKLDLMDHGTNAMDILSGRVYPLKLGFIGVVNRSQQDIQSGKSLADALRAESEF
FT                   FRHHPAYRNMANRCGTHFLAKTLNTTLMSHIRDRLPDIKARLNTLMGQTQQELASYGNK
FT                   QFSGEEHRGSLILQQMTRFAASFISSIDGTSSEISTKELCGGARIYYIFNSVFGNSLET
FT                   IDPTHNLTVSDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLESPSQRCVELVYEEL
FT                   IKICHTCGNQELLRFPRLQGKLIEVVSDLLRERLGPCSTYVESLISIQRAYINTNHPNF
FT                   LGAAAAMSSIMQNKQDEERKAVLAEEKRKREKRRQKELGAPNGNTGGPDEEEHADKQNL
FT                   PVRSHSSKGSRSMSPHVGRTGENGIAATLNGAHSNHAAFGGGASNTARDSFLNYFFGKE
FT                   GTHNTAMSPAGMNTNRQGPHAGEPSISQSIRRAEVRAPIMPTEEYAAPPEYGGDLSAFP
FT                   HENTEPALTDREMLETELIRRLISSYFNIVRETIADQVPKAVMHLLVNHCKDVVQNRLV
FT                   SELYKEDLFGELLYEDDGIKAEREKCERLLETYKEAAKIVGEVL"
FT   exon            complement(265835..266149)
FT                   /gene="Pc16g01180"
FT                   /locus_tag="PCH_Pc16g01180"
FT                   /number=1
FT   intron          complement(266150..266210)
FT                   /gene="Pc16g01180"
FT                   /locus_tag="PCH_Pc16g01180"
FT                   /number=1
FT   exon            complement(266211..268190)
FT                   /gene="Pc16g01180"
FT                   /locus_tag="PCH_Pc16g01180"
FT                   /number=2
FT   intron          complement(268191..268277)
FT                   /gene="Pc16g01180"
FT                   /locus_tag="PCH_Pc16g01180"
FT                   /number=2
FT   exon            complement(268278..268376)
FT                   /gene="Pc16g01180"
FT                   /locus_tag="PCH_Pc16g01180"
FT                   /number=3
FT   mRNA            complement(join(<268932..269018,269089..270993,
FT                   271052..271239,271297..>271498))
FT                   /gene="Pc16g01190"
FT                   /locus_tag="PCH_Pc16g01190"
FT   CDS_pept        complement(join(268932..269018,269089..270993,
FT                   271052..271239,271297..271498))
FT                   /gene="Pc16g01190"
FT                   /locus_tag="PCH_Pc16g01190"
FT                   /note="Title: strong similarity to actin-binding protein
FT                   like protein An03g06960 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92789"
FT                   /db_xref="GOA:B6H721"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR035718"
FT                   /db_xref="InterPro:IPR035719"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:B6H721"
FT                   /inference="protein motif:PFAM:PF00241"
FT                   /inference="protein motif:PFAM:PF00018"
FT                   /protein_id="CAP92789.1"
FT                   /translation="MASLNLSSNGPSISKSYQTVVNAPPPSGNAGSPTYGQWVVYSVST
FT                   PLVSAFQQDGGKESVLKVQSTGEGELADLIEEFSEGRVQFAYVKVTDSNTGLSKNVLIG
FT                   WCGEGVPERTKGYFTSHLATVAKFLHGYHVQITARADGDLTPEGIIQRVADSSGSKYSV
FT                   GDAPAPAPAPRPVVASKPAFTPTRSGGITPSPAARVQPAPSTSDVTDDGWGADAPPVTR
FT                   TQLEKVQSAYQPTRVNLQELKANPTATRQPAATTNDSSDVVKGGYQPVGKVDIAAIRKQ
FT                   AAASGQLTDERPTIVKGSYEPVGKVDIAAIRARAQKPEGTSDNVSPSPAVNRQPATLPE
FT                   RPAPSNAASERLTTLPKPRVANKFGSSPSFPGTKPPLPTGIQPKPSSSAQIGAASRTFA
FT                   DEGGKTPAQIWAERKAKERGMASSPGSTETVSTPASIQSQTSGQGEWKSSYAGKSWAPV
FT                   QTAQEKTHIPEQPVDAKANDQQEEEPQPHVSSIHEQFAHDTPAPAPLAPPAPPVPQASR
FT                   PVPVLGLSSGPVESEPEHDVQQALPSPPPQPRSPTPPTPPVRESSPIQIAMPVGHSVAD
FT                   SVADVHEEQHSPPPAMPVHSLQEAVPDERDIEDDSHDLGRAAAEATAPQQHQQPQGGPR
FT                   AQIQYDYEKAEDNEIELREGEYVTDIEMVDPDWWVGVNTQGERGLFPANYVELLEDKEP
FT                   ASHATAGSHHYEPEPEPAAAPVPAASTPVTAAASSAATPSSKGVTATALYDYEAAEDNE
FT                   IGFPEDAKISNVEFPDDDWWLGEYNGKRGLFPANYVRLDE"
FT   exon            complement(268932..269018)
FT                   /gene="Pc16g01190"
FT                   /locus_tag="PCH_Pc16g01190"
FT                   /number=1
FT   intron          complement(269019..269088)
FT                   /gene="Pc16g01190"
FT                   /locus_tag="PCH_Pc16g01190"
FT                   /number=1
FT   exon            complement(269089..270993)
FT                   /gene="Pc16g01190"
FT                   /locus_tag="PCH_Pc16g01190"
FT                   /number=2
FT   intron          complement(270994..271051)
FT                   /gene="Pc16g01190"
FT                   /locus_tag="PCH_Pc16g01190"
FT                   /number=2
FT   exon            complement(271052..271239)
FT                   /gene="Pc16g01190"
FT                   /locus_tag="PCH_Pc16g01190"
FT                   /number=3
FT   intron          complement(271240..271296)
FT                   /gene="Pc16g01190"
FT                   /locus_tag="PCH_Pc16g01190"
FT                   /number=3
FT   exon            complement(271297..271498)
FT                   /gene="Pc16g01190"
FT                   /locus_tag="PCH_Pc16g01190"
FT                   /number=4
FT   mRNA            join(<272479..273876,274024..275144,275208..275296,
FT                   275361..>275647)
FT                   /gene="Pc16g01200"
FT                   /locus_tag="PCH_Pc16g01200"
FT   CDS_pept        join(272479..273876,274024..275144,275208..275296,
FT                   275361..275647)
FT                   /gene="Pc16g01200"
FT                   /locus_tag="PCH_Pc16g01200"
FT                   /note="unknown EC_number=3.5.4.6"
FT                   /note="Title: strong similarity to AMP deaminase Amd1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01200"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92790"
FT                   /db_xref="GOA:B6H722"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006329"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6H722"
FT                   /inference="similar to AA sequence:TREMBL:SCAMD.1"
FT                   /inference="protein motif:PFAM:PF00962"
FT                   /inference="protein motif:COGS:COG1816"
FT                   /inference="protein motif:COGS:COG0402"
FT                   /protein_id="CAP92790.1"
FT                   /translation="MGPPQPDLSSSRNANDSSNDESATSTPGLKSPMDSPLHESSDALD
FT                   QPTEDILPRDQQQKTATYDYAYEKSMSHAEARLFYQHHQLAARNDTTLPLSPVAPARSA
FT                   VELQPEEPPANITDPMNTQGQLSREGSMVLESEPSALRLQSASEPGPSASHFLEDDQDE
FT                   ANDPARNQAALLGAVYGQEPYSAAESLQSTGVGIRGPQVASGFASSGDAVTSELNAIYC
FT                   KIKKLLDRRSQYMDLSLQGPGNDPKDQPDWQIYPPPPEPAWDDGKEYQPGSLGDPSDVA
FT                   GKKRKMGQDIGEDFDMEELLPLPKESPWTYRLDGNSVYQVFDSEASADQQTPIVRIPSL
FT                   RDFYMDLDAVVDVSTDGPAKSFAFKRLSYLEGKFQLYTLLNEYQEMADSKKVPHRDFYN
FT                   VRKVDTHVHHSACMNQKHLLRFIKSKMRKSPDEVVLFRDGKHLTLREVFESINLTAYDL
FT                   SIDTLDMHAHTDSFHRFDKFNLKYNPVGESRLREIFLKTDNYIKGRYLAEITKEVISDL
FT                   ESSKYQMVEWRISIYGRSLQEWDKLAAWVVDNKLFSPNVRWLIQVPRLYDVYKASGMME
FT                   NFEQVITNVFQPLFEVTKDPSSHPKLHIFLQRVVGFDSVDDESKPERRLYRKYPIPREW
FT                   STKQNPPYTYWLYFMFANIASLNNWRKRRGFNTFVLRPHCGEAGDPDHLAVGFLCCHSI
FT                   SHGILLRKVPLLQYLYYLDQIGIAMSPLSNNALFLTYDKNPCATFFKRGLNVSLSTDDP
FT                   LQFAFTKEPLIEEYSVAAQIYKFSAVDMCELAKHSVDQSGFERSLKERWLGSNCSMPGV
FT                   AGNNVAKSNVPDIREAFRHETLLGELSLIERYSEGDVTGEQKSLAPSPPGVAVPSNHDH
FT                   HTSNLESQSELSSSAADTTDALPSETHGTNQMATSPSTPSTYLARSPRLGTGEFSSPSG
FT                   NPALGTGVGGPDGLPEQKIFPGIVHERARKGNMQ"
FT   exon            272479..273876
FT                   /gene="Pc16g01200"
FT                   /locus_tag="PCH_Pc16g01200"
FT                   /number=1
FT   intron          273877..274023
FT                   /gene="Pc16g01200"
FT                   /locus_tag="PCH_Pc16g01200"
FT                   /number=1
FT   exon            274024..275144
FT                   /gene="Pc16g01200"
FT                   /locus_tag="PCH_Pc16g01200"
FT                   /number=2
FT   intron          275145..275207
FT                   /gene="Pc16g01200"
FT                   /locus_tag="PCH_Pc16g01200"
FT                   /number=2
FT   exon            275208..275296
FT                   /gene="Pc16g01200"
FT                   /locus_tag="PCH_Pc16g01200"
FT                   /number=3
FT   intron          275297..275360
FT                   /gene="Pc16g01200"
FT                   /locus_tag="PCH_Pc16g01200"
FT                   /number=3
FT   exon            275361..275647
FT                   /gene="Pc16g01200"
FT                   /locus_tag="PCH_Pc16g01200"
FT                   /number=4
FT   mRNA            complement(<275984..>277843)
FT                   /gene="Pc16g01210"
FT                   /locus_tag="PCH_Pc16g01210"
FT   CDS_pept        complement(275984..277843)
FT                   /gene="Pc16g01210"
FT                   /locus_tag="PCH_Pc16g01210"
FT                   /note="Title: similarity to hypothetical protein B24M22.160
FT                   - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92791"
FT                   /db_xref="UniProtKB/TrEMBL:B6H723"
FT                   /protein_id="CAP92791.1"
FT                   /translation="MGHPPEAHGKPSMPTEGCRSTAKLQDLTTPYECQPISSDNGHRAL
FT                   GSALSRSQVSPRAPRRFLAQPIETVSRSSNIQQSTLSGANQSAPSKPEIHSKGPCEQRS
FT                   TRRFLPEPIETSKTSNRRSHSTYEVHERNSASQSKTSTAPRRFKPDLIESDTRSVRKGE
FT                   PVRFVQRHNAVGSSAPHTITSPDTTLWSDTKPNAPTYLPSESQFSFSSLLRRQQARRHS
FT                   FRVPDLPSIPSNSSEESDNSRSHSACTSPPGPSNKASRDLCTSELPREICDGEISEFLL
FT                   SLAARSAQIQLKEQALAAFPNEQVYEPVDHFAIDEDDGDSDDYDVSMKYHHIKSRRQSS
FT                   ADLSWELEYMRHHKEEAEMRVRAMGASGQPKSSSEHNKNGKTPPMLGSDIVLPRSDSPE
FT                   GTICEHSSTDAASRGVDDLCTGCGDLWYAAPPRGGGKGAGLWKGTCCKDDGQEREVHGL
FT                   LPGIVTPMPRVDEAGISMGLSPSPSYTNLDRFEASPGNHSSRKPASPNLQKAIESEFHD
FT                   GFVTQIYNYLSLGYPCLARYYDYELSRISGISVEDLRRDDLQTDARGYLVASGKDDLAD
FT                   ICTRWKALRLYIQEWARQEPGMAEEDTNLEGWGLPERRGSWAI"
FT   exon            complement(275984..277843)
FT                   /gene="Pc16g01210"
FT                   /locus_tag="PCH_Pc16g01210"
FT                   /number=1
FT   mRNA            join(<278369..278905,279002..>279196)
FT                   /gene="Pc16g01220"
FT                   /locus_tag="PCH_Pc16g01220"
FT   CDS_pept        join(278369..278905,279002..279196)
FT                   /gene="Pc16g01220"
FT                   /locus_tag="PCH_Pc16g01220"
FT                   /note="Title: strong similarity to nucleolus-cytoplasm
FT                   shuttle phosphoprotein like protein An14g03590 -Aspergillus
FT                   niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92792"
FT                   /db_xref="InterPro:IPR022226"
FT                   /db_xref="UniProtKB/TrEMBL:B6H724"
FT                   /protein_id="CAP92792.1"
FT                   /translation="MDSKDKRKFENDDPYPGSVSKQRKVIGPSLPPPREADAANSETSN
FT                   DDDDDDDDDFGPSLPPSGSVKGPVPPVPTVSTASSIPKPVERESQRDQWMLQPPSHSDW
FT                   SSKVDPTQLRNRKFNTGKSATAPKNMDSSWVETPEERMRRLQDTVMGVAASTNQPEDNK
FT                   GATKAKLMEDQIKRYKDMTGKNSRLETPGQAEKEDDDPSTRAFDREKDMAVASKISSAQ
FT                   RREMVKKAADYNTRFTKGNFL"
FT   exon            278369..278905
FT                   /gene="Pc16g01220"
FT                   /locus_tag="PCH_Pc16g01220"
FT                   /number=1
FT   intron          278906..279001
FT                   /gene="Pc16g01220"
FT                   /locus_tag="PCH_Pc16g01220"
FT                   /number=1
FT   exon            279002..279196
FT                   /gene="Pc16g01220"
FT                   /locus_tag="PCH_Pc16g01220"
FT                   /number=2
FT   mRNA            complement(<279781..>280620)
FT                   /gene="Pc16g01230"
FT                   /locus_tag="PCH_Pc16g01230"
FT   CDS_pept        complement(279781..280620)
FT                   /gene="Pc16g01230"
FT                   /locus_tag="PCH_Pc16g01230"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   PA0544 - Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92793"
FT                   /db_xref="GOA:B6H725"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B6H725"
FT                   /inference="similar to AA sequence:PIR:C83579"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="CAP92793.1"
FT                   /translation="MFEGILSIFDKSSASFQVLSDLHLEVNQQYSSFEIPVCAKYLVLA
FT                   GDVGRLVDYDNYRCFLQKQTDRFELVFLILGNHEFYSDTFAAGLQRARQLEQEHCLNGR
FT                   LILLHRGRYDIPGSHVTILGCTLWSRVPDEARDIVCSRIQDFKRIRDWSVNDHNRSHEA
FT                   DLAWLLSGIESIQIQSKTRSRKQSVLVVTHHAPSLQGTSSPQHANNAWSSAFATDVLSQ
FT                   ISKSSGIKFWVFGHTHYTTEFRNQGIRVVANQRGYVLPWTDSKGPKDGFDIGKVIHV"
FT   exon            complement(279781..280620)
FT                   /gene="Pc16g01230"
FT                   /locus_tag="PCH_Pc16g01230"
FT                   /number=1
FT   mRNA            complement(<282424..>284079)
FT                   /gene="Pc16g01240"
FT                   /locus_tag="PCH_Pc16g01240"
FT   CDS_pept        complement(282424..284079)
FT                   /pseudo
FT                   /gene="Pc16g01240"
FT                   /locus_tag="PCH_Pc16g01240"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to transposase Tan1
FT                   -Aspergillus niger [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT                   /inference="protein motif:PFAM:PF03184"
FT   exon            complement(282424..284079)
FT                   /gene="Pc16g01240"
FT                   /locus_tag="PCH_Pc16g01240"
FT                   /number=1
FT   mRNA            complement(<285975..>287108)
FT                   /gene="Pc16g01250"
FT                   /locus_tag="PCH_Pc16g01250"
FT   CDS_pept        complement(285975..287108)
FT                   /pseudo
FT                   /gene="Pc16g01250"
FT                   /locus_tag="PCH_Pc16g01250"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to retrotransposable element tf2
FT                   155 kd protein - Schizosaccharomyces pombe [putative
FT                   pseudogene]"
FT                   /inference="similar to AA sequence:PIR:T38401"
FT                   /inference="protein motif:COGS:COG2801"
FT   exon            complement(285975..287108)
FT                   /gene="Pc16g01250"
FT                   /locus_tag="PCH_Pc16g01250"
FT                   /number=1
FT   gap             288637..288736
FT                   /estimated_length=unknown
FT   mRNA            complement(<289228..>289818)
FT                   /gene="Pc16g01260"
FT                   /locus_tag="PCH_Pc16g01260"
FT   CDS_pept        complement(289228..289818)
FT                   /pseudo
FT                   /gene="Pc16g01260"
FT                   /locus_tag="PCH_Pc16g01260"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg11070.1 - Magnaporthe grisea [putative pseudogene]"
FT                   /inference="protein motif:COGS:COG2801"
FT   exon            complement(289228..289818)
FT                   /gene="Pc16g01260"
FT                   /locus_tag="PCH_Pc16g01260"
FT                   /number=1
FT   mRNA            <291928..>293138
FT                   /gene="Pc16g01270"
FT                   /locus_tag="PCH_Pc16g01270"
FT   CDS_pept        291928..293138
FT                   /pseudo
FT                   /gene="Pc16g01270"
FT                   /locus_tag="PCH_Pc16g01270"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to transposase Tan1
FT                   -Aspergillus niger [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT                   /inference="protein motif:PFAM:PF03184"
FT   exon            291928..293138
FT                   /gene="Pc16g01270"
FT                   /locus_tag="PCH_Pc16g01270"
FT                   /number=1
FT   mRNA            complement(<294318..>295869)
FT                   /gene="Pc16g01280"
FT                   /locus_tag="PCH_Pc16g01280"
FT   CDS_pept        complement(294318..295869)
FT                   /pseudo
FT                   /gene="Pc16g01280"
FT                   /locus_tag="PCH_Pc16g01280"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to transposase Tan1
FT                   -Aspergillus niger [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT                   /inference="protein motif:PFAM:PF05225"
FT                   /inference="protein motif:PFAM:PF03184"
FT   exon            complement(294318..295869)
FT                   /gene="Pc16g01280"
FT                   /locus_tag="PCH_Pc16g01280"
FT                   /number=1
FT   mRNA            join(<295939..296020,296055..296070,296209..296238,
FT                   296340..296352,296414..296430,296580..296616,
FT                   296972..296978,297070..297120,297323..297338,
FT                   297440..297452,297535..>297564)
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT   CDS_pept        join(295939..296020,296055..296070,296209..296238,
FT                   296340..296352,296414..296430,296580..296616,
FT                   296972..296978,297070..297120,297323..297338,
FT                   297440..297452,297535..297564)
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01290"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92799"
FT                   /db_xref="GOA:B6H726"
FT                   /db_xref="UniProtKB/TrEMBL:B6H726"
FT                   /protein_id="CAP92799.1"
FT                   /translation="MRSSLVKYVIGILGILVDFRIVAVSIINLGDRRLDFIVSYDYKSG
FT                   VRAIYPDSLYSRTIIKKLREVKDILGILVDFRAVAASIIIFSNYKSGVRVGFVLGRLS"
FT   exon            295939..296020
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=1
FT   intron          296021..296054
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=1
FT   exon            296055..296070
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=2
FT   intron          296071..296208
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=2
FT   exon            296209..296238
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=3
FT   intron          296239..296339
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=3
FT   exon            296340..296352
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=4
FT   intron          296353..296413
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=4
FT   exon            296414..296430
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=5
FT   intron          296431..296579
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=5
FT   exon            296580..296616
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=6
FT   intron          296617..296971
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=6
FT   exon            296972..296978
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=7
FT   intron          296979..297069
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=7
FT   exon            297070..297120
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=8
FT   intron          297121..297322
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=8
FT   exon            297323..297338
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=9
FT   intron          297339..297439
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=9
FT   exon            297440..297452
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=10
FT   intron          297453..297534
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=10
FT   exon            297535..297564
FT                   /gene="Pc16g01290"
FT                   /locus_tag="PCH_Pc16g01290"
FT                   /number=11
FT   gap             297582..297681
FT                   /estimated_length=unknown
FT   mRNA            <297739..>298173
FT                   /gene="Pc16g01300"
FT                   /locus_tag="PCH_Pc16g01300"
FT   CDS_pept        297739..298173
FT                   /pseudo
FT                   /gene="Pc16g01300"
FT                   /locus_tag="PCH_Pc16g01300"
FT                   /product="hypothetical protein [putative pseudogene]"
FT                   /note="putative pseudogene"
FT   exon            297739..298173
FT                   /gene="Pc16g01300"
FT                   /locus_tag="PCH_Pc16g01300"
FT                   /number=1
FT   mRNA            complement(<299037..>300397)
FT                   /gene="Pc16g01310"
FT                   /locus_tag="PCH_Pc16g01310"
FT   CDS_pept        complement(299037..300397)
FT                   /pseudo
FT                   /gene="Pc16g01310"
FT                   /locus_tag="PCH_Pc16g01310"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to transposase Tan1
FT                   -Aspergillus niger [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT                   /inference="protein motif:PFAM:PF03184"
FT   exon            complement(299037..300397)
FT                   /gene="Pc16g01310"
FT                   /locus_tag="PCH_Pc16g01310"
FT                   /number=1
FT   gap             301685..301784
FT                   /estimated_length=unknown
FT   mRNA            complement(<302032..>303114)
FT                   /gene="Pc16g01320"
FT                   /locus_tag="PCH_Pc16g01320"
FT   CDS_pept        complement(302032..303114)
FT                   /pseudo
FT                   /gene="Pc16g01320"
FT                   /locus_tag="PCH_Pc16g01320"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to hypothetical
FT                   retrovirus-related pol polyprotein - Oryza sativa [putative
FT                   pseudogene]"
FT                   /inference="similar to AA sequence:TREMBLNEW:AP003202.5"
FT   exon            complement(302032..303114)
FT                   /gene="Pc16g01320"
FT                   /locus_tag="PCH_Pc16g01320"
FT                   /number=1
FT   mRNA            complement(join(<303289..303302,303372..303394,
FT                   303449..303626,303717..303798,303967..304024,
FT                   304171..304181,304378..304430,304518..304677,
FT                   304825..>304827))
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT   CDS_pept        complement(join(303289..303302,303372..303394,
FT                   303449..303626,303717..303798,303967..304024,
FT                   304171..304181,304378..304430,304518..304677,
FT                   304825..304827))
FT                   /pseudo
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /product="hypothetical protein [putative pseudogene]"
FT                   /note="putative pseudogene"
FT                   /db_xref="PSEUDO:CAP92803.1"
FT   exon            complement(303289..303302)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=1
FT   intron          complement(303303..303371)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=1
FT   exon            complement(303372..303394)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=2
FT   intron          complement(303395..303448)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=2
FT   exon            complement(303449..303626)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=3
FT   intron          complement(303627..303716)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=3
FT   exon            complement(303717..303798)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=4
FT   intron          complement(303799..303966)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=4
FT   exon            complement(303967..304024)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=5
FT   intron          complement(304025..304170)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=5
FT   exon            complement(304171..304181)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=6
FT   intron          complement(304182..304377)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=6
FT   exon            complement(304378..304430)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=7
FT   intron          complement(304431..304517)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=7
FT   exon            complement(304518..304677)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=8
FT   intron          complement(304678..304824)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=8
FT   exon            complement(304825..304827)
FT                   /gene="Pc16g01330"
FT                   /locus_tag="PCH_Pc16g01330"
FT                   /number=9
FT   mRNA            <304829..>306463
FT                   /gene="Pc16g01340"
FT                   /locus_tag="PCH_Pc16g01340"
FT   CDS_pept        304829..306463
FT                   /pseudo
FT                   /gene="Pc16g01340"
FT                   /locus_tag="PCH_Pc16g01340"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to transposase Tan1
FT                   -Aspergillus niger [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT                   /inference="protein motif:PFAM:PF05225"
FT                   /inference="protein motif:PFAM:PF03184"
FT   exon            304829..306463
FT                   /gene="Pc16g01340"
FT                   /locus_tag="PCH_Pc16g01340"
FT                   /number=1
FT   gap             309185..309284
FT                   /estimated_length=unknown
FT   mRNA            <312834..>313178
FT                   /gene="Pc16g01350"
FT                   /locus_tag="PCH_Pc16g01350"
FT   CDS_pept        312834..313178
FT                   /pseudo
FT                   /gene="Pc16g01350"
FT                   /locus_tag="PCH_Pc16g01350"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg11070.1 - Magnaporthe grisea [putative pseudogene]"
FT   exon            312834..313178
FT                   /gene="Pc16g01350"
FT                   /locus_tag="PCH_Pc16g01350"
FT                   /number=1
FT   mRNA            <313180..>314190
FT                   /gene="Pc16g01360"
FT                   /locus_tag="PCH_Pc16g01360"
FT   CDS_pept        313180..314190
FT                   /pseudo
FT                   /gene="Pc16g01360"
FT                   /locus_tag="PCH_Pc16g01360"
FT                   /note="putative pseudogene"
FT                   /note="Title: weak similarity to MAGGY LTR retrotransposon
FT                   Pol - Magnaporthe grisea [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AF314096.2"
FT                   /inference="protein motif:COGS:COG2801"
FT   exon            313180..314190
FT                   /gene="Pc16g01360"
FT                   /locus_tag="PCH_Pc16g01360"
FT                   /number=1
FT   mRNA            <314416..>315159
FT                   /gene="Pc16g01370"
FT                   /locus_tag="PCH_Pc16g01370"
FT   CDS_pept        314416..315159
FT                   /pseudo
FT                   /gene="Pc16g01370"
FT                   /locus_tag="PCH_Pc16g01370"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical protein mg02174.1
FT                   - Magnaporthe grisea [putative pseudogene]"
FT                   /inference="protein motif:COGS:COG2801"
FT   exon            314416..315159
FT                   /gene="Pc16g01370"
FT                   /locus_tag="PCH_Pc16g01370"
FT                   /number=1
FT   mRNA            <316205..>316540
FT                   /gene="Pc16g01380"
FT                   /locus_tag="PCH_Pc16g01380"
FT   CDS_pept        316205..316540
FT                   /pseudo
FT                   /gene="Pc16g01380"
FT                   /locus_tag="PCH_Pc16g01380"
FT                   /note="putative pseudogene"
FT                   /note="Title: weak similarity to retrotransposon Tto1
FT                   -Nicotiana tabacum [putative pseudogene]"
FT                   /inference="similar to AA sequence:PIR:T02206"
FT   exon            316205..316540
FT                   /gene="Pc16g01380"
FT                   /locus_tag="PCH_Pc16g01380"
FT                   /number=1
FT   mRNA            <317072..>317568
FT                   /gene="Pc16g01390"
FT                   /locus_tag="PCH_Pc16g01390"
FT   CDS_pept        317072..317568
FT                   /pseudo
FT                   /gene="Pc16g01390"
FT                   /locus_tag="PCH_Pc16g01390"
FT                   /note="putative pseudogene"
FT                   /note="Title: weak similarity to polyprotein-like
FT                   -Lycopersicon chilense [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AF279585.1"
FT   exon            317072..317568
FT                   /gene="Pc16g01390"
FT                   /locus_tag="PCH_Pc16g01390"
FT                   /number=1
FT   mRNA            <318203..>318898
FT                   /gene="Pc16g01400"
FT                   /locus_tag="PCH_Pc16g01400"
FT   CDS_pept        318203..318898
FT                   /pseudo
FT                   /gene="Pc16g01400"
FT                   /locus_tag="PCH_Pc16g01400"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to retroviral-like
FT                   transposable element like protein An03g03110 - Aspergillus
FT                   niger [putative pseudogene]"
FT   exon            318203..318898
FT                   /gene="Pc16g01400"
FT                   /locus_tag="PCH_Pc16g01400"
FT                   /number=1
FT   mRNA            <319082..>319360
FT                   /gene="Pc16g01410"
FT                   /locus_tag="PCH_Pc16g01410"
FT   CDS_pept        319082..319360
FT                   /pseudo
FT                   /gene="Pc16g01410"
FT                   /locus_tag="PCH_Pc16g01410"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to retroviral-like transposable
FT                   element like protein An03g03110 - Aspergillus niger
FT                   [putative pseudogene]"
FT   exon            319082..319360
FT                   /gene="Pc16g01410"
FT                   /locus_tag="PCH_Pc16g01410"
FT                   /number=1
FT   mRNA            complement(<320074..>321582)
FT                   /gene="Pc16g01420"
FT                   /locus_tag="PCH_Pc16g01420"
FT   CDS_pept        complement(320074..321582)
FT                   /pseudo
FT                   /gene="Pc16g01420"
FT                   /locus_tag="PCH_Pc16g01420"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to transposase Tan1
FT                   -Aspergillus niger [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT                   /inference="protein motif:PFAM:PF05225"
FT                   /inference="protein motif:PFAM:PF03184"
FT   exon            complement(320074..321582)
FT                   /gene="Pc16g01420"
FT                   /locus_tag="PCH_Pc16g01420"
FT                   /number=1
FT   mRNA            complement(<321732..>322313)
FT                   /gene="Pc16g01430"
FT                   /locus_tag="PCH_Pc16g01430"
FT   CDS_pept        complement(321732..322313)
FT                   /pseudo
FT                   /gene="Pc16g01430"
FT                   /locus_tag="PCH_Pc16g01430"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical protein An02g09120
FT                   - Aspergillus niger [putative pseudogene]"
FT   exon            complement(321732..322313)
FT                   /gene="Pc16g01430"
FT                   /locus_tag="PCH_Pc16g01430"
FT                   /number=1
FT   mRNA            complement(<323737..>325446)
FT                   /gene="Pc16g01440"
FT                   /locus_tag="PCH_Pc16g01440"
FT   CDS_pept        complement(323737..325446)
FT                   /pseudo
FT                   /gene="Pc16g01440"
FT                   /locus_tag="PCH_Pc16g01440"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to retroviral-like
FT                   transposable element like protein An03g03110 - Aspergillus
FT                   niger [putative pseudogene]"
FT   exon            complement(323737..325446)
FT                   /gene="Pc16g01440"
FT                   /locus_tag="PCH_Pc16g01440"
FT                   /number=1
FT   gap             329280..329379
FT                   /estimated_length=unknown
FT   gap             332939..333038
FT                   /estimated_length=unknown
FT   mRNA            complement(<333679..>334449)
FT                   /gene="Pc16g01450"
FT                   /locus_tag="PCH_Pc16g01450"
FT   CDS_pept        complement(333679..334449)
FT                   /pseudo
FT                   /gene="Pc16g01450"
FT                   /locus_tag="PCH_Pc16g01450"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical protein mg00006.1
FT                   - Magnaporthe grisea [putative pseudogene]"
FT   exon            complement(333679..334449)
FT                   /gene="Pc16g01450"
FT                   /locus_tag="PCH_Pc16g01450"
FT                   /number=1
FT   mRNA            <337496..>338527
FT                   /gene="Pc16g01460"
FT                   /locus_tag="PCH_Pc16g01460"
FT   CDS_pept        337496..338527
FT                   /pseudo
FT                   /gene="Pc16g01460"
FT                   /locus_tag="PCH_Pc16g01460"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to retrotransposon like
FT                   protein An10g00740 - Aspergillus niger [putative
FT                   pseudogene]"
FT   exon            337496..338527
FT                   /gene="Pc16g01460"
FT                   /locus_tag="PCH_Pc16g01460"
FT                   /number=1
FT   mRNA            <339747..>341297
FT                   /gene="Pc16g01470"
FT                   /locus_tag="PCH_Pc16g01470"
FT   CDS_pept        339747..341297
FT                   /pseudo
FT                   /gene="Pc16g01470"
FT                   /locus_tag="PCH_Pc16g01470"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to retrotransposon like
FT                   protein An10g00740 - Aspergillus niger [putative
FT                   pseudogene]"
FT   exon            339747..341297
FT                   /gene="Pc16g01470"
FT                   /locus_tag="PCH_Pc16g01470"
FT                   /number=1
FT   mRNA            <345457..>346377
FT                   /gene="Pc16g01480"
FT                   /locus_tag="PCH_Pc16g01480"
FT   CDS_pept        345457..346377
FT                   /pseudo
FT                   /gene="Pc16g01480"
FT                   /locus_tag="PCH_Pc16g01480"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to transposase Tan1
FT                   -Aspergillus niger [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT   exon            345457..346377
FT                   /gene="Pc16g01480"
FT                   /locus_tag="PCH_Pc16g01480"
FT                   /number=1
FT   mRNA            <347221..>347679
FT                   /gene="Pc16g01490"
FT                   /locus_tag="PCH_Pc16g01490"
FT   CDS_pept        347221..347679
FT                   /pseudo
FT                   /gene="Pc16g01490"
FT                   /locus_tag="PCH_Pc16g01490"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to transposase Tan1 - Aspergillus
FT                   niger [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT   exon            347221..347679
FT                   /gene="Pc16g01490"
FT                   /locus_tag="PCH_Pc16g01490"
FT                   /number=1
FT   mRNA            <348937..>349239
FT                   /gene="Pc16g01500"
FT                   /locus_tag="PCH_Pc16g01500"
FT   CDS_pept        348937..349239
FT                   /pseudo
FT                   /gene="Pc16g01500"
FT                   /locus_tag="PCH_Pc16g01500"
FT                   /product="hypothetical protein [putative pseudogene]"
FT                   /note="putative pseudogene"
FT   exon            348937..349239
FT                   /gene="Pc16g01500"
FT                   /locus_tag="PCH_Pc16g01500"
FT                   /number=1
FT   gap             349753..349852
FT                   /estimated_length=unknown
FT   gap             352332..352431
FT                   /estimated_length=unknown
FT   mRNA            complement(<352947..>353960)
FT                   /gene="Pc16g01510"
FT                   /locus_tag="PCH_Pc16g01510"
FT   CDS_pept        complement(352947..353960)
FT                   /pseudo
FT                   /gene="Pc16g01510"
FT                   /locus_tag="PCH_Pc16g01510"
FT                   /note="putative pseudogene"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   gi_19114896 - Schizosaccharomyces pombe [putative
FT                   pseudogene]"
FT                   /inference="protein motif:COGS:COG2801"
FT   exon            complement(352947..353960)
FT                   /gene="Pc16g01510"
FT                   /locus_tag="PCH_Pc16g01510"
FT                   /number=1
FT   mRNA            complement(<356923..>357258)
FT                   /gene="Pc16g01520"
FT                   /locus_tag="PCH_Pc16g01520"
FT   CDS_pept        complement(356923..357258)
FT                   /pseudo
FT                   /gene="Pc16g01520"
FT                   /locus_tag="PCH_Pc16g01520"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical protein mg11070.1
FT                   - Magnaporthe grisea [putative pseudogene]"
FT   exon            complement(356923..357258)
FT                   /gene="Pc16g01520"
FT                   /locus_tag="PCH_Pc16g01520"
FT                   /number=1
FT   mRNA            complement(<357321..>358058)
FT                   /gene="Pc16g01530"
FT                   /locus_tag="PCH_Pc16g01530"
FT   CDS_pept        complement(357321..358058)
FT                   /pseudo
FT                   /gene="Pc16g01530"
FT                   /locus_tag="PCH_Pc16g01530"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg11070.1 - Magnaporthe grisea [putative pseudogene]"
FT                   /inference="protein motif:COGS:COG2801"
FT   exon            complement(357321..358058)
FT                   /gene="Pc16g01530"
FT                   /locus_tag="PCH_Pc16g01530"
FT                   /number=1
FT   gap             359066..359165
FT                   /estimated_length=unknown
FT   mRNA            complement(<363086..>363544)
FT                   /gene="Pc16g01540"
FT                   /locus_tag="PCH_Pc16g01540"
FT   CDS_pept        complement(363086..363544)
FT                   /pseudo
FT                   /gene="Pc16g01540"
FT                   /locus_tag="PCH_Pc16g01540"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical protein mg04796.1
FT                   - Magnaporthe grisea [putative pseudogene]"
FT   exon            complement(363086..363544)
FT                   /gene="Pc16g01540"
FT                   /locus_tag="PCH_Pc16g01540"
FT                   /number=1
FT   mRNA            <363910..>365545
FT                   /pseudo
FT                   /gene="Pc16g01550"
FT                   /locus_tag="PCH_Pc16g01550"
FT                   /note="submitted as non-pseudo"
FT   CDS_pept        363910..365545
FT                   /pseudo
FT                   /gene="Pc16g01550"
FT                   /locus_tag="PCH_Pc16g01550"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to transposase Tan1
FT                   -Aspergillus niger"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT                   /inference="protein motif:PFAM:PF03184"
FT   exon            363910..365545
FT                   /gene="Pc16g01550"
FT                   /locus_tag="PCH_Pc16g01550"
FT                   /number=1
FT   mRNA            <366891..>367520
FT                   /gene="Pc16g01560"
FT                   /locus_tag="PCH_Pc16g01560"
FT   CDS_pept        366891..367520
FT                   /pseudo
FT                   /gene="Pc16g01560"
FT                   /locus_tag="PCH_Pc16g01560"
FT                   /note="putative pseudogene"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   1397_scaffold_6.tfa_30wg - Fusarium graminearum [putative
FT                   pseudogene]"
FT   exon            366891..367520
FT                   /gene="Pc16g01560"
FT                   /locus_tag="PCH_Pc16g01560"
FT                   /number=1
FT   mRNA            complement(<370791..>371660)
FT                   /gene="Pc16g01570"
FT                   /locus_tag="PCH_Pc16g01570"
FT   CDS_pept        complement(370791..371660)
FT                   /pseudo
FT                   /gene="Pc16g01570"
FT                   /locus_tag="PCH_Pc16g01570"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to transposase -Aspergillus
FT                   oryzae [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AB078787.1"
FT   exon            complement(370791..371660)
FT                   /gene="Pc16g01570"
FT                   /locus_tag="PCH_Pc16g01570"
FT                   /number=1
FT   mRNA            complement(<371779..>372568)
FT                   /gene="Pc16g01580"
FT                   /locus_tag="PCH_Pc16g01580"
FT   CDS_pept        complement(371779..372568)
FT                   /pseudo
FT                   /gene="Pc16g01580"
FT                   /locus_tag="PCH_Pc16g01580"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg11070.1 - Magnaporthe grisea [putative pseudogene]"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /inference="protein motif:COGS:COG2801"
FT   exon            complement(371779..372568)
FT                   /gene="Pc16g01580"
FT                   /locus_tag="PCH_Pc16g01580"
FT                   /number=1
FT   gap             376268..376367
FT                   /estimated_length=unknown
FT   mRNA            <377283..>377647
FT                   /gene="Pc16g01590"
FT                   /locus_tag="PCH_Pc16g01590"
FT   CDS_pept        377283..377647
FT                   /pseudo
FT                   /gene="Pc16g01590"
FT                   /locus_tag="PCH_Pc16g01590"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical copia-like
FT                   retrotransposon protein - Oryza sativa [putative
FT                   pseudogene]"
FT                   /inference="similar to AA sequence:TREMBLNEW:AC092557.17"
FT   exon            377283..377647
FT                   /gene="Pc16g01590"
FT                   /locus_tag="PCH_Pc16g01590"
FT                   /number=1
FT   mRNA            <377847..>378233
FT                   /gene="Pc16g01600"
FT                   /locus_tag="PCH_Pc16g01600"
FT   CDS_pept        377847..378233
FT                   /pseudo
FT                   /gene="Pc16g01600"
FT                   /locus_tag="PCH_Pc16g01600"
FT                   /note="putative pseudogene"
FT                   /note="Title: weak similarity to retrotransposon Tto1
FT                   -Nicotiana tabacum [putative pseudogene]"
FT                   /inference="similar to AA sequence:PIR:T02206"
FT   exon            377847..378233
FT                   /gene="Pc16g01600"
FT                   /locus_tag="PCH_Pc16g01600"
FT                   /number=1
FT   mRNA            <378930..>379952
FT                   /gene="Pc16g01610"
FT                   /locus_tag="PCH_Pc16g01610"
FT   CDS_pept        378930..379952
FT                   /pseudo
FT                   /gene="Pc16g01610"
FT                   /locus_tag="PCH_Pc16g01610"
FT                   /note="putative pseudogene"
FT                   /note="unknown EC_number=2.7.7.49"
FT                   /note="Title: strong similarity to hypothetical
FT                   retrotransposon Tto1 - Nicotiana tabacum [putative
FT                   pseudogene]"
FT                   /inference="similar to AA sequence:PIR:T02206"
FT   exon            378930..379952
FT                   /gene="Pc16g01610"
FT                   /locus_tag="PCH_Pc16g01610"
FT                   /number=1
FT   mRNA            <380596..>380901
FT                   /gene="Pc16g01620"
FT                   /locus_tag="PCH_Pc16g01620"
FT   CDS_pept        380596..380901
FT                   /pseudo
FT                   /gene="Pc16g01620"
FT                   /locus_tag="PCH_Pc16g01620"
FT                   /note="putative pseudogene"
FT                   /note="unknown EC_number=2.7.7.49"
FT                   /note="Title: weak similarity to hypothetical
FT                   retrotransposon Tto1 - Nicotiana tabacum [putative
FT                   pseudogene]"
FT                   /inference="similar to AA sequence:PIR:T02206"
FT   exon            380596..380901
FT                   /gene="Pc16g01620"
FT                   /locus_tag="PCH_Pc16g01620"
FT                   /number=1
FT   gap             382164..382263
FT                   /estimated_length=unknown
FT   mRNA            complement(<383015..>384169)
FT                   /gene="Pc16g01630"
FT                   /locus_tag="PCH_Pc16g01630"
FT   CDS_pept        complement(383015..384169)
FT                   /pseudo
FT                   /gene="Pc16g01630"
FT                   /locus_tag="PCH_Pc16g01630"
FT                   /note="putative pseudogene"
FT                   /note="Title: weak similarity to MAGGY LTR retrotransposon
FT                   Pol - Magnaporthe grisea [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AF314096.2"
FT                   /inference="protein motif:COGS:COG2801"
FT   exon            complement(383015..384169)
FT                   /gene="Pc16g01630"
FT                   /locus_tag="PCH_Pc16g01630"
FT                   /number=1
FT   gap             385085..385184
FT                   /estimated_length=unknown
FT   mRNA            join(<385248..385297,385728..385747,385849..385857,
FT                   385934..385949,386088..386117,386210..386231,
FT                   386307..386313,386599..386640,386695..386761,
FT                   386819..386823,386890..>386933)
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT   CDS_pept        join(<385248..385297,385728..385747,385849..385857,
FT                   385934..385949,386088..386117,386210..386231,
FT                   386307..386313,386599..386640,386695..386761,
FT                   386819..386823,386890..386933)
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /product="hypothetical protein [truncated ORF]"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01640"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92834"
FT                   /db_xref="UniProtKB/TrEMBL:B6H731"
FT                   /protein_id="CAP92834.1"
FT                   /translation="TTTTTTTTVASLTLYLYSRYRVYNILDLRDRKLDFIVFSNYNLYR
FT                   SGVRFIGRKDVICVKQIKLRRGKSEIICDIFIIPLLSYYDTRSTGPRNPYRDYKDYSI"
FT   exon            <385248..385297
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=1
FT   intron          385298..385727
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=1
FT   exon            385728..385747
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=2
FT   intron          385748..385848
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=2
FT   exon            385849..385857
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=3
FT   intron          385858..385933
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=3
FT   exon            385934..385949
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=4
FT   intron          385950..386087
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=4
FT   exon            386088..386117
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=5
FT   intron          386118..386209
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=5
FT   exon            386210..386231
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=6
FT   intron          386232..386306
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=6
FT   exon            386307..386313
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=7
FT   intron          386314..386598
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=7
FT   exon            386599..386640
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=8
FT   intron          386641..386694
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=8
FT   exon            386695..386761
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=9
FT   intron          386762..386818
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=9
FT   exon            386819..386823
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=10
FT   intron          386824..386889
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=10
FT   exon            386890..>386933
FT                   /gene="Pc16g01640"
FT                   /locus_tag="PCH_Pc16g01640"
FT                   /number=11
FT   mRNA            <388030..>389661
FT                   /gene="Pc16g01650"
FT                   /locus_tag="PCH_Pc16g01650"
FT   CDS_pept        388030..389661
FT                   /pseudo
FT                   /gene="Pc16g01650"
FT                   /locus_tag="PCH_Pc16g01650"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to transposase Tan1
FT                   -Aspergillus niger [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AAU58946.1"
FT                   /inference="protein motif:PFAM:PF05225"
FT                   /inference="protein motif:PFAM:PF03184"
FT   exon            388030..389661
FT                   /gene="Pc16g01650"
FT                   /locus_tag="PCH_Pc16g01650"
FT                   /number=1
FT   mRNA            complement(<389801..>390994)
FT                   /gene="Pc16g01660"
FT                   /locus_tag="PCH_Pc16g01660"
FT   CDS_pept        complement(389801..390994)
FT                   /pseudo
FT                   /gene="Pc16g01660"
FT                   /locus_tag="PCH_Pc16g01660"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to retrotransposon Tto1 -Nicotiana
FT                   tabacum [putative pseudogene]"
FT                   /inference="similar to AA sequence:PIR:T02206"
FT   exon            complement(389801..390994)
FT                   /gene="Pc16g01660"
FT                   /locus_tag="PCH_Pc16g01660"
FT                   /number=1
FT   mRNA            complement(<391042..>391914)
FT                   /gene="Pc16g01670"
FT                   /locus_tag="PCH_Pc16g01670"
FT   CDS_pept        complement(391042..391914)
FT                   /pseudo
FT                   /gene="Pc16g01670"
FT                   /locus_tag="PCH_Pc16g01670"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical transposon protein
FT                   - Nicotiana tabacum [putative pseudogene]"
FT                   /inference="similar to AA sequence:PIR:T02206"
FT   exon            complement(391042..391914)
FT                   /gene="Pc16g01670"
FT                   /locus_tag="PCH_Pc16g01670"
FT                   /number=1
FT   mRNA            complement(<393451..>393900)
FT                   /gene="Pc16g01680"
FT                   /locus_tag="PCH_Pc16g01680"
FT   CDS_pept        complement(393451..393900)
FT                   /pseudo
FT                   /gene="Pc16g01680"
FT                   /locus_tag="PCH_Pc16g01680"
FT                   /note="putative pseudogene"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   -Bifidobacterium longum [putative pseudogene]"
FT                   /inference="protein motif:COGS:COG4775"
FT                   /inference="protein motif:COGS:COG0247"
FT                   /inference="protein motif:COGS:COG5263"
FT                   /inference="protein motif:COGS:COG0206"
FT   exon            complement(393451..393900)
FT                   /gene="Pc16g01680"
FT                   /locus_tag="PCH_Pc16g01680"
FT                   /number=1
FT   mRNA            join(<395529..396120,396196..397643,397697..397822,
FT                   397873..>399034)
FT                   /pseudo
FT                   /gene="Pc16g01690"
FT                   /locus_tag="PCH_Pc16g01690"
FT                   /note="submitted as non-pseudo"
FT   CDS_pept        join(395529..396120,396196..397643,397697..397822,
FT                   397873..399034)
FT                   /pseudo
FT                   /gene="Pc16g01690"
FT                   /locus_tag="PCH_Pc16g01690"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An06g00670 - Aspergillus niger"
FT                   /inference="protein motif:PFAM:PF00646"
FT   exon            395529..396120
FT                   /gene="Pc16g01690"
FT                   /locus_tag="PCH_Pc16g01690"
FT                   /number=1
FT   intron          396121..396195
FT                   /gene="Pc16g01690"
FT                   /locus_tag="PCH_Pc16g01690"
FT                   /number=1
FT   exon            396196..397643
FT                   /gene="Pc16g01690"
FT                   /locus_tag="PCH_Pc16g01690"
FT                   /number=2
FT   intron          397644..397696
FT                   /gene="Pc16g01690"
FT                   /locus_tag="PCH_Pc16g01690"
FT                   /number=2
FT   exon            397697..397822
FT                   /gene="Pc16g01690"
FT                   /locus_tag="PCH_Pc16g01690"
FT                   /number=3
FT   intron          397823..397872
FT                   /gene="Pc16g01690"
FT                   /locus_tag="PCH_Pc16g01690"
FT                   /number=3
FT   exon            397873..399034
FT                   /gene="Pc16g01690"
FT                   /locus_tag="PCH_Pc16g01690"
FT                   /number=4
FT   mRNA            join(<400190..400420,400492..>401394)
FT                   /gene="Pc16g01700"
FT                   /locus_tag="PCH_Pc16g01700"
FT   CDS_pept        join(400190..400420,400492..401394)
FT                   /gene="Pc16g01700"
FT                   /locus_tag="PCH_Pc16g01700"
FT                   /note="unknown EC_number=4.2.1.24"
FT                   /note="Title: strong similarity to porphobilinogen synthase
FT                   like protein An08g00010 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01700"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92840"
FT                   /db_xref="GOA:B6H727"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:B6H727"
FT                   /inference="protein motif:PFAM:PF00490"
FT                   /inference="protein motif:COGS:COG0113"
FT                   /protein_id="CAP92840.1"
FT                   /translation="MSFSNLVSDIAFRDARVDDGSSQISHARSHRSHATARSYASTAAT
FT                   SVSISGEVSSQLHSGYSHPLTRAWQADRQLTKDMLIYPLFITDNPDEETSIPSLPNQYR
FT                   RGINRLVPFLAPLVRKGLRSVMLFGVPLQPSAKDALGTAADDPDGPVIQAIRLLRSRFP
FT                   QLYITTDVCLCEYTSHGHCGILREDGSLDNAQSVDRISDVAIAYAAAGAHCVAPSDMND
FT                   GRIRAIKLKLIEAGMAHRVLLMSYSAKFSGCLYGPFRDAAGSCPSFGDRRCYQLPPGGR
FT                   GLARRAIQRDMAEGADIIMVKPASSYLDIIRDAKDLAPDLPVAAYQVSGEFAMIHAAAK
FT                   AGVFNLKDMAFESTEGILRAGAGIVISYFVPEFLDWL"
FT   exon            400190..400420
FT                   /gene="Pc16g01700"
FT                   /locus_tag="PCH_Pc16g01700"
FT                   /number=1
FT   intron          400421..400491
FT                   /gene="Pc16g01700"
FT                   /locus_tag="PCH_Pc16g01700"
FT                   /number=1
FT   exon            400492..401394
FT                   /gene="Pc16g01700"
FT                   /locus_tag="PCH_Pc16g01700"
FT                   /number=2
FT   mRNA            complement(join(<402172..403418,403601..>404396))
FT                   /gene="Pc16g01710"
FT                   /locus_tag="PCH_Pc16g01710"
FT   CDS_pept        complement(join(402172..403418,403601..404396))
FT                   /gene="Pc16g01710"
FT                   /locus_tag="PCH_Pc16g01710"
FT                   /note="unknown EC_number=2.3.1.-"
FT                   /note="Title: similarity to maltose O-acetyltransferase maa
FT                   - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01710"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92841"
FT                   /db_xref="GOA:B6H728"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H728"
FT                   /inference="similar to AA sequence:SWISSPROT:MAA_ECOLI"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:COGS:COG0110"
FT                   /inference="protein motif:COGS:COG1045"
FT                   /protein_id="CAP92841.1"
FT                   /translation="MTALAAGPVMNGGHDSGAETGTEHSPSRFTAVNGREPVNPGNTNG
FT                   KGNGPTPSSIPNGEHVPAQEKTNSDATQRDDRDDPANDQEKWSQRSSPSGSHNKNKRKR
FT                   SESRERDSVNASRSPVTRPMDSNQPNPNGSIPGSVSEMERGNHSATPSQRSEGNDAGQT
FT                   SANSPWSEYDSQLITQAQRAQQMDASDAHLADALQREAGQEKSITNRSTPGPQHPSSPG
FT                   YAPDRHGTMQVAPKRKRVFSNRTKTGCMTCRRRKKKCDEQHPACNNCIRGGFLCEGYSS
FT                   RSTWQKPSSTKTPIPLQSKEGYSDINGPYMQETSRPQDRQPGLVEHVDAAKIRPLVEEN
FT                   DRPVQQYSTSPTHTPSNHAWSKQAWPGAGPGATSNTGHPPYPSEPIAKVVDYREVPPIH
FT                   ELSREGRPKPDYPVISSLRDLSHPSHPKSSMPLFQNGPEQRTLPAAAVDTHSPQAQARM
FT                   ALSIEHQLSGRTVSSDETEKEKMIRGKLYRPFDVHLVEERDRCRGALWKFNNACNPLNG
FT                   ISSKEQNRLLKEVIVPPACSIVNSPAGTGVPRSVGSIGQGAVVEAPFSCHYGYNIHLGE
FT                   DVMISENCLFVDDCVIRIGAHTWIGPNVKIISSTAHPNMQERKGSQSRYQGRQVIIEED
FT                   CYVGAGCIIYPGVRLARGVYVAPGEIVNTNIAGYMFQGSKPSFAM"
FT   exon            complement(402172..403418)
FT                   /gene="Pc16g01710"
FT                   /locus_tag="PCH_Pc16g01710"
FT                   /number=1
FT   intron          complement(403419..403600)
FT                   /gene="Pc16g01710"
FT                   /locus_tag="PCH_Pc16g01710"
FT                   /number=1
FT   exon            complement(403601..404396)
FT                   /gene="Pc16g01710"
FT                   /locus_tag="PCH_Pc16g01710"
FT                   /number=2
FT   mRNA            join(<406307..406372,406495..406524,406589..406661,
FT                   406742..406813,406875..407587,407656..408898,
FT                   408967..409196,409302..409680,409739..409910,
FT                   409968..>410208)
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT   CDS_pept        join(406307..406372,406495..406524,406589..406661,
FT                   406742..406813,406875..407587,407656..408898,
FT                   408967..409196,409302..409680,409739..409910,
FT                   409968..410208)
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /note="Title: strong similarity to chromosome region
FT                   maintenance protein 1 crm1p - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01720"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92842"
FT                   /db_xref="GOA:B6H729"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR014877"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040485"
FT                   /db_xref="InterPro:IPR041123"
FT                   /db_xref="InterPro:IPR041235"
FT                   /db_xref="UniProtKB/TrEMBL:B6H729"
FT                   /inference="similar to AA sequence:SWISSPROT:CRM1_SCHPO"
FT                   /inference="protein motif:PFAM:PF03810"
FT                   /inference="protein motif:COGS:COG5101"
FT                   /protein_id="CAP92842.1"
FT                   /translation="MSISVQELDNTVRALFEGKGAVQNQAQQTLTEFKQNPDAWVTVGN
FT                   ILQEASYLQTKYIALQVLDNVIMTRWKVLPRDQCQGIRNFIVRFILENSESEEKIQAER
FT                   PLLNKLNLVLVSILKQEWPHNWPTFINEIISSCHASLSICENNMTILRLLSEEVFDFSQ
FT                   DQMTSAKARNLKTSMTSEFASIFQLCSEVLNTANQPSLVKATLETLLRFLNWIPLGYIF
FT                   ETPIINTLLTRFLGEPEFRNVTLKCLTEIGGLQIGAPYNYDERLVHMFTETLTTVSNVI
FT                   PLSLDLKQTYAMSNGRDQEFVSNLALFLSSFFSAHLDLIEKLPNQDYLTHAHFYLIRVS
FT                   QIDDREVFKICLDYWTRLVQELYEEMQQLPITDINPLVSMSVSGLANGGAPNPTTLANY
FT                   PLRKHKYETVLTNLRTVMIEKMVRPEEVLVVENDEGEIVREFVKESDTIQLYKTIRECL
FT                   VYLTHLDVVDTETIMIDKLAKQVDGTEWSWVNCNTLCWAIGSISGAMNEETEKRFLVTV
FT                   IKDLLGLTEQKRGKDNKAVVASNIMYIVGQYPRFLKAHWKFLKTVVNKLFEFMHETHEG
FT                   VQDMACDTFIKIANKCRRHFVALQPGESEPFIEEIVRNMRKITMDLSPQQIHTFYEACG
FT                   YMISAQGQKGLQDRLTENLMALPNTAWDQIIAEANQNPAILQDANTIKIVGNIMKTNVA
FT                   ACSSIGTYFYSQIGRIYHDMLNMYRAASQLINDAVASDGAIAPKTPKVRGLRTIKKEIL
FT                   KLIDTYVDKSDDLEMVNASMVPPLMEAVLIDYARNVPDAREAEVLNAMTTIIHKLHNLM
FT                   EDKIPAIMDSVFNCTLEMINKDFHEYPEHRVEFFKLLQAVNLYCFQALLKLDAAQFKFV
FT                   IDSCMWASKHDNREVENTGLTMCLELMNNMAETDPQTSSIFFREFYIPILQDVFFVLTD
FT                   SDHKAGFKSQAMLLSRMFYFVESGKIQEPIYSPDQAPAGTSNKDFLQEHIANLLKNAFG
FT                   NLQEAQIKQFVLGLFAYTDDLNKFKTHLRDFLISLKEFSDDNAELYAEEREQAVRDAQV
FT                   AERDRAMKVGGLLKPSEMDHEDEL"
FT   exon            406307..406372
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=1
FT   intron          406373..406494
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=1
FT   exon            406495..406524
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=2
FT   intron          406525..406588
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=2
FT   exon            406589..406661
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=3
FT   intron          406662..406741
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=3
FT   exon            406742..406813
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=4
FT   intron          406814..406874
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=4
FT   exon            406875..407587
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=5
FT   intron          407588..407655
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=5
FT   exon            407656..408898
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=6
FT   intron          408899..408966
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=6
FT   exon            408967..409196
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=7
FT   intron          409197..409301
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=7
FT   exon            409302..409680
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=8
FT   intron          409681..409738
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=8
FT   exon            409739..409910
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=9
FT   intron          409911..409967
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=9
FT   exon            409968..410208
FT                   /gene="Pc16g01720"
FT                   /locus_tag="PCH_Pc16g01720"
FT                   /number=10
FT   mRNA            join(<410824..411037,411113..>411435)
FT                   /gene="Pc16g01730"
FT                   /locus_tag="PCH_Pc16g01730"
FT   CDS_pept        join(410824..411037,411113..411435)
FT                   /gene="Pc16g01730"
FT                   /locus_tag="PCH_Pc16g01730"
FT                   /note="Title: similarity to hypothetical protein encoded by
FT                   B1D1.100 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01730"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92843"
FT                   /db_xref="GOA:B6H730"
FT                   /db_xref="InterPro:IPR011107"
FT                   /db_xref="UniProtKB/TrEMBL:B6H730"
FT                   /inference="similar to AA sequence:TREMBL:NCB1D1.8"
FT                   /protein_id="CAP92843.1"
FT                   /translation="MSRTRQPMGSNLFQTTTESPQDSSTAHIPPTLRLRAEEAPTDASE
FT                   ATSSSRRIRWSEDVVDNEGMGKKSSKVCCIYHKARPVGESSSEESSSSSSESDSESEDD
FT                   RRTARVNRARHTHSHNGGREPHSEHASQPDEGCCPEDHGSKPKRNRRKPSPNAYEKMPK
FT                   PSKNPKQNQNHARGT"
FT   exon            410824..411037
FT                   /gene="Pc16g01730"
FT                   /locus_tag="PCH_Pc16g01730"
FT                   /number=1
FT   intron          411038..411112
FT                   /gene="Pc16g01730"
FT                   /locus_tag="PCH_Pc16g01730"
FT                   /number=1
FT   exon            411113..411435
FT                   /gene="Pc16g01730"
FT                   /locus_tag="PCH_Pc16g01730"
FT                   /number=2
FT   mRNA            complement(join(<411987..412912,412973..413511,
FT                   413565..413976,414054..>414102))
FT                   /gene="Pc16g01740"
FT                   /locus_tag="PCH_Pc16g01740"
FT   CDS_pept        complement(join(411987..412912,412973..413511,
FT                   413565..413976,414054..414102))
FT                   /gene="Pc16g01740"
FT                   /locus_tag="PCH_Pc16g01740"
FT                   /note="Title: similarity to hypothetical protein An08g00090
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92844"
FT                   /db_xref="GOA:B6H752"
FT                   /db_xref="InterPro:IPR011515"
FT                   /db_xref="InterPro:IPR011516"
FT                   /db_xref="InterPro:IPR038889"
FT                   /db_xref="UniProtKB/TrEMBL:B6H752"
FT                   /protein_id="CAP92844.1"
FT                   /translation="MARLNDYAAPAESIDALKRRFVRQNREIARVNSLQSLRIRSLESE
FT                   VSHLLSENVSLRKQVINLTQETERLEAGKMLHNGIYDIKSKLDAKLAELSNLAADLGSL
FT                   PRKVGKLCDDQLDRPKQAESRPRTEDIVGGEDGRLPAIVEDKYYPRRTLEPQELDSLVH
FT                   DDHSILDSPPQFSFMPEEGDAPIEHSSPSPPESKFRSQIENDTPEEPEPLLPPTLETRR
FT                   KKKKSGSIVAPEISPAQTDRPPSPPVDTTQHAKPVSTKRKYIPEDDDRFASNLIGDGDD
FT                   DEFQFTRPSHSPKKRTTPFEDTQRDQLLTESHVEVTRGSKTPVLSMRKVLEPKSANSNL
FT                   GSPKKARMSSYQDSKLLQMSTKGDENNNSPQKVKDVEKIGGKTVNQKPRVSRIAPSNKE
FT                   KRAIHPVPPQLEEPTPHQPAMPLHPNAMKTEEESAVRPSRRRGAVVSYAEPNLRDKMRR
FT                   PTKEMIDAVALGSRRSSSFQASQENVDGGGEGGHTQPHSSLPDDSTLAQSSDLFSADGS
FT                   SEQLAMVSRRKRKVSANPKDDNDAGNPSSALKNEIEDSLADISAQVSQKPLNSRRQTRR
FT                   HSSNPRSTTANIAQYGVDQVDLQSPTGDSPEDEDSFGPGPNSSTMDTNDVRRGQRAAAR
FT                   RKSMMV"
FT   exon            complement(411987..412912)
FT                   /gene="Pc16g01740"
FT                   /locus_tag="PCH_Pc16g01740"
FT                   /number=1
FT   intron          complement(412913..412972)
FT                   /gene="Pc16g01740"
FT                   /locus_tag="PCH_Pc16g01740"
FT                   /number=1
FT   exon            complement(412973..413511)
FT                   /gene="Pc16g01740"
FT                   /locus_tag="PCH_Pc16g01740"
FT                   /number=2
FT   intron          complement(413512..413564)
FT                   /gene="Pc16g01740"
FT                   /locus_tag="PCH_Pc16g01740"
FT                   /number=2
FT   exon            complement(413565..413976)
FT                   /gene="Pc16g01740"
FT                   /locus_tag="PCH_Pc16g01740"
FT                   /number=3
FT   intron          complement(413977..414053)
FT                   /gene="Pc16g01740"
FT                   /locus_tag="PCH_Pc16g01740"
FT                   /number=3
FT   exon            complement(414054..414102)
FT                   /gene="Pc16g01740"
FT                   /locus_tag="PCH_Pc16g01740"
FT                   /number=4
FT   mRNA            join(<414451..414682,414740..414798,414908..>414997)
FT                   /gene="Pc16g01750"
FT                   /locus_tag="PCH_Pc16g01750"
FT   CDS_pept        join(414451..414682,414740..414798,414908..414997)
FT                   /gene="Pc16g01750"
FT                   /locus_tag="PCH_Pc16g01750"
FT                   /note="Title: similarity to hypothetical protein
FT                   SPAC1805.07c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01750"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92845"
FT                   /db_xref="GOA:B6H753"
FT                   /db_xref="InterPro:IPR013963"
FT                   /db_xref="UniProtKB/TrEMBL:B6H753"
FT                   /inference="similar to AA sequence:PIR:T37892"
FT                   /protein_id="CAP92845.1"
FT                   /translation="MAYSSRPTSMLPGAPGGSSMRQPSGSQSQQSSALSARIAAKKAEL
FT                   ENLRQLRDLSGTLAIQMQALDNKISTLKDGTEAVAYVLSNWDNVLRAITLASKNVEKPR
FT                   NDARLPSTLVRIPAEPRDKTGE"
FT   exon            414451..414682
FT                   /gene="Pc16g01750"
FT                   /locus_tag="PCH_Pc16g01750"
FT                   /number=1
FT   intron          414683..414739
FT                   /gene="Pc16g01750"
FT                   /locus_tag="PCH_Pc16g01750"
FT                   /number=1
FT   exon            414740..414798
FT                   /gene="Pc16g01750"
FT                   /locus_tag="PCH_Pc16g01750"
FT                   /number=2
FT   intron          414799..414907
FT                   /gene="Pc16g01750"
FT                   /locus_tag="PCH_Pc16g01750"
FT                   /number=2
FT   exon            414908..414997
FT                   /gene="Pc16g01750"
FT                   /locus_tag="PCH_Pc16g01750"
FT                   /number=3
FT   mRNA            <416337..>416711
FT                   /gene="Pc16g01760"
FT                   /locus_tag="PCH_Pc16g01760"
FT   CDS_pept        416337..416711
FT                   /gene="Pc16g01760"
FT                   /locus_tag="PCH_Pc16g01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01760"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92846"
FT                   /db_xref="InterPro:IPR024368"
FT                   /db_xref="UniProtKB/TrEMBL:B6H754"
FT                   /protein_id="CAP92846.1"
FT                   /translation="MSTEWSLDFCLVCDRQTLGAPYCSQTCRLAELDEVSDGMSRRSSA
FT                   ASTHWSEINQAQARAEALKADTHNPSRTLSVSSSQTSLSSLKSNTSTSSNVADRLQDEL
FT                   RDYASCFDQVRDLKRRMTTT"
FT   exon            416337..416711
FT                   /gene="Pc16g01760"
FT                   /locus_tag="PCH_Pc16g01760"
FT                   /number=1
FT   mRNA            complement(join(<417399..417706,417774..417892,
FT                   417960..418717,418815..>419183))
FT                   /gene="Pc16g01770"
FT                   /locus_tag="PCH_Pc16g01770"
FT   CDS_pept        complement(join(417399..417706,417774..417892,
FT                   417960..418717,418815..419183))
FT                   /gene="Pc16g01770"
FT                   /locus_tag="PCH_Pc16g01770"
FT                   /note="unknown EC_number=1.14.14.1"
FT                   /note="Title: strong similarity to phenylacetate
FT                   hydroxylase pahA - Penicillium chrysogenum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01770"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92847"
FT                   /db_xref="GOA:B6H755"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B6H755"
FT                   /inference="similar to AA sequence:TREMBL:AF057559.1"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /inference="protein motif:COGS:COG2124"
FT                   /protein_id="CAP92847.1"
FT                   /translation="MAIAAALASLQGSVIEYPYHSLAAAAVLAPILYVILNEFIRDAAR
FT                   VKGMKGPRGLPLIGNLAQIRKDAAEQYRLWSKKHGAVYQIQLGNIPVVVVNSAASAKVL
FT                   FGQNAQALSSRPETYTFHKIVSNTAGTTIGTSPYSDSLKRRRKGAASALNRPSVDTYVS
FT                   HLDVESKAFVEELYRYGNHGKTPVDPMAMIQRLSLSLALTLNWGVRIASQEEELFDEIT
FT                   EVEEEISRFRSTTGNLQDYIPLLRLNPFSSNSKKAAEMRRRRDKYLGALNSDLDDRMAK
FT                   GTHKPCIQANVIMDKEAKLNSEELTSISLTMLSGGLDTVTTLVAWSLGLLAQRPDIQDR
FT                   AAKAIQEMYGEDDPMCSPDDDQRCAYIAALVKECLRFFTVLRLALPRTSIKDITYKGIT
FT                   IPKGTVFFLNAWACNMDPDVWTDPDDFRPERWLEQPDAPLFTYGMGYRMCAGSLLANRE
FT                   LYLVFIRTLNSFRLEPHDKTDCHPLRGNSDPTSLVAIPQKYKVRFVPKNEKALSKVLAQ
FT                   "
FT   exon            complement(417399..417706)
FT                   /gene="Pc16g01770"
FT                   /locus_tag="PCH_Pc16g01770"
FT                   /number=1
FT   mat_peptide     complement(join(417402..417706,417774..417892,
FT                   417960..418717,418815..419138))
FT                   /gene="Pc16g01770"
FT                   /locus_tag="PCH_Pc16g01770"
FT   intron          complement(417707..417773)
FT                   /gene="Pc16g01770"
FT                   /locus_tag="PCH_Pc16g01770"
FT                   /number=1
FT   exon            complement(417774..417892)
FT                   /gene="Pc16g01770"
FT                   /locus_tag="PCH_Pc16g01770"
FT                   /number=2
FT   intron          complement(417893..417959)
FT                   /gene="Pc16g01770"
FT                   /locus_tag="PCH_Pc16g01770"
FT                   /number=2
FT   exon            complement(417960..418717)
FT                   /gene="Pc16g01770"
FT                   /locus_tag="PCH_Pc16g01770"
FT                   /number=3
FT   intron          complement(418718..418814)
FT                   /gene="Pc16g01770"
FT                   /locus_tag="PCH_Pc16g01770"
FT                   /number=3
FT   exon            complement(418815..419183)
FT                   /gene="Pc16g01770"
FT                   /locus_tag="PCH_Pc16g01770"
FT                   /number=4
FT   sig_peptide     complement(419139..419183)
FT                   /gene="Pc16g01770"
FT                   /locus_tag="PCH_Pc16g01770"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<419310..419405,419836..419928,420018..420149,
FT                   420333..>420410)
FT                   /gene="Pc16g01780"
FT                   /locus_tag="PCH_Pc16g01780"
FT   CDS_pept        join(419310..419405,419836..419928,420018..420149,
FT                   420333..420410)
FT                   /gene="Pc16g01780"
FT                   /locus_tag="PCH_Pc16g01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01780"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92848"
FT                   /db_xref="UniProtKB/TrEMBL:B6H756"
FT                   /protein_id="CAP92848.1"
FT                   /translation="MEHFRVVKVVQPAMASLGVLLPHTTPGLARSQGLVKIISTCARTQ
FT                   DLLERRASFGKRFPKSGKFEGTRKQVDPKLFINGSPWSPVGPGWGKIAVPDWSIGQMEL
FT                   DSQKVESWKGEVGSSGRDNEISSRHVSE"
FT   sig_peptide     419310..419402
FT                   /gene="Pc16g01780"
FT                   /locus_tag="PCH_Pc16g01780"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            419310..419405
FT                   /gene="Pc16g01780"
FT                   /locus_tag="PCH_Pc16g01780"
FT                   /number=1
FT   mat_peptide     join(419403..419405,419836..419928,420018..420149,
FT                   420333..420407)
FT                   /gene="Pc16g01780"
FT                   /locus_tag="PCH_Pc16g01780"
FT   intron          419406..419835
FT                   /gene="Pc16g01780"
FT                   /locus_tag="PCH_Pc16g01780"
FT                   /number=1
FT   exon            419836..419928
FT                   /gene="Pc16g01780"
FT                   /locus_tag="PCH_Pc16g01780"
FT                   /number=2
FT   intron          419929..420017
FT                   /gene="Pc16g01780"
FT                   /locus_tag="PCH_Pc16g01780"
FT                   /number=2
FT   exon            420018..420149
FT                   /gene="Pc16g01780"
FT                   /locus_tag="PCH_Pc16g01780"
FT                   /number=3
FT   intron          420150..420332
FT                   /gene="Pc16g01780"
FT                   /locus_tag="PCH_Pc16g01780"
FT                   /number=3
FT   exon            420333..420410
FT                   /gene="Pc16g01780"
FT                   /locus_tag="PCH_Pc16g01780"
FT                   /number=4
FT   mRNA            join(<420963..421393,421529..421788,421844..423172,
FT                   423235..>423320)
FT                   /gene="Pc16g01790"
FT                   /locus_tag="PCH_Pc16g01790"
FT   CDS_pept        join(420963..421393,421529..421788,421844..423172,
FT                   423235..423320)
FT                   /gene="Pc16g01790"
FT                   /locus_tag="PCH_Pc16g01790"
FT                   /note="unknown EC_number=1.1.99.5"
FT                   /note="Title: strong similarity to glycerol-3-phosphate
FT                   dehydrogenase like protein An08g00210 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01790"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92849"
FT                   /db_xref="GOA:B6H757"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:B6H757"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /inference="protein motif:COGS:COG0578"
FT                   /protein_id="CAP92849.1"
FT                   /translation="MAARHSRKLLRPLLYTSAAAAAGAGVLYISYRPRNIPGLEAPAVP
FT                   PPGYREGKLVPPSFPSIKSRLDQIQDLKRSNDEEEYDLLIIGAGATGAGIALDAATRGL
FT                   KVAVVERDDFSSGTSSKSTKLVHGGVRYLEKAVWELDYNQYALVKEALRERKYFLNTAP
FT                   HLSSWLPIMVPVQKWWQAPYFWAGTKAYDFLAGSEGIETSYFLTKSKAIDAFPMLKRDD
FT                   IIGAMVYYDGAHNDSRMNVSLAMTAALYGTTVVNHLEVTGLNKDASGKLCGARAKDLVT
FT                   EKNGEVAQEFNIRAKGVINATGPFSDSIRKMDEPDVKEIVAPSAGVHIILPGYFSPSNM
FT                   GLIDPSTSDGRVIFFLPWQGNTIAGTTDQPCEIEAQPQPTEKDINWILSEIRGYIAPDI
FT                   TVDRSDVLAAWSGIRPLVRDPKVKNSEALVRNHLVTVSQSGLLTCAGGKWTTYRQMAEE
FT                   AVDEAINVFKLKPRQLSTLPDISGVGGSGLVADGAVLDGSCQTHQVRLIGAHGFSKTLF
FT                   INLIQHFGLETDVAKHLTESYGDRSWQVAALSSPTSERFPVRGCRISPMYPFIDGEVRY
FT                   AVRHEYAQTAVDVIARRTRLAFLNAEAALESLPTVIDLMGEELEWSTARKDLEWKDSLT
FT                   FLSSMGLPKSFMGLSRRDVQNGRVKQVDDAERATFSRNEPPADMIESDKRATTAAPAAP
FT                   AATPSLN"
FT   sig_peptide     420963..421034
FT                   /gene="Pc16g01790"
FT                   /locus_tag="PCH_Pc16g01790"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            420963..421393
FT                   /gene="Pc16g01790"
FT                   /locus_tag="PCH_Pc16g01790"
FT                   /number=1
FT   mat_peptide     join(421035..421393,421529..421788,421844..423172,
FT                   423235..423317)
FT                   /gene="Pc16g01790"
FT                   /locus_tag="PCH_Pc16g01790"
FT   intron          421394..421528
FT                   /gene="Pc16g01790"
FT                   /locus_tag="PCH_Pc16g01790"
FT                   /number=1
FT   exon            421529..421788
FT                   /gene="Pc16g01790"
FT                   /locus_tag="PCH_Pc16g01790"
FT                   /number=2
FT   intron          421789..421843
FT                   /gene="Pc16g01790"
FT                   /locus_tag="PCH_Pc16g01790"
FT                   /number=2
FT   exon            421844..423172
FT                   /gene="Pc16g01790"
FT                   /locus_tag="PCH_Pc16g01790"
FT                   /number=3
FT   intron          423173..423234
FT                   /gene="Pc16g01790"
FT                   /locus_tag="PCH_Pc16g01790"
FT                   /number=3
FT   exon            423235..423320
FT                   /gene="Pc16g01790"
FT                   /locus_tag="PCH_Pc16g01790"
FT                   /number=4
FT   mRNA            join(<423636..423799,423850..423863,423915..423987,
FT                   424041..424734,424791..424988,425052..>425216)
FT                   /gene="Pc16g01800"
FT                   /locus_tag="PCH_Pc16g01800"
FT   CDS_pept        join(423636..423799,423850..423863,423915..423987,
FT                   424041..424734,424791..424988,425052..425216)
FT                   /gene="Pc16g01800"
FT                   /locus_tag="PCH_Pc16g01800"
FT                   /note="Title: strong similarity to hypothetical neutral
FT                   amino acid permease - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01800"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92850"
FT                   /db_xref="GOA:B6H758"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:B6H758"
FT                   /inference="similar to AA sequence:PIR:S47892"
FT                   /inference="protein motif:PFAM:PF01490"
FT                   /inference="protein motif:COGS:COG0833"
FT                   /inference="protein motif:COGS:COG1113"
FT                   /protein_id="CAP92850.1"
FT                   /translation="MNPNQCEIDSQPLSFVKQKLDPDKESVLPKPELEEQDPFGDESQA
FT                   GVKYKTMAWWQAGMIMIAETISLGILALPKALAVLGLIPGILTILGVGTISTYTAYTIG
FT                   QFKCRHVRVHSMADAGDILMGKIGRSTLDVAQLVFFVLVMGSHVLTFSIMMNVLTEHSS
FT                   CTIIFSVVGLLASFMLTLPRRLERLSHISSVSFVSIVGAVLTGMIGVTLVKEGPVHVSA
FT                   FSPSPKVHDACLAIANIIFAYAGHVAFFTLFSELRELRDFPKALALLQMSEMVLYTVAA
FT                   IVIYAYIGPTVNSPALNSAGQLFRKISYAIAIPTIVIGGVVNAHVAVKFIYVRVFRGTN
FT                   SMHSRSFLARLLWAAICAALWILSWIIAEGIPVFNDVLGLASSLFASWFSFGLPGLFWL
FT                   YLNRSCWFLTWRQRVLFGFNIFLVFLGFVIVSCVPL"
FT   exon            423636..423799
FT                   /gene="Pc16g01800"
FT                   /locus_tag="PCH_Pc16g01800"
FT                   /number=1
FT   intron          423800..423849
FT                   /gene="Pc16g01800"
FT                   /locus_tag="PCH_Pc16g01800"
FT                   /number=1
FT   exon            423850..423863
FT                   /gene="Pc16g01800"
FT                   /locus_tag="PCH_Pc16g01800"
FT                   /number=2
FT   intron          423864..423914
FT                   /gene="Pc16g01800"
FT                   /locus_tag="PCH_Pc16g01800"
FT                   /number=2
FT   exon            423915..423987
FT                   /gene="Pc16g01800"
FT                   /locus_tag="PCH_Pc16g01800"
FT                   /number=3
FT   intron          423988..424040
FT                   /gene="Pc16g01800"
FT                   /locus_tag="PCH_Pc16g01800"
FT                   /number=3
FT   exon            424041..424734
FT                   /gene="Pc16g01800"
FT                   /locus_tag="PCH_Pc16g01800"
FT                   /number=4
FT   intron          424735..424790
FT                   /gene="Pc16g01800"
FT                   /locus_tag="PCH_Pc16g01800"
FT                   /number=4
FT   exon            424791..424988
FT                   /gene="Pc16g01800"
FT                   /locus_tag="PCH_Pc16g01800"
FT                   /number=5
FT   intron          424989..425051
FT                   /gene="Pc16g01800"
FT                   /locus_tag="PCH_Pc16g01800"
FT                   /number=5
FT   exon            425052..425216
FT                   /gene="Pc16g01800"
FT                   /locus_tag="PCH_Pc16g01800"
FT                   /number=6
FT   mRNA            complement(<426741..>427043)
FT                   /gene="Pc16g01810"
FT                   /locus_tag="PCH_Pc16g01810"
FT   CDS_pept        complement(426741..427043)
FT                   /gene="Pc16g01810"
FT                   /locus_tag="PCH_Pc16g01810"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig46_part_i.tfa_70cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01810"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92851"
FT                   /db_xref="UniProtKB/TrEMBL:B6H759"
FT                   /protein_id="CAP92851.1"
FT                   /translation="MPNLPLSRSWPEIRQALEHARECEDGPVNAQSAAVLEAAITELWN
FT                   RIQAQPESYVLTPDEFALFNYFLATRYRGSTVAQRAVARFWNSYQKTTNCDGVSN"
FT   exon            complement(426741..427043)
FT                   /gene="Pc16g01810"
FT                   /locus_tag="PCH_Pc16g01810"
FT                   /number=1
FT   mRNA            join(<429792..429864,429920..429963,430082..430208,
FT                   430270..>430670)
FT                   /gene="Pc16g01820"
FT                   /locus_tag="PCH_Pc16g01820"
FT   CDS_pept        join(429792..429864,429920..429963,430082..430208,
FT                   430270..430670)
FT                   /gene="Pc16g01820"
FT                   /locus_tag="PCH_Pc16g01820"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g00280 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01820"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92852"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="InterPro:IPR039730"
FT                   /db_xref="UniProtKB/TrEMBL:B6H760"
FT                   /inference="protein motif:PFAM:PF05670"
FT                   /protein_id="CAP92852.1"
FT                   /translation="MVFYFTSTVVEPSAFIYVGKDKFENEDLIKYGLDNDVWYFHVDNL
FT                   SSAHVYVRLREGETWDNIAQPLLEDCAQLTKANSIEGNKKDNITIIYTPWSNLKKDGSM
FT                   AAGQVTFHNHKLVRKIYVKQRENPIVNRLNKTRVEKFPDLRAEKEEDMKKKQRSDRKAR
FT                   DEQRAKEKKKQQEYEQLKWQKNHAYDDMFTEENMEASNNQDRDEDFLDDFM"
FT   exon            429792..429864
FT                   /gene="Pc16g01820"
FT                   /locus_tag="PCH_Pc16g01820"
FT                   /number=1
FT   intron          429865..429919
FT                   /gene="Pc16g01820"
FT                   /locus_tag="PCH_Pc16g01820"
FT                   /number=1
FT   exon            429920..429963
FT                   /gene="Pc16g01820"
FT                   /locus_tag="PCH_Pc16g01820"
FT                   /number=2
FT   intron          429964..430081
FT                   /gene="Pc16g01820"
FT                   /locus_tag="PCH_Pc16g01820"
FT                   /number=2
FT   exon            430082..430208
FT                   /gene="Pc16g01820"
FT                   /locus_tag="PCH_Pc16g01820"
FT                   /number=3
FT   intron          430209..430269
FT                   /gene="Pc16g01820"
FT                   /locus_tag="PCH_Pc16g01820"
FT                   /number=3
FT   exon            430270..430670
FT                   /gene="Pc16g01820"
FT                   /locus_tag="PCH_Pc16g01820"
FT                   /number=4
FT   mRNA            join(<431282..431315,431363..431466,431522..431941,
FT                   431995..432710,432770..432876,432940..>433181)
FT                   /gene="Pc16g01830"
FT                   /locus_tag="PCH_Pc16g01830"
FT   CDS_pept        join(431282..431315,431363..431466,431522..431941,
FT                   431995..432710,432770..432876,432940..433181)
FT                   /gene="Pc16g01830"
FT                   /locus_tag="PCH_Pc16g01830"
FT                   /note="Title: similarity to golgin-160 related protein Rud3
FT                   - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01830"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92853"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="InterPro:IPR019459"
FT                   /db_xref="UniProtKB/TrEMBL:B6H761"
FT                   /inference="similar to AA sequence:PIR:S60943"
FT                   /inference="protein motif:COGS:COG0542"
FT                   /protein_id="CAP92853.1"
FT                   /translation="MSEGNPPSATPSAKSKKNKKKAAKAKADSKADEHAEDAPGDHDDT
FT                   DNEPHDANEDPIQVPESNGAKLNTIDGSLPDRSVNNQGPVATSDVPSGTDIHSDPASDG
FT                   TEPKDRFDALVRDRDSLRAEVADMRKSLEEIQSKHTADMEALQQKLDDAENKKEQAETQ
FT                   FQMLLERVNTIKSQLGERLKEDAEELALARSQIEDLEDENNNLKDELNSKSTQLIELSE
FT                   DSAEKEKELSTLRDRTNLSQQNWLKEKEELLEQESYLQSEFEQAKEAMHNWEILAMEER
FT                   SIRENLNEKVADLEEQLSSLRDGYERATHERDTQQSTVDGLQRALQEIQLARKQELREL
FT                   VESSDSQLENLRRSLREAQKQATDADKALQNAKEEIERVRPFEKEVKEKNLLIGKLRHE
FT                   AVTLNDHLTKALRFLKKGKPEDNVDRHIVTNHFLHFLALDRSDPKKFQILQLIAALLGW
FT                   NDEQREQAGLARPGTSSMPGKLRVPGTPLRTPSTPNLATEFMDNGASSKETLAELWSNF
FT                   LEQEAEVGNMSSSRRGSQQGPPK"
FT   exon            431282..431315
FT                   /gene="Pc16g01830"
FT                   /locus_tag="PCH_Pc16g01830"
FT                   /number=1
FT   intron          431316..431362
FT                   /gene="Pc16g01830"
FT                   /locus_tag="PCH_Pc16g01830"
FT                   /number=1
FT   exon            431363..431466
FT                   /gene="Pc16g01830"
FT                   /locus_tag="PCH_Pc16g01830"
FT                   /number=2
FT   intron          431467..431521
FT                   /gene="Pc16g01830"
FT                   /locus_tag="PCH_Pc16g01830"
FT                   /number=2
FT   exon            431522..431941
FT                   /gene="Pc16g01830"
FT                   /locus_tag="PCH_Pc16g01830"
FT                   /number=3
FT   intron          431942..431994
FT                   /gene="Pc16g01830"
FT                   /locus_tag="PCH_Pc16g01830"
FT                   /number=3
FT   exon            431995..432710
FT                   /gene="Pc16g01830"
FT                   /locus_tag="PCH_Pc16g01830"
FT                   /number=4
FT   intron          432711..432769
FT                   /gene="Pc16g01830"
FT                   /locus_tag="PCH_Pc16g01830"
FT                   /number=4
FT   exon            432770..432876
FT                   /gene="Pc16g01830"
FT                   /locus_tag="PCH_Pc16g01830"
FT                   /number=5
FT   intron          432877..432939
FT                   /gene="Pc16g01830"
FT                   /locus_tag="PCH_Pc16g01830"
FT                   /number=5
FT   exon            432940..433181
FT                   /gene="Pc16g01830"
FT                   /locus_tag="PCH_Pc16g01830"
FT                   /number=6
FT   mRNA            join(<433511..433520,433602..433706,433782..433889,
FT                   433944..434074,434131..>434367)
FT                   /gene="Pc16g01840"
FT                   /locus_tag="PCH_Pc16g01840"
FT   CDS_pept        join(433511..433520,433602..433706,433782..433889,
FT                   433944..434074,434131..434367)
FT                   /gene="Pc16g01840"
FT                   /locus_tag="PCH_Pc16g01840"
FT                   /note="unknown EC_number=2.7.4.8"
FT                   /note="Title: strong similarity to guanylate kinase Guk1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01840"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92854"
FT                   /db_xref="GOA:B6H762"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6H762"
FT                   /inference="similar to AA sequence:PIR:KIBYGU"
FT                   /inference="protein motif:PFAM:PF00625"
FT                   /inference="protein motif:COGS:COG3842"
FT                   /inference="protein motif:COGS:COG3839"
FT                   /inference="protein motif:COGS:COG1118"
FT                   /protein_id="CAP92854.1"
FT                   /translation="MASAYRPIVISGPSGTGKSTLLKRLFAEYPDTFGFSISETTRSPR
FT                   PGEQDGREYNFVTKDAFLDLVAKNGFIEHAQFGGNFYGTSVQAVKNIAEKKRICILDIE
FT                   MEGVKQVKRTDLNARFLFLAPPSLEVLEQRLRGRGTETEESLQRRLTQARNELEYANQP
FT                   AAHDKIVVNDDLEKAYAELRDWVVDGGKFGAAQ"
FT   exon            433511..433520
FT                   /gene="Pc16g01840"
FT                   /locus_tag="PCH_Pc16g01840"
FT                   /number=1
FT   intron          433521..433601
FT                   /gene="Pc16g01840"
FT                   /locus_tag="PCH_Pc16g01840"
FT                   /number=1
FT   exon            433602..433706
FT                   /gene="Pc16g01840"
FT                   /locus_tag="PCH_Pc16g01840"
FT                   /number=2
FT   intron          433707..433781
FT                   /gene="Pc16g01840"
FT                   /locus_tag="PCH_Pc16g01840"
FT                   /number=2
FT   exon            433782..433889
FT                   /gene="Pc16g01840"
FT                   /locus_tag="PCH_Pc16g01840"
FT                   /number=3
FT   intron          433890..433943
FT                   /gene="Pc16g01840"
FT                   /locus_tag="PCH_Pc16g01840"
FT                   /number=3
FT   exon            433944..434074
FT                   /gene="Pc16g01840"
FT                   /locus_tag="PCH_Pc16g01840"
FT                   /number=4
FT   intron          434075..434130
FT                   /gene="Pc16g01840"
FT                   /locus_tag="PCH_Pc16g01840"
FT                   /number=4
FT   exon            434131..434367
FT                   /gene="Pc16g01840"
FT                   /locus_tag="PCH_Pc16g01840"
FT                   /number=5
FT   mRNA            complement(join(<434752..435096,435145..435358,
FT                   435430..435567,435622..435703,435759..435887,
FT                   435949..>436087))
FT                   /gene="Pc16g01850"
FT                   /locus_tag="PCH_Pc16g01850"
FT   CDS_pept        complement(join(434752..435096,435145..435358,
FT                   435430..435567,435622..435703,435759..435887,
FT                   435949..436087))
FT                   /gene="Pc16g01850"
FT                   /locus_tag="PCH_Pc16g01850"
FT                   /note="Title: strong similarity to septin aspD -Aspergillus
FT                   nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01850"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92855"
FT                   /db_xref="GOA:B6H763"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:B6H763"
FT                   /inference="similar to AA sequence:TREMBL:AF299322.1"
FT                   /inference="protein motif:PFAM:PF00735"
FT                   /inference="protein motif:COGS:COG5019"
FT                   /inference="protein motif:COGS:COG0218"
FT                   /inference="protein motif:COGS:COG2262"
FT                   /protein_id="CAP92855.1"
FT                   /translation="MAAATTAAQAQQPTVFPHSHVGFDSITSQIERKLLKRGFQFNVMC
FT                   VGQTGLGKSTLINTIFASHLIDSKGRLTPSEPVRSTTEIKTESHIIEENGVRLRLNIVD
FT                   TPGYGDQVNNDRCWDPIVKYIKDQHSAYLRKELTAQRERYIQDTRVHCCLFFIQPSGHA
FT                   LKPIDIVVLKKLSDVVNVVPVIAKSDSLTLEERQAFQERIKEEFSFHNLKMYPYDNDEL
FT                   DDEERAINAQIKLQDIIPFSVVGSEKTIVVNGKQVRGRQNRWGVINVEDENHCEFVYLR
FT                   NFLTRTHLQDLVETTSQIHYETFRAKQLLALKESSAAGGHTGGSRPISPSADRELSRNS
FT                   QRAAMNGY"
FT   exon            complement(434752..435096)
FT                   /gene="Pc16g01850"
FT                   /locus_tag="PCH_Pc16g01850"
FT                   /number=1
FT   intron          complement(435097..435144)
FT                   /gene="Pc16g01850"
FT                   /locus_tag="PCH_Pc16g01850"
FT                   /number=1
FT   exon            complement(435145..435358)
FT                   /gene="Pc16g01850"
FT                   /locus_tag="PCH_Pc16g01850"
FT                   /number=2
FT   intron          complement(435359..435429)
FT                   /gene="Pc16g01850"
FT                   /locus_tag="PCH_Pc16g01850"
FT                   /number=2
FT   exon            complement(435430..435567)
FT                   /gene="Pc16g01850"
FT                   /locus_tag="PCH_Pc16g01850"
FT                   /number=3
FT   intron          complement(435568..435621)
FT                   /gene="Pc16g01850"
FT                   /locus_tag="PCH_Pc16g01850"
FT                   /number=3
FT   exon            complement(435622..435703)
FT                   /gene="Pc16g01850"
FT                   /locus_tag="PCH_Pc16g01850"
FT                   /number=4
FT   intron          complement(435704..435758)
FT                   /gene="Pc16g01850"
FT                   /locus_tag="PCH_Pc16g01850"
FT                   /number=4
FT   exon            complement(435759..435887)
FT                   /gene="Pc16g01850"
FT                   /locus_tag="PCH_Pc16g01850"
FT                   /number=5
FT   intron          complement(435888..435948)
FT                   /gene="Pc16g01850"
FT                   /locus_tag="PCH_Pc16g01850"
FT                   /number=5
FT   exon            complement(435949..436087)
FT                   /gene="Pc16g01850"
FT                   /locus_tag="PCH_Pc16g01850"
FT                   /number=6
FT   mRNA            join(<436375..436711,436780..>436817)
FT                   /gene="Pc16g01860"
FT                   /locus_tag="PCH_Pc16g01860"
FT   CDS_pept        join(436375..436711,436780..436817)
FT                   /gene="Pc16g01860"
FT                   /locus_tag="PCH_Pc16g01860"
FT                   /note="Title: similarity to mitochondrial ribosomal protein
FT                   of the large subunit Yml32 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01860"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92856"
FT                   /db_xref="GOA:B6H764"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:B6H764"
FT                   /inference="similar to AA sequence:PIR:R5BY32"
FT                   /inference="protein motif:PFAM:PF01783"
FT                   /inference="protein motif:COGS:COG0333"
FT                   /protein_id="CAP92856.1"
FT                   /translation="MALRLLPFAPATMSRSLLSESLQFPRLARFPPITPIATRFLQPVS
FT                   ISLNIPSLLSDLWDSVLRAVPKKKTSHMKKRHRQMAGKALKDVKSLNKCPGCGQIKRAH
FT                   LLCPNCVKDIKESWRTLDMA"
FT   sig_peptide     436375..436431
FT                   /gene="Pc16g01860"
FT                   /locus_tag="PCH_Pc16g01860"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            436375..436711
FT                   /gene="Pc16g01860"
FT                   /locus_tag="PCH_Pc16g01860"
FT                   /number=1
FT   mat_peptide     join(436432..436711,436780..436814)
FT                   /gene="Pc16g01860"
FT                   /locus_tag="PCH_Pc16g01860"
FT   intron          436712..436779
FT                   /gene="Pc16g01860"
FT                   /locus_tag="PCH_Pc16g01860"
FT                   /number=1
FT   exon            436780..436817
FT                   /gene="Pc16g01860"
FT                   /locus_tag="PCH_Pc16g01860"
FT                   /number=2
FT   mRNA            join(<437409..437525,437587..437623,437683..437943,
FT                   438014..438168,438224..438317,438370..438556,
FT                   438608..>438788)
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT   CDS_pept        join(437409..437525,437587..437623,437683..437943,
FT                   438014..438168,438224..438317,438370..438556,
FT                   438608..438788)
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /note="Title: strong similarity to meiotic recombination
FT                   protein rec14p - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01870"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92857"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B6H765"
FT                   /inference="similar to AA sequence:PIR:T40226"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP92857.1"
FT                   /translation="MNKKKSGDKGGTGLRAPTSLFLRKQSLDTALRELGIIRMSKQYLS
FT                   RGSADNAHIFDIFSLAITDKQILSVSGASSIKVHSTTDADFPLVQSIDGAHTIGCHHIA
FT                   INGNGSRAITAGFDGEIKAWSCEDGHWTADRKLTGADAWAIAISEDGQYLAGVTQEGRI
FT                   NVWDLSADGTRIRDHETRGNFGTCIDLSPDGRLIASGHEDGAVYIFSTETGRMPISLLG
FT                   LVNPVRAVAFSPRSKILAAAGDSKVIVLYDTSSGEQIANLSGHSAWILSLSWSDTGEYL
FT                   LSSSFDGKVKVWSMETKACVATHSETDKAVWSAKWLPKVGRTEGFATAGANRSIAFYRE
FT                   ATG"
FT   exon            437409..437525
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /number=1
FT   intron          437526..437586
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /number=1
FT   exon            437587..437623
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /number=2
FT   intron          437624..437682
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /number=2
FT   exon            437683..437943
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /number=3
FT   intron          437944..438013
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /number=3
FT   exon            438014..438168
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /number=4
FT   intron          438169..438223
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /number=4
FT   exon            438224..438317
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /number=5
FT   intron          438318..438369
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /number=5
FT   exon            438370..438556
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /number=6
FT   intron          438557..438607
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /number=6
FT   exon            438608..438788
FT                   /gene="Pc16g01870"
FT                   /locus_tag="PCH_Pc16g01870"
FT                   /number=7
FT   mRNA            complement(join(<438937..439481,439554..>439785))
FT                   /gene="Pc16g01880"
FT                   /locus_tag="PCH_Pc16g01880"
FT   CDS_pept        complement(join(438937..439481,439554..439785))
FT                   /gene="Pc16g01880"
FT                   /locus_tag="PCH_Pc16g01880"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPCC188.04c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01880"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92858"
FT                   /db_xref="InterPro:IPR013255"
FT                   /db_xref="UniProtKB/TrEMBL:B6H766"
FT                   /inference="similar to AA sequence:PIR:T41184"
FT                   /protein_id="CAP92858.1"
FT                   /translation="MTSSFEPSLSTSGMRPPLASADAPSMADSLPSINFGFEDLRNSMA
FT                   QFTVKFDAFIERGRKRLLEERNQFHINLAEYEEDERMRQRDIEILNLKSQTHEQTLQKE
FT                   AAEAAEMHAAISSITLERDARLAKRDRLKQQIAETQKAISQKVEAQKSHAQHLDAQSRL
FT                   NFPELEFWQDYLCLRIEGAGREDRLKFVYSHLLEKDWEAEAWFELGTASRDYEVFHTRP
FT                   KVDRDALEHVVDLVNDDRDFGAFLKRMRKLFVETMN"
FT   exon            complement(438937..439481)
FT                   /gene="Pc16g01880"
FT                   /locus_tag="PCH_Pc16g01880"
FT                   /number=1
FT   intron          complement(439482..439553)
FT                   /gene="Pc16g01880"
FT                   /locus_tag="PCH_Pc16g01880"
FT                   /number=1
FT   exon            complement(439554..439785)
FT                   /gene="Pc16g01880"
FT                   /locus_tag="PCH_Pc16g01880"
FT                   /number=2
FT   mRNA            join(<440051..441399,441454..>443093)
FT                   /pseudo
FT                   /gene="Pc16g01890"
FT                   /locus_tag="PCH_Pc16g01890"
FT                   /note="submitted as non-pseudo"
FT   CDS_pept        join(440051..441399,441454..443093)
FT                   /pseudo
FT                   /gene="Pc16g01890"
FT                   /locus_tag="PCH_Pc16g01890"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: weak similarity to transcription initiation
FT                   factor Rrn6 - Saccharomyces cerevisiae"
FT                   /inference="similar to AA sequence:PIR:S25332"
FT   exon            440051..441399
FT                   /gene="Pc16g01890"
FT                   /locus_tag="PCH_Pc16g01890"
FT                   /number=1
FT   intron          441400..441453
FT                   /gene="Pc16g01890"
FT                   /locus_tag="PCH_Pc16g01890"
FT                   /number=1
FT   exon            441454..443093
FT                   /gene="Pc16g01890"
FT                   /locus_tag="PCH_Pc16g01890"
FT                   /number=2
FT   mRNA            join(<443412..443499,443556..>443707)
FT                   /gene="Pc16g01900"
FT                   /locus_tag="PCH_Pc16g01900"
FT   CDS_pept        join(443412..443499,443556..443707)
FT                   /gene="Pc16g01900"
FT                   /locus_tag="PCH_Pc16g01900"
FT                   /note="Title: strong similarity to copper transport protein
FT                   like protein An08g00370 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01900"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92860"
FT                   /db_xref="GOA:B6H796"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B6H796"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /inference="protein motif:COGS:COG2217"
FT                   /protein_id="CAP92860.1"
FT                   /translation="MSDHQYKFNVTMTCGGCSGAVERVLKKLEGVKTFDVSLETQTVNV
FT                   TTEPTLSYDDVLEKIKKTGKAVNSGEADGESKEV"
FT   exon            443412..443499
FT                   /gene="Pc16g01900"
FT                   /locus_tag="PCH_Pc16g01900"
FT                   /number=1
FT   intron          443500..443555
FT                   /gene="Pc16g01900"
FT                   /locus_tag="PCH_Pc16g01900"
FT                   /number=1
FT   exon            443556..443707
FT                   /gene="Pc16g01900"
FT                   /locus_tag="PCH_Pc16g01900"
FT                   /number=2
FT   mRNA            complement(join(<444307..445772,445938..446460,
FT                   446525..446818,446878..446997,447050..>447184))
FT                   /gene="Pc16g01910"
FT                   /locus_tag="PCH_Pc16g01910"
FT   CDS_pept        complement(join(444307..445772,445938..446460,
FT                   446525..446818,446878..446997,447050..447184))
FT                   /gene="Pc16g01910"
FT                   /locus_tag="PCH_Pc16g01910"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   Rv2802c - Mycobacterium tuberculosis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01910"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92861"
FT                   /db_xref="InterPro:IPR018744"
FT                   /db_xref="UniProtKB/TrEMBL:B6H797"
FT                   /inference="similar to AA sequence:PIR:E70689"
FT                   /protein_id="CAP92861.1"
FT                   /translation="MARVTRRAASASARHGAGRAVQRRARRHKVIMESVTQEKKKLRSV
FT                   ICFEAQAPSGYTFIPAGNPQLTTTCKERCRAEGLQIHAVSTTPHHRHHNLSQHVHRIGY
FT                   HFPSTVVAAVCSELGFYLTSTGKTVPSTFPTDRIENSKRADSEVSQITLNTEARDALKD
FT                   LFPNIPDKDLNQIIKTAFQKGQNKVGTATELPLARRVQLAVVAHVRHVYTDYDRLLKTT
FT                   SFHEARGVVEHTTLAKVIEWRGDDENGQTVLEDVFREVIVISDDDDSESEEETADLAGH
FT                   QNTSVEILPSDTRAHEIRSQPINNTNPLGRDLARELSEEAPPGFRFVTRAPATDTINRR
FT                   GFNRYKAWTRAVKEYREASNDSQAHRVPAIPLMDRQVAKRHVGVQENYLHSDVQQKYSA
FT                   HELNARPTGLTNQESPELQILEELSGPRNVNMSHSQDVPPPRMEPRFRQRLPPQSDRTN
FT                   APVFVSGPKDNRQKLTPVGRRPDAGNSPLLRLGSNTQDSILPSIENPRPPENRRTDGAN
FT                   PLVHMANKMSLRSVTPGHPQGEMMPQPDVIEKEGDSGQASKRRRLACREGSRTESRPDP
FT                   WSARPMGLPVSDGFGPPSYRPVELVPDYRAQDQPHFRRDYLPVEPPPVVGYQRESNPNA
FT                   FSYSSAQHGPETRSVLGRQPISGPHEPQSKVGLSGTSIIVSEGDRNFRAAPAVSDSGPW
FT                   HLYHGDRSFRSDCVPKEPRAIRRTRIDGGRPLSENVHSDRNLYAEDFVRHVDHREPPPF
FT                   EYVSRRAGPAAKPIGESSQTARTRDLDYLGTKNLSQTQVSSDQHRPLPIGRVAPSHDHL
FT                   RTFSDPVGKIQPHVSLPQVPRERPASGGFNSSR"
FT   exon            complement(444307..445772)
FT                   /gene="Pc16g01910"
FT                   /locus_tag="PCH_Pc16g01910"
FT                   /number=1
FT   intron          complement(445773..445937)
FT                   /gene="Pc16g01910"
FT                   /locus_tag="PCH_Pc16g01910"
FT                   /number=1
FT   exon            complement(445938..446460)
FT                   /gene="Pc16g01910"
FT                   /locus_tag="PCH_Pc16g01910"
FT                   /number=2
FT   intron          complement(446461..446524)
FT                   /gene="Pc16g01910"
FT                   /locus_tag="PCH_Pc16g01910"
FT                   /number=2
FT   exon            complement(446525..446818)
FT                   /gene="Pc16g01910"
FT                   /locus_tag="PCH_Pc16g01910"
FT                   /number=3
FT   intron          complement(446819..446877)
FT                   /gene="Pc16g01910"
FT                   /locus_tag="PCH_Pc16g01910"
FT                   /number=3
FT   exon            complement(446878..446997)
FT                   /gene="Pc16g01910"
FT                   /locus_tag="PCH_Pc16g01910"
FT                   /number=4
FT   intron          complement(446998..447049)
FT                   /gene="Pc16g01910"
FT                   /locus_tag="PCH_Pc16g01910"
FT                   /number=4
FT   exon            complement(447050..447184)
FT                   /gene="Pc16g01910"
FT                   /locus_tag="PCH_Pc16g01910"
FT                   /number=5
FT   mRNA            <447782..>448090
FT                   /gene="Pc16g01920"
FT                   /locus_tag="PCH_Pc16g01920"
FT   CDS_pept        447782..448090
FT                   /gene="Pc16g01920"
FT                   /locus_tag="PCH_Pc16g01920"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   SPAC806.05 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01920"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92862"
FT                   /db_xref="UniProtKB/TrEMBL:B6H798"
FT                   /inference="similar to AA sequence:PIR:T39097"
FT                   /protein_id="CAP92862.1"
FT                   /translation="MNASIQAMKVDQRAMIHAYRHLYRQGLKAIQYSTPGRHILLKSLR
FT                   NSYRSSPSEQFDPAKITNTLRFLERATEVAGMEHKILKNLLLARYWEQGHLARESRV"
FT   exon            447782..448090
FT                   /gene="Pc16g01920"
FT                   /locus_tag="PCH_Pc16g01920"
FT                   /number=1
FT   mRNA            join(<448941..450173,450224..450588,450640..>451228)
FT                   /gene="Pc16g01930"
FT                   /locus_tag="PCH_Pc16g01930"
FT   CDS_pept        join(448941..450173,450224..450588,450640..451228)
FT                   /gene="Pc16g01930"
FT                   /locus_tag="PCH_Pc16g01930"
FT                   /note="Title: strong similarity to hypothetical zinc-finger
FT                   protein - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01930"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92863"
FT                   /db_xref="GOA:B6H799"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="InterPro:IPR037275"
FT                   /db_xref="InterPro:IPR039512"
FT                   /db_xref="UniProtKB/TrEMBL:B6H799"
FT                   /inference="similar to AA sequence:PIR:T38548"
FT                   /inference="protein motif:PFAM:PF05495"
FT                   /inference="protein motif:PFAM:PF00097"
FT                   /inference="protein motif:COGS:COG1453"
FT                   /inference="protein motif:COGS:COG4357"
FT                   /inference="protein motif:COGS:COG5574"
FT                   /inference="protein motif:COGS:COG5243"
FT                   /inference="protein motif:COGS:COG0553"
FT                   /inference="protein motif:COGS:COG1716"
FT                   /inference="protein motif:COGS:COG5219"
FT                   /inference="protein motif:COGS:COG5175"
FT                   /inference="protein motif:COGS:COG5540"
FT                   /protein_id="CAP92863.1"
FT                   /translation="MSGFISSLLIQIGIRSPLPPQPSKQPNDDQAKFHLNEPTNPSCNS
FT                   EDHKFGPQLDQDHGQKSNCGDAGAGSLHSPPFFTTLPKEMDGRNLQAEGTRSVTDNTPG
FT                   SRNIAATTVGSLDPTYEIDVTAQPDGSGNPQGSHPSEVSNSPSEPQYAASGIAIGEPRR
FT                   SLDNALDPEGLTQSSLPADDGMGVLRSKIIAIRELGLTNVEKARMVHGLMTEGYNSSRE
FT                   LPNTSSPPSLELPTSPRTPRASEINTSRPGSPYTESVPLYESTFNLTTEDLQPTFVPKA
FT                   ETEPPELETGDEDCDTEEQEETILGCVHYQRNVKLECYTCKKWYTCRFCHDEVEDHTLV
FT                   RRDTEHMLCMLCGHAQPAAQNCRQCSEQTAQYYCEICKLWDNDSKKSIYHCSDCGICRI
FT                   GQGLGKDFFHCQTCSVCLPMCIENTHRCIERSTQCDCPICGDYMFTSPETVVVMRCGHS
FT                   IHHKCLSEYSKSSFRCPLCSKTITNMESTFRNLDRTIESQPMPEEFKDTKGLIYCNDCG
FT                   SKSVVKYHWLGLRCDLCESYNTAQLRILHGDMSAQPDEDSGEDLLPRPRSSSVIENDDS
FT                   MSSSLAALNVNNTSVPRSRLSVPMSPEPVRRFSSYNITRGRAVSPVVSNYFGLPTERES
FT                   EKPSSMPFFGGPSRGENEDYGALNFLSKKLTYRYGLFGGETKSVEKVLETGDEEEDDDD
FT                   GESSDSAESDGSHGTEDDEEEEEDQDHIQIFGHQ"
FT   exon            448941..450173
FT                   /gene="Pc16g01930"
FT                   /locus_tag="PCH_Pc16g01930"
FT                   /number=1
FT   intron          450174..450223
FT                   /gene="Pc16g01930"
FT                   /locus_tag="PCH_Pc16g01930"
FT                   /number=1
FT   exon            450224..450588
FT                   /gene="Pc16g01930"
FT                   /locus_tag="PCH_Pc16g01930"
FT                   /number=2
FT   intron          450589..450639
FT                   /gene="Pc16g01930"
FT                   /locus_tag="PCH_Pc16g01930"
FT                   /number=2
FT   exon            450640..451228
FT                   /gene="Pc16g01930"
FT                   /locus_tag="PCH_Pc16g01930"
FT                   /number=3
FT   mRNA            join(<451260..451519,451567..>451702)
FT                   /gene="Pc16g01940"
FT                   /locus_tag="PCH_Pc16g01940"
FT   CDS_pept        join(451260..451519,451567..451702)
FT                   /gene="Pc16g01940"
FT                   /locus_tag="PCH_Pc16g01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01940"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A0"
FT                   /protein_id="CAP92864.1"
FT                   /translation="MADGLVYRPGECDPAALFLPSSIIPSQAVHRAMNTVQLERSPTPL
FT                   VGFDFRSISDPVPHRVDKNPSRPIPFCTKAISLSLCVPLHMGQPSEGQLNALRGCWSYI
FT                   HQAAGFAAALRSLLFWLSKHTGVMTQR"
FT   exon            451260..451519
FT                   /gene="Pc16g01940"
FT                   /locus_tag="PCH_Pc16g01940"
FT                   /number=1
FT   intron          451520..451566
FT                   /gene="Pc16g01940"
FT                   /locus_tag="PCH_Pc16g01940"
FT                   /number=1
FT   exon            451567..451702
FT                   /gene="Pc16g01940"
FT                   /locus_tag="PCH_Pc16g01940"
FT                   /number=2
FT   mRNA            <453082..>453459
FT                   /gene="Pc16g01950"
FT                   /locus_tag="PCH_Pc16g01950"
FT   CDS_pept        453082..453459
FT                   /gene="Pc16g01950"
FT                   /locus_tag="PCH_Pc16g01950"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig46_part_i.tfa_150wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01950"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92865"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A1"
FT                   /protein_id="CAP92865.1"
FT                   /translation="MQIIHGKGEERHFKVTHELSQPYRLYNIVHDPSHLTQITIFDPKV
FT                   PLREETRSQPDQFVAIISENGAKGELDTSHTSPWNRQVASEGNNENVGERKDLCFVPYY
FT                   LRADRGGRGRGQMRVSVLSTE"
FT   exon            453082..453459
FT                   /gene="Pc16g01950"
FT                   /locus_tag="PCH_Pc16g01950"
FT                   /number=1
FT   mRNA            <454035..>456974
FT                   /gene="Pc16g01960"
FT                   /locus_tag="PCH_Pc16g01960"
FT   CDS_pept        454035..456974
FT                   /gene="Pc16g01960"
FT                   /locus_tag="PCH_Pc16g01960"
FT                   /note="Title: similarity to hypothetical protein BAA92131.1
FT                   - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01960"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92866"
FT                   /db_xref="InterPro:IPR008862"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A2"
FT                   /inference="similar to AA sequence:TREMBLNEW:AK002198.1"
FT                   /inference="protein motif:PFAM:PF05794"
FT                   /inference="protein motif:COGS:COG3468"
FT                   /inference="protein motif:COGS:COG5281"
FT                   /inference="protein motif:COGS:COG1418"
FT                   /inference="protein motif:COGS:COG3264"
FT                   /inference="protein motif:COGS:COG0542"
FT                   /protein_id="CAP92866.1"
FT                   /translation="MIRRNSDIEIQLPDAGPTPLSPESVSDLDVEMLSEESALPLSLPP
FT                   HIAARFYRKSSKARRSSAVSSRRSSVSSLHSHHSNTSSNGSPGADHIAQHLRRTSILES
FT                   RKARLADRALHAEKVRLRAALAKAATRNLQFEERALAAQQARERLLADITAKCEDQVKR
FT                   AKKKAEDQREKKAAEQARLRLEMAEKLAEAEKRRTLYQQTHRRQRTSSLPATEEKKMSR
FT                   EVTKSLTQDAAARKIQRVWRTHNAKMTMQRFQSLNLSVARVRDMTFEEVGALLSNRKLL
FT                   DTMTNVLRLCGLQDMEGGAMGERGAVRTFLSSYLIVTHPKEVLSSDGDQEQDLIAKARE
FT                   LLVAFDQVTALLSSGCCSPSVITADLQTLCESHNVFFSAFHAWKSHDSSVLIEIMVAQF
FT                   VELELIWQTVKNDKAGGAAEDYRLGIRQNQVLLLARLKRLAGPDRHMEMIRDSLKKAKR
FT                   EKKRAAPKQAIPRSAETAPPTTEATQSVTSPLSESFNNIDAAVFQELDKQRTSPHERFT
FT                   KILTPLPENRELVHELLINKEFKIEEAPYTEPRRQIMKQMCDTMRRGVEAGHGTNWTVA
FT                   MATVIQDRLLRSLQRGNSLYVIISEVLDPKLVQGQCEAGTFSYDNFFEFMNNILPRLCA
FT                   PYRDPVVKAYIEDTSGDAIDRLARLMSIIDLLSLDQTNFMIQLAAPQLIEEAPGYEKRA
FT                   FDRDVTDGTISLGKTRRFWRIHRKIIVDEMKKRDPEGVQGEPRPSSARVYAQGLADTVL
FT                   SNAVVSEDLVPETLSLDRQRLERLHAKAFQIVATASILLTAKNLLKRDARSQWKPEADR
FT                   ILSLDFNEISAERVQSILEATHPMPPAASAQLKATIKRVLGPVATACLAAAPQLAVVTS
FT                   ETSASDASVSSTDSPGTTTSAPSFSDPVTKLILSRLRGHVLSRLSASSASERVRATTTA
FT                   SQNLAGAGMPEFVNEVGKLVEELEKVREVDWLCHGAIYEGLYEEGVPAQ"
FT   exon            454035..456974
FT                   /gene="Pc16g01960"
FT                   /locus_tag="PCH_Pc16g01960"
FT                   /number=1
FT   mRNA            <457355..>458722
FT                   /gene="Pc16g01970"
FT                   /locus_tag="PCH_Pc16g01970"
FT   CDS_pept        457355..458722
FT                   /gene="Pc16g01970"
FT                   /locus_tag="PCH_Pc16g01970"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_19_scaffold_1.tfa_120cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01970"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92867"
FT                   /db_xref="GOA:B6H7A3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR028608"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H7A3"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP92867.1"
FT                   /translation="MSPKVTITHLSDLTPPSQERTWLTAPHPTLPLVATCSSDKTIRVY
FT                   SLTNFTLLSTITGGHKRSVRTAAWKPHMTGESVLATGSFDATVGIWRRWDSYGQEGDAG
FT                   MGMSSGDKQIPTDISTAASNGTGTDTADREEDEEEWRFAVLLDGHDSEVKSVSWSASGM
FT                   LLATCSRDKSIWIWEDLDDGDNNFETVAVMQEHGGDVKCVSWHPSEECLASGSYDDTIR
FT                   LWREDLDDWGQVACIKGHGGTVWFLDWEGEETEGNWSGPVADSVSESALSALQAQWRSQ
FT                   RALSGPRLLSCSDDRTVRVWRRQPKESQQTGPLSSATTGIPSIIRPTGTDEVWEEDAVL
FT                   PRAHELPVYAVAWSKRTGLVASTGADGRIALYEERFVTREQEQEQQADSDAMDTTSGDV
FT                   LRTEWVLVGVQDGAHGIYEINHVAWAKRADRRPGGEEEVLVSTADDGSVKVWTLTR"
FT   exon            457355..458722
FT                   /gene="Pc16g01970"
FT                   /locus_tag="PCH_Pc16g01970"
FT                   /number=1
FT   mRNA            complement(join(<459130..460470,460524..460884,
FT                   460951..>461072))
FT                   /gene="Pc16g01980"
FT                   /locus_tag="PCH_Pc16g01980"
FT   CDS_pept        complement(join(459130..460470,460524..460884,
FT                   460951..461072))
FT                   /gene="Pc16g01980"
FT                   /locus_tag="PCH_Pc16g01980"
FT                   /note="unknown EC_number=3.4.16.6"
FT                   /note="Title: strong similarity to precursor of
FT                   carboxypeptidase Kex1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01980"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92868"
FT                   /db_xref="GOA:B6H7A4"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H7A4"
FT                   /inference="similar to AA sequence:PIR:A29651"
FT                   /inference="protein motif:PFAM:PF00450"
FT                   /inference="protein motif:COGS:COG2939"
FT                   /protein_id="CAP92868.1"
FT                   /translation="MLLSALSLLLSPLVSASSAADYYVRSLPGAPEGPFLKMHAGHIEV
FT                   DPDTNGNLFFWHFQNRHIANRQRTVIWLNGGPGCSSMDGAFMEVGPYRLQDDHTLKYNE
FT                   GRWDEFANLLFVDNPVGTGFSYANTNSYLHELDEMAAHFVIFLEKFFELFPEYANDDLY
FT                   IAGESYAGQHIPYIAKAIQDRNKGITENGGTKWPLKGLLIGNGWISPADQYPSYFKFIE
FT                   REGLAKPGTSLHHNINALNEVCLSKLETPGAKNKLDVGACELVLQQFLDLTTEDHQCYN
FT                   MYDVRLKDEAKSCGMNWPPDLKNIEPYLQRPDVVKALNINPAKKSGWTECAGMVHMAFT
FT                   AKNSIPSVHLLPGLIESGINVLLFSGDKDLICNHIGTETLIHNMDWKGGTGFETSPGVW
FT                   APRHDWSFEGEPAGIYQSARNLTYVLFYNSSHMVPFDNPRQSRDMLDRFMKVDIASIGG
FT                   QPSDSRIDGEKLPQTAVGGQANSTAAEQNEKERLKQTEMHAYTKSGEAVLIIVIIGVIA
FT                   WGFFIWRSRRTRRGYKGVSNNDMSDSTSVLSRFQNKHSGRDVEAGDFDEAELDQLHSPS
FT                   IEREDYAVGEASDDDDHIISHPETGGNRQSS"
FT   exon            complement(459130..460470)
FT                   /gene="Pc16g01980"
FT                   /locus_tag="PCH_Pc16g01980"
FT                   /number=1
FT   mat_peptide     complement(join(459133..460470,460524..460884,
FT                   460951..461015))
FT                   /gene="Pc16g01980"
FT                   /locus_tag="PCH_Pc16g01980"
FT   intron          complement(460471..460523)
FT                   /gene="Pc16g01980"
FT                   /locus_tag="PCH_Pc16g01980"
FT                   /number=1
FT   exon            complement(460524..460884)
FT                   /gene="Pc16g01980"
FT                   /locus_tag="PCH_Pc16g01980"
FT                   /number=2
FT   intron          complement(460885..460950)
FT                   /gene="Pc16g01980"
FT                   /locus_tag="PCH_Pc16g01980"
FT                   /number=2
FT   exon            complement(460951..461072)
FT                   /gene="Pc16g01980"
FT                   /locus_tag="PCH_Pc16g01980"
FT                   /number=3
FT   sig_peptide     complement(461016..461072)
FT                   /gene="Pc16g01980"
FT                   /locus_tag="PCH_Pc16g01980"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<461791..461844,461892..462010,
FT                   462064..462174,462227..462244,462344..>462656))
FT                   /gene="Pc16g01990"
FT                   /locus_tag="PCH_Pc16g01990"
FT   CDS_pept        complement(join(461791..461844,461892..462010,
FT                   462064..462174,462227..462244,462344..462656))
FT                   /gene="Pc16g01990"
FT                   /locus_tag="PCH_Pc16g01990"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   YOR021c - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g01990"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92869"
FT                   /db_xref="GOA:B6H7A5"
FT                   /db_xref="InterPro:IPR007364"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A5"
FT                   /inference="similar to AA sequence:PIR:S54627"
FT                   /inference="protein motif:PFAM:PF04252"
FT                   /inference="protein motif:COGS:COG2428"
FT                   /inference="protein motif:COGS:COG2419"
FT                   /protein_id="CAP92869.1"
FT                   /translation="MTRPTFVVEHLDPELGPWSTLEYACIARESHDRGARFLLSSVPAE
FT                   LQMPADLAATKGLEVEQRSVEEIFADRKDKVCLLDPSAQTELSPEDGDNFEVFLFGGIL
FT                   GDDPPRDRTSELRKKGYVGRRLGPKQMTTDTAVRVTRLVVHEKTPLEDIQYVDYPELLI
FT                   NEHERTEMPFRYVKGANEQPIMPDGMVDLIKKDADKSIDFF"
FT   exon            complement(461791..461844)
FT                   /gene="Pc16g01990"
FT                   /locus_tag="PCH_Pc16g01990"
FT                   /number=1
FT   intron          complement(461845..461891)
FT                   /gene="Pc16g01990"
FT                   /locus_tag="PCH_Pc16g01990"
FT                   /number=1
FT   exon            complement(461892..462010)
FT                   /gene="Pc16g01990"
FT                   /locus_tag="PCH_Pc16g01990"
FT                   /number=2
FT   intron          complement(462011..462063)
FT                   /gene="Pc16g01990"
FT                   /locus_tag="PCH_Pc16g01990"
FT                   /number=2
FT   exon            complement(462064..462174)
FT                   /gene="Pc16g01990"
FT                   /locus_tag="PCH_Pc16g01990"
FT                   /number=3
FT   intron          complement(462175..462226)
FT                   /gene="Pc16g01990"
FT                   /locus_tag="PCH_Pc16g01990"
FT                   /number=3
FT   exon            complement(462227..462244)
FT                   /gene="Pc16g01990"
FT                   /locus_tag="PCH_Pc16g01990"
FT                   /number=4
FT   intron          complement(462245..462343)
FT                   /gene="Pc16g01990"
FT                   /locus_tag="PCH_Pc16g01990"
FT                   /number=4
FT   exon            complement(462344..462656)
FT                   /gene="Pc16g01990"
FT                   /locus_tag="PCH_Pc16g01990"
FT                   /number=5
FT   mRNA            join(<463363..463398,463446..463529,463596..>463988)
FT                   /gene="Pc16g02000"
FT                   /locus_tag="PCH_Pc16g02000"
FT   CDS_pept        join(463363..463398,463446..463529,463596..463988)
FT                   /gene="Pc16g02000"
FT                   /locus_tag="PCH_Pc16g02000"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   SPAC10F6.16 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02000"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92870"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A6"
FT                   /inference="similar to AA sequence:PIR:T37510"
FT                   /inference="protein motif:PFAM:PF04667"
FT                   /protein_id="CAP92870.1"
FT                   /translation="MNPHQQNKVDINSLSPEEQRLLRLYGKMPTKKDVLQNKLKERKYF
FT                   DSGDYALSKAGKASDVGVTNIGSRHPVPENIPHLTSTSPGANNSANNGSVSSQGGQQVP
FT                   GSISGHPGSVGFQSRSPIKEGGSYLHHGTSISEGEPGSGPASESVRGEQEFSVSPPPAR
FT                   EGVPIRR"
FT   exon            463363..463398
FT                   /gene="Pc16g02000"
FT                   /locus_tag="PCH_Pc16g02000"
FT                   /number=1
FT   intron          463399..463445
FT                   /gene="Pc16g02000"
FT                   /locus_tag="PCH_Pc16g02000"
FT                   /number=1
FT   exon            463446..463529
FT                   /gene="Pc16g02000"
FT                   /locus_tag="PCH_Pc16g02000"
FT                   /number=2
FT   intron          463530..463595
FT                   /gene="Pc16g02000"
FT                   /locus_tag="PCH_Pc16g02000"
FT                   /number=2
FT   exon            463596..463988
FT                   /gene="Pc16g02000"
FT                   /locus_tag="PCH_Pc16g02000"
FT                   /number=3
FT   mRNA            join(<465399..465923,465979..>466782)
FT                   /gene="Pc16g02010"
FT                   /locus_tag="PCH_Pc16g02010"
FT   CDS_pept        join(465399..465923,465979..466782)
FT                   /gene="Pc16g02010"
FT                   /locus_tag="PCH_Pc16g02010"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPAC23C11.01 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92871"
FT                   /db_xref="GOA:B6H7A7"
FT                   /db_xref="InterPro:IPR013635"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A7"
FT                   /inference="similar to AA sequence:PIR:T38239"
FT                   /protein_id="CAP92871.1"
FT                   /translation="MWLFRVFSSALFLAITVSSIPLAFDVGGKTCGLAFSLSLAAFYFL
FT                   VSLLKVTTPERSWFRSSIIAVLRFIQWAVILVLLIWSLNRFSVDLDSTGPGWVERTFSG
FT                   KRAEDSSIQEWLFGREGLVETVALGNWDRLLRWSTPVFQLAEGFCSLLVIQAAGQITRW
FT                   LVNRGGRSDSWMIGLLVLSATIISSSVYFLWRVLQFPEISNVDAALIGVSVTCAVILCA
FT                   WGIGSGRGNPVESSLLFAYIVLCIYQIFTDYQPSHPVEQIPSPSQVGDFPPLPPIIMAS
FT                   YTTLMHALSLLPSIIHAAFNVITAVFSAVTPSVLISLAYRLLVLYASTRIIPAVRESGA
FT                   RALSQEASIDDTDAAGQVLGFLSYFAPSILIAVYTSLLMQHFASTSQAMGGSGEWWSTQ
FT                   GNGGGNPWRWINLACTISLYAVELWLGETNDLDNGVAGHWKTD"
FT   sig_peptide     465399..465467
FT                   /gene="Pc16g02010"
FT                   /locus_tag="PCH_Pc16g02010"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            465399..465923
FT                   /gene="Pc16g02010"
FT                   /locus_tag="PCH_Pc16g02010"
FT                   /number=1
FT   mat_peptide     join(465468..465923,465979..466779)
FT                   /gene="Pc16g02010"
FT                   /locus_tag="PCH_Pc16g02010"
FT   intron          465924..465978
FT                   /gene="Pc16g02010"
FT                   /locus_tag="PCH_Pc16g02010"
FT                   /number=1
FT   exon            465979..466782
FT                   /gene="Pc16g02010"
FT                   /locus_tag="PCH_Pc16g02010"
FT                   /number=2
FT   mRNA            join(<468079..468137,468204..>469236)
FT                   /gene="Pc16g02020"
FT                   /locus_tag="PCH_Pc16g02020"
FT   CDS_pept        join(468079..468137,468204..469236)
FT                   /gene="Pc16g02020"
FT                   /locus_tag="PCH_Pc16g02020"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g00480 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92872"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/TrEMBL:B6H774"
FT                   /inference="protein motif:PFAM:PF03690"
FT                   /inference="protein motif:COGS:COG4286"
FT                   /protein_id="CAP92872.1"
FT                   /translation="MAENVAKKLKTSSPSIGTHNGHFHADEALAVYLLRLLPTYASSPL
FT                   IRTRDPAELEKCHTVVDVGGVYDPAIHRYDHHQRTFSTTFPQRATKLSSAGLVYMHFGK
FT                   AIIAQKLSLPVEHADVDLLYEKLYTDFIEAIDANDNGISAYDQAALTAAGIEKRFKNGG
FT                   ITLASMVGDMNNPDPTSPPGEPQDEDSLFGRASTLIGNAFARKMHHACTSWLPARTTVG
FT                   SAYASRKDVHPSGRIIVLPQGGVPWKEHLYNFEAEASGTKEIDPTVQAYYVLYPENATE
FT                   GAKWRVQCVSVSESSFESRKPLPEAWRGVRDQDLDGVMAAEAEKNGQSKIPEGAVFVHA
FT                   SGFIGGHKTREGAMAMAERSLEL"
FT   exon            468079..468137
FT                   /gene="Pc16g02020"
FT                   /locus_tag="PCH_Pc16g02020"
FT                   /number=1
FT   intron          468138..468203
FT                   /gene="Pc16g02020"
FT                   /locus_tag="PCH_Pc16g02020"
FT                   /number=1
FT   exon            468204..469236
FT                   /gene="Pc16g02020"
FT                   /locus_tag="PCH_Pc16g02020"
FT                   /number=2
FT   mRNA            complement(<469824..>470393)
FT                   /gene="Pc16g02030"
FT                   /locus_tag="PCH_Pc16g02030"
FT   CDS_pept        complement(469824..470393)
FT                   /gene="Pc16g02030"
FT                   /locus_tag="PCH_Pc16g02030"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_19_scaffold_1.tfa_90wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92873"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="UniProtKB/TrEMBL:B6H775"
FT                   /protein_id="CAP92873.1"
FT                   /translation="MEHNLLDSLLDVEEQFYNEGYELGTADGAATGYTEGSVFAVEKGF
FT                   EKFVEMGRLYGKALVWAQRLDMKSSEGAAAQADSTTGSTTDTLSLDPSICEDMPSLPPH
FT                   SSRLARNLQTLLELVDPATLDMSNTEEAVNDVDERLKGAATKAKLIQRAMGEREDPAAQ
FT                   VEPKDMSTSGDGSGSIEDISALSIRH"
FT   exon            complement(469824..470393)
FT                   /gene="Pc16g02030"
FT                   /locus_tag="PCH_Pc16g02030"
FT                   /number=1
FT   mRNA            join(<470561..470691,470753..>472571)
FT                   /gene="Pc16g02040"
FT                   /locus_tag="PCH_Pc16g02040"
FT   CDS_pept        join(470561..470691,470753..472571)
FT                   /gene="Pc16g02040"
FT                   /locus_tag="PCH_Pc16g02040"
FT                   /note="unknown EC_number=6.1.1.10"
FT                   /note="Title: strong similarity to cytosolic
FT                   methionine--tRNA ligase Mes1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92874"
FT                   /db_xref="GOA:B6H776"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:B6H776"
FT                   /inference="similar to AA sequence:TREMBL:SCMES1.1"
FT                   /inference="protein motif:PFAM:PF00133"
FT                   /inference="protein motif:COGS:COG0143"
FT                   /protein_id="CAP92874.1"
FT                   /translation="MTDPILPKAGERNILVTSALPYVNNVPHLGNVVGSVLSADVFARY
FT                   HKACGRRTLYICGTDEYGTATETKALEEKMSPEDLCAKYNKIHQDVYEWFNIGFDHFGR
FT                   TPTQKHTDISQSIFKRLHENGYLGERTAEQPFCEQHGSFLADRFVEGECPRCHYDDARG
FT                   DQCDKCGHLLDPFDLINPRCKIDGAAPVRRETKHIHILLDKLQPEIEKWAHPAIEKGNW
FT                   PRNSRIITESWLKEGLKGRGITRDLKWGVPVPLEGYENKVLYVWFEACIGYPSITANYT
FT                   DDWEKWWRNPEDVQLWQFLGKDNVPFHSVIFPGTQIGTKDKWTMLHHLSTTEYLNYEGG
FT                   KFSKSRGVGVFGTNARETGVPADVWRYFLLKNRPETGDTQFEWAPFVDSNNGELLAKLG
FT                   NLVNRIIKLVTASYGSVIPEFTVPETFNPFLEEVTEHLRQYHEDLEGAHLRAGVQTAMR
FT                   IAEAGNGLIQANRLDNALIANEPERAAAVVGTVLNLIHLLSSVFSPYMPATSKSILEQL
FT                   NAPFLYLPSVEELQSGWKPTSLKAGHKIGKAAYLFSRIDPKKADEWREMFGGSQADRKK
FT                   KEEEAAKLAAKKAAAKAKKKEKKEKGRAGAPEGGVEGSAKGGAEKVSVTTEGKNDEAVE
FT                   KVADGVAQVTLPTS"
FT   exon            470561..470691
FT                   /gene="Pc16g02040"
FT                   /locus_tag="PCH_Pc16g02040"
FT                   /number=1
FT   intron          470692..470752
FT                   /gene="Pc16g02040"
FT                   /locus_tag="PCH_Pc16g02040"
FT                   /number=1
FT   exon            470753..472571
FT                   /gene="Pc16g02040"
FT                   /locus_tag="PCH_Pc16g02040"
FT                   /number=2
FT   mRNA            complement(join(<473078..473902,474002..>474262))
FT                   /gene="Pc16g02050"
FT                   /locus_tag="PCH_Pc16g02050"
FT   CDS_pept        complement(join(473078..473902,474002..474262))
FT                   /gene="Pc16g02050"
FT                   /locus_tag="PCH_Pc16g02050"
FT                   /note="Title: strong similarity to protein sonA
FT                   -Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92875"
FT                   /db_xref="GOA:B6H777"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037631"
FT                   /db_xref="UniProtKB/TrEMBL:B6H777"
FT                   /inference="similar to AA sequence:TREMBL:AF069492.1"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP92875.1"
FT                   /translation="MSLFGGGASSASAGQTNTTGDISKDVALNAPPEDGISDLRFSPTS
FT                   EHLAVASWDKKVRIYEINDQGQSEGKALFEHEAPVLNCCWSPDGTKVVGAGADKAARML
FT                   DLSSGTTTQVAAHDAPIRSCHMIPNPSVGGTPLLITGSWDKTVKYWDLRQSTAIASVEC
FT                   QERVYTMDVKNKLLVIGTADRYINIINLDQPTKFYKTMQSPLKWQTRVVSCFSDASGFA
FT                   VGSVEGRCAIQYVEEKDSASNFSFKCHRETPPANRDVCNIYSVNAISFHPIHGTFSTAG
FT                   ADGTFHFWDKDAKHRLKGYPAVGGPITTTAFNRNGNIFAYSVSYDWSKGYSANTQQTVN
FT                   KVMLHPIGPDETKPRPNTRKR"
FT   exon            complement(473078..473902)
FT                   /gene="Pc16g02050"
FT                   /locus_tag="PCH_Pc16g02050"
FT                   /number=1
FT   intron          complement(473903..474001)
FT                   /gene="Pc16g02050"
FT                   /locus_tag="PCH_Pc16g02050"
FT                   /number=1
FT   exon            complement(474002..474262)
FT                   /gene="Pc16g02050"
FT                   /locus_tag="PCH_Pc16g02050"
FT                   /number=2
FT   mRNA            complement(<475566..>476246)
FT                   /gene="Pc16g02060"
FT                   /locus_tag="PCH_Pc16g02060"
FT   CDS_pept        complement(475566..476246)
FT                   /gene="Pc16g02060"
FT                   /locus_tag="PCH_Pc16g02060"
FT                   /note="Title: similarity to hypothetical protein An08g09690
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92876"
FT                   /db_xref="UniProtKB/TrEMBL:B6H778"
FT                   /protein_id="CAP92876.1"
FT                   /translation="MASIGWFPRAKFGPGTTVLFEKPTISAWSIREKQSQHNYQREDWD
FT                   LDPGPSTAEATFHVQQDYGPLAYMRVYMQVPDPSTEFEPREVRRRQAALCPHREVDALK
FT                   CFHQKHFTMTPALLGIKEELQGDDDVVPGGFIVYMVFQHVPGIRLADDQGAPVRGCSIH
FT                   TFFREFDREERDKVRDEFDKNYPRLAELDLTLYSIWADHLVWDPVSSKLYVPSMLIQSC
FT                   SLTT"
FT   exon            complement(475566..476246)
FT                   /gene="Pc16g02060"
FT                   /locus_tag="PCH_Pc16g02060"
FT                   /number=1
FT   mRNA            join(<477336..477486,477537..477588,477642..477825,
FT                   477895..>478053)
FT                   /gene="Pc16g02070"
FT                   /locus_tag="PCH_Pc16g02070"
FT   CDS_pept        join(477336..477486,477537..477588,477642..477825,
FT                   477895..478053)
FT                   /gene="Pc16g02070"
FT                   /locus_tag="PCH_Pc16g02070"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g00540 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92877"
FT                   /db_xref="UniProtKB/TrEMBL:B6H779"
FT                   /protein_id="CAP92877.1"
FT                   /translation="MSVPLTKIDSAIAGLSISDEKPETTEKEVKAKSHRRTSSTAEGVW
FT                   NIKDLEEQKMDITLPIETQKTGWKLNTSPSTIEDKDILKMFLVNPPVKKIDLHFPLGLE
FT                   VTARNLKGVTVKDALDAIYKQFKKKADDELDKPYLAGFEWDKEDCWTRLIVHQKKEGAP
FT                   QPSKKSKKKSKKKSKDEA"
FT   exon            477336..477486
FT                   /gene="Pc16g02070"
FT                   /locus_tag="PCH_Pc16g02070"
FT                   /number=1
FT   intron          477487..477536
FT                   /gene="Pc16g02070"
FT                   /locus_tag="PCH_Pc16g02070"
FT                   /number=1
FT   exon            477537..477588
FT                   /gene="Pc16g02070"
FT                   /locus_tag="PCH_Pc16g02070"
FT                   /number=2
FT   intron          477589..477641
FT                   /gene="Pc16g02070"
FT                   /locus_tag="PCH_Pc16g02070"
FT                   /number=2
FT   exon            477642..477825
FT                   /gene="Pc16g02070"
FT                   /locus_tag="PCH_Pc16g02070"
FT                   /number=3
FT   intron          477826..477894
FT                   /gene="Pc16g02070"
FT                   /locus_tag="PCH_Pc16g02070"
FT                   /number=3
FT   exon            477895..478053
FT                   /gene="Pc16g02070"
FT                   /locus_tag="PCH_Pc16g02070"
FT                   /number=4
FT   mRNA            complement(<479140..>479646)
FT                   /gene="Pc16g02080"
FT                   /locus_tag="PCH_Pc16g02080"
FT   CDS_pept        complement(479140..479646)
FT                   /gene="Pc16g02080"
FT                   /locus_tag="PCH_Pc16g02080"
FT                   /note="Title: similarity to hypothetical protein An12g07270
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92878"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:B6H780"
FT                   /protein_id="CAP92878.1"
FT                   /translation="MAPTPTPAQSHALSIPEIFELILLNLDIRTLLTKASRICHSWSHF
FT                   INSSPRIQWALFFRPLDHALDKPKTQNPLLAETFPSIFDQFECTSKKNDLDTDTTNEKP
FT                   TSNVTLTTFDMIKNPHKWDAYIRPEASWRRMLVQQPPVYTLSLLRSNVGHGGQHLYIYE
FT                   AMVSV"
FT   exon            complement(479140..479646)
FT                   /gene="Pc16g02080"
FT                   /locus_tag="PCH_Pc16g02080"
FT                   /number=1
FT   mRNA            complement(join(<479870..480885,480937..481445,
FT                   481734..>483583))
FT                   /gene="Pc16g02090"
FT                   /locus_tag="PCH_Pc16g02090"
FT   CDS_pept        complement(join(479870..480885,480937..481445,
FT                   481734..483583))
FT                   /gene="Pc16g02090"
FT                   /locus_tag="PCH_Pc16g02090"
FT                   /note="Title: similarity to protein Mdm1 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92879"
FT                   /db_xref="GOA:B6H781"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="InterPro:IPR013937"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:B6H781"
FT                   /inference="similar to AA sequence:PIR:S47445"
FT                   /inference="protein motif:PFAM:PF02194"
FT                   /inference="protein motif:PFAM:PF00787"
FT                   /inference="protein motif:COGS:COG5391"
FT                   /protein_id="CAP92879.1"
FT                   /translation="MALSRRDLVLAGVGVFIAWGLVVRWLPILRYLGYAVTLGAILSSV
FT                   GLLGLITLTIRHQNDKANTKNVSVAFIKPNQWRKEVLNVRRSTRYRPRPLYPQSFVVSE
FT                   RIDELLSLITRDFISSWYRSISPNPIFANEVDRTIRVALENLRDRLVAEDMVSLIVSRI
FT                   FPIVTSHLKEFDIAERSVRGRNLNRNVTESGELDLAIANKYRDGRLHPAVATSASDQKA
FT                   VQQDYLRKLAVGLLPQLFPESVLNSRIVSVLIREIISCAVLIPIVTALSDPDTWNQLME
FT                   AYGRTALHDRKTVRKLRAALDQHASPTPKSKRGQPFPRLSATDSERAFERFVRAIRKCN
FT                   NLSDARRFRALVSSQLKQESVVEGQDQVYLKRLETGKRVLDQKVAKLAKPGEDSHVPPA
FT                   LDPRPEIPSKTHESSLVDVMHSASGLSYFMEFMDRQKLMSLVQFWVVVDGFRNPLEDDF
FT                   GDEAAPTSLAWKPADRNDLALISETYLSKPELKVSEESRRAVKTFLSAGKRATPEQYRK
FT                   ARMVVLTTQSAILEHLQDTYYPKFKESDLYWKYLASDEASAAQAPVRQPSPIAVTFEAP
FT                   ERRPLPPLLSRTSSQPGLRPSKDLRRAAVSSGDVRGMGKLFSSEIPQVDNRNERTKKSI
FT                   ASLGLVDHASRLGVFDDDLFPDQQKFIEDEYEEPDGVDEKDSADEVHEAAPGDLGLTEA
FT                   IEALSVDIDKLAAQDAVVQALTRKAELTNNTAELRILRKSKASIQREMHRKEMQRQQYI
FT                   LQESDNSLFGRSTVSIKSIVVGKEEDDGREFAMYVVEVQRNAGEQMPAASWVVARRYSE
FT                   FHDLHQKLRQRYPSVRHLEFPRRRVVMKLQKEFLHKRRLALEAYLQKLLLLPEVCRSRD
FT                   LRAFLSQRAILPRMEIARDNEGETKDLVTRIYNSVADGMDDFLGNFGVLDQLSTAGQNL
FT                   ISAATQQASSAIPESSLATEDAVTAAEAEAELNAFEDRELEPFIKPICDLFLEAFELNR
FT                   GNNWLRGRAVVVVLHQLLGGTIERKVRDGARGLVQDDSLLKYISLARDTLWPGGILRKA
FT                   PPRSAAERLNSRAEATVVLATLIPDLAGNVVGRANAQAAARRIFATLNNQHLNTHLVFT
FT                   ILDEIVLVLFGSAGRPR"
FT   exon            complement(479870..480885)
FT                   /gene="Pc16g02090"
FT                   /locus_tag="PCH_Pc16g02090"
FT                   /number=1
FT   intron          complement(480886..480936)
FT                   /gene="Pc16g02090"
FT                   /locus_tag="PCH_Pc16g02090"
FT                   /number=1
FT   exon            complement(480937..481445)
FT                   /gene="Pc16g02090"
FT                   /locus_tag="PCH_Pc16g02090"
FT                   /number=2
FT   intron          complement(481446..481733)
FT                   /gene="Pc16g02090"
FT                   /locus_tag="PCH_Pc16g02090"
FT                   /number=2
FT   exon            complement(481734..483583)
FT                   /gene="Pc16g02090"
FT                   /locus_tag="PCH_Pc16g02090"
FT                   /number=3
FT   mRNA            join(<484008..484056,484113..484152,484237..484253,
FT                   484310..484736,484787..>484844)
FT                   /gene="Pc16g02100"
FT                   /locus_tag="PCH_Pc16g02100"
FT   CDS_pept        join(484008..484056,484113..484152,484237..484253,
FT                   484310..484736,484787..484844)
FT                   /gene="Pc16g02100"
FT                   /locus_tag="PCH_Pc16g02100"
FT                   /note="unknown EC_number=2.1.1.71"
FT                   /note="Title: strong similarity to
FT                   phosphatidyl-N-methylethanolamine N-methyltransferase Opi3
FT                   - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02100"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92880"
FT                   /db_xref="GOA:B6H782"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="InterPro:IPR024960"
FT                   /db_xref="UniProtKB/TrEMBL:B6H782"
FT                   /inference="similar to AA sequence:PIR:B28443"
FT                   /inference="protein motif:PFAM:PF04191"
FT                   /protein_id="CAP92880.1"
FT                   /translation="MASLTDFVDFSSKPLLWSAATIAFNPIFWNIVARAEYRNHFLTRL
FT                   FGGAYNGCYFLAFTIFSLGILRDHLYQLALADQPFYAPVHQPIVGGVLFAIGSVLVLSS
FT                   MWALGVTGTYLGDYFGILMDAPVTGFPFNVTGSPMYWGSTLNFLGVALYQGKVAGILLT
FT                   AQVFVLYWFALGWEDPFTAEIYAKRERERAKKQ"
FT   exon            484008..484056
FT                   /gene="Pc16g02100"
FT                   /locus_tag="PCH_Pc16g02100"
FT                   /number=1
FT   intron          484057..484112
FT                   /gene="Pc16g02100"
FT                   /locus_tag="PCH_Pc16g02100"
FT                   /number=1
FT   exon            484113..484152
FT                   /gene="Pc16g02100"
FT                   /locus_tag="PCH_Pc16g02100"
FT                   /number=2
FT   intron          484153..484236
FT                   /gene="Pc16g02100"
FT                   /locus_tag="PCH_Pc16g02100"
FT                   /number=2
FT   exon            484237..484253
FT                   /gene="Pc16g02100"
FT                   /locus_tag="PCH_Pc16g02100"
FT                   /number=3
FT   intron          484254..484309
FT                   /gene="Pc16g02100"
FT                   /locus_tag="PCH_Pc16g02100"
FT                   /number=3
FT   exon            484310..484736
FT                   /gene="Pc16g02100"
FT                   /locus_tag="PCH_Pc16g02100"
FT                   /number=4
FT   intron          484737..484786
FT                   /gene="Pc16g02100"
FT                   /locus_tag="PCH_Pc16g02100"
FT                   /number=4
FT   exon            484787..484844
FT                   /gene="Pc16g02100"
FT                   /locus_tag="PCH_Pc16g02100"
FT                   /number=5
FT   mRNA            join(<487422..487544,487585..>487851)
FT                   /gene="Pc16g02110"
FT                   /locus_tag="PCH_Pc16g02110"
FT   CDS_pept        join(487422..487544,487585..487851)
FT                   /gene="Pc16g02110"
FT                   /locus_tag="PCH_Pc16g02110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92881"
FT                   /db_xref="UniProtKB/TrEMBL:B6H783"
FT                   /protein_id="CAP92881.1"
FT                   /translation="MEILKDENLTVNVTSTETPAHRTHFSAMPGEEIQIPAGIVALQRR
FT                   GGYDLKAVIGTQDEAQTKEQTYDADSKIEGEDEDNTNDKGEERQNQDSGTWTISPCTHC
FT                   LLPKWTCVPYWDGPWTFQLSFYYVD"
FT   exon            487422..487544
FT                   /gene="Pc16g02110"
FT                   /locus_tag="PCH_Pc16g02110"
FT                   /number=1
FT   intron          487545..487584
FT                   /gene="Pc16g02110"
FT                   /locus_tag="PCH_Pc16g02110"
FT                   /number=1
FT   exon            487585..487851
FT                   /gene="Pc16g02110"
FT                   /locus_tag="PCH_Pc16g02110"
FT                   /number=2
FT   mRNA            complement(join(<488080..489263,489334..489487,
FT                   489579..>489839))
FT                   /gene="Pc16g02120"
FT                   /locus_tag="PCH_Pc16g02120"
FT   CDS_pept        complement(join(488080..489263,489334..489487,
FT                   489579..489839))
FT                   /pseudo
FT                   /gene="Pc16g02120"
FT                   /locus_tag="PCH_Pc16g02120"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g00570 - Aspergillus niger"
FT   exon            complement(488080..489263)
FT                   /gene="Pc16g02120"
FT                   /locus_tag="PCH_Pc16g02120"
FT                   /number=1
FT   intron          complement(489264..489333)
FT                   /gene="Pc16g02120"
FT                   /locus_tag="PCH_Pc16g02120"
FT                   /number=1
FT   exon            complement(489334..489487)
FT                   /gene="Pc16g02120"
FT                   /locus_tag="PCH_Pc16g02120"
FT                   /number=2
FT   intron          complement(489488..489578)
FT                   /gene="Pc16g02120"
FT                   /locus_tag="PCH_Pc16g02120"
FT                   /number=2
FT   exon            complement(489579..489839)
FT                   /gene="Pc16g02120"
FT                   /locus_tag="PCH_Pc16g02120"
FT                   /number=3
FT   mRNA            complement(join(<490267..491715,491752..492032,
FT                   492085..492198,492259..493870,493946..>494239))
FT                   /gene="Pc16g02130"
FT                   /locus_tag="PCH_Pc16g02130"
FT   CDS_pept        complement(join(490267..491715,491752..492032,
FT                   492085..492198,492259..493870,493946..494239))
FT                   /gene="Pc16g02130"
FT                   /locus_tag="PCH_Pc16g02130"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g00580 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92883"
FT                   /db_xref="InterPro:IPR012880"
FT                   /db_xref="InterPro:IPR021773"
FT                   /db_xref="UniProtKB/TrEMBL:B6H784"
FT                   /protein_id="CAP92883.1"
FT                   /translation="MDAYPEDYVNHNLPLVLLSGLEADTENEPGTPSDYPLLSEKGTHI
FT                   FSDFPPLSGAVAEELRSLLLEEDSSQSPWKSRVTVSGNTTIANIGYRIKSSGRSCRLPP
FT                   QKADPPIPSPPTTPSDDHDNEHSEPSAHYVLHSPISPLSPGSPTFPDGLLTPLWVTKHQ
FT                   DLVPAAVINFFPFSLDPNMNSLRDNQLKIEINSLKKEWQSSGYKTRFVVVLLSEDGEEG
FT                   GYEGEIDDRIAGIRRATNLDPRSIFVIPPDATSSELQDFVKSLFSLLQPSVVEYYRDLS
FT                   KHARRKRNRGNIPPPTAPPTTGTSQTLSSQGWNVRYEFKLGIFAEFRQEMDAACRNYES
FT                   AYETLFGHEVFENIAGWNPRFNDARLLADALAIRIIRCLLWTGQTTTAARLWVDHRVRV
FT                   KDIVDRRGKGSKHYGWEAWEARWSMVMAQLIRRAEIPPISSEISSEQPRKLYALPEKSI
FT                   PTGERVRPWEHLHHEGYWLHRSAKHTMLRRALAQEIPLEDRKPPGQSPASQLANKSYLY
FT                   DTYLVPDAHAEAPQEGRTGFDHSGLILSTLKAAIEEFAKRDQTRKVESLSLEAAEEYMR
FT                   IGSWSEAHGLLRPLWSTLSWRRSGWWHLMANFGRALRECALRMQDSETILRVDWELLNK
FT                   NLKPRSAWHYDIHKSLESLPSEKPKPSLILRAEDVITSLTASLVFEKSDGNVGEPLHAQ
FT                   LAITSCAHKFSAPIRLSEVKLVFEGCLRPVKVQSDQNQDADTTTSCCIATLPLREPSNA
FT                   DTAVQSPAGGLTALTKVFDLTCVPREAGEARVASITMLIEEEQFDLGYAVTEPEQRESF
FT                   WWEQTQKGVTRRRVGKDRDTGRCKVMPKPPKIRLTTPNLKRTYYTNERVMLQIGIHNEE
FT                   DEAADISAEIRLFGTESAAQIQWLDGDSNPELLESGASTPIEGPSHYLKRSVGVLERSS
FT                   QKTLTIVLVDTQEATDFTLEVSTVYHLVSDTQTPIMKNTTVDLSFIRPFEANYEFLPAI
FT                   HPQPWPNFFAVSDNLLEDGSAPSPGGLFQKWYLNSKVVSFALEPLVIDKMSLVLLEANG
FT                   GVVCDVHSEELVTPGTPHLAPEELRESNFCLDVQKLLLGDRRPTALTCTLEINWRRQSS
FT                   ESVASSDAENSVTTTVLDIPRFVVPMGEPRVLASATPSSSMAGLIHMGYVLENPSTHFL
FT                   TFNLVMEASEHFAFSGPKTTVVQLVPLSRHTVNFNLFAAKRGLWIQPQLVVIDTYFNKT
FT                   LRVLPTGDMRSDKKGVLVWVDADD"
FT   exon            complement(490267..491715)
FT                   /gene="Pc16g02130"
FT                   /locus_tag="PCH_Pc16g02130"
FT                   /number=1
FT   intron          complement(491716..491751)
FT                   /gene="Pc16g02130"
FT                   /locus_tag="PCH_Pc16g02130"
FT                   /number=1
FT   exon            complement(491752..492032)
FT                   /gene="Pc16g02130"
FT                   /locus_tag="PCH_Pc16g02130"
FT                   /number=2
FT   intron          complement(492033..492084)
FT                   /gene="Pc16g02130"
FT                   /locus_tag="PCH_Pc16g02130"
FT                   /number=2
FT   exon            complement(492085..492198)
FT                   /gene="Pc16g02130"
FT                   /locus_tag="PCH_Pc16g02130"
FT                   /number=3
FT   intron          complement(492199..492258)
FT                   /gene="Pc16g02130"
FT                   /locus_tag="PCH_Pc16g02130"
FT                   /number=3
FT   exon            complement(492259..493870)
FT                   /gene="Pc16g02130"
FT                   /locus_tag="PCH_Pc16g02130"
FT                   /number=4
FT   intron          complement(493871..493945)
FT                   /gene="Pc16g02130"
FT                   /locus_tag="PCH_Pc16g02130"
FT                   /number=4
FT   exon            complement(493946..494239)
FT                   /gene="Pc16g02130"
FT                   /locus_tag="PCH_Pc16g02130"
FT                   /number=5
FT   mRNA            join(<495350..497147,497196..>498124)
FT                   /gene="Pc16g02140"
FT                   /locus_tag="PCH_Pc16g02140"
FT   CDS_pept        join(495350..497147,497196..498124)
FT                   /gene="Pc16g02140"
FT                   /locus_tag="PCH_Pc16g02140"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   Rv3312c - Mycobacterium tuberculosis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92884"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H785"
FT                   /inference="similar to AA sequence:PIR:G70842"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /inference="protein motif:COGS:COG0596"
FT                   /protein_id="CAP92884.1"
FT                   /translation="MSNENPVQAESALLSRRRRRKSLPSRNGTDPTSPEVISSLISSLS
FT                   TISVPLNSHFDTIPKIDNESDPGLPEVPHTAPVYSIPPSEQHGFGMSYGAYKPTVEPPA
FT                   LPENPFLHPDDAASSPVIRMARAPPSPKSPRSPRFKPFRTADSSSTRPASRESYTSVIA
FT                   APEPSSFGTISTEPGPRLSTPSIASNSSAGRTKSLKGQLSLLKRSSREFVGEKDPQIER
FT                   LRKTTSYNDSLRHNVPRSRASLRSLHSMAEVTEEARPADVKEEPYEEKVASTPTKDYQS
FT                   FHGTPDASNPGGIGSGRIIPTRDSSLRHRHSQSSSSKKHRSARHSRYSSTASKEFNTDN
FT                   GLPGTSNDAEQVTRRIQEVKDQQQKIKTELEVGNSPEHSTKASPAKQAKPSKVSRVLGY
FT                   DVNQAMQNGPRRDRPSFNESAPSPNVMTGKSRTGSRPGAPLAPKSTHLPSQLPKSSVER
FT                   PDSERARYRQSLEPITPITHRRTPSGHLSHLSNGRPSYSTERPSSADSIDLAVDDYIFS
FT                   PKLTQRVIHPTTGRSIAFSEVGNPKGHVVLCCVGMGLTRYLMAFYDELARTLNLRLVTL
FT                   DRPGVGESGPHQGDEPSTPLSWPDDVAIVCNHLRVTKFSILAHSAGAIYALATALRIPQ
FT                   HIRGRIHLLAPWIPPSQLSNIGSKKEPAPTNAVPYSQKILRALPTSLLKVANSSFMSAT
FT                   SASITTSLPKSPRRAKRKAATKEASNATAIPPVPPIPSVDPNPQTPRVDIVPNIKPSAS
FT                   NTASYRKSDATLGSRAKSPEDEVERQRDYDTRLTYKIWELATTNANPAVDLLTCLERRQ
FT                   TIGFRYVDITRSVVIHHGSKDPRVPAENVQWLGKTMRRCEVRILEGEGHGLMASAGVMG
FT                   NVLTEIAKEWEDWTILVQGKRRATVSHAARPGLSIQT"
FT   exon            495350..497147
FT                   /gene="Pc16g02140"
FT                   /locus_tag="PCH_Pc16g02140"
FT                   /number=1
FT   intron          497148..497195
FT                   /gene="Pc16g02140"
FT                   /locus_tag="PCH_Pc16g02140"
FT                   /number=1
FT   exon            497196..498124
FT                   /gene="Pc16g02140"
FT                   /locus_tag="PCH_Pc16g02140"
FT                   /number=2
FT   mRNA            join(<498906..498983,499054..499477,499545..>499861)
FT                   /gene="Pc16g02150"
FT                   /locus_tag="PCH_Pc16g02150"
FT   CDS_pept        join(498906..498983,499054..499477,499545..499861)
FT                   /gene="Pc16g02150"
FT                   /locus_tag="PCH_Pc16g02150"
FT                   /note="Title: similarity to glutaredoxin - Oryza sativa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92885"
FT                   /db_xref="GOA:B6H786"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6H786"
FT                   /inference="similar to AA sequence:PIR:JC5445"
FT                   /inference="protein motif:PFAM:PF00462"
FT                   /inference="protein motif:COGS:COG3634"
FT                   /inference="protein motif:COGS:COG0695"
FT                   /inference="protein motif:COGS:COG0526"
FT                   /protein_id="CAP92885.1"
FT                   /translation="MPSSQRRLRLVVIAVIALLFMVFYYTGDATKIQNQKFYRSTIDAM
FT                   KAKEQAKQAKAQEKIQHPVHAPGQNVAAGAGAGEKVPVAEVEKAAVPPATDNEDTEEVS
FT                   IAGRTKMTVPKKANQDTPSEVQSELKSEEEKEREEKAKREREEKERKEAEATTELNAIL
FT                   KRAPVIVFSKSYCPYSKKAKLILLEHYSIEPKPLVVELDQHPLGPYLQALLAQSTGRRT
FT                   VPNVLVSGKSIGGGDDIAALDQRDELASTLRQMGGKWIVDVSHHEVEKSL"
FT   exon            498906..498983
FT                   /gene="Pc16g02150"
FT                   /locus_tag="PCH_Pc16g02150"
FT                   /number=1
FT   intron          498984..499053
FT                   /gene="Pc16g02150"
FT                   /locus_tag="PCH_Pc16g02150"
FT                   /number=1
FT   exon            499054..499477
FT                   /gene="Pc16g02150"
FT                   /locus_tag="PCH_Pc16g02150"
FT                   /number=2
FT   intron          499478..499544
FT                   /gene="Pc16g02150"
FT                   /locus_tag="PCH_Pc16g02150"
FT                   /number=2
FT   exon            499545..499861
FT                   /gene="Pc16g02150"
FT                   /locus_tag="PCH_Pc16g02150"
FT                   /number=3
FT   mRNA            join(<500252..500297,500563..500866,500965..501142,
FT                   501214..>501264)
FT                   /gene="Pc16g02160"
FT                   /locus_tag="PCH_Pc16g02160"
FT   CDS_pept        join(500252..500297,500563..500866,500965..501142,
FT                   501214..501264)
FT                   /gene="Pc16g02160"
FT                   /locus_tag="PCH_Pc16g02160"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit L9.b - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02160"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92886"
FT                   /db_xref="GOA:B6H787"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002359"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:B6H787"
FT                   /inference="similar to AA sequence:PIR:S53915"
FT                   /inference="protein motif:PFAM:PF00347"
FT                   /inference="protein motif:COGS:COG0097"
FT                   /protein_id="CAP92886.1"
FT                   /translation="MRYIHSEERLPILDNVKVHIKSRIVTVEGPRGKLVKDLSHIAVTF
FT                   GRPEQNVISIELHHGARKGVATLRTVRTIINNLMIGVTRGFKYKMRYVYAHFPINVNIE
FT                   PNPETGRAVVEIRNFLGEKYVRRITAQPDVDIAPSANVKDELVLTGNSLEGVSQSAADI
FT                   QQVCRVRNKDIRKFLDGLYVSEKGNIIEE"
FT   exon            500252..500297
FT                   /gene="Pc16g02160"
FT                   /locus_tag="PCH_Pc16g02160"
FT                   /number=1
FT   intron          500298..500562
FT                   /gene="Pc16g02160"
FT                   /locus_tag="PCH_Pc16g02160"
FT                   /number=1
FT   exon            500563..500866
FT                   /gene="Pc16g02160"
FT                   /locus_tag="PCH_Pc16g02160"
FT                   /number=2
FT   intron          500867..500964
FT                   /gene="Pc16g02160"
FT                   /locus_tag="PCH_Pc16g02160"
FT                   /number=2
FT   exon            500965..501142
FT                   /gene="Pc16g02160"
FT                   /locus_tag="PCH_Pc16g02160"
FT                   /number=3
FT   intron          501143..501213
FT                   /gene="Pc16g02160"
FT                   /locus_tag="PCH_Pc16g02160"
FT                   /number=3
FT   exon            501214..501264
FT                   /gene="Pc16g02160"
FT                   /locus_tag="PCH_Pc16g02160"
FT                   /number=4
FT   mRNA            join(<501844..501927,502053..502183,502260..503058,
FT                   503116..>503850)
FT                   /gene="Pc16g02170"
FT                   /locus_tag="PCH_Pc16g02170"
FT   CDS_pept        join(501844..501927,502053..502183,502260..503058,
FT                   503116..503850)
FT                   /gene="Pc16g02170"
FT                   /locus_tag="PCH_Pc16g02170"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPCC1450.16c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02170"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92887"
FT                   /db_xref="GOA:B6H788"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniProtKB/TrEMBL:B6H788"
FT                   /inference="similar to AA sequence:PIR:T40998"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /inference="protein motif:COGS:COG1752"
FT                   /inference="protein motif:COGS:COG4667"
FT                   /protein_id="CAP92887.1"
FT                   /translation="MGSWWLGLWNIVGAVWNMVLDVAQFWRDKLLSWWHSKSPRDRLFH
FT                   TLANAQSYEEWEEAAFELDELQSKDIWRQNPVSRHYDYRLILGRLEALMGARESEDILT
FT                   LVNLLRSGLVRNLGNITSTKLFTHAYAGTKLLIDDYITQVALSIQYVTSVPGAPMHPSG
FT                   FSSQAKLELLHDTRQAFGRTTLLLQGGSAFGLCHLGVVKALHLQGLLPRIITGTATGAM
FT                   IAALVGIHSEDELLPLLDGEGLDLSAFERRKMVSGGGEGNSDYSWVGTFYRRMKRLLRK
FT                   GYLFDVGVLEECVRANVGDLTFEEAYARSKRILNITVATTEKNGTPNLLNYLTAPNVLI
FT                   WSAAVASNASSSGLYSPVTIYCKDETGTIIPWPHTQDTVFRPWRHVQYNEGESPLSRIS
FT                   ELFNVNHFIVSQARPYLVPFLRSELNLLDRRQTGWNNLSRSAMRLMIVELRHRLRQLDY
FT                   LGVLPAPLSRLLIDETIPGPNLTLVPDLCFWDLRKLFQSPTKERVSEWTLKGERGVWPA
FT                   ISALKVREAVEIELDRGYQLVRRRRPSDASLSVSVPKQVNAMNEGVPRRRRGESENEEG
FT                   ILADRE"
FT   sig_peptide     501844..501894
FT                   /gene="Pc16g02170"
FT                   /locus_tag="PCH_Pc16g02170"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            501844..501927
FT                   /gene="Pc16g02170"
FT                   /locus_tag="PCH_Pc16g02170"
FT                   /number=1
FT   mat_peptide     join(501895..501927,502053..502183,502260..503058,
FT                   503116..503847)
FT                   /gene="Pc16g02170"
FT                   /locus_tag="PCH_Pc16g02170"
FT   intron          501928..502052
FT                   /gene="Pc16g02170"
FT                   /locus_tag="PCH_Pc16g02170"
FT                   /number=1
FT   exon            502053..502183
FT                   /gene="Pc16g02170"
FT                   /locus_tag="PCH_Pc16g02170"
FT                   /number=2
FT   intron          502184..502259
FT                   /gene="Pc16g02170"
FT                   /locus_tag="PCH_Pc16g02170"
FT                   /number=2
FT   exon            502260..503058
FT                   /gene="Pc16g02170"
FT                   /locus_tag="PCH_Pc16g02170"
FT                   /number=3
FT   intron          503059..503115
FT                   /gene="Pc16g02170"
FT                   /locus_tag="PCH_Pc16g02170"
FT                   /number=3
FT   exon            503116..503850
FT                   /gene="Pc16g02170"
FT                   /locus_tag="PCH_Pc16g02170"
FT                   /number=4
FT   mRNA            complement(join(<504114..504200,504304..504405,
FT                   504639..>504812))
FT                   /gene="Pc16g02180"
FT                   /locus_tag="PCH_Pc16g02180"
FT   CDS_pept        complement(join(504114..504200,504304..504405,
FT                   504639..504812))
FT                   /gene="Pc16g02180"
FT                   /locus_tag="PCH_Pc16g02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92888"
FT                   /db_xref="UniProtKB/TrEMBL:B6H789"
FT                   /protein_id="CAP92888.1"
FT                   /translation="MSLLDDGWTVVERHKNARVRNKIAAENVKFIGHSIKELEGCWVVA
FT                   VNTFFARGGGAEQDERLVLTFIVTAVTGEQRKCHVFETGKGTRCVGDEVLDIKLKSMRV
FT                   ILKPNPNLQDIGIIPR"
FT   exon            complement(504114..504200)
FT                   /gene="Pc16g02180"
FT                   /locus_tag="PCH_Pc16g02180"
FT                   /number=1
FT   intron          complement(504201..504303)
FT                   /gene="Pc16g02180"
FT                   /locus_tag="PCH_Pc16g02180"
FT                   /number=1
FT   exon            complement(504304..504405)
FT                   /gene="Pc16g02180"
FT                   /locus_tag="PCH_Pc16g02180"
FT                   /number=2
FT   intron          complement(504406..504638)
FT                   /gene="Pc16g02180"
FT                   /locus_tag="PCH_Pc16g02180"
FT                   /number=2
FT   exon            complement(504639..504812)
FT                   /gene="Pc16g02180"
FT                   /locus_tag="PCH_Pc16g02180"
FT                   /number=3
FT   mRNA            join(<505768..506060,506122..506456,506513..506817,
FT                   506875..507046,507101..>507306)
FT                   /gene="Pc16g02190"
FT                   /locus_tag="PCH_Pc16g02190"
FT   CDS_pept        join(505768..506060,506122..506456,506513..506817,
FT                   506875..507046,507101..507306)
FT                   /gene="Pc16g02190"
FT                   /locus_tag="PCH_Pc16g02190"
FT                   /note="unknown EC_number=2.7.-.-"
FT                   /note="Title: similarity to protein kinase AFC1
FT                   -Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92889"
FT                   /db_xref="GOA:B6H790"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H790"
FT                   /inference="similar to AA sequence:SWISSPROT:AFC1_ARATH"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP92889.1"
FT                   /translation="MTSILEWLKRLFGKRLFNLEWLRSLFRRSLKFPVSFPKAGWAVIP
FT                   ADEKVEEEQMPGFYEQNYFLPVTMGEILLSRYQAVGKLGWGTTSTVWLVRDLEMNDYKA
FT                   LKLFALDVFAAEESAFYDQTKQGNQQHPGANRVRAKIGNVMIPRKDWMYYDDHLALVQT
FT                   PLGESLQDLQIRSAGERLDKLSIQSTIYQMLLALDYLHTECHLIHGDIKGDNIFQEIGD
FT                   KTRLDRYVQAEMENPSPRKFADDYPIYRSRPLEPASELGILQLGDFGASAQGDQPRNGK
FT                   ILQPGLYRSPEVVLKKEWNYPVDVWNLAVWAWCAFEGSPLFQCTDTSENKRSYSVSLHL
FT                   AQFTGLLGPPPPDLIEPDTISAEYFDKDGNLVAKDREVKMTSFEELEKHLEGEDKEMFL
FT                   DLMRGMITWRPEDRKTPKELIKHPWLQAMDTCFSQAN"
FT   exon            505768..506060
FT                   /gene="Pc16g02190"
FT                   /locus_tag="PCH_Pc16g02190"
FT                   /number=1
FT   intron          506061..506121
FT                   /gene="Pc16g02190"
FT                   /locus_tag="PCH_Pc16g02190"
FT                   /number=1
FT   exon            506122..506456
FT                   /gene="Pc16g02190"
FT                   /locus_tag="PCH_Pc16g02190"
FT                   /number=2
FT   intron          506457..506512
FT                   /gene="Pc16g02190"
FT                   /locus_tag="PCH_Pc16g02190"
FT                   /number=2
FT   exon            506513..506817
FT                   /gene="Pc16g02190"
FT                   /locus_tag="PCH_Pc16g02190"
FT                   /number=3
FT   intron          506818..506874
FT                   /gene="Pc16g02190"
FT                   /locus_tag="PCH_Pc16g02190"
FT                   /number=3
FT   exon            506875..507046
FT                   /gene="Pc16g02190"
FT                   /locus_tag="PCH_Pc16g02190"
FT                   /number=4
FT   intron          507047..507100
FT                   /gene="Pc16g02190"
FT                   /locus_tag="PCH_Pc16g02190"
FT                   /number=4
FT   exon            507101..507306
FT                   /gene="Pc16g02190"
FT                   /locus_tag="PCH_Pc16g02190"
FT                   /number=5
FT   mRNA            join(<508621..508784,508841..509259,509310..509450,
FT                   509514..509728,509781..509978,510040..510183,
FT                   510239..>510322)
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT   CDS_pept        join(508621..508784,508841..509259,509310..509450,
FT                   509514..509728,509781..509978,510040..510183,
FT                   510239..510322)
FT                   /exception="reasons given in citation"
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /note="putative sequencing error"
FT                   /note="Title: strong similarity to hypothetical neutral
FT                   amino acid permease - Neurospora crassa [putative
FT                   sequencing error]"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="InterPro:IPR021711"
FT                   /db_xref="UniProtKB/TrEMBL:B6H791"
FT                   /inference="similar to AA sequence:PIR:S47892"
FT                   /inference="protein motif:PFAM:PF01490"
FT                   /inference="protein motif:COGS:COG1113"
FT                   /inference="protein motif:COGS:COG0833"
FT                   /inference="protein motif:COGS:COG0531"
FT                   /protein_id="CAP92890.1"
FT                   /translation="MPLTTPVLTVDADNIHKVDTANAQSLHGMWMVFSKCADYMDQGRR
FT                   LENLSWRLWTRETFCVEPEKSNSTSALPLLRSEAGDLPELSASVESAASDQAERIEAHI
FT                   KRPKFSDYRPAVVREDSLASLGRGKEKHITSLDLERMVLNIKEKKQLEPMPTVEPAAPV
FT                   VDITPRPSTPTPTPPSVSTARQVPNFSVRPTPYPHESTESCSTTAPEGNESDTAQVNAS
FT                   DTSVSSSGILPSRPQLVKSTSIVRGFSPSHISSSFRSQPRLSIEPSPSRSATQLKPSPL
FT                   KKKGGMFTLGGSGDDDESSFEERMVPQAGQENATGALKPKNNTDPTKKTASFSNQVSSH
FT                   IIPNSKDISRSDEDAIETDDEVSESAIEDDEDSDWEDSITEGGESSVDEQGGMFQRVDS
FT                   RPNLVSRRSMLTMMMHQPARMQGNAFRSSPALQRSRLTSPSGPSIPQSPPSNEEESLVM
FT                   RGPDVPRSKPIVMNTNASQSMAHSPRTTRRNMLATELTESLRRHLLWERQQKSATANAF
FT                   LKRRHTAHDMKNLQEYPGPKGPHKGVGPNQASAEADPNAADLGKNGSWTNYTTDYGPWE
FT                   YHVKGW"
FT   exon            508621..508784
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /number=1
FT   intron          508785..508840
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /number=1
FT   exon            508841..509259
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /number=2
FT   intron          509260..509309
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /number=2
FT   exon            509310..509450
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /number=3
FT   intron          509451..509513
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /number=3
FT   exon            509514..509728
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /number=4
FT   intron          509729..509780
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /number=4
FT   exon            509781..509978
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /number=5
FT   intron          509979..510039
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /number=5
FT   exon            510040..510183
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /number=6
FT   intron          510184..510238
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /number=6
FT   exon            510239..510322
FT                   /gene="Pc16g02200"
FT                   /locus_tag="PCH_Pc16g02200"
FT                   /number=7
FT   mRNA            complement(join(<511175..511212,511271..>512759))
FT                   /gene="Pc16g02210"
FT                   /locus_tag="PCH_Pc16g02210"
FT   CDS_pept        complement(join(511175..511212,511271..512759))
FT                   /gene="Pc16g02210"
FT                   /locus_tag="PCH_Pc16g02210"
FT                   /note="Title: strong similarity to choline permease Hnm1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92891"
FT                   /db_xref="GOA:B6H792"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B6H792"
FT                   /inference="similar to AA sequence:PIR:S11175"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /inference="protein motif:COGS:COG0833"
FT                   /inference="protein motif:COGS:COG0531"
FT                   /protein_id="CAP92891.1"
FT                   /translation="MALEKEISPSPSPQDHEKGTIENLQLDRLGYKQELRRNRSVLTLL
FT                   FQTLAMAAIPYGEGSPLLSAIYGGGPLSIFIGWIVVCLLDQCIALSLAELSSRYPTSAG
FT                   PYYWTFQISRKKTTLSFINAWIWLIGNWTITLSVNFGFASMLSATISIYHPTWSASSWQ
FT                   LLLIFYAVCLTSLAICIFANNHLPLVDTLCATWTLLTIIIILVALSIKADTGRHSVSYT
FT                   LSHYDKSFAGWGDFTFFIGLLPAAYTFSAIGMISSMAEECANPAIKVPRAIALSIPVGG
FT                   TAGLFFIIPICATLPPLQDIIDAPAGQALPYILARVMGSPAGGLGLVSLVLVITVFCSI
FT                   SITVAASRATWAVARDDAVPLARLWARVDQRWGVPVWALVLLTGIQMLLGLINLGSSSA
FT                   FTAFVSVGVIALATAYAIPIFLSLWYGRREVAKAPWNCGGVGWFVNVVALAWIAFELVL
FT                   FSMPMALPVTAVSMNYASVVFVGFMAISAVWYGVYARKYYKGPPESDALD"
FT   exon            complement(511175..511212)
FT                   /gene="Pc16g02210"
FT                   /locus_tag="PCH_Pc16g02210"
FT                   /number=1
FT   intron          complement(511213..511270)
FT                   /gene="Pc16g02210"
FT                   /locus_tag="PCH_Pc16g02210"
FT                   /number=1
FT   exon            complement(511271..512759)
FT                   /gene="Pc16g02210"
FT                   /locus_tag="PCH_Pc16g02210"
FT                   /number=2
FT   mRNA            complement(<513516..>515699)
FT                   /gene="Pc16g02220"
FT                   /locus_tag="PCH_Pc16g02220"
FT   CDS_pept        complement(513516..515699)
FT                   /gene="Pc16g02220"
FT                   /locus_tag="PCH_Pc16g02220"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   YGR266w - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92892"
FT                   /db_xref="UniProtKB/TrEMBL:B6H793"
FT                   /inference="similar to AA sequence:PIR:S64599"
FT                   /protein_id="CAP92892.1"
FT                   /translation="MGNPALDLKVAQTNQSMVAIAGIPQNGETGQYIARGSNDRFELIS
FT                   GPLLNLKNMHYEATTTWHGSVLIVTKPTQDNPQLRLRQVGAVDSGAQNGEGRAPTSQTI
FT                   EGLKLYEDPQKAFWRFSLTVPVAAFEARWAYDIPGLYESGAQVQTSWEFVVPAEEQSMR
FT                   IMFHSCNGFSVGTDMDAWVGPNLWNDVMRVHGEKPFHVMVGGGDQIYNDGIRVDGPLKP
FT                   WTMISNPHKRRHHDFNNQMRAESDDYYYANYVRWYNTEPFRAANGRIPQVNIWDDHDII
FT                   DGFGSYTDHFMKCAVFRGIGGVAFKYYCLFQHHIAPPKSTFTTDSPQTMHAVNGTSGVD
FT                   PRQVENTYVLENQVEDDSWIIGKRPGPYVEERSRNLYMRFGKRIAFMGLDARTERTRHQ
FT                   VNYEDTYDLIFDRLQREIVDSNGDIKHLVVLLGVPIAYPRLAWLENILTSPLIAPVRLL
FT                   NKRFGVAGGLFNEFDGQVDLLDDLDDHYTARQHKRERKMLVHRLQEFARSHSVRVTILS
FT                   GDVHLAAIGRFYSNPKLNLSGENDHRFIVNVVSSAITNKPPPQAVANLLARRNKIHHLD
FT                   RECDETLMPIFDKQPGGREKGADWNKVTMPSRNFAILTEVVAPGAGNTGILDANSVKLD
FT                   RLPKDGHAPLHKGEVDAGTTHGAADGFTCATGMYGGLDVSVRVEIDPHDRSATTEGYGF
FT                   SIPPLLATEGPPSTGHRLSLHSRRSQGRPSTAM"
FT   exon            complement(513516..515699)
FT                   /gene="Pc16g02220"
FT                   /locus_tag="PCH_Pc16g02220"
FT                   /number=1
FT   mRNA            complement(join(<515918..516247,516291..516316,
FT                   516401..516419,516550..>517542))
FT                   /gene="Pc16g02230"
FT                   /locus_tag="PCH_Pc16g02230"
FT   CDS_pept        complement(join(515918..516247,516291..516316,
FT                   516401..516419,516550..517542))
FT                   /gene="Pc16g02230"
FT                   /locus_tag="PCH_Pc16g02230"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig_1_18_scaffold_1.tfa_440wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92893"
FT                   /db_xref="UniProtKB/TrEMBL:B6H794"
FT                   /protein_id="CAP92893.1"
FT                   /translation="MQSPRLSPSADDMIPVNPLKRVKPTKSTNPNPPKDPQPVTKELSF
FT                   ASYLNRYMRHPWGVIDYHIYLTHIESGRDKLRREKECHLLETTGFAQVTLHDEPVLNNI
FT                   PAYTNPTVFFVSLPVPDIQNESSNALLVLGFDLQSDRLQGYFFEPESPVENYDDLWEVW
FT                   SQGEGHLVIDVPVDRFLAIIRHTMQHRIEILEIGVLHHYGLTTREFQAGLDMVVTVQFL
FT                   QFVDDFAELLSEEPDELRETYTPFQDELRELLASGSRDAWFAVRDGLNIEQYRQKQLKK
FT                   VVSSGLFQGQDVLVLRDGSEEITEKDKSRPVKIVPGHRRWSWSKLRVRVLLFRSIEIKS
FT                   PGVHDSGLYMYKCPKQDNSSIQIAIKICEIHENPRKSDRQKKKCTASLAQSGIARNHSC
FT                   GVTWLNWGVAGITFSPIGQTINGMSWQRQSCSSSFLGPRPQGPKGTDPQPPISLRV"
FT   exon            complement(515918..516247)
FT                   /gene="Pc16g02230"
FT                   /locus_tag="PCH_Pc16g02230"
FT                   /number=1
FT   intron          complement(516248..516290)
FT                   /gene="Pc16g02230"
FT                   /locus_tag="PCH_Pc16g02230"
FT                   /number=1
FT   exon            complement(516291..516316)
FT                   /gene="Pc16g02230"
FT                   /locus_tag="PCH_Pc16g02230"
FT                   /number=2
FT   intron          complement(516317..516400)
FT                   /gene="Pc16g02230"
FT                   /locus_tag="PCH_Pc16g02230"
FT                   /number=2
FT   exon            complement(516401..516419)
FT                   /gene="Pc16g02230"
FT                   /locus_tag="PCH_Pc16g02230"
FT                   /number=3
FT   intron          complement(516420..516549)
FT                   /gene="Pc16g02230"
FT                   /locus_tag="PCH_Pc16g02230"
FT                   /number=3
FT   exon            complement(516550..517542)
FT                   /gene="Pc16g02230"
FT                   /locus_tag="PCH_Pc16g02230"
FT                   /number=4
FT   mRNA            <518856..>519248
FT                   /gene="Pc16g02240"
FT                   /locus_tag="PCH_Pc16g02240"
FT   CDS_pept        518856..519248
FT                   /gene="Pc16g02240"
FT                   /locus_tag="PCH_Pc16g02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92894"
FT                   /db_xref="UniProtKB/TrEMBL:B6H795"
FT                   /protein_id="CAP92894.1"
FT                   /translation="MGQDSVFIVQAEYFQDFDGDAWVSVDSHDFDDPDNEEADWVTVVL
FT                   PEEMAHTHDDEDIMMYVLHNIQTRRAVVREVALHNMGTVCISIPIPVGTADTTSILVQA
FT                   ETDVKKWLEHIRDGMVTLDREVIFGR"
FT   exon            518856..519248
FT                   /gene="Pc16g02240"
FT                   /locus_tag="PCH_Pc16g02240"
FT                   /number=1
FT   mRNA            complement(join(<519294..519384,519452..519530,
FT                   519567..519621,519962..>520459))
FT                   /gene="Pc16g02250"
FT                   /locus_tag="PCH_Pc16g02250"
FT   CDS_pept        complement(join(519294..519384,519452..519530,
FT                   519567..519621,519962..520459))
FT                   /gene="Pc16g02250"
FT                   /locus_tag="PCH_Pc16g02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92895"
FT                   /db_xref="GOA:B6H7A8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A8"
FT                   /protein_id="CAP92895.1"
FT                   /translation="MNKGKMPIYQGHSSSLSSEPPQLCSNPLTNLPSQFQPSVYKFTSG
FT                   QYFAEPAGHRSDYYWVTVYFPKDIDHRDIQDSEVMLYVKDMIVKGRFTIDDQSMHGLGG
FT                   KCLSIPIKRDPDTPLPKSYTPDPTHPDLLLAENLAAYWKDQIAFKKVTLDRRMIFVETR
FT                   RKTRVPAILGGIVTVFLSIFFDTWMDIWPYTYMNIYVHVLDTRELAMRFDIPTLTQFSD
FT                   STRQPIAQSLDNPFVLEI"
FT   exon            complement(519294..519384)
FT                   /gene="Pc16g02250"
FT                   /locus_tag="PCH_Pc16g02250"
FT                   /number=1
FT   intron          complement(519385..519451)
FT                   /gene="Pc16g02250"
FT                   /locus_tag="PCH_Pc16g02250"
FT                   /number=1
FT   exon            complement(519452..519530)
FT                   /gene="Pc16g02250"
FT                   /locus_tag="PCH_Pc16g02250"
FT                   /number=2
FT   intron          complement(519531..519566)
FT                   /gene="Pc16g02250"
FT                   /locus_tag="PCH_Pc16g02250"
FT                   /number=2
FT   exon            complement(519567..519621)
FT                   /gene="Pc16g02250"
FT                   /locus_tag="PCH_Pc16g02250"
FT                   /number=3
FT   intron          complement(519622..519961)
FT                   /gene="Pc16g02250"
FT                   /locus_tag="PCH_Pc16g02250"
FT                   /number=3
FT   exon            complement(519962..520459)
FT                   /gene="Pc16g02250"
FT                   /locus_tag="PCH_Pc16g02250"
FT                   /number=4
FT   mRNA            join(<521064..521205,521248..>521552)
FT                   /gene="Pc16g02260"
FT                   /locus_tag="PCH_Pc16g02260"
FT   CDS_pept        join(521064..521205,521248..521552)
FT                   /gene="Pc16g02260"
FT                   /locus_tag="PCH_Pc16g02260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92896"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A9"
FT                   /protein_id="CAP92896.1"
FT                   /translation="MPFFQASVFQSTQPDHDRRFHFKDPHNSQPGWVWGTVALPDTIGV
FT                   ATAGLVSWGDRATHGLGNYCISFPIKVETPEQNLERLTDQVQDAAMWWLRLVRDKSVSI
FT                   DKHMLFQARQPPPDRDDQLLDAPLHWERPKYTVPNPWSAVTVLQ"
FT   exon            521064..521205
FT                   /gene="Pc16g02260"
FT                   /locus_tag="PCH_Pc16g02260"
FT                   /number=1
FT   intron          521206..521247
FT                   /gene="Pc16g02260"
FT                   /locus_tag="PCH_Pc16g02260"
FT                   /number=1
FT   exon            521248..521552
FT                   /gene="Pc16g02260"
FT                   /locus_tag="PCH_Pc16g02260"
FT                   /number=2
FT   mRNA            complement(join(<521795..522065,522128..522302,
FT                   522369..522702,522760..522863,522919..>523762))
FT                   /gene="Pc16g02270"
FT                   /locus_tag="PCH_Pc16g02270"
FT   CDS_pept        complement(join(521795..522065,522128..522302,
FT                   522369..522702,522760..522863,522919..523762))
FT                   /gene="Pc16g02270"
FT                   /locus_tag="PCH_Pc16g02270"
FT                   /note="Title: similarity to hypothetical membrane protein
FT                   YGR101w - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92897"
FT                   /db_xref="GOA:B6H7B0"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B0"
FT                   /inference="similar to AA sequence:PIR:S64406"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /inference="protein motif:COGS:COG0705"
FT                   /inference="protein motif:COGS:COG1263"
FT                   /inference="protein motif:COGS:COG0004"
FT                   /protein_id="CAP92897.1"
FT                   /translation="MSNVVWAVWRAPCPGLRTSVLPVPFRAASRDLRITPWRMYSTSRQ
FT                   SMLPIPNLLSQLLARPSRPTPTPISPQRFNPVSTPRRFKRTSAASQKPKPKSDPSEVHP
FT                   RQKPFSDAEIKAIFGPAKFNAKLGNRILAVLHGHRLSGTLDADLPVDIARAVTKQQVDA
FT                   ALEWLRDEYPLDEDAAIFARIEREDRAAEEKLVRRAEKLGLYKPQSGSYDAELGEEGSP
FT                   YGKSVLKEARERNEKRLLAEQERKRQEWLDGEKEEQERLKREFGKNTSLQEYQEAALTE
FT                   ARPRADPIERPYLAWVQKHHIAATNDSPESMNITNSQRLLAPLLFSIVVLALCYTFAQK
FT                   YEFPARKDRIMPDVPPAVATVGAIVAANVAVTLLWKYIPPAWKLLNRYFVIVPFYPSSL
FT                   GMIGSTFSHQTWRHLGTNMMVLGLMGTRVHDEIGRGNFLAIYFASGVMGSVFSLTRSVI
FT                   LGRLGMTSLGASAATSGIVAAWCMSHFNDKLTMWILPQGLQDQIWTYGWVFLTCLVGTE
FT                   VFSLIAPAFLFRAWPLSRLTKMDHAAHLGGYATGAGCGYTLMQKRKERERKARQSRWF"
FT   exon            complement(521795..522065)
FT                   /gene="Pc16g02270"
FT                   /locus_tag="PCH_Pc16g02270"
FT                   /number=1
FT   intron          complement(522066..522127)
FT                   /gene="Pc16g02270"
FT                   /locus_tag="PCH_Pc16g02270"
FT                   /number=1
FT   exon            complement(522128..522302)
FT                   /gene="Pc16g02270"
FT                   /locus_tag="PCH_Pc16g02270"
FT                   /number=2
FT   intron          complement(522303..522368)
FT                   /gene="Pc16g02270"
FT                   /locus_tag="PCH_Pc16g02270"
FT                   /number=2
FT   exon            complement(522369..522702)
FT                   /gene="Pc16g02270"
FT                   /locus_tag="PCH_Pc16g02270"
FT                   /number=3
FT   intron          complement(522703..522759)
FT                   /gene="Pc16g02270"
FT                   /locus_tag="PCH_Pc16g02270"
FT                   /number=3
FT   exon            complement(522760..522863)
FT                   /gene="Pc16g02270"
FT                   /locus_tag="PCH_Pc16g02270"
FT                   /number=4
FT   intron          complement(522864..522918)
FT                   /gene="Pc16g02270"
FT                   /locus_tag="PCH_Pc16g02270"
FT                   /number=4
FT   exon            complement(522919..523762)
FT                   /gene="Pc16g02270"
FT                   /locus_tag="PCH_Pc16g02270"
FT                   /number=5
FT   mRNA            <524168..>524629
FT                   /gene="Pc16g02280"
FT                   /locus_tag="PCH_Pc16g02280"
FT   CDS_pept        524168..524629
FT                   /gene="Pc16g02280"
FT                   /locus_tag="PCH_Pc16g02280"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g00680 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92898"
FT                   /db_xref="GOA:B6H7B1"
FT                   /db_xref="InterPro:IPR038966"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B1"
FT                   /protein_id="CAP92898.1"
FT                   /translation="MSTESLPITPGAFAEAIKELPIAVLYSKVSELTNSIAHLHRSNAE
FT                   LRAFLAESNDSEEDKKELEGYITENEGVAVSMNERILLLKTEVENRGQPWIELDELKIN
FT                   NDQEASPVTNGNETETETETETGVRPGSGAEAGAGQESHDREDGDGVYL"
FT   exon            524168..524629
FT                   /gene="Pc16g02280"
FT                   /locus_tag="PCH_Pc16g02280"
FT                   /number=1
FT   mRNA            complement(join(<525278..525794,525846..525960,
FT                   526018..526286,526548..>526570))
FT                   /gene="Pc16g02290"
FT                   /locus_tag="PCH_Pc16g02290"
FT   CDS_pept        complement(join(525278..525794,525846..525960,
FT                   526018..526286,526548..526570))
FT                   /gene="Pc16g02290"
FT                   /locus_tag="PCH_Pc16g02290"
FT                   /note="Title: strong similarity to completion of mitosis
FT                   and maintenance of ploidy protein like protein An08g00690
FT                   -Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02290"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92899"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="InterPro:IPR036703"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B2"
FT                   /inference="protein motif:PFAM:PF03637"
FT                   /protein_id="CAP92899.1"
FT                   /translation="MATFFQSVRQGFGRGGNNKSNNPPKSPAQTSAPQHQATMSNSPSI
FT                   SSSLSVENQANDPEGPKYFFQEKYAPLNVRGNFLTLCACPKNVELGEWLAHQIVEQYRL
FT                   LHGMLQVIQEVNTVTGLPICNENTCPTMSAGRLTYTWLVDGRAAKISAPKFINRVEKWI
FT                   VSKIHDPVMFPTEKVNGTPETSAIKEANGASATPSDPANPDEWIGKSSGFPPTFYKDCQ
FT                   GIMKQMFRCYAHLYHAHWLNPFWHINKHDVLNMCFVHFVTVSKYYGLVSDKEMEPMQPL
FT                   IELFIKQQRVPPEALNGGHWAQQATT"
FT   exon            complement(525278..525794)
FT                   /gene="Pc16g02290"
FT                   /locus_tag="PCH_Pc16g02290"
FT                   /number=1
FT   intron          complement(525795..525845)
FT                   /gene="Pc16g02290"
FT                   /locus_tag="PCH_Pc16g02290"
FT                   /number=1
FT   exon            complement(525846..525960)
FT                   /gene="Pc16g02290"
FT                   /locus_tag="PCH_Pc16g02290"
FT                   /number=2
FT   intron          complement(525961..526017)
FT                   /gene="Pc16g02290"
FT                   /locus_tag="PCH_Pc16g02290"
FT                   /number=2
FT   exon            complement(526018..526286)
FT                   /gene="Pc16g02290"
FT                   /locus_tag="PCH_Pc16g02290"
FT                   /number=3
FT   intron          complement(526287..526547)
FT                   /gene="Pc16g02290"
FT                   /locus_tag="PCH_Pc16g02290"
FT                   /number=3
FT   exon            complement(526548..526570)
FT                   /gene="Pc16g02290"
FT                   /locus_tag="PCH_Pc16g02290"
FT                   /number=4
FT   mRNA            join(<526920..527068,527120..527285,527339..>528331)
FT                   /gene="Pc16g02300"
FT                   /locus_tag="PCH_Pc16g02300"
FT   CDS_pept        join(526920..527068,527120..527285,527339..528331)
FT                   /gene="Pc16g02300"
FT                   /locus_tag="PCH_Pc16g02300"
FT                   /note="Title: strong similarity to hydrophilic proteasome
FT                   interacting protein like protein An08g00700 - Aspergillus
FT                   niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02300"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92900"
FT                   /db_xref="GOA:B6H7B3"
FT                   /db_xref="InterPro:IPR007149"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B3"
FT                   /inference="protein motif:PFAM:PF04004"
FT                   /protein_id="CAP92900.1"
FT                   /translation="MSSDEEGVRRPSNGNESPAHSNAHDSGADQMDEGDDLFGSDGEGG
FT                   LDDIEPHRTLDDEQLDSGDDENRYDRREDRMEDVAEEQQEVNVADQDLARAPVPLTNDG
FT                   EVYTMRVPDFLSIEGEEFNPETYVPPPYQTAATSLCWRKDPADESLLQSNARIIKWEDG
FT                   SITLQLASAPLEQYRIASKPLAPLTKSGDYDHKLDSHVYLAAGLETAQVFRLTSHITQG
FT                   LTVLPTTLETDDAVQRLQEQLAAAARGSKQTAAGTAPRYELTEDPELAGKRAEMMEKEA
FT                   IKAERRRQQLADREADRGRRHGATRPGPSGLSVGGLEDAGLLTTRPRAKPRRQNRRGEI
FT                   YTDDEEEDYSRGARNREDEYDEDDGFLVGSDEEVEEEAEDEEEELEDEDMDAEGEDDVE
FT                   AAPAKAGRSKPEPQVRDGTPPARKKNRYVVDDEDDE"
FT   exon            526920..527068
FT                   /gene="Pc16g02300"
FT                   /locus_tag="PCH_Pc16g02300"
FT                   /number=1
FT   intron          527069..527119
FT                   /gene="Pc16g02300"
FT                   /locus_tag="PCH_Pc16g02300"
FT                   /number=1
FT   exon            527120..527285
FT                   /gene="Pc16g02300"
FT                   /locus_tag="PCH_Pc16g02300"
FT                   /number=2
FT   intron          527286..527338
FT                   /gene="Pc16g02300"
FT                   /locus_tag="PCH_Pc16g02300"
FT                   /number=2
FT   exon            527339..528331
FT                   /gene="Pc16g02300"
FT                   /locus_tag="PCH_Pc16g02300"
FT                   /number=3
FT   mRNA            complement(join(<528653..529884,529941..>530034))
FT                   /gene="Pc16g02310"
FT                   /locus_tag="PCH_Pc16g02310"
FT   CDS_pept        complement(join(528653..529884,529941..530034))
FT                   /gene="Pc16g02310"
FT                   /locus_tag="PCH_Pc16g02310"
FT                   /note="Title: weak similarity to aflatoxin biosynthesis
FT                   regulatory protein aflR - Aspergillus parasiticus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02310"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92901"
FT                   /db_xref="GOA:B6H7B4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B4"
FT                   /inference="similar to AA sequence:SWISSPROT:AFLR_ASPPA"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /protein_id="CAP92901.1"
FT                   /translation="MSLLHEYEGGLPLPITNSLSEPKRHAACDECRKRKLKCSGELTGC
FT                   SRCTKQSLSCNYSIQKQMGRPPKKRARTDNEGVDFPALSEAEIWPSPEDSQQSSLGMDT
FT                   VTLTDADHLCPQIFWRPGTNMNLPQSQPSDLSQPADLLSGYEDHNHAWRPDRLKQPNLP
FT                   VPASSSPWPDFSAISEATAMPMPFPNSPPFPSMHSLPLSPATSISSDSTTSGCPCLSYL
FT                   YLSLSHMTSISSFPVNSHTLCSLYIAARTARDVIRCQVCPKVFSTGLQNIMFIGTLLTV
FT                   TADAWLRVLRADAVELGTQSALPQYVSEALQSPDPAQYWKSWLHQVVRRAVIGGAVEPS
FT                   AMIACSEQPDLLSMIIEIENRQRRFHEPGKHPLGECNPIFMPDSAQSQDEDDHGEKKFL
FT                   CLRVVGSARDVIARFNFDPSEYPEGVEPVTATNKAHAGAYHA"
FT   exon            complement(528653..529884)
FT                   /gene="Pc16g02310"
FT                   /locus_tag="PCH_Pc16g02310"
FT                   /number=1
FT   intron          complement(529885..529940)
FT                   /gene="Pc16g02310"
FT                   /locus_tag="PCH_Pc16g02310"
FT                   /number=1
FT   exon            complement(529941..530034)
FT                   /gene="Pc16g02310"
FT                   /locus_tag="PCH_Pc16g02310"
FT                   /number=2
FT   mRNA            <530250..>532556
FT                   /gene="Pc16g02320"
FT                   /locus_tag="PCH_Pc16g02320"
FT   CDS_pept        530250..532556
FT                   /gene="Pc16g02320"
FT                   /locus_tag="PCH_Pc16g02320"
FT                   /note="Title: strong similarity to conserved eukaryotic
FT                   protein involved in ribosome biogenesis Erb1 -Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02320"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92902"
FT                   /db_xref="GOA:B6H7B5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012953"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR028598"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B5"
FT                   /inference="similar to AA sequence:PIR:S54549"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /protein_id="CAP92902.1"
FT                   /translation="MNPKAASKKRKAVTRDVEEEAGVFSGDELSKGNLDGALSDNSKDL
FT                   SDSEDDESDSEVELVDDFSDSEDGEEELDSDEIPSDTEEVKPTAGDPNFRIVKDANGND
FT                   RYLWDEIHPDDNSELSEVDENANTIGDIPLKFYDEYPHIGYDINGKKIMRPAKGEALDA
FT                   LLDSIEIPKGWTGLTDPKTGKPLNLSQEELELLRKVQMNEVPSEGYDPYEPLVEWFSSE
FT                   KEIMPLSAAPEPKRRFVPSKHEQKRVMKLVKAIREGRILPYKAPEEREDKEEELINYDL
FT                   WADEAERPDHVMHIPAPKLPPPGYEESYHPPPEYLPDSKERKAWEQTDPEDREKDFLPN
FT                   DFGSLRKVPGYDNFVQEKFERCLDLYLAPRVRRSKLNIDPESLLPKLPSPEELKPFPTA
FT                   CATVFRGHKGRVRSVNVDPTGIWLATGGDDGTVRVWELLTGRQLWSAKLSDDEAVNTVR
FT                   WRPGKDAVVLAATAGDDIFLAVPPIVDPEIEKASLDLLDAGWGFAASRPAPSASEDGKK
FT                   NAPPTWIRPEAALVDAGVCVVIPLRYVPKTISWHRRGDYFVTVCSGASTPASVAISIHT
FT                   VSKHLTQFPFRRRLKGGGPPQTAHFHPSKPILFVANQRSIRAYDLSRQLLVKILQPGAR
FT                   WISSFDIHPTSSSASGGDNIIVGSYDRRLLWHDLDLSQRPYKTLRYHRKAIRAVKFHPS
FT                   GRYPLFADASDDGSLQIFHGSVTGDMLSNATIVPLKVLKGHKITGELGVLDIDWHPREA
FT                   WAVSAGADGTCRLWM"
FT   exon            530250..532556
FT                   /gene="Pc16g02320"
FT                   /locus_tag="PCH_Pc16g02320"
FT                   /number=1
FT   mRNA            complement(join(<532896..534785,534853..535092,
FT                   535142..>535195))
FT                   /gene="Pc16g02330"
FT                   /locus_tag="PCH_Pc16g02330"
FT   CDS_pept        complement(join(532896..534785,534853..535092,
FT                   535142..535195))
FT                   /gene="Pc16g02330"
FT                   /locus_tag="PCH_Pc16g02330"
FT                   /note="unknown EC_number=3.6.1.-"
FT                   /note="Title: strong similarity to transitional endoplasmic
FT                   reticulum like protein An08g00730 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02330"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92903"
FT                   /db_xref="GOA:B6H7B6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B6"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /inference="protein motif:COGS:COG0464"
FT                   /protein_id="CAP92903.1"
FT                   /translation="MPARKGGRPTLSQGLDREVYQIVRKIIDDQPENGRIRLSVPAIYD
FT                   TIKKSNSSLNRKPKRLIEDSLERVLEVVKADMGEEDEDSMEGDFEGLEEPAATEPNGMN
FT                   QSVVGSWATTKAKKTESTASTPAPTSSKRRTHGGESASKRRKAEPADRSPPTHVSLADL
FT                   GGLDDVVQELGDLVILPMTRPQVYLSSNVQPPRGVLLHGPPGCGKTLIANAFAAELGVP
FT                   FISISAPSVVSGMSGESEKALREYFEEAKRLAPCLIFIDEIDAITPKRESAQREMEKRI
FT                   VAQLLTCMDEIALEKTDGKPVIVLAATNRPDSLDAALRRGGRFDKEINMTVPSEPVREQ
FT                   ILRALTRKMRLADDIDLKTLAKRTPGFVGADLNDLVSTAGSAAIKRYLAILKSNSGEEM
FT                   EMEIEGEDDISPRVRELRRLINHAKETPIGDEAEVVLVSNADFFTALPKIQPSSKREGF
FT                   ATIPDTTWADIGALGGIRDELVTAIVEPIKNPDIYANVGITAPTGVLLWGPPGCGKTLL
FT                   AKAVANESRANFISVKGPELLNKFVGESERAVRQVFVRARSSVPCVIFFDELDALVPRR
FT                   DDTLSEASARVVNTLLTELDGLGSSRQGIYVIAATNRPDIIDPAMLRPGRLETLLFVNL
FT                   PTPLERVEILQTLVRKLSIEFNEDLRKLAEECEGFSGADLGSLLRRAGYSAIKRRDSIK
FT                   LVDFVAAKSFIRPSVTDLRKYEKLRRDWSGGVV"
FT   exon            complement(532896..534785)
FT                   /gene="Pc16g02330"
FT                   /locus_tag="PCH_Pc16g02330"
FT                   /number=1
FT   intron          complement(534786..534852)
FT                   /gene="Pc16g02330"
FT                   /locus_tag="PCH_Pc16g02330"
FT                   /number=1
FT   exon            complement(534853..535092)
FT                   /gene="Pc16g02330"
FT                   /locus_tag="PCH_Pc16g02330"
FT                   /number=2
FT   intron          complement(535093..535141)
FT                   /gene="Pc16g02330"
FT                   /locus_tag="PCH_Pc16g02330"
FT                   /number=2
FT   exon            complement(535142..535195)
FT                   /gene="Pc16g02330"
FT                   /locus_tag="PCH_Pc16g02330"
FT                   /number=3
FT   mRNA            join(<535359..535402,535580..535943,536034..>536261)
FT                   /gene="Pc16g02340"
FT                   /locus_tag="PCH_Pc16g02340"
FT   CDS_pept        join(535359..535402,535580..535943,536034..536261)
FT                   /gene="Pc16g02340"
FT                   /locus_tag="PCH_Pc16g02340"
FT                   /note="Title: similarity to vacuolar protein
FT                   sorting-associated protein Vps20 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92904"
FT                   /db_xref="GOA:B6H7B7"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B7"
FT                   /inference="similar to AA sequence:PIR:S54452"
FT                   /inference="protein motif:PFAM:PF03357"
FT                   /protein_id="CAP92904.1"
FT                   /translation="MGNSSSSQKISAQDRAILDLKNQRDKLHQYQRRITVLTDRETEIA
FT                   KECLARDDRRRALLALRRKKYQESLLAKTDGQLAQLEQLTGQVEFALVQKDVLFGLQQG
FT                   TKVLQTINKEMGGIEGVERLMGETEDARAYQEEVSQMLAGHLTNQDEDEVEDELEALQR
FT                   ELAGPEILPDDVVLPSPPTADLPVEEPVLESSKRTKAKAETRTALPAT"
FT   exon            535359..535402
FT                   /gene="Pc16g02340"
FT                   /locus_tag="PCH_Pc16g02340"
FT                   /number=1
FT   intron          535403..535579
FT                   /gene="Pc16g02340"
FT                   /locus_tag="PCH_Pc16g02340"
FT                   /number=1
FT   exon            535580..535943
FT                   /gene="Pc16g02340"
FT                   /locus_tag="PCH_Pc16g02340"
FT                   /number=2
FT   intron          535944..536033
FT                   /gene="Pc16g02340"
FT                   /locus_tag="PCH_Pc16g02340"
FT                   /number=2
FT   exon            536034..536261
FT                   /gene="Pc16g02340"
FT                   /locus_tag="PCH_Pc16g02340"
FT                   /number=3
FT   mRNA            complement(join(<536626..537046,537202..537313,
FT                   537370..>537499))
FT                   /gene="Pc16g02350"
FT                   /locus_tag="PCH_Pc16g02350"
FT   CDS_pept        complement(join(536626..537046,537202..537313,
FT                   537370..537499))
FT                   /gene="Pc16g02350"
FT                   /locus_tag="PCH_Pc16g02350"
FT                   /note="Title: strong similarity to hypothetical conserved
FT                   protein SPBP35G2.02 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92905"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="InterPro:IPR037047"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B8"
FT                   /inference="similar to AA sequence:TREMBL:SPBP35G2.2"
FT                   /inference="protein motif:PFAM:PF06201"
FT                   /inference="protein motif:COGS:COG0526"
FT                   /protein_id="CAP92905.1"
FT                   /translation="MSGHHHDHGHCHGEDHDHTNDITPAIQSLLYSQINFDLITTLNET
FT                   TPNSGASIVQKTWAERLNDKPELESDADEQLLMTIPFNGQVNVHSLLLYTAPTNSAPRT
FT                   VKLFKNRDDLDFSTASELHPAQTIEVPRPVPGADVFELPLNRAHWNATTSVTLFFEDNW
FT                   SDGEEDVTKVGYVGFKGQFMKLTREPVNFLYEAAANPQDHVSIPGVSGIGGRIMPGQ"
FT   exon            complement(536626..537046)
FT                   /gene="Pc16g02350"
FT                   /locus_tag="PCH_Pc16g02350"
FT                   /number=1
FT   intron          complement(537047..537201)
FT                   /gene="Pc16g02350"
FT                   /locus_tag="PCH_Pc16g02350"
FT                   /number=1
FT   exon            complement(537202..537313)
FT                   /gene="Pc16g02350"
FT                   /locus_tag="PCH_Pc16g02350"
FT                   /number=2
FT   intron          complement(537314..537369)
FT                   /gene="Pc16g02350"
FT                   /locus_tag="PCH_Pc16g02350"
FT                   /number=2
FT   exon            complement(537370..537499)
FT                   /gene="Pc16g02350"
FT                   /locus_tag="PCH_Pc16g02350"
FT                   /number=3
FT   mRNA            complement(join(<537892..538026,538084..539742,
FT                   539808..>540032))
FT                   /gene="Pc16g02360"
FT                   /locus_tag="PCH_Pc16g02360"
FT   CDS_pept        complement(join(537892..538026,538084..539742,
FT                   539808..540032))
FT                   /gene="Pc16g02360"
FT                   /locus_tag="PCH_Pc16g02360"
FT                   /note="Title: strong similarity to RNA helicase 1 HRH1
FT                   -Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02360"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92906"
FT                   /db_xref="GOA:B6H7B9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B9"
FT                   /inference="similar to AA sequence:PIR:A56236"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /inference="protein motif:PFAM:PF04408"
FT                   /inference="protein motif:COGS:COG1643"
FT                   /protein_id="CAP92906.1"
FT                   /translation="MASEQELSTSFIPALYKPAALLPIARHKKNLLYLVEKYPVTIVVG
FT                   QTGSGKTTQLPQYLDQAGWCEDGKIIAVTQPRRVAATTVATRVAEEMRCKVGEEVGYSI
FT                   RFEDLTSPATRIKFLTDGMLLREALVDPLLSRYSVIMVDEAHERSLGTDVLLGTLKKIR
FT                   KKRPELRIIVSSATLQAEDFLRFFAGEEYQPEAEPEDLGGSVGRIISLEGRMYPVDILF
FT                   LDSPAEDYIERAVKTVFDIHTQEPEGDVLLFLTGREEIDTAIQLISERAATLHPKAPSL
FT                   LPLPLYAGLTTEQQMYVFEPTPENTRKVIVSTNIAEASVTIDGIVYVIDSGFAKLRAYN
FT                   PNTGIDTLTAVPISKASATQRAGRAGRTKPGKCFRLYTQQAFEQMPEARVPEIQRSNLA
FT                   PVIMQLKALGIDNIVRFDFLTPPPAELIIRALELLSSLGAVDDYAKLTKPLGMRMAEIA
FT                   LDPMMAKVLLVAPSFNCLSEILTIAAMVNLQGTVWVQHAGDKRSAESHRRKFAVEEGDH
FT                   LTYLNVYQAFVTKGKKDSKWCRDNLLNYRALLRAVSIRGQLKRYLERFGIQVDETLSSR
FT                   HGAADLSKQPEQIRRCLTTGYFAHAAKMQPDGTFKTVSGGLTLHAHPTSLMFNRKADWV
FT                   IFHEIMQTGEKTYIRDVTKIEKSYLLEYAPDYYRVRQ"
FT   exon            complement(537892..538026)
FT                   /gene="Pc16g02360"
FT                   /locus_tag="PCH_Pc16g02360"
FT                   /number=1
FT   intron          complement(538027..538083)
FT                   /gene="Pc16g02360"
FT                   /locus_tag="PCH_Pc16g02360"
FT                   /number=1
FT   exon            complement(538084..539742)
FT                   /gene="Pc16g02360"
FT                   /locus_tag="PCH_Pc16g02360"
FT                   /number=2
FT   intron          complement(539743..539807)
FT                   /gene="Pc16g02360"
FT                   /locus_tag="PCH_Pc16g02360"
FT                   /number=2
FT   exon            complement(539808..540032)
FT                   /gene="Pc16g02360"
FT                   /locus_tag="PCH_Pc16g02360"
FT                   /number=3
FT   mRNA            join(<540337..540357,540417..540726,540790..541032,
FT                   541087..541353,541406..>541800)
FT                   /gene="Pc16g02370"
FT                   /locus_tag="PCH_Pc16g02370"
FT   CDS_pept        join(540337..540357,540417..540726,540790..541032,
FT                   541087..541353,541406..541800)
FT                   /gene="Pc16g02370"
FT                   /locus_tag="PCH_Pc16g02370"
FT                   /note="Title: similarity to hypothetical protein
FT                   SPBC16E9.02c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92907"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7C0"
FT                   /inference="similar to AA sequence:PIR:T39577"
FT                   /inference="protein motif:PFAM:PF02845"
FT                   /protein_id="CAP92907.1"
FT                   /translation="MSEEDKMNTPGRPLGALNSPNSPRAESPTTARPMDFDDEPQETGV
FT                   ITSSPVAPQPAAAEPAPPKPPRPLSPREQSENTLREAFPSIEPGVVKAVLTASNWHVER
FT                   AFNALLGMTDPKAQEEMTPPPKPPRPTQQSTAAQRQLEADEMYARQLSEHYNATGRRAP
FT                   PPGWESDPRYQRPRGSEDSEEREYSFFDDDLPVIRENLRKGFLETQNKVNSWVTNLKKR
FT                   IDGDDLDEEPSQNQRETTHARPRRSGDMGRRSGDRERYDADPQVLSDDFSALELRDGEA
FT                   PPPRPPRPGNSSLKPSVSPSPDRRRVSFQEGPPTEIDNSYDASTPSKRLSSTGSKSSKW
FT                   QPLSTVEPSPVAENDPFSLGDSDDEKEIKTKEQTTSSEGDQLKHATVESVSDEVGSSKG
FT                   PDTKGASKPESK"
FT   exon            540337..540357
FT                   /gene="Pc16g02370"
FT                   /locus_tag="PCH_Pc16g02370"
FT                   /number=1
FT   intron          540358..540416
FT                   /gene="Pc16g02370"
FT                   /locus_tag="PCH_Pc16g02370"
FT                   /number=1
FT   exon            540417..540726
FT                   /gene="Pc16g02370"
FT                   /locus_tag="PCH_Pc16g02370"
FT                   /number=2
FT   intron          540727..540789
FT                   /gene="Pc16g02370"
FT                   /locus_tag="PCH_Pc16g02370"
FT                   /number=2
FT   exon            540790..541032
FT                   /gene="Pc16g02370"
FT                   /locus_tag="PCH_Pc16g02370"
FT                   /number=3
FT   intron          541033..541086
FT                   /gene="Pc16g02370"
FT                   /locus_tag="PCH_Pc16g02370"
FT                   /number=3
FT   exon            541087..541353
FT                   /gene="Pc16g02370"
FT                   /locus_tag="PCH_Pc16g02370"
FT                   /number=4
FT   intron          541354..541405
FT                   /gene="Pc16g02370"
FT                   /locus_tag="PCH_Pc16g02370"
FT                   /number=4
FT   exon            541406..541800
FT                   /gene="Pc16g02370"
FT                   /locus_tag="PCH_Pc16g02370"
FT                   /number=5
FT   mRNA            complement(join(<542192..542260,542371..542448,
FT                   542570..>542656))
FT                   /gene="Pc16g02380"
FT                   /locus_tag="PCH_Pc16g02380"
FT   CDS_pept        complement(join(542192..542260,542371..542448,
FT                   542570..542656))
FT                   /gene="Pc16g02380"
FT                   /locus_tag="PCH_Pc16g02380"
FT                   /note="Title: similarity to hypothetical protein AT4g09550
FT                   - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92908"
FT                   /db_xref="GOA:B6H7C1"
FT                   /db_xref="InterPro:IPR022214"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7C1"
FT                   /inference="similar to AA sequence:PIR:E85097"
FT                   /protein_id="CAP92908.1"
FT                   /translation="MPPKSQEADDKRQAAREVIDILQEISDLLNTNLDRTELSLCVSLI
FT                   ENGVNPDALATVIKDLRKETGSKRVGNAHAVE"
FT   exon            complement(542192..542260)
FT                   /gene="Pc16g02380"
FT                   /locus_tag="PCH_Pc16g02380"
FT                   /number=1
FT   intron          complement(542261..542370)
FT                   /gene="Pc16g02380"
FT                   /locus_tag="PCH_Pc16g02380"
FT                   /number=1
FT   exon            complement(542371..542448)
FT                   /gene="Pc16g02380"
FT                   /locus_tag="PCH_Pc16g02380"
FT                   /number=2
FT   intron          complement(542449..542569)
FT                   /gene="Pc16g02380"
FT                   /locus_tag="PCH_Pc16g02380"
FT                   /number=2
FT   exon            complement(542570..542656)
FT                   /gene="Pc16g02380"
FT                   /locus_tag="PCH_Pc16g02380"
FT                   /number=3
FT   mRNA            <543254..>544171
FT                   /gene="Pc16g02390"
FT                   /locus_tag="PCH_Pc16g02390"
FT   CDS_pept        543254..544171
FT                   /gene="Pc16g02390"
FT                   /locus_tag="PCH_Pc16g02390"
FT                   /note="Title: similarity to hypothetical protein encoded by
FT                   CG16717 - Drosophila melanogaster"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02390"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92909"
FT                   /db_xref="GOA:B6H7C2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7C2"
FT                   /inference="similar to AA sequence:TREMBL:AE003551.31"
FT                   /protein_id="CAP92909.1"
FT                   /translation="MSYEITTHSGGARCFLIPPKKPSAWQQFRDEPCLFLARKLSAWRP
FT                   TNLPKLPENPVTVVCISNTYHERPEIPPGDILIHAGDLTSDGSLAELQITLNWLQAQPH
FT                   PIKIAVAGRADRYLDKMKKGGRRWRHGHRERAYWGDIIYLEHQHLTVTAPNGRQLRIYG
FT                   SPYSPMTVPSLAFQYSDSDNIWDRVPDNMDILITHTPPYTHRDSLRGCLHLLNHIWMDP
FT                   PRLHVFGCAREHHGCEFLYYDALQAAVERIEDVGGGFSNLLMVVKGLVQSFFRPDIKAK
FT                   SVLVNACTNGGLWDPERQPISVVI"
FT   exon            543254..544171
FT                   /gene="Pc16g02390"
FT                   /locus_tag="PCH_Pc16g02390"
FT                   /number=1
FT   gap             544373..544472
FT                   /estimated_length=unknown
FT   mRNA            <544665..>545183
FT                   /gene="Pc16g02400"
FT                   /locus_tag="PCH_Pc16g02400"
FT   CDS_pept        544665..545183
FT                   /gene="Pc16g02400"
FT                   /locus_tag="PCH_Pc16g02400"
FT                   /note="unknown EC_number=2.3.1.-"
FT                   /note="Title: similarity to hypothetical acetyltransferase
FT                   F21B7.10 - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92910"
FT                   /db_xref="GOA:B6H733"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B6H733"
FT                   /inference="similar to AA sequence:PIR:T00896"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /inference="protein motif:COGS:COG0456"
FT                   /inference="protein motif:COGS:COG0454"
FT                   /protein_id="CAP92910.1"
FT                   /translation="MAPQYETGGMGGMPGLTISDIHALKRNEALEILARISRVEKKTFP
FT                   TNEAFPFGEDLWRKKPNTRVLYAIRAKGSQSDLIAYAVYVRQKGIALLHKVCVTEPNRR
FT                   RGVGQEVLSYIQQRLRKEGCQYIQLWVDQAREPARALYLRIGFEEREVIPDYYAPGRTG
FT                   IKMVLDLQA"
FT   exon            544665..545183
FT                   /gene="Pc16g02400"
FT                   /locus_tag="PCH_Pc16g02400"
FT                   /number=1
FT   mRNA            <545709..>548537
FT                   /gene="Pc16g02410"
FT                   /locus_tag="PCH_Pc16g02410"
FT   CDS_pept        545709..548537
FT                   /gene="Pc16g02410"
FT                   /locus_tag="PCH_Pc16g02410"
FT                   /note="Title: strong similarity to plasma membrane
FT                   glycoprotein Axl2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92911"
FT                   /db_xref="GOA:B6H734"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:B6H734"
FT                   /inference="similar to AA sequence:PIR:S48394"
FT                   /inference="protein motif:COGS:COG2931"
FT                   /protein_id="CAP92911.1"
FT                   /translation="MAFFLTIVLVFLSVASAASLSANYPINAQLPPVARVSQPFRFEFA
FT                   QSTFANTDADTKYSLLNAPSWLEVDSSSLALYGTPDSSDSGANEFKLVASNGSEKDSMD
FT                   VTLIVTADQGPTVNKPLVPQLQKSGPVSYPATLFIHPGRQFSIEFDQDTFDNTHPSTIY
FT                   YGTSPNNAPLPPWITFDPAALKFAGNSPAFPGAGPQTFTFQLVASDVAGYSAANVTFEL
FT                   SIGPHILTFNETVQNFNLTRGEEFNSPKFTSLLSMDGSPVSIKELEKVDAELPNWLNLD
FT                   KENISLSGTPPKDAVNQNITISVTDTFHDQAHLMVRLEFLKLFLDTVNGCEAAIGQDFK
FT                   FVFNQSILTDDSVQLEVDLDNDLAWLTYFSDNKTLYGHVPDDMDPKKFTIPLTAYQGST
FT                   EDTMDFVLDVLKASDTHSNPTDPFTDTGSPDHKKAGIIAISVVVPLVVILSLLILFCCW
FT                   RSRKNSPTIEEGTSDRKAPPRPVRPDVPNCQPSMTERPSRDDNSDDWMSPISPSSIPKL
FT                   ELGPAWNVASFDKRENPVNFVIPEPIIPPRSPARNSPTRGGFVPRRDTITQEDKPVEAV
FT                   SPSKKQNNRLSYTNSPVRRRTTNRSRREPLKPIQPRAMKRESLQSSKSKRYSKRSSGIS
FT                   SIASGLPVRFSGAGHGAGGFGPPGHGVVHTSWQNARASMINDESSLTNMAPMFSRPPAA
FT                   GRMRHSMASSIPENYRRMTLRTVEPDDSIISESDSLEAFVHSRAKHRNSSNPLFSAQIS
FT                   RRTSSGMRALDRNRSMRSRADTVSVSTFSDEYRQSMQDRPLSTAISASEYGDDNTTNNN
FT                   SRFSQYQSQTGLFPLAEGSAYGQSQLSIAQDYRGAISPLPQCWSENSMGSARQLEGQGN
FT                   SQPQKVNDENAMPPSSSMISDLDEHLSRKVNPNKGANHEWWLSSPVEPPRPLKNSDNRS
FT                   LPVASSGELAFV"
FT   sig_peptide     545709..545759
FT                   /gene="Pc16g02410"
FT                   /locus_tag="PCH_Pc16g02410"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            545709..548537
FT                   /gene="Pc16g02410"
FT                   /locus_tag="PCH_Pc16g02410"
FT                   /number=1
FT   mat_peptide     545760..548534
FT                   /gene="Pc16g02410"
FT                   /locus_tag="PCH_Pc16g02410"
FT   mRNA            join(<550223..550258,550608..550926,550983..551056,
FT                   551123..551207,551276..551482,551538..551824,
FT                   551894..>552205)
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT   CDS_pept        join(550223..550258,550608..550926,550983..551056,
FT                   551123..551207,551276..551482,551538..551824,
FT                   551894..552205)
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /note="unknown EC_number=3.1.3.16"
FT                   /note="Title: strong similarity to protein phosphatase type
FT                   2C Ptc2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92912"
FT                   /db_xref="GOA:B6H735"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B6H735"
FT                   /inference="similar to AA sequence:PIR:S50592"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /inference="protein motif:COGS:COG0631"
FT                   /protein_id="CAP92912.1"
FT                   /translation="MGQTLSEPVVEKTSSEGGDDCCVYGVSAMQGWRISMEDAHATVLD
FT                   LQAKYTGTDDKPTDPEHRLAFFGVYDGHGGDKVALFTGENLHKIVSRQDAFAKGDIEQA
FT                   LKDGFLATDRAILEDPRYEEEVSGCTASTAIISQKKIWVANAGDSRSVLGVKGRAKPLS
FT                   FDHKPQNEGEKARITAAGGFVDFGRVNGNLALSRAIGDFEFKKSPELSPEQQIVTAYPD
FT                   VTVHELTNDDEFLVIACDGIWDCQSSQAVVEFVRRGIAAKQPLAQICENMMDNCLASNS
FT                   ETGGVGCDNMTMSVIGLLQGKTKEEWYNQIAERVANGDGPCAPPEYGKSPEEPESFEDT
FT                   PDEYDLEMERSRGFSVRSGRIILLGDGTEVITDQNDEELFDQTEEDQDLTNQVQHESGT
FT                   RNDRQATPGPQGKQENGSGTSAQISESPASTDAEKEKPAS"
FT   exon            550223..550258
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /number=1
FT   intron          550259..550607
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /number=1
FT   exon            550608..550926
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /number=2
FT   intron          550927..550982
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /number=2
FT   exon            550983..551056
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /number=3
FT   intron          551057..551122
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /number=3
FT   exon            551123..551207
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /number=4
FT   intron          551208..551275
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /number=4
FT   exon            551276..551482
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /number=5
FT   intron          551483..551537
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /number=5
FT   exon            551538..551824
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /number=6
FT   intron          551825..551893
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /number=6
FT   exon            551894..552205
FT                   /gene="Pc16g02420"
FT                   /locus_tag="PCH_Pc16g02420"
FT                   /number=7
FT   mRNA            join(<553385..553893,553997..554347,554400..554808,
FT                   554887..>555024)
FT                   /gene="Pc16g02430"
FT                   /locus_tag="PCH_Pc16g02430"
FT   CDS_pept        join(553385..553893,553997..554347,554400..554808,
FT                   554887..555024)
FT                   /gene="Pc16g02430"
FT                   /locus_tag="PCH_Pc16g02430"
FT                   /note="unknown EC_number=2.7.7.15"
FT                   /note="Title: strong similarity to choline-phosphate
FT                   cytidylyltransferase Pct1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92913"
FT                   /db_xref="GOA:B6H736"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR041723"
FT                   /db_xref="UniProtKB/TrEMBL:B6H736"
FT                   /inference="similar to AA sequence:PIR:XNBYCP"
FT                   /inference="protein motif:PFAM:PF01467"
FT                   /inference="protein motif:COGS:COG0615"
FT                   /inference="protein motif:COGS:COG2870"
FT                   /inference="protein motif:COGS:COG0196"
FT                   /protein_id="CAP92913.1"
FT                   /translation="MSPSTSPAGKRKRSASHLPAPVPKNVTADLQPSSRDASGEEGGED
FT                   STGPANANSNSSNGTRHPSKRARKAAAADAASHTEVNGVEPVNKEDPGEPSETTVASSD
FT                   IEGGPRSRPGLHIDLPEDDEPVTEEQMAPPVFGRLQDPVGYHTNPPPTGRPVRVYADGV
FT                   FDLFHLGHMRQLEQAKKAFPDTYLIVGVTGDEETHLRKGLTVLSGAERAETIRHCKWVD
FT                   EVIPCCPWIVTPEFLSEHKIDYVAHDDLPYGAAEGDDIYAPIKEQGKFLVTQRTEGVST
FT                   TGIITRVVRDYDQYISRQFKRGASRQELNVSWLKKNELEIKRHVAELRDNIRNNWTMTG
FT                   QELGRELRQIWQNSRPNSPAPSARNSMDWGMRGPLTSPTGGSKSHLSRVGAEHNRADSP
FT                   MGSRRNEDFATGYSLGLIGGVRAWMARSRQSLQEPPSGMHSPTDEELEPEHNNGYEEEV
FT                   RGRTGHVSAK"
FT   exon            553385..553893
FT                   /gene="Pc16g02430"
FT                   /locus_tag="PCH_Pc16g02430"
FT                   /number=1
FT   intron          553894..553996
FT                   /gene="Pc16g02430"
FT                   /locus_tag="PCH_Pc16g02430"
FT                   /number=1
FT   exon            553997..554347
FT                   /gene="Pc16g02430"
FT                   /locus_tag="PCH_Pc16g02430"
FT                   /number=2
FT   intron          554348..554399
FT                   /gene="Pc16g02430"
FT                   /locus_tag="PCH_Pc16g02430"
FT                   /number=2
FT   exon            554400..554808
FT                   /gene="Pc16g02430"
FT                   /locus_tag="PCH_Pc16g02430"
FT                   /number=3
FT   intron          554809..554886
FT                   /gene="Pc16g02430"
FT                   /locus_tag="PCH_Pc16g02430"
FT                   /number=3
FT   exon            554887..555024
FT                   /gene="Pc16g02430"
FT                   /locus_tag="PCH_Pc16g02430"
FT                   /number=4
FT   mRNA            complement(<555744..>556523)
FT                   /gene="Pc16g02440"
FT                   /locus_tag="PCH_Pc16g02440"
FT   CDS_pept        complement(555744..556523)
FT                   /gene="Pc16g02440"
FT                   /locus_tag="PCH_Pc16g02440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92914"
FT                   /db_xref="GOA:B6H737"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:B6H737"
FT                   /protein_id="CAP92914.1"
FT                   /translation="MDIPISPSACLLLGSLPLLALSEWNSTSHTGTAVFKMLSSLAFLS
FT                   SPLLLSTEWTDYRRLITIGLGFSLLGDFFLIPSHSEFHDLNTTPSATSEAKSEGNVSIS
FT                   FQLGIVAFAAAHIAYTIAFLQDSSDTSWMTFAVTFVGTLGAARWLGVIYPPPSFSLRNN
FT                   VLGLAIAPDMKPLVSVYAVIIGTMFAAATSTSPLTVPTEWWHSRALGAAMFVVSDLFVA
FT                   KNAFGKSSAKGRGWLRIFVGYALYFWAQMVIAGTVRA"
FT   exon            complement(555744..556523)
FT                   /gene="Pc16g02440"
FT                   /locus_tag="PCH_Pc16g02440"
FT                   /number=1
FT   mat_peptide     complement(555747..556457)
FT                   /gene="Pc16g02440"
FT                   /locus_tag="PCH_Pc16g02440"
FT   sig_peptide     complement(556458..556523)
FT                   /gene="Pc16g02440"
FT                   /locus_tag="PCH_Pc16g02440"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(<556738..>557913)
FT                   /gene="Pc16g02450"
FT                   /locus_tag="PCH_Pc16g02450"
FT   CDS_pept        complement(556738..557913)
FT                   /gene="Pc16g02450"
FT                   /locus_tag="PCH_Pc16g02450"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig46_part_i.tfa_440cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92915"
FT                   /db_xref="UniProtKB/TrEMBL:B6H738"
FT                   /protein_id="CAP92915.1"
FT                   /translation="MRHFDTWVLRDPYSIWHYYPTGHRWRDTVRDLIQSRAICSPNHID
FT                   WNASSPSSSSSSSSTSNQFQFQFQPQQSPLLRLPPELRQIIWSYVLTNSSTPNTQTPQT
FT                   IHLVQLKGKIRHVRCPEPHPNPNDSQSTQPSQTHPNPSLTQNRHCCPTTPARWRIYDGR
FT                   VPGHSDRLLYPHTHSHLPSTLSNSNSALLRVCRSIYYEAETILYKASHFDVDDLYTFIA
FT                   FATSLSPAARNAIARLTVQWMPIWVPMAGLDHKGSIYAHTHSDELWVRFWDIVASLEGL
FT                   RDLGLSLDLGRFTSVVGNTGEAVVSGQRIPFGIMEEWVKPILRVRGLEGFDLAVTARCD
FT                   LLAKGVVEGELVRDVGLLREALRGILCGPRERKKKMEEREGRKGMRLAITA"
FT   exon            complement(556738..557913)
FT                   /gene="Pc16g02450"
FT                   /locus_tag="PCH_Pc16g02450"
FT                   /number=1
FT   mRNA            complement(join(<558277..559272,559360..>559761))
FT                   /gene="Pc16g02460"
FT                   /locus_tag="PCH_Pc16g02460"
FT   CDS_pept        complement(join(558277..559272,559360..559761))
FT                   /gene="Pc16g02460"
FT                   /locus_tag="PCH_Pc16g02460"
FT                   /note="Title: strong similarity to hypothetical membrane
FT                   protein YMR253c - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92916"
FT                   /db_xref="GOA:B6H767"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B6H767"
FT                   /inference="similar to AA sequence:PIR:S53075"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /inference="protein motif:COGS:COG0697"
FT                   /protein_id="CAP92916.1"
FT                   /translation="MVSPNLDSASGTGQYQDHPDAPLPIRVEQSESNSRSEQRSSSTQT
FT                   QTYRDDERGYCESDEAESQPALTQSDPIPIEDDDEAIAIAAASRPRHAWQVWWLRNKGM
FT                   GLVLLAQAFAASMNVMTQVLEIHSSMHPFQILFARMSITAVASYLYMYIASTPSPLGTR
FT                   PVRGLLLLRALFGFTGVYGLYYSVQYLPLSEATVITFLSPIMSCYACSLLIPGETFSRK
FT                   QLLAGLISLGGVVLIARPFSKRDPSMTIATPTATTAWVLGLSTSTVDKPPSETDSYHHV
FT                   MATIVAFLGVLGASGAYTSIRMIGRRAHPLVSVTYFSSVTTVISFVAMLTVPSVPFRVP
FT                   NTVVEWMLLTGLGVCGFLLQFLLTAGLSYVPPASVSDGKPTAQGARATSMVYMQMFFAV
FT                   FYDKVVWGSTLSPISWVGSGIILACAVYVAFAQESPVQQGSGSAEYRDVAGYKDATDEE
FT                   RAEERGN"
FT   exon            complement(558277..559272)
FT                   /gene="Pc16g02460"
FT                   /locus_tag="PCH_Pc16g02460"
FT                   /number=1
FT   intron          complement(559273..559359)
FT                   /gene="Pc16g02460"
FT                   /locus_tag="PCH_Pc16g02460"
FT                   /number=1
FT   exon            complement(559360..559761)
FT                   /gene="Pc16g02460"
FT                   /locus_tag="PCH_Pc16g02460"
FT                   /number=2
FT   mRNA            complement(join(<562201..563694,563753..564275,
FT                   564322..>564452))
FT                   /gene="Pc16g02470"
FT                   /locus_tag="PCH_Pc16g02470"
FT   CDS_pept        complement(join(562201..563694,563753..564275,
FT                   564322..564452))
FT                   /gene="Pc16g02470"
FT                   /locus_tag="PCH_Pc16g02470"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1A9.230 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92917"
FT                   /db_xref="GOA:B6H768"
FT                   /db_xref="InterPro:IPR010678"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H768"
FT                   /inference="similar to AA sequence:PIR:T48719"
FT                   /protein_id="CAP92917.1"
FT                   /translation="MPAPRGSGSFRGARGRGGRGRGRGRGRGGQGRNSFATSRLNESDT
FT                   RSDDSSGGEDDASEQSQEELDDDTLMDEGSSSDEEDENTERPYNELLQLLQPNESSGPA
FT                   RKKRKIATDPNAEVQIAQPAEEPEQGDDDLEAQAPSDDEEEEADEDEDPTAPFEKHFDL
FT                   RDSADLTKQIEPIQSNKWASVKKEVDGLRLVHTVPDTGANSAPILPPLKSTTNIKLKQK
FT                   LKSRAAEILPKITGQAQIIAPYVFNYQDVLYGARTTSNANEIRDIMALHSVNHLLKTRD
FT                   QVLKNNARLAKDPDTDIECRDQGFTRPKVLYILPTRQACVKVLDAITRIYQPEQQENKK
FT                   RFTDSFSAPNDDSWEHKTEDFRELFGGNDDDMFRLGLKFTRKTVKYFAQFYSSDIILAS
FT                   PLGLRTIMDQSDAKKRDHDFLSSIELVVVDHADALLMQNWDHVDYIFQHLNLQPKQAHG
FT                   CDFGRVRNWYLDNQARHVRQTVVVSSYITPEINALFSSQMQNASGRLKATPTYAGAITE
FT                   LPLAVPVKQTFTRIDSTSPIKDPDARFKHFTTTILSTLVKNITHGRGKGGAGTLIFIPS
FT                   YLDFVRVRNHFATSTQTTNVSFGAISEYTESKEANRARSHFMSGRHSVLLYTERAHHFR
FT                   RYQVRGVKRVVMYGLPDNAMFYGEIVGFLGLDPAALIEAAEGGVRALFSKWDALKLERV
FT                   VGTSRTGNMLREKGGDTFTFV"
FT   exon            complement(562201..563694)
FT                   /gene="Pc16g02470"
FT                   /locus_tag="PCH_Pc16g02470"
FT                   /number=1
FT   intron          complement(563695..563752)
FT                   /gene="Pc16g02470"
FT                   /locus_tag="PCH_Pc16g02470"
FT                   /number=1
FT   exon            complement(563753..564275)
FT                   /gene="Pc16g02470"
FT                   /locus_tag="PCH_Pc16g02470"
FT                   /number=2
FT   intron          complement(564276..564321)
FT                   /gene="Pc16g02470"
FT                   /locus_tag="PCH_Pc16g02470"
FT                   /number=2
FT   exon            complement(564322..564452)
FT                   /gene="Pc16g02470"
FT                   /locus_tag="PCH_Pc16g02470"
FT                   /number=3
FT   mRNA            join(<564676..564777,564828..565540,565596..>565800)
FT                   /gene="Pc16g02480"
FT                   /locus_tag="PCH_Pc16g02480"
FT   CDS_pept        join(564676..564777,564828..565540,565596..565800)
FT                   /gene="Pc16g02480"
FT                   /locus_tag="PCH_Pc16g02480"
FT                   /note="Title: strong similarity to hypothetical
FT                   branched-chain alpha-ketoacid dehydrogenase E1 beta subunit
FT                   - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92918"
FT                   /db_xref="GOA:B6H769"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR024969"
FT                   /db_xref="InterPro:IPR027531"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:B6H769"
FT                   /inference="similar to AA sequence:TREMBLNEW:AK095574.1"
FT                   /inference="protein motif:PFAM:PF01398"
FT                   /inference="protein motif:COGS:COG1310"
FT                   /protein_id="CAP92918.1"
FT                   /translation="MAEDSFLHLARPLGPVSVGTAPTTAPLNVVIQPQAIFSVLDHSLR
FT                   RNADQERVIGTLLGTRSEDGSEVEVRSAFAVGHSEAEDQVEVDMEYHKQMLALHLKANP
FT                   REVLVGWYATASELNTFSALIQNFYSGQGDGTWPHPAVHLTVSTEAGKDLETRAYISAP
FT                   VGVTAERAADSAAFIPVPYELRYGEADKSGLESIANAKDAEDRSTSVTSDIESLERAIE
FT                   EVLSMVDRVSRYVESVIDEETPASTAMGQFLLNALALAPKVEPADIERDFNNHIQDVLV
FT                   VSYLANTVRTQMELSTRLATAQLTLGGGGEGPATEGQRNQRGKGQGRPRQDRAEEARA"
FT   exon            564676..564777
FT                   /gene="Pc16g02480"
FT                   /locus_tag="PCH_Pc16g02480"
FT                   /number=1
FT   intron          564778..564827
FT                   /gene="Pc16g02480"
FT                   /locus_tag="PCH_Pc16g02480"
FT                   /number=1
FT   exon            564828..565540
FT                   /gene="Pc16g02480"
FT                   /locus_tag="PCH_Pc16g02480"
FT                   /number=2
FT   intron          565541..565595
FT                   /gene="Pc16g02480"
FT                   /locus_tag="PCH_Pc16g02480"
FT                   /number=2
FT   exon            565596..565800
FT                   /gene="Pc16g02480"
FT                   /locus_tag="PCH_Pc16g02480"
FT                   /number=3
FT   mRNA            complement(join(<566955..567817,568120..>568144))
FT                   /gene="Pc16g02490"
FT                   /locus_tag="PCH_Pc16g02490"
FT   CDS_pept        complement(join(566955..567817,568120..568144))
FT                   /gene="Pc16g02490"
FT                   /locus_tag="PCH_Pc16g02490"
FT                   /note="Title: strong similarity to Lux/npt-II fusion
FT                   protein like protein An15g05580 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92919"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H770"
FT                   /protein_id="CAP92919.1"
FT                   /translation="MVDLLGDKACSWSPARQHACRYQSHVNLFYGVSNRGVWSLGSNLI
FT                   LKERSTEPPNFEVPNIRFLASKTSIPIPRIVEEWQEDDGACFLLTRRIRGQPLSELWPT
FT                   MTSADKERVAKQTAEYLMIQLHELRSNRMESIGGQPIYSAFLFPHTYGIGHGPFSSDDE
FT                   LWAEMSLTLNDQVPEQVRSKLRQRMPTAAPYTFTHGDLTNVNIMVENGNLAGILDWESS
FT                   AFFPVWWEFTCAGIGLGQDDKEWKDLLRSHLPDHTEARNFWLDFFAIHNYPNLNERGLA
FT                   LLKECDLDLPEKET"
FT   exon            complement(566955..567817)
FT                   /gene="Pc16g02490"
FT                   /locus_tag="PCH_Pc16g02490"
FT                   /number=1
FT   intron          complement(567818..568119)
FT                   /gene="Pc16g02490"
FT                   /locus_tag="PCH_Pc16g02490"
FT                   /number=1
FT   exon            complement(568120..568144)
FT                   /gene="Pc16g02490"
FT                   /locus_tag="PCH_Pc16g02490"
FT                   /number=2
FT   mRNA            join(<568592..568672,568821..569007,569100..>569218)
FT                   /gene="Pc16g02500"
FT                   /locus_tag="PCH_Pc16g02500"
FT   CDS_pept        join(568592..568672,568821..569007,569100..569218)
FT                   /gene="Pc16g02500"
FT                   /locus_tag="PCH_Pc16g02500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92920"
FT                   /db_xref="UniProtKB/TrEMBL:B6H771"
FT                   /protein_id="CAP92920.1"
FT                   /translation="MPRLWLLYATHDLLRDRALRYVDYLVSVVPTNSGTTSCDVLLPVV
FT                   DHGTIFVEIRDETTSGYTRQLAVQHRTSGTASNLQVVVLLLVFKDYVNQKKPLKRHKKI
FT                   IREDYLRPPDYDRISGRLFLSIVK"
FT   exon            568592..568672
FT                   /gene="Pc16g02500"
FT                   /locus_tag="PCH_Pc16g02500"
FT                   /number=1
FT   intron          568673..568820
FT                   /gene="Pc16g02500"
FT                   /locus_tag="PCH_Pc16g02500"
FT                   /number=1
FT   exon            568821..569007
FT                   /gene="Pc16g02500"
FT                   /locus_tag="PCH_Pc16g02500"
FT                   /number=2
FT   intron          569008..569099
FT                   /gene="Pc16g02500"
FT                   /locus_tag="PCH_Pc16g02500"
FT                   /number=2
FT   exon            569100..569218
FT                   /gene="Pc16g02500"
FT                   /locus_tag="PCH_Pc16g02500"
FT                   /number=3
FT   mRNA            complement(join(<569394..569890,569965..>570025))
FT                   /gene="Pc16g02510"
FT                   /locus_tag="PCH_Pc16g02510"
FT   CDS_pept        complement(join(569394..569890,569965..570025))
FT                   /gene="Pc16g02510"
FT                   /locus_tag="PCH_Pc16g02510"
FT                   /note="Title: similarity to subunit of transcription
FT                   initation factor TFIID Taf19 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92921"
FT                   /db_xref="GOA:B6H772"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:B6H772"
FT                   /inference="similar to AA sequence:PIR:S49628"
FT                   /inference="protein motif:PFAM:PF02269"
FT                   /inference="protein motif:COGS:COG5248"
FT                   /protein_id="CAP92921.1"
FT                   /translation="MAEPRARMARHKGQMNFQNELRLLLLAYGDPSPHPSFPNEPLPET
FT                   VRVLDEIVTDFVLELSHGAAQVAHHARRQKIKVEDFRFALRRDPNKLGRVQELLRMERE
FT                   LKEARKAFDQNDDQVAKEAGKKGAAAAAAAAAAGEDPVAAEAAATATVTKKSKGKGKRG
FT                   AAIRRGSDATEESVSKKRKTIG"
FT   exon            complement(569394..569890)
FT                   /gene="Pc16g02510"
FT                   /locus_tag="PCH_Pc16g02510"
FT                   /number=1
FT   intron          complement(569891..569964)
FT                   /gene="Pc16g02510"
FT                   /locus_tag="PCH_Pc16g02510"
FT                   /number=1
FT   exon            complement(569965..570025)
FT                   /gene="Pc16g02510"
FT                   /locus_tag="PCH_Pc16g02510"
FT                   /number=2
FT   mRNA            join(<570692..570733,570822..570931,571004..>571178)
FT                   /gene="Pc16g02520"
FT                   /locus_tag="PCH_Pc16g02520"
FT   CDS_pept        join(570692..570733,570822..570931,571004..571178)
FT                   /gene="Pc16g02520"
FT                   /locus_tag="PCH_Pc16g02520"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g00900 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92922"
FT                   /db_xref="GOA:B6H773"
FT                   /db_xref="InterPro:IPR009653"
FT                   /db_xref="UniProtKB/TrEMBL:B6H773"
FT                   /protein_id="CAP92922.1"
FT                   /translation="MVSSCTCQDLWHCCSALFNFQSLLLVILLIICTSSYAHSIMPGIM
FT                   DRNQNGIFGIFWKCARVGERLSPYVSICCVVMAVSSLFHKPRYMKKDTDIACRSQSSSV
FT                   VNLA"
FT   sig_peptide     join(570692..570733,570822..570890)
FT                   /gene="Pc16g02520"
FT                   /locus_tag="PCH_Pc16g02520"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            570692..570733
FT                   /gene="Pc16g02520"
FT                   /locus_tag="PCH_Pc16g02520"
FT                   /number=1
FT   intron          570734..570821
FT                   /gene="Pc16g02520"
FT                   /locus_tag="PCH_Pc16g02520"
FT                   /number=1
FT   exon            570822..570931
FT                   /gene="Pc16g02520"
FT                   /locus_tag="PCH_Pc16g02520"
FT                   /number=2
FT   mat_peptide     join(570891..570931,571004..571175)
FT                   /gene="Pc16g02520"
FT                   /locus_tag="PCH_Pc16g02520"
FT   intron          570932..571003
FT                   /gene="Pc16g02520"
FT                   /locus_tag="PCH_Pc16g02520"
FT                   /number=2
FT   exon            571004..571178
FT                   /gene="Pc16g02520"
FT                   /locus_tag="PCH_Pc16g02520"
FT                   /number=3
FT   mRNA            complement(<571478..>573880)
FT                   /gene="Pc16g02530"
FT                   /locus_tag="PCH_Pc16g02530"
FT   CDS_pept        complement(571478..573880)
FT                   /gene="Pc16g02530"
FT                   /locus_tag="PCH_Pc16g02530"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g00910 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92923"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B6H739"
FT                   /inference="protein motif:PFAM:PF01535"
FT                   /protein_id="CAP92923.1"
FT                   /translation="MSSCPHQLVRSRLNGLLSPQCRSAGRWYRESGTANVGHRVRLSTY
FT                   NAPAILEPGVTHDTPDPVSYQHNRGSTSSSHPPTSEQSDQVANDRYGMGHGQTKPPTQS
FT                   RKSSQTPIITNDKMKKVAYVRQADPKLVAMAAERVNREILNKGRHLTDRGLYLSLAMRM
FT                   NSLYTRDLGLRQWKEAYGAIHKAKTYGREVLHKAALPKLREDGEQLLALLLNDCQGKFR
FT                   EAWLAMNRATRAWAWQRLAGWLLQNNPAMALEFLLVTTEPRDKPDFTMVVDCLAYLEKF
FT                   HYEELRDWTKGVHTFESVVATCLDPKDWPIISPPQKGIRFYIRRAGFLGVYESFRLMNE
FT                   RGITMEAQTALCYMYRFTQLNDVEYALRALEFIPKINDPGFSMDSEGVLRHCCKLLTLD
FT                   TVEDKAGGRNFRILPRLLKMGVQPDRDMMNIVLANAYKTGDPQLGADMLQFMKNHHHDF
FT                   DSYTYLTLLTDAVSRGDRGRVDELVREVEMQEDIRNNPYIFSKIFHAHFTFTAKHIDPE
FT                   SDPAGVFYSMLDMYNKIHDITPLKELLLLPPHYTAPPTQGLEVKTPPSPVSLFLMIATF
FT                   FRCRNRISQVHHMYDRFRELVQQGHPSIAPLVETDHVYNEFLIAFRKSSRGLRSSIRLV
FT                   EDMLDASALPKETTAGKPLKHVSPTPRTWTILLSAFNYSRQPDAAEKVKEMMAKHDVEY
FT                   NQVTWNTIINGYANAQDIPETANAIKKMEKDGFAIDHYTMKSLRYLRDPERLWVAIEEM
FT                   DEGLDLDGTHKLLTLEPASDVHTDQKEQDELIDNGLEKLESKLKPKM"
FT   exon            complement(571478..573880)
FT                   /gene="Pc16g02530"
FT                   /locus_tag="PCH_Pc16g02530"
FT                   /number=1
FT   mRNA            <574183..>574785
FT                   /gene="Pc16g02540"
FT                   /locus_tag="PCH_Pc16g02540"
FT   CDS_pept        574183..574785
FT                   /gene="Pc16g02540"
FT                   /locus_tag="PCH_Pc16g02540"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1A9.290 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92924"
FT                   /db_xref="InterPro:IPR013169"
FT                   /db_xref="UniProtKB/TrEMBL:B6H740"
FT                   /inference="similar to AA sequence:PIR:T48725"
FT                   /protein_id="CAP92924.1"
FT                   /translation="MSSSHANLDAASTDRKARLAKLAALKRKQPEQDTNEAGAVDRELP
FT                   DADTTPDVTAKYLSGRNYDPETRGPKLGFEQGPQEGQVTLEAQAAEIARATAEQSKEDT
FT                   GADEPLDLFKLQPKKPNWDLKRDLDEKLKILNVRTENAIARIVRQRVEDAKRAAKARGP
FT                   KSNGDEEGEEVGMEGETLVEGIHMREREEEKSDEETI"
FT   exon            574183..574785
FT                   /gene="Pc16g02540"
FT                   /locus_tag="PCH_Pc16g02540"
FT                   /number=1
FT   mRNA            complement(join(<575191..575839,575911..576069,
FT                   576095..>576189))
FT                   /gene="Pc16g02550"
FT                   /locus_tag="PCH_Pc16g02550"
FT   CDS_pept        complement(join(575191..575839,575911..576069,
FT                   576095..576189))
FT                   /gene="Pc16g02550"
FT                   /locus_tag="PCH_Pc16g02550"
FT                   /note="Title: similarity to hypothetical protein CAB88521.3
FT                   - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02550"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92925"
FT                   /db_xref="InterPro:IPR039715"
FT                   /db_xref="UniProtKB/TrEMBL:B6H741"
FT                   /inference="similar to AA sequence:TREMBL:NC1A9.16"
FT                   /protein_id="CAP92925.1"
FT                   /translation="MNRYRNAPRLGGSNSNKATATTLCQKCLGRDILLTNSDPRHYSFD
FT                   CKASAQERPYIPRPSRTQQLLNPELMPKLSSENPNELLRKEGVADELLATREEERGRKR
FT                   DLDDMTDRNAQSPGRARSLSVETISTNRSYSSSPRRNKRGAADRGRRDDSSAPPAKSRK
FT                   RRYSDSTEGSSGSVHSGPKDRSPSRERTRTDDRNTRRRRRESSPEERGRHRRAGRHSER
FT                   RDRRSKSLDKDRVEESRATAQDVPKDRSYRDRASPPRQSQHERSRPDPIMQKNQPPRER
FT                   SLSPFSKRLALTQAMNNGR"
FT   exon            complement(575191..575839)
FT                   /gene="Pc16g02550"
FT                   /locus_tag="PCH_Pc16g02550"
FT                   /number=1
FT   intron          complement(575840..575910)
FT                   /gene="Pc16g02550"
FT                   /locus_tag="PCH_Pc16g02550"
FT                   /number=1
FT   exon            complement(575911..576069)
FT                   /gene="Pc16g02550"
FT                   /locus_tag="PCH_Pc16g02550"
FT                   /number=2
FT   intron          complement(576070..576094)
FT                   /gene="Pc16g02550"
FT                   /locus_tag="PCH_Pc16g02550"
FT                   /number=2
FT   exon            complement(576095..576189)
FT                   /gene="Pc16g02550"
FT                   /locus_tag="PCH_Pc16g02550"
FT                   /number=3
FT   mRNA            join(<576968..577018,577074..>579485)
FT                   /gene="Pc16g02560"
FT                   /locus_tag="PCH_Pc16g02560"
FT   CDS_pept        join(576968..577018,577074..579485)
FT                   /gene="Pc16g02560"
FT                   /locus_tag="PCH_Pc16g02560"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1A9.260 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02560"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92926"
FT                   /db_xref="GOA:B6H742"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR024771"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/TrEMBL:B6H742"
FT                   /inference="similar to AA sequence:TREMBL:NC1A9.15"
FT                   /protein_id="CAP92926.1"
FT                   /translation="MASKSPPGGDSPLSFAKIAAMPAPLKPHSSSVSDENEICQPTEQP
FT                   PFSEANGSGAALPSQHNLDKTPEASSVDLAVDDLGRGVQDIGLTLKKHSDDPSSLAGGQ
FT                   DNGLLKRENSFEDDRTHLSTSSTKMTNFDSKSLASVTTFAMDEKDSVRPDDSASVQAID
FT                   EEESLSGLASGAPNSVAGSEAGSRAFRDHYRDGIPTRPRGILPVPRLFDGTQPANGTIP
FT                   PDSVANNFVIPANPNGIEDGQILHGFPLEPDEKLLEAMKSPKDRLLILQLEEKIRYFIK
FT                   DCNEQSLELPPSNAFGRLLAHKLGDYYHLTHFVDNNVTSVRLHRTPFCRLPTPLSDVHA
FT                   ACNSTPPPVVPAMKIMRRNDGGQFEGSIGGSSNPSKANSEDGDSGPDGERHGSSSGATP
FT                   AKDRMALTREEREAKYHEVRERIFRDFPDSAKSDPASGDSNPNMSRSSSASGRKKNPRQ
FT                   RTPHDDSFEVRSQFNAYYPGMQYGNGTAQYNAPVNDGSYPNQVPYLVGPGVPPPSGGYM
FT                   PSGQNGAIYPGQLNMNMNGVSQYPTMSPQVASNGSWQGGNMPQQSPYSGYASMSQQGMM
FT                   NQPSSNASSPAMNNYAVPNVAPYQQTPNWSSPPFPTNFQQSPHQRNGPVHWPNYPQQPM
FT                   TSSMPPNMGPNMPSNMGAYPYAQYPGQHMNPGLQHSAGSHAAMQAGYARSHFNPQTRSF
FT                   IPGGAPLGRHPNKSQHTMQPYGNMQSGAQPQWNGYPEPIPNRTMDSTPAMNSNRVPTGP
FT                   RDSIAKWGTPAHLPPKPPPSEVPSDFDLKNRPVPASVPAPTYSSNGIPAVSNGPLVVSG
FT                   GTTVSKPN"
FT   exon            576968..577018
FT                   /gene="Pc16g02560"
FT                   /locus_tag="PCH_Pc16g02560"
FT                   /number=1
FT   intron          577019..577073
FT                   /gene="Pc16g02560"
FT                   /locus_tag="PCH_Pc16g02560"
FT                   /number=1
FT   exon            577074..579485
FT                   /gene="Pc16g02560"
FT                   /locus_tag="PCH_Pc16g02560"
FT                   /number=2
FT   mRNA            complement(join(<581045..581105,581210..581338,
FT                   581412..581482,581572..581756,581956..581969,
FT                   582063..582148,582242..>582310))
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT   CDS_pept        complement(join(581045..581105,581210..581338,
FT                   581412..581482,581572..581756,581956..581969,
FT                   582063..582148,582242..582310))
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02570"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92927"
FT                   /db_xref="UniProtKB/TrEMBL:B6H743"
FT                   /protein_id="CAP92927.1"
FT                   /translation="METFMSMVCHVIVNLVDTHRLMRGVQQYDRENETYKVHAKDAGRR
FT                   TECAWHWALFQGAGSQTRSTMVYWAMNDGNCDLSEDRRVDGYDTDPETTPFAIEDENLL
FT                   PMLSIHSQPTFQLSNMFEHAAFDLARTFAGETPLGRGREQVSNSPGELRVDETIRPGRD
FT                   DTKREPCAAYTMGRNRLSQTSRCNVGGHDLNICGRKLVAKP"
FT   exon            complement(581045..581105)
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /number=1
FT   intron          complement(581106..581209)
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /number=1
FT   exon            complement(581210..581338)
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /number=2
FT   intron          complement(581339..581411)
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /number=2
FT   exon            complement(581412..581482)
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /number=3
FT   intron          complement(581483..581571)
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /number=3
FT   exon            complement(581572..581756)
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /number=4
FT   intron          complement(581757..581955)
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /number=4
FT   exon            complement(581956..581969)
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /number=5
FT   intron          complement(581970..582062)
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /number=5
FT   exon            complement(582063..582148)
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /number=6
FT   intron          complement(582149..582241)
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /number=6
FT   exon            complement(582242..582310)
FT                   /gene="Pc16g02570"
FT                   /locus_tag="PCH_Pc16g02570"
FT                   /number=7
FT   mRNA            complement(<583235..>583750)
FT                   /gene="Pc16g02580"
FT                   /locus_tag="PCH_Pc16g02580"
FT   CDS_pept        complement(583235..583750)
FT                   /gene="Pc16g02580"
FT                   /locus_tag="PCH_Pc16g02580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02580"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92928"
FT                   /db_xref="GOA:B6H744"
FT                   /db_xref="UniProtKB/TrEMBL:B6H744"
FT                   /protein_id="CAP92928.1"
FT                   /translation="MSLETHNPLRQNAPSPPYPDTYKEVAASYPPRQTIEHSVSGESTL
FT                   QVSDRDCTLEFSDRDCNMEVNQYPDHKYTDKQAEAGAGLGAGAADRNQADASGPQSAAA
FT                   TEGKQDLESQSVTGTVMRHKSRRREWIIFGSAMVAVVLLVVIIVPSVIFGIRQSRPQYS
FT                   PPKNPYIS"
FT   exon            complement(583235..583750)
FT                   /gene="Pc16g02580"
FT                   /locus_tag="PCH_Pc16g02580"
FT                   /number=1
FT   mRNA            complement(join(<584998..585423,585602..>585817))
FT                   /gene="Pc16g02590"
FT                   /locus_tag="PCH_Pc16g02590"
FT   CDS_pept        complement(join(584998..585423,585602..585817))
FT                   /gene="Pc16g02590"
FT                   /locus_tag="PCH_Pc16g02590"
FT                   /note="Title: similarity to mitochondrial ribosomal protein
FT                   of the large subunit Yml8 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02590"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92929"
FT                   /db_xref="GOA:B6H745"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:B6H745"
FT                   /inference="similar to AA sequence:TREMBL:SCMRPL8.1"
FT                   /inference="protein motif:PFAM:PF01196"
FT                   /inference="protein motif:COGS:COG0203"
FT                   /protein_id="CAP92929.1"
FT                   /translation="MAGGGSRYRHLSRDSAHRQAMLRNLVTSLFKHETITTTWPKAKEA
FT                   QRLAEKLITLGKKNTEASRRRALEIFYTPHEMLPKLFGPLRERYADRPGGYTRVLRVEP
FT                   REKNEYFSAKKGDKNAIREPKPQVKAPTAILELVDGPKDMRFAMTARTVAREREQGRDL
FT                   VHSLTRLNVKKVTQFRKDGVEVLERAISKLSLAKKQNDKLAKEGEVESKE"
FT   exon            complement(584998..585423)
FT                   /gene="Pc16g02590"
FT                   /locus_tag="PCH_Pc16g02590"
FT                   /number=1
FT   intron          complement(585424..585601)
FT                   /gene="Pc16g02590"
FT                   /locus_tag="PCH_Pc16g02590"
FT                   /number=1
FT   exon            complement(585602..585817)
FT                   /gene="Pc16g02590"
FT                   /locus_tag="PCH_Pc16g02590"
FT                   /number=2
FT   mRNA            complement(<586960..>587748)
FT                   /gene="Pc16g02600"
FT                   /locus_tag="PCH_Pc16g02600"
FT   CDS_pept        complement(586960..587748)
FT                   /gene="Pc16g02600"
FT                   /locus_tag="PCH_Pc16g02600"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g00960 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02600"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92930"
FT                   /db_xref="UniProtKB/TrEMBL:B6H746"
FT                   /protein_id="CAP92930.1"
FT                   /translation="MDLSRKPTNPQRLPPPALFQGPPSHNASNISLPVPPAASTLATAS
FT                   GSQPPPLHRNRSPRGAEGETPEKSSLLSPFVSRRPSKNDVDGADAIWQEMQSALSEVEL
FT                   SAVTSENVFGAKHSEALEDLRMKQLKLAQAWARSEADDEVVDPGHSGADEASGKPSSAR
FT                   RGTEESKAQYDTATEISAGRGSVSHRTLDGETENDIHLARKRREANDRYFDRVNQGVLD
FT                   VVAKLEEVAQAMRAVERESKDIWSDSESVTTTAPSSTQTS"
FT   exon            complement(586960..587748)
FT                   /gene="Pc16g02600"
FT                   /locus_tag="PCH_Pc16g02600"
FT                   /number=1
FT   mRNA            join(<588253..588511,588642..>588820)
FT                   /gene="Pc16g02610"
FT                   /locus_tag="PCH_Pc16g02610"
FT   CDS_pept        join(588253..588511,588642..588820)
FT                   /gene="Pc16g02610"
FT                   /locus_tag="PCH_Pc16g02610"
FT                   /note="Title: strong similarity to ribosomal protein of the
FT                   small subunit rps28 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02610"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92931"
FT                   /db_xref="GOA:B6H747"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B6H747"
FT                   /inference="similar to AA sequence:TREMBL:ANI249691.1"
FT                   /inference="protein motif:PFAM:PF00164"
FT                   /inference="protein motif:COGS:COG0048"
FT                   /protein_id="CAP92931.1"
FT                   /translation="MGKGQPRGLNAARKLQSHRKDQRWADDHFKKRLLGTAYKSSPFGG
FT                   ASHAKGIVLEKVGVEAKQPNSAIRKCVKVQLIKNGKKVAAFVPNDGCLNFIDENDEVLL
FT                   AGFGRKGKAKGDIPGVRFKVVKVSGVGLAALWKEKKEKPRS"
FT   exon            588253..588511
FT                   /gene="Pc16g02610"
FT                   /locus_tag="PCH_Pc16g02610"
FT                   /number=1
FT   intron          588512..588641
FT                   /gene="Pc16g02610"
FT                   /locus_tag="PCH_Pc16g02610"
FT                   /number=1
FT   exon            588642..588820
FT                   /gene="Pc16g02610"
FT                   /locus_tag="PCH_Pc16g02610"
FT                   /number=2
FT   mRNA            complement(join(<589966..590038,590108..590945,
FT                   590999..591294,591374..>591471))
FT                   /gene="Pc16g02620"
FT                   /locus_tag="PCH_Pc16g02620"
FT   CDS_pept        complement(join(589966..590038,590108..590945,
FT                   590999..591294,591374..591471))
FT                   /gene="Pc16g02620"
FT                   /locus_tag="PCH_Pc16g02620"
FT                   /note="Title: strong similarity to translation initiation
FT                   factor eIF2B guanine nucleotide exchange factor 43 kDa
FT                   subunit Gcd7 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92932"
FT                   /db_xref="GOA:B6H748"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:B6H748"
FT                   /inference="similar to AA sequence:PIR:B48156"
FT                   /inference="protein motif:PFAM:PF01008"
FT                   /inference="protein motif:COGS:COG1184"
FT                   /inference="protein motif:COGS:COG0182"
FT                   /protein_id="CAP92932.1"
FT                   /translation="MPSSSLALTPGLGSFLKCLKTNPIDTSIETLISLLKRRQIRHSRS
FT                   CATATAYLLRSVISACRTTDSAKLIERVQSVGRRLMAAQPREMVVGNIVRRVLGLIRDE
FT                   AEDDRDAEFALSDIGSESQPQTPRAYDDASLPLDRDSPSFRAEDRSSRPPLTSMFSLLS
FT                   HPEPEISLPSTPGSSSPSGRFTGHGPSKDVRAEVLEGIGEIIDELGQVDDQIAAYALDH
FT                   IHSNEIILTHTSSTTVQKFLLKAAAKRKFTVIHAESYPNNHEATHATVSGSAVSDDDNL
FT                   GLEAFQKPLIEHGITVILIPDSAVFALMSRVNKVILGTHSVLANGGLVAAAGTRVIARA
FT                   AKVHQTPVVVVSGVYKLSPVYPFDFDSLIEYGDPSKVLPYEEGDLVDLVDVQNPIYDYV
FT                   PAELVDLYITNLGGHAPSYLYRIVSDHYRKEDISF"
FT   exon            complement(589966..590038)
FT                   /gene="Pc16g02620"
FT                   /locus_tag="PCH_Pc16g02620"
FT                   /number=1
FT   mat_peptide     complement(join(589969..590038,590108..590945,
FT                   590999..591294,591374..591408))
FT                   /gene="Pc16g02620"
FT                   /locus_tag="PCH_Pc16g02620"
FT   intron          complement(590039..590107)
FT                   /gene="Pc16g02620"
FT                   /locus_tag="PCH_Pc16g02620"
FT                   /number=1
FT   exon            complement(590108..590945)
FT                   /gene="Pc16g02620"
FT                   /locus_tag="PCH_Pc16g02620"
FT                   /number=2
FT   intron          complement(590946..590998)
FT                   /gene="Pc16g02620"
FT                   /locus_tag="PCH_Pc16g02620"
FT                   /number=2
FT   exon            complement(590999..591294)
FT                   /gene="Pc16g02620"
FT                   /locus_tag="PCH_Pc16g02620"
FT                   /number=3
FT   intron          complement(591295..591373)
FT                   /gene="Pc16g02620"
FT                   /locus_tag="PCH_Pc16g02620"
FT                   /number=3
FT   exon            complement(591374..591471)
FT                   /gene="Pc16g02620"
FT                   /locus_tag="PCH_Pc16g02620"
FT                   /number=4
FT   sig_peptide     complement(591409..591471)
FT                   /gene="Pc16g02620"
FT                   /locus_tag="PCH_Pc16g02620"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<592049..593453,593506..>593648)
FT                   /gene="Pc16g02630"
FT                   /locus_tag="PCH_Pc16g02630"
FT   CDS_pept        join(592049..593453,593506..593648)
FT                   /gene="Pc16g02630"
FT                   /locus_tag="PCH_Pc16g02630"
FT                   /note="Title: strong similarity to Nem1 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02630"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92933"
FT                   /db_xref="GOA:B6H749"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B6H749"
FT                   /inference="similar to AA sequence:PIR:S46802"
FT                   /inference="protein motif:PFAM:PF03031"
FT                   /inference="protein motif:COGS:COG5190"
FT                   /protein_id="CAP92933.1"
FT                   /translation="MNSLNILSSRVIGQSSSSSRHRSQSQGDGKRAPLPSDFSKLRSYS
FT                   EDNFRSLDPTEKSYNDGLPVGEDREEDAPYDLDEKTPLLHEAHKNGTLTARSTWRLITQ
FT                   RFFDAITETIKFILSTIAAPGVYLAQCFQADDGHYSLLAPVRKLRRSSADPTIRSAKGA
FT                   TRVEGRRRSGSTRKLRPQGSHESIVSTTSESDTDRRHVKNLSSGRNRPIKTKGHDPDPI
FT                   PEGEEHEHTPRRSIRIKLHNEESLKRQRQRRSQSADLGHPMPEGVSRVQGAVHLDSLKS
FT                   PTSPNIHRITKYPHSPTPPRPLLPPRVPSYTAPPRNARAPQKTLVLDLDETLIHSLAKG
FT                   GRMSSGHMVEVKLSIPTTTSLSPGGPQTTLGPQHPILYYVHKRPHCDEFLRKVSKWYKL
FT                   VIFTASVQEYADPVIDWLEQERKYFQGRLYRQHCTFRNGAYIKDLSSVEPDLSKVMILD
FT                   NSPMSYIFHEDNAIPIEGWINDPTDNGLLHLVPMLEALQYVTDVRALLALRRGELES"
FT   exon            592049..593453
FT                   /gene="Pc16g02630"
FT                   /locus_tag="PCH_Pc16g02630"
FT                   /number=1
FT   intron          593454..593505
FT                   /gene="Pc16g02630"
FT                   /locus_tag="PCH_Pc16g02630"
FT                   /number=1
FT   exon            593506..593648
FT                   /gene="Pc16g02630"
FT                   /locus_tag="PCH_Pc16g02630"
FT                   /number=2
FT   mRNA            complement(join(<593945..594013,594106..594334,
FT                   594661..594681,594767..594792,594838..>594873))
FT                   /gene="Pc16g02640"
FT                   /locus_tag="PCH_Pc16g02640"
FT   CDS_pept        complement(join(593945..594013,594106..594334,
FT                   594661..594681,594767..594792,594838..594873))
FT                   /gene="Pc16g02640"
FT                   /locus_tag="PCH_Pc16g02640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02640"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92934"
FT                   /db_xref="UniProtKB/TrEMBL:B6H750"
FT                   /protein_id="CAP92934.1"
FT                   /translation="MAKRLLSPLECQAGSANQITTGGNQQGGVRSAGGKTGLCLASAAV
FT                   PPRQHYEAHCAGMTTSRAGHNAAKIVLPIIHHFLEGWFPRKPLNLLRSAANAAKEKAQR
FT                   LIFSRDNGRKSWHGFVAWDQRG"
FT   exon            complement(593945..594013)
FT                   /gene="Pc16g02640"
FT                   /locus_tag="PCH_Pc16g02640"
FT                   /number=1
FT   intron          complement(594014..594105)
FT                   /gene="Pc16g02640"
FT                   /locus_tag="PCH_Pc16g02640"
FT                   /number=1
FT   exon            complement(594106..594334)
FT                   /gene="Pc16g02640"
FT                   /locus_tag="PCH_Pc16g02640"
FT                   /number=2
FT   intron          complement(594335..594660)
FT                   /gene="Pc16g02640"
FT                   /locus_tag="PCH_Pc16g02640"
FT                   /number=2
FT   exon            complement(594661..594681)
FT                   /gene="Pc16g02640"
FT                   /locus_tag="PCH_Pc16g02640"
FT                   /number=3
FT   intron          complement(594682..594766)
FT                   /gene="Pc16g02640"
FT                   /locus_tag="PCH_Pc16g02640"
FT                   /number=3
FT   exon            complement(594767..594792)
FT                   /gene="Pc16g02640"
FT                   /locus_tag="PCH_Pc16g02640"
FT                   /number=4
FT   intron          complement(594793..594837)
FT                   /gene="Pc16g02640"
FT                   /locus_tag="PCH_Pc16g02640"
FT                   /number=4
FT   exon            complement(594838..594873)
FT                   /gene="Pc16g02640"
FT                   /locus_tag="PCH_Pc16g02640"
FT                   /number=5
FT   mRNA            join(<595358..595978,596057..596340,596431..>596788)
FT                   /gene="Pc16g02650"
FT                   /locus_tag="PCH_Pc16g02650"
FT   CDS_pept        join(595358..595978,596057..596340,596431..596788)
FT                   /gene="Pc16g02650"
FT                   /locus_tag="PCH_Pc16g02650"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   T22K18.2 - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02650"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92935"
FT                   /db_xref="GOA:B6H751"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:B6H751"
FT                   /inference="similar to AA sequence:TREMBL:AC010927.2"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /inference="protein motif:COGS:COG1409"
FT                   /inference="protein motif:COGS:COG0420"
FT                   /inference="protein motif:COGS:COG1408"
FT                   /protein_id="CAP92935.1"
FT                   /translation="MSIRRRTAHRRRAGDQRLRFDENGTFQISVFSDLHFAEGTITDLN
FT                   HCLGILTIFKDDEEDHKTTGVMRSVLSSEEAQLVVLNGDLISGEATQSSNSTLYVDRVV
FT                   APLVDLDLPWASTYGNHDSEINLDPEELFRRETEYRNSLTQRDILDPAAGITNYYLPIF
FT                   PHGASNDSIPVFILWFFDSQGGHYPLTENDDGKATKRQNWVDDTVIEWFVKANANLTST
FT                   YGQTIPSLAFVHIPVYAMRAFQETGVSPTTEPGINGERVQQQGYEPDSGYHYQDFPFIN
FT                   ALLNTTGLAATFSGHDHDNDWCFRWDSKLPNLNVTGNGMSMCYGRHTGYGGYGDRARGG
FT                   RQILLDERLLGDDIRTWIRMEDGSISGDVHLNATYGHDHYGLVERSIVNGQNGGLSPPC
FT                   LGVICLWICVFSGLISGFHLW"
FT   exon            595358..595978
FT                   /gene="Pc16g02650"
FT                   /locus_tag="PCH_Pc16g02650"
FT                   /number=1
FT   intron          595979..596056
FT                   /gene="Pc16g02650"
FT                   /locus_tag="PCH_Pc16g02650"
FT                   /number=1
FT   exon            596057..596340
FT                   /gene="Pc16g02650"
FT                   /locus_tag="PCH_Pc16g02650"
FT                   /number=2
FT   intron          596341..596430
FT                   /gene="Pc16g02650"
FT                   /locus_tag="PCH_Pc16g02650"
FT                   /number=2
FT   exon            596431..596788
FT                   /gene="Pc16g02650"
FT                   /locus_tag="PCH_Pc16g02650"
FT                   /number=3
FT   mRNA            join(<598244..598343,598418..598665,598729..599178,
FT                   599249..>599818)
FT                   /gene="Pc16g02660"
FT                   /locus_tag="PCH_Pc16g02660"
FT   CDS_pept        join(598244..598343,598418..598665,598729..599178,
FT                   599249..599818)
FT                   /gene="Pc16g02660"
FT                   /locus_tag="PCH_Pc16g02660"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   B2J23.120 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92936"
FT                   /db_xref="GOA:B6H7I2"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I2"
FT                   /inference="similar to AA sequence:PIR:T52516"
FT                   /inference="protein motif:PFAM:PF03663"
FT                   /protein_id="CAP92936.1"
FT                   /translation="MRLSGTWSISNGLIATLLFSTLTPAIELDLNDEQSIKDAASTSTY
FT                   SMMGWYYGNETGQIPGSFPEKWWEGSALFLALLQYWHFTGDTTYNSLMSEGMQWQSGEE
FT                   GDYMPSNYSSYLGNDDQMFWGLAAMMAAELKFPDVEDGFSWLSLAQGVFNTQTARWDTT
FT                   TCGGGLRWQLFPYQSGYTMKNSVSNGGLFQLAARLARYTDDDKYSKWAEKIWDWSTSSP
FT                   LVNNKTWNVADSTQMANDCADSGNYQWTYNYGAYLMGAVYMYNYTNGDEKWKKPVDGLL
FT                   GKTLKTFFPNGDVIEDVTCEPIKMCNFNEILFKGLTSSWLAFTTLLAPDTAAQIKPKLA
FT                   SSAEAAAKSCTGNNNNTCGITWYQNKWDGTTGMEQEISATNVFLANLINYNTGSFGPVT
FT                   SKTGGNSASDPNAGSENDDEKKMKPITTGDKAGASILTLIFVFGWAGAVAFMMLGG"
FT   sig_peptide     598244..598318
FT                   /gene="Pc16g02660"
FT                   /locus_tag="PCH_Pc16g02660"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            598244..598343
FT                   /gene="Pc16g02660"
FT                   /locus_tag="PCH_Pc16g02660"
FT                   /number=1
FT   mat_peptide     join(598319..598343,598418..598665,598729..599178,
FT                   599249..599815)
FT                   /gene="Pc16g02660"
FT                   /locus_tag="PCH_Pc16g02660"
FT   intron          598344..598417
FT                   /gene="Pc16g02660"
FT                   /locus_tag="PCH_Pc16g02660"
FT                   /number=1
FT   exon            598418..598665
FT                   /gene="Pc16g02660"
FT                   /locus_tag="PCH_Pc16g02660"
FT                   /number=2
FT   intron          598666..598728
FT                   /gene="Pc16g02660"
FT                   /locus_tag="PCH_Pc16g02660"
FT                   /number=2
FT   exon            598729..599178
FT                   /gene="Pc16g02660"
FT                   /locus_tag="PCH_Pc16g02660"
FT                   /number=3
FT   intron          599179..599248
FT                   /gene="Pc16g02660"
FT                   /locus_tag="PCH_Pc16g02660"
FT                   /number=3
FT   exon            599249..599818
FT                   /gene="Pc16g02660"
FT                   /locus_tag="PCH_Pc16g02660"
FT                   /number=4
FT   mRNA            <600584..>602140
FT                   /gene="Pc16g02670"
FT                   /locus_tag="PCH_Pc16g02670"
FT   CDS_pept        600584..602140
FT                   /gene="Pc16g02670"
FT                   /locus_tag="PCH_Pc16g02670"
FT                   /note="Title: similarity to hypothetical transport protein
FT                   YCR023c - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92937"
FT                   /db_xref="GOA:B6H7I3"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I3"
FT                   /inference="similar to AA sequence:PIR:S19434"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP92937.1"
FT                   /translation="MVAITWTDRQPDAVHEESYHVDETTALLASGKTKHGGAPTSDTLD
FT                   SSSGPDGDNDGNNDNDDEKKPLPIAQILLLCYARAVEPLAFFSIFPYVSQMVQDNGGLA
FT                   DADVGFYSGLIESMFSLTQAIVMIFWGQAADRFGRKPVLVSSLFGVTVATSLFGLAKTI
FT                   PQMIMFRCLAGVFAGTIVTIRTMVAEHSTPNTQARAFSWFAFSGNLGIFLGPLLGGALA
FT                   DPVRQYPGVFGAVHFFEKYPYALSSLVVASVGATAAVSSACFVEETLKKEPVTVGHDGE
FT                   EAASDVPTQSSDLSTWELLKSPGVGMVLYAYGHIMVLAFAFTAIIPVFWFTPVHLGGYG
FT                   FTPLQISLMMGLNGAAQATWLLLVFPPLQKKIGSNGVIRLCATGYPLFFLCCPLGNVLL
FT                   RIGTDGSVKAFWIILPITLAIGCGVSMSFTAIQLALNDVAPSPKVLGTLNALALTGVSA
FT                   LRAFCPALFTTLFALGARTQLAGGYAIWVLMLIIASGLSVTAKYLPEPEAARKRRSSQP
FT                   R"
FT   exon            600584..602140
FT                   /gene="Pc16g02670"
FT                   /locus_tag="PCH_Pc16g02670"
FT                   /number=1
FT   mRNA            join(<603728..603893,603945..604256,604306..604720,
FT                   604792..605259,605316..>605475)
FT                   /gene="Pc16g02680"
FT                   /locus_tag="PCH_Pc16g02680"
FT   CDS_pept        join(603728..603893,603945..604256,604306..604720,
FT                   604792..605259,605316..605475)
FT                   /gene="Pc16g02680"
FT                   /locus_tag="PCH_Pc16g02680"
FT                   /note="Title: strong similarity to allantoate permease Dal5
FT                   - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02680"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92938"
FT                   /db_xref="GOA:B6H7I4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I4"
FT                   /inference="similar to AA sequence:PIR:A28671"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /inference="protein motif:COGS:COG2271"
FT                   /protein_id="CAP92938.1"
FT                   /translation="MIQIHGVTSATETPHVSEKDAALAVVSDVAQEIDPVVEKRVLRKI
FT                   DWYLMPAMLIGYGMVYYDKAILGSAALFGMTTDLELSVKDYSTSPPTVDTSRLGWATSI
FT                   FYFGMLAGLYPMTFILQRFNIRTVLGPVVLVWAVICAATAGVSTWQGLYVQRFFLGFIE
FT                   SVIPTGFMTIVSGYYTQEEQALRQAWWFSGTGWFTIIGSALNYGFGQITSGSLKRWQYI
FT                   YILAGALTFLFGLWCCTMPNSPVSAWFLTPEERMVAVERLRKGQTGVRCQKIKLDQIKE
FT                   CLTDVKIYLVAIMMAAAYTINGAISGFGPLIVSTFGYDTLDSILFQFPVGGVCVIFIPL
FT                   CGYISTIVPNVRIPMLIACCLPVIAGCVMIWKSEWGYRPVTPVVGYALTGFFGPVVSLI
FT                   ITTGACNVAGATKKTVMAATVFVAYTVGNIIGPQLVKSDTKAQHYPELWTGMIICYCIT
FT                   IAAAVVLYLVLRRENRIRGQLDLDEVQRDKIAFDDLTDKQNPFFRYAL"
FT   exon            603728..603893
FT                   /gene="Pc16g02680"
FT                   /locus_tag="PCH_Pc16g02680"
FT                   /number=1
FT   intron          603894..603944
FT                   /gene="Pc16g02680"
FT                   /locus_tag="PCH_Pc16g02680"
FT                   /number=1
FT   exon            603945..604256
FT                   /gene="Pc16g02680"
FT                   /locus_tag="PCH_Pc16g02680"
FT                   /number=2
FT   intron          604257..604305
FT                   /gene="Pc16g02680"
FT                   /locus_tag="PCH_Pc16g02680"
FT                   /number=2
FT   exon            604306..604720
FT                   /gene="Pc16g02680"
FT                   /locus_tag="PCH_Pc16g02680"
FT                   /number=3
FT   intron          604721..604791
FT                   /gene="Pc16g02680"
FT                   /locus_tag="PCH_Pc16g02680"
FT                   /number=3
FT   exon            604792..605259
FT                   /gene="Pc16g02680"
FT                   /locus_tag="PCH_Pc16g02680"
FT                   /number=4
FT   intron          605260..605315
FT                   /gene="Pc16g02680"
FT                   /locus_tag="PCH_Pc16g02680"
FT                   /number=4
FT   exon            605316..605475
FT                   /gene="Pc16g02680"
FT                   /locus_tag="PCH_Pc16g02680"
FT                   /number=5
FT   mRNA            join(<605707..605879,605954..606339,606404..606674,
FT                   606738..>607380)
FT                   /gene="Pc16g02690"
FT                   /locus_tag="PCH_Pc16g02690"
FT   CDS_pept        join(605707..605879,605954..606339,606404..606674,
FT                   606738..607380)
FT                   /gene="Pc16g02690"
FT                   /locus_tag="PCH_Pc16g02690"
FT                   /note="Title: strong similarity to benomyl/methotrexate
FT                   resistance protein MDR1 - Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02690"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92939"
FT                   /db_xref="GOA:B6H7I5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I5"
FT                   /inference="similar to AA sequence:PIR:S16304"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP92939.1"
FT                   /translation="MEDPKQSPAVALCGDDTIFRDPRYEVTWESGDSENPRTWSVWYRG
FT                   FIVASMSFSTTIVVIYTTMYTSGVEGIQKEFNISSKLVVLLGLTTNLFGLALGSVILSS
FT                   LSEIYGRRPVYLVSVLLFGLLTLPVALANNIEAILISRFFGGFFGGTMIASAPGSVTDV
FT                   TDDQYRALALSCWSLGTMNGPVLGPIIGGFVYQYLGWRWLNWLVLICSGISLCLMFLVK
FT                   ETYSPALLRQKTIKRQKMTGDRRWWCRFDHEETGLQVLKTNLIRPLRMAVLEPICIFWN
FT                   LYVGVVYSVLFLCFVAYPIVFEGARGWTPGLAGLSYCGIGTGTAIAVGLEPLIRKIIAL
FT                   HPHDPSTSRPAPEAAVIAVCIGSVLIPIGEFWFSWTAQPSVHWILPILAGIPFGLGNGL
FT                   VFIYATNYMAGSYTVYAASALAGNSIVRYGLAGVLPLAGEKMYSTLGANWAGTMLALIE
FT                   VILIPIPFIFYKYGHHIRLRSPMIVKRDMDSS"
FT   exon            605707..605879
FT                   /gene="Pc16g02690"
FT                   /locus_tag="PCH_Pc16g02690"
FT                   /number=1
FT   intron          605880..605953
FT                   /gene="Pc16g02690"
FT                   /locus_tag="PCH_Pc16g02690"
FT                   /number=1
FT   exon            605954..606339
FT                   /gene="Pc16g02690"
FT                   /locus_tag="PCH_Pc16g02690"
FT                   /number=2
FT   intron          606340..606403
FT                   /gene="Pc16g02690"
FT                   /locus_tag="PCH_Pc16g02690"
FT                   /number=2
FT   exon            606404..606674
FT                   /gene="Pc16g02690"
FT                   /locus_tag="PCH_Pc16g02690"
FT                   /number=3
FT   intron          606675..606737
FT                   /gene="Pc16g02690"
FT                   /locus_tag="PCH_Pc16g02690"
FT                   /number=3
FT   exon            606738..607380
FT                   /gene="Pc16g02690"
FT                   /locus_tag="PCH_Pc16g02690"
FT                   /number=4
FT   mRNA            complement(join(<607565..608527,608593..609171,
FT                   609238..609955,610206..>610312))
FT                   /gene="Pc16g02700"
FT                   /locus_tag="PCH_Pc16g02700"
FT   CDS_pept        complement(join(607565..608527,608593..609171,
FT                   609238..609955,610206..610312))
FT                   /gene="Pc16g02700"
FT                   /locus_tag="PCH_Pc16g02700"
FT                   /note="Title: weak similarity to cutinase transcription
FT                   factor beta CTF1b - Fusarium solani"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02700"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92940"
FT                   /db_xref="GOA:B6H7I6"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I6"
FT                   /inference="similar to AA sequence:SWISSPROT:CT1B_FUSSO"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP92940.1"
FT                   /translation="MRRKHGGHSRIAIETSSNTKEPISNVVVSVSAGKLKQGKSRFIEP
FT                   QDKSDQNTSRSPKLYTRSHQEDVPEDQNGHKGLPDESITPFSGETSLAHNMTVVEDRLE
FT                   QMGVRYARLRSESPNHSFSSQLTPSPQASPKGNRPQQTKSYVYQALDSHKIVPDRVQWD
FT                   RAMKTFCDEVHILVPFLHLPSVWEAYERLWESFLVPSANHYSRGEWRFTFACVLLCLAN
FT                   GTCVESSRVDGQQGQYSAGWSLYRAARDVIGDLLDVFGECTDQILLLQNILLMVIYLFR
FT                   LDSHGPAEKLLALSISHSHHIGLQRRQVVEAMNPFESEMARRLWWCIYLMDRRLAIETG
FT                   RPFLIQDLNVDIGLPRSMSDEWLSKHRGTSHPLQPEDTATGNSPTTVPYLIAMASYSKV
FT                   IGKVWEALYGASTSDSTPSPFLKEYLELLITQSQSDLQPEFSYDPQRPGSYRARGLAWW
FT                   QIKQQLMMRIRWSSLYLLIRKPMLQRKGASSLPVPEAIENEVICMRLAQSIIEDFSNVA
FT                   EDHPKYTFPFLHYLTSATIIALGLIIKQSSFKHTYGELTLEAARSLKKHCRKTWVSGRM
FT                   ARAVWKLNQMAEAIMNPGPRLTENLGSNDQQSSSSRPMSSSNHLSHESPKTCDNALQER
FT                   VQFNLSSSDCLADSTLSASCRRTQIRQAIDRDPPVAGHMDLDESPFMPNDFPFEERHTP
FT                   AHTSGHRPPRHHPHELHSGGVQTAGMEPGLPGDTNDTDPNTGVLSTSLPISGMDMIGSD
FT                   QNAWLPGEMIDGGIEWLQELFVSDLDSHVPSAWNW"
FT   exon            complement(607565..608527)
FT                   /gene="Pc16g02700"
FT                   /locus_tag="PCH_Pc16g02700"
FT                   /number=1
FT   intron          complement(608528..608592)
FT                   /gene="Pc16g02700"
FT                   /locus_tag="PCH_Pc16g02700"
FT                   /number=1
FT   exon            complement(608593..609171)
FT                   /gene="Pc16g02700"
FT                   /locus_tag="PCH_Pc16g02700"
FT                   /number=2
FT   intron          complement(609172..609237)
FT                   /gene="Pc16g02700"
FT                   /locus_tag="PCH_Pc16g02700"
FT                   /number=2
FT   exon            complement(609238..609955)
FT                   /gene="Pc16g02700"
FT                   /locus_tag="PCH_Pc16g02700"
FT                   /number=3
FT   intron          complement(609956..610205)
FT                   /gene="Pc16g02700"
FT                   /locus_tag="PCH_Pc16g02700"
FT                   /number=3
FT   exon            complement(610206..610312)
FT                   /gene="Pc16g02700"
FT                   /locus_tag="PCH_Pc16g02700"
FT                   /number=4
FT   mRNA            complement(<610770..>611799)
FT                   /gene="Pc16g02710"
FT                   /locus_tag="PCH_Pc16g02710"
FT   CDS_pept        complement(610770..611799)
FT                   /pseudo
FT                   /gene="Pc16g02710"
FT                   /locus_tag="PCH_Pc16g02710"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to high affinity glucose
FT                   transporter HGT1 - Kluyveromyces lactis [putative
FT                   pseudogene]"
FT                   /inference="similar to AA sequence:SWISSPROT:HGT1_KLULA"
FT                   /inference="protein motif:COGS:COG0477"
FT   exon            complement(610770..611799)
FT                   /gene="Pc16g02710"
FT                   /locus_tag="PCH_Pc16g02710"
FT                   /number=1
FT   mRNA            join(<612455..612572,612637..>613116)
FT                   /gene="Pc16g02720"
FT                   /locus_tag="PCH_Pc16g02720"
FT   CDS_pept        join(612455..612572,612637..613116)
FT                   /pseudo
FT                   /gene="Pc16g02720"
FT                   /locus_tag="PCH_Pc16g02720"
FT                   /note="putative pseudogene"
FT                   /note="unknown EC_number=3.2.1.21"
FT                   /note="Title: strong similarity to beta-glucosidase
FT                   precursor BGLUC - Kluyveromyces marxianus [putative
FT                   pseudogene]"
FT                   /inference="similar to AA sequence:PIR:GLVK"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /inference="protein motif:COGS:COG1472"
FT   exon            612455..612572
FT                   /gene="Pc16g02720"
FT                   /locus_tag="PCH_Pc16g02720"
FT                   /number=1
FT   intron          612573..612636
FT                   /gene="Pc16g02720"
FT                   /locus_tag="PCH_Pc16g02720"
FT                   /number=1
FT   exon            612637..613116
FT                   /gene="Pc16g02720"
FT                   /locus_tag="PCH_Pc16g02720"
FT                   /number=2
FT   mRNA            join(<613927..614004,614056..614307,614380..614752,
FT                   614802..>615376)
FT                   /gene="Pc16g02730"
FT                   /locus_tag="PCH_Pc16g02730"
FT   CDS_pept        join(613927..614004,614056..614307,614380..614752,
FT                   614802..615376)
FT                   /gene="Pc16g02730"
FT                   /locus_tag="PCH_Pc16g02730"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   B9B15.50 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02730"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92943"
FT                   /db_xref="InterPro:IPR012901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I7"
FT                   /inference="similar to AA sequence:TREMBL:NCB9B15.5"
FT                   /protein_id="CAP92943.1"
FT                   /translation="MLREVFSIFTCVAWVGFAIYLSPWMKDISNEVEAYNATTFQYPVP
FT                   LSTHNEEHTRLMQNLQRSNGKWDSNHPRHRLLTALYGYTSYKDKNLAEVNRWRNLYKNV
FT                   SKQQRTLLESTVHYTRKLNTIEHLLDTNNELAKSIVDHGLWFYNISQSELDEFIKESES
FT                   QKRSADKTSVSQGMKHFVRDWADEGHEEREQSFGCILKSLAQTPRTTDRPLRVLLPGAG
FT                   LGRLAHEVDNLGGFDVTMNEWSTYMNLAYRYVSSRSVPNSVPFHPYIDWWSHHATTEDL
FT                   QRSITFPDQVIRPSSVLLIEGDFTTVFAEHTGQYDILVTLFFIDTARNLVTYLETIHRL
FT                   LRPGGRWVNLGPLLYGTAPFVQLSLDEIVALSESIGFEFQETDPSVGDITVPGLQVRGL
FT                   DVAYGRNARGLNKNAYQAQYWEAVKR"
FT   exon            613927..614004
FT                   /gene="Pc16g02730"
FT                   /locus_tag="PCH_Pc16g02730"
FT                   /number=1
FT   intron          614005..614055
FT                   /gene="Pc16g02730"
FT                   /locus_tag="PCH_Pc16g02730"
FT                   /number=1
FT   exon            614056..614307
FT                   /gene="Pc16g02730"
FT                   /locus_tag="PCH_Pc16g02730"
FT                   /number=2
FT   intron          614308..614379
FT                   /gene="Pc16g02730"
FT                   /locus_tag="PCH_Pc16g02730"
FT                   /number=2
FT   exon            614380..614752
FT                   /gene="Pc16g02730"
FT                   /locus_tag="PCH_Pc16g02730"
FT                   /number=3
FT   intron          614753..614801
FT                   /gene="Pc16g02730"
FT                   /locus_tag="PCH_Pc16g02730"
FT                   /number=3
FT   exon            614802..615376
FT                   /gene="Pc16g02730"
FT                   /locus_tag="PCH_Pc16g02730"
FT                   /number=4
FT   mRNA            complement(join(<615472..615527,615614..615736,
FT                   615978..>616128))
FT                   /gene="Pc16g02740"
FT                   /locus_tag="PCH_Pc16g02740"
FT   CDS_pept        complement(join(615472..615527,615614..615736,
FT                   615978..616128))
FT                   /gene="Pc16g02740"
FT                   /locus_tag="PCH_Pc16g02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92944"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I8"
FT                   /protein_id="CAP92944.1"
FT                   /translation="MNVPKSRNLFPRVQAGLYTYCSAGIVGFARPRKEKVLVPQRFSNG
FT                   LGAGGGILYYQSMLLGYGPGIGNVQGPTVAPETLTALASQWGLGAKGKTQVDSLLPYPA
FT                   SSLPV"
FT   exon            complement(615472..615527)
FT                   /gene="Pc16g02740"
FT                   /locus_tag="PCH_Pc16g02740"
FT                   /number=1
FT   intron          complement(615528..615613)
FT                   /gene="Pc16g02740"
FT                   /locus_tag="PCH_Pc16g02740"
FT                   /number=1
FT   exon            complement(615614..615736)
FT                   /gene="Pc16g02740"
FT                   /locus_tag="PCH_Pc16g02740"
FT                   /number=2
FT   intron          complement(615737..615977)
FT                   /gene="Pc16g02740"
FT                   /locus_tag="PCH_Pc16g02740"
FT                   /number=2
FT   exon            complement(615978..616128)
FT                   /gene="Pc16g02740"
FT                   /locus_tag="PCH_Pc16g02740"
FT                   /number=3
FT   mRNA            join(<616170..616279,616344..>616773)
FT                   /gene="Pc16g02750"
FT                   /locus_tag="PCH_Pc16g02750"
FT   CDS_pept        join(616170..616279,616344..616773)
FT                   /gene="Pc16g02750"
FT                   /locus_tag="PCH_Pc16g02750"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig50.tfa_250wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02750"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92945"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I9"
FT                   /protein_id="CAP92945.1"
FT                   /translation="MKLSIFLIALMTSVSSAQDPGPSPTASVGCEPHGDHWHCDGPAST
FT                   DVSSVTSTSAAEVSTTASPTMPSPTESVGCEPHGDHWHCDGPAETGTEAEASTTSATAS
FT                   PTMPSPTESVGCEPHGDHWHCDGPAETGSASASASASASASASTSAGDEEGAAGSIGVQ
FT                   VSLLAGLSLVAAGLNL"
FT   sig_peptide     616170..616220
FT                   /gene="Pc16g02750"
FT                   /locus_tag="PCH_Pc16g02750"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            616170..616279
FT                   /gene="Pc16g02750"
FT                   /locus_tag="PCH_Pc16g02750"
FT                   /number=1
FT   mat_peptide     join(616221..616279,616344..616770)
FT                   /gene="Pc16g02750"
FT                   /locus_tag="PCH_Pc16g02750"
FT   intron          616280..616343
FT                   /gene="Pc16g02750"
FT                   /locus_tag="PCH_Pc16g02750"
FT                   /number=1
FT   exon            616344..616773
FT                   /gene="Pc16g02750"
FT                   /locus_tag="PCH_Pc16g02750"
FT                   /number=2
FT   mRNA            complement(join(<618406..618505,618568..618963,
FT                   619018..619155,619208..619501,619558..620809,
FT                   620882..621015,621081..621186,621252..621290,
FT                   621373..621395,621464..>621483))
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT   CDS_pept        complement(join(618406..618505,618568..618963,
FT                   619018..619155,619208..619501,619558..620809,
FT                   620882..621015,621081..621186,621252..621290,
FT                   621373..621395,621464..621483))
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /note="unknown EC_number=6.3.2.19"
FT                   /note="Title: strong similarity to ubiquitin protein ligase
FT                   ub1p - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02760"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92946"
FT                   /db_xref="GOA:B6H7J0"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR024928"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J0"
FT                   /inference="similar to AA sequence:PIR:T37545"
FT                   /inference="protein motif:PFAM:PF00168"
FT                   /inference="protein motif:PFAM:PF00397"
FT                   /inference="protein motif:PFAM:PF00632"
FT                   /inference="protein motif:COGS:COG5021"
FT                   /inference="protein motif:COGS:COG5038"
FT                   /protein_id="CAP92946.1"
FT                   /translation="MASNLPAQPNLRVTIIAADGLYKRDVFRFPDPFAVATVGGEQTHT
FT                   TSVIKKTLNPYWNEPFDLRVNEDSILAIQIFDQKKFKKKDQGFLGVINVRIGDVIDLSM
FT                   GGDEMLTRDLKKSNDNLVVHGKLIINLSSNLTTPHPNQNGLQRQQAQTSTSSGLVPQVA
FT                   APTSQSQAGPSNIDTSPAAASSSSLTQRTSATAPPAGAPPSLNGAPTNPPGPGVPSRTN
FT                   LSSFEDSQGRLPAGYERREDNLGRTYYVDHNTRTTTWSRPSANYNEHAQRSQREANMQL
FT                   ERRAHQSRMLPEDRTGANSPNLPDAQQIPTPPPGPNAGTSLASGAPAGSNAAAISMMAT
FT                   GATTAGTGELPPGWERRVTPEGRPYFVDHNTRTTTWVDPRRQQYIRMYGQGQTTGGANN
FT                   TTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQGVPQYKRD
FT                   FRRKLIYFRSQPALRIMSGQCHVKVRRNNIFEDSYAEIMRQSASDLKKRLMIKFDGEDG
FT                   LDYGGLSREFFFLLSHEMFNPFYCLFEYSAHDNYTLQINPHSGVNPEHLNYFKFIGRVV
FT                   GLAIFHRRFLDSFFIGAFYKMMLRKKVSLQDMEGVDEDLHRNLAWTLDNDIDGIVELTF
FT                   SVDDEKFGERRTIDLIPGGRDIPVTNENKPQYIELVTEWKIMKRVEEQFDAFMSGFNEL
FT                   IPPDLVNVFDERELELLIGGIADIDVEDWKKHTDYRGYQEQDEVIQNFWKIVRTWDAEQ
FT                   KSRLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKSGDPAALPKSHTCFNRLDLPPYKT
FT                   HDALEHKMSIAVEETLGFGQE"
FT   exon            complement(618406..618505)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=1
FT   intron          complement(618506..618567)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=1
FT   exon            complement(618568..618963)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=2
FT   intron          complement(618964..619017)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=2
FT   exon            complement(619018..619155)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=3
FT   intron          complement(619156..619207)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=3
FT   exon            complement(619208..619501)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=4
FT   intron          complement(619502..619557)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=4
FT   exon            complement(619558..620809)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=5
FT   intron          complement(620810..620881)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=5
FT   exon            complement(620882..621015)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=6
FT   intron          complement(621016..621080)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=6
FT   exon            complement(621081..621186)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=7
FT   intron          complement(621187..621251)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=7
FT   exon            complement(621252..621290)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=8
FT   intron          complement(621291..621372)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=8
FT   exon            complement(621373..621395)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=9
FT   intron          complement(621396..621463)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=9
FT   exon            complement(621464..621483)
FT                   /gene="Pc16g02760"
FT                   /locus_tag="PCH_Pc16g02760"
FT                   /number=10
FT   mRNA            complement(join(<622325..622474,622532..622619,
FT                   622685..622941,623085..>623165))
FT                   /gene="Pc16g02770"
FT                   /locus_tag="PCH_Pc16g02770"
FT   CDS_pept        complement(join(622325..622474,622532..622619,
FT                   622685..622941,623085..623165))
FT                   /gene="Pc16g02770"
FT                   /locus_tag="PCH_Pc16g02770"
FT                   /note="Title: strong similarity to poly(A)-binding protein
FT                   II Pabp2 - Drosophila melanogaster"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02770"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92947"
FT                   /db_xref="GOA:B6H7J1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J1"
FT                   /inference="similar to AA sequence:TREMBL:AE003838.22"
FT                   /inference="protein motif:PFAM:PF00076"
FT                   /inference="protein motif:COGS:COG0724"
FT                   /protein_id="CAP92947.1"
FT                   /translation="MAAEGQEIPEEIKGEKVPAQEDGVDDEEEIEAMKRRVAEMESEAA
FT                   KLREMQADLDQQTESLQENKEDIDARSIFVGNVDYGASPEEIQAHFQSCGSINRVTILL
FT                   DKFSGQPKGYAYVEFAEPSLVAQALVLNESVFRGRNLKVVPKRTNLPGMHRGRGRGFGR
FT                   GRGRGFPRGGGYRGGAPYRGRGRGFSPY"
FT   exon            complement(622325..622474)
FT                   /gene="Pc16g02770"
FT                   /locus_tag="PCH_Pc16g02770"
FT                   /number=1
FT   intron          complement(622475..622531)
FT                   /gene="Pc16g02770"
FT                   /locus_tag="PCH_Pc16g02770"
FT                   /number=1
FT   exon            complement(622532..622619)
FT                   /gene="Pc16g02770"
FT                   /locus_tag="PCH_Pc16g02770"
FT                   /number=2
FT   intron          complement(622620..622684)
FT                   /gene="Pc16g02770"
FT                   /locus_tag="PCH_Pc16g02770"
FT                   /number=2
FT   exon            complement(622685..622941)
FT                   /gene="Pc16g02770"
FT                   /locus_tag="PCH_Pc16g02770"
FT                   /number=3
FT   intron          complement(622942..623084)
FT                   /gene="Pc16g02770"
FT                   /locus_tag="PCH_Pc16g02770"
FT                   /number=3
FT   exon            complement(623085..623165)
FT                   /gene="Pc16g02770"
FT                   /locus_tag="PCH_Pc16g02770"
FT                   /number=4
FT   mRNA            complement(join(<624312..624428,624481..624894,
FT                   625021..>625077))
FT                   /gene="Pc16g02780"
FT                   /locus_tag="PCH_Pc16g02780"
FT   CDS_pept        complement(join(624312..624428,624481..624894,
FT                   625021..625077))
FT                   /gene="Pc16g02780"
FT                   /locus_tag="PCH_Pc16g02780"
FT                   /note="Title: strong similarity to vacuolar protein sorting
FT                   protein Vps29 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02780"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92948"
FT                   /db_xref="GOA:B6H7J2"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR028661"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J2"
FT                   /inference="similar to AA sequence:PIR:S46793"
FT                   /inference="protein motif:COGS:COG0622"
FT                   /inference="protein motif:COGS:COG0639"
FT                   /protein_id="CAP92948.1"
FT                   /translation="MTARLVLVIGDLFIPDRAPFRKLLTPGKIGQTLCLGNLTDRETYD
FT                   FLREVAPDLQMVKGDYDVDSPNLPLSRIVNHGSLRIGFTHGHTIVPPADADALLIAARQ
FT                   MDVDVLLWGGTHRFEAFEMEGRFFINPGSATGAMSSGFWPDGEEPTPSFCLMDIQGDVL
FT                   VLYVYQLKTDANGVENVAVEKVSFRKNHPPAS"
FT   exon            complement(624312..624428)
FT                   /gene="Pc16g02780"
FT                   /locus_tag="PCH_Pc16g02780"
FT                   /number=1
FT   intron          complement(624429..624480)
FT                   /gene="Pc16g02780"
FT                   /locus_tag="PCH_Pc16g02780"
FT                   /number=1
FT   exon            complement(624481..624894)
FT                   /gene="Pc16g02780"
FT                   /locus_tag="PCH_Pc16g02780"
FT                   /number=2
FT   intron          complement(624895..625020)
FT                   /gene="Pc16g02780"
FT                   /locus_tag="PCH_Pc16g02780"
FT                   /number=2
FT   exon            complement(625021..625077)
FT                   /gene="Pc16g02780"
FT                   /locus_tag="PCH_Pc16g02780"
FT                   /number=3
FT   mRNA            join(<626252..626340,626397..>627465)
FT                   /gene="Pc16g02790"
FT                   /locus_tag="PCH_Pc16g02790"
FT   CDS_pept        join(626252..626340,626397..627465)
FT                   /gene="Pc16g02790"
FT                   /locus_tag="PCH_Pc16g02790"
FT                   /note="unknown EC_number=2.6.1.-"
FT                   /note="Title: strong similarity to aspartate transaminase
FT                   like protein An08g01000 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02790"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92949"
FT                   /db_xref="GOA:B6H7J3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J3"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /inference="protein motif:COGS:COG0075"
FT                   /inference="protein motif:COGS:COG0436"
FT                   /inference="protein motif:COGS:COG0520"
FT                   /inference="protein motif:COGS:COG1104"
FT                   /protein_id="CAP92949.1"
FT                   /translation="MSAQAPHNTLLIPGPIEFDDAVLQSMSHYAESHVAPGFVKVFGET
FT                   LTLVRKLFQSTNPTAQPFIIAGSGTLGWDLVSANLIERGENALVLNTGYFGDSFGQCLE
FT                   TYGANVTHLKAPIGDRTPLEQVEQALKEKPYKLITLTHVDTSTGVLGDVKGVAQLVRRV
FT                   SPNTLVVVDGVCSVGSEEIAFDEWDLDAVVTASQKAIGCPPGLSIVMTSGRAIQAAQSR
FT                   KTPPGAYYASIANWLPIMQNYENNKPSYFATPPTQLVHALHTTLTQITADVPGRFAIHT
FT                   EVSDKVKAAVAELGLKQVASYPECQAHGMTAMYLPEGLVPADVLPGLLKRGVIFAAGLH
FT                   KEIATKYIRFGHMGVTVTDPKRGDVDKALAALKEALAEAKQAKGL"
FT   exon            626252..626340
FT                   /gene="Pc16g02790"
FT                   /locus_tag="PCH_Pc16g02790"
FT                   /number=1
FT   intron          626341..626396
FT                   /gene="Pc16g02790"
FT                   /locus_tag="PCH_Pc16g02790"
FT                   /number=1
FT   exon            626397..627465
FT                   /gene="Pc16g02790"
FT                   /locus_tag="PCH_Pc16g02790"
FT                   /number=2
FT   mRNA            join(<628343..628470,628565..628666,628728..>629085)
FT                   /gene="Pc16g02800"
FT                   /locus_tag="PCH_Pc16g02800"
FT   CDS_pept        join(628343..628470,628565..628666,628728..629085)
FT                   /gene="Pc16g02800"
FT                   /locus_tag="PCH_Pc16g02800"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig46_part_i.tfa_580wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02800"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92950"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J4"
FT                   /protein_id="CAP92950.1"
FT                   /translation="MHYLNSTLPFLLAAATFTLADTAATTTTTSADNAVNTTSASENII
FT                   LQECIQSVRSNLGNCAPDDWDCRCTNSMDVVDCYTNCREDTSKKDAETTRQRDCANAKA
FT                   HASISVATSTVSSSRAAATGTDIDDGTDISDSEVETDSEGDSINSYSGLEANLFVRPEE
FT                   GAASGLRMRGWLRFLGHAPGVSLLVLGAGLRF"
FT   sig_peptide     628343..628414
FT                   /gene="Pc16g02800"
FT                   /locus_tag="PCH_Pc16g02800"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            628343..628470
FT                   /gene="Pc16g02800"
FT                   /locus_tag="PCH_Pc16g02800"
FT                   /number=1
FT   mat_peptide     join(628415..628470,628565..628666,628728..629082)
FT                   /gene="Pc16g02800"
FT                   /locus_tag="PCH_Pc16g02800"
FT   intron          628471..628564
FT                   /gene="Pc16g02800"
FT                   /locus_tag="PCH_Pc16g02800"
FT                   /number=1
FT   exon            628565..628666
FT                   /gene="Pc16g02800"
FT                   /locus_tag="PCH_Pc16g02800"
FT                   /number=2
FT   intron          628667..628727
FT                   /gene="Pc16g02800"
FT                   /locus_tag="PCH_Pc16g02800"
FT                   /number=2
FT   exon            628728..629085
FT                   /gene="Pc16g02800"
FT                   /locus_tag="PCH_Pc16g02800"
FT                   /number=3
FT   mRNA            complement(join(<629279..629726,629790..>630202))
FT                   /gene="Pc16g02810"
FT                   /locus_tag="PCH_Pc16g02810"
FT   CDS_pept        complement(join(629279..629726,629790..630202))
FT                   /gene="Pc16g02810"
FT                   /locus_tag="PCH_Pc16g02810"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An06g00740 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02810"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92951"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J5"
FT                   /protein_id="CAP92951.1"
FT                   /translation="MEPTTSEHEPKTTKWDEGQIYVKACHNATRKLLVCLLSRSNEKKL
FT                   NLTTAGLDLSSGDSPDYGPRFVKPFSHDKMREYVEREQPWDDRWDIHSLCIPDEPELYK
FT                   YRLWRNAHHVAGILHLTLENFWGYDWPHGLVDEDNELGSLYRNQSQWYLEGWTIAKDTS
FT                   QPHINAFVSDSQPHRVGRLNSGEVSLAYGLIAKRRLQEGYNDHRYIPITMFSMSNFTVR
FT                   ILQIWHDKQNPKALQVRSSRIMDFKGGIQNNLDDWITILCWMTGEPVGDTKNGTEVAKV
FT                   IEREE"
FT   exon            complement(629279..629726)
FT                   /gene="Pc16g02810"
FT                   /locus_tag="PCH_Pc16g02810"
FT                   /number=1
FT   intron          complement(629727..629789)
FT                   /gene="Pc16g02810"
FT                   /locus_tag="PCH_Pc16g02810"
FT                   /number=1
FT   exon            complement(629790..630202)
FT                   /gene="Pc16g02810"
FT                   /locus_tag="PCH_Pc16g02810"
FT                   /number=2
FT   mRNA            complement(join(<630977..631018,631071..631341,
FT                   631396..631591,631650..631691,631752..632154,
FT                   632248..632481,632540..>632932))
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT   CDS_pept        complement(join(630977..631018,631071..631341,
FT                   631396..631591,631650..631691,631752..632154,
FT                   632248..632481,632540..632932))
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /note="Title: strong similarity to cycloheximide resistance
FT                   protein CYHR - Candida maltosa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02820"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92952"
FT                   /db_xref="GOA:B6H7J6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J6"
FT                   /inference="similar to AA sequence:SWISSPROT:CYHR_CANMA"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP92952.1"
FT                   /translation="MDTLIRDSLFGRLSNSLISNKLWPYPNLEACKFETLSTSPTSTIS
FT                   VTPEPSQQFIVEFSGDDDPDMPRNWSLLSKTLVTLDIMLLNFSFYAASAIFTPSIPGIE
FT                   EQFGATTAEGTLGLSLFVIAYGIGPLFLSPLSNLPAIGRTPVYVLGSLIFCLLNIGAAL
FT                   GKNVETILILRFFGGFFGSAPISVGGATLMEVYGPGEAPYAIALYAIFGTLAMFVPSYI
FT                   YALVMVANSHSERWHTWTASLWLLSGITAFTTLFIFFLLPETLSSNILLRRAQRLREHT
FT                   GNPLYRSKSEMDTPTTSFGAMIFKQTVDDLKLSCMDPVIIFVNIHTMLIYGILYLWFEF
FT                   FPFVFDGIYHFTPIQQALAFFGILVGAAISVVSYMLWLRFSYQPRVSKVESSIEPEARL
FT                   VPGQIGAICIPICLFMFAWTSRPGVHWVVPIIGTAFFAPGFYLTFQSVLNYLGESYPRH
FT                   VASVFAGNTFFRSSFGGALPLAAPRMLQSLGIVWASSTLGFISIAMLPLPFILERYGKT
FT                   LRSWSKFAN"
FT   exon            complement(630977..631018)
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /number=1
FT   intron          complement(631019..631070)
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /number=1
FT   exon            complement(631071..631341)
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /number=2
FT   intron          complement(631342..631395)
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /number=2
FT   exon            complement(631396..631591)
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /number=3
FT   intron          complement(631592..631649)
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /number=3
FT   exon            complement(631650..631691)
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /number=4
FT   intron          complement(631692..631751)
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /number=4
FT   exon            complement(631752..632154)
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /number=5
FT   intron          complement(632155..632247)
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /number=5
FT   exon            complement(632248..632481)
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /number=6
FT   intron          complement(632482..632539)
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /number=6
FT   exon            complement(632540..632932)
FT                   /gene="Pc16g02820"
FT                   /locus_tag="PCH_Pc16g02820"
FT                   /number=7
FT   mRNA            join(<633685..634368,634418..>634969)
FT                   /gene="Pc16g02830"
FT                   /locus_tag="PCH_Pc16g02830"
FT   CDS_pept        join(633685..634368,634418..634969)
FT                   /gene="Pc16g02830"
FT                   /locus_tag="PCH_Pc16g02830"
FT                   /note="Title: similarity to aflatoxin biosynthesis
FT                   regulatory protein aflR - Aspergillus parasiticus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02830"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92953"
FT                   /db_xref="GOA:B6H7J7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J7"
FT                   /inference="similar to AA sequence:TREMBLNEW:AF441438.1"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /protein_id="CAP92953.1"
FT                   /translation="MKVRKQVPPRKKACQSCTDSKVRCGLEKPTCSRCRARGKQCRYPA
FT                   GSGDVHQSSPMVSSEQISADESLTFGLSPANLSATSTVTAFSSPVSGHPSDIPRIYSQH
FT                   ESTQTVDTDLNFDHIDLVPMIDAEKIRDRWLQPYLLTATEQVPKLFNPFTVQFVTCVLR
FT                   SYPNHLLDEKSLPPFIHPLQLNSKAMPRTIANCFSLVRMWMNRVAGSEAIVLSTVRQEM
FT                   ERLSREDATSDFDTLCSFQVYLIYLLTAYFFPIENASLGDDMSMITIQDLAFRVAKAGF
FT                   TCKAELSQTRPTWESWIIASAKRRTLFTMYIFSNVYNSDKGLPNFLSDELGDILVPESK
FT                   ALWEASDRDSWTREYNRHLSKWEDGMLKISELWRSSETGSEARRKRIGRWVQSTDEFGM
FT                   MLFAVCAHIHGC"
FT   exon            633685..634368
FT                   /gene="Pc16g02830"
FT                   /locus_tag="PCH_Pc16g02830"
FT                   /number=1
FT   intron          634369..634417
FT                   /gene="Pc16g02830"
FT                   /locus_tag="PCH_Pc16g02830"
FT                   /number=1
FT   exon            634418..634969
FT                   /gene="Pc16g02830"
FT                   /locus_tag="PCH_Pc16g02830"
FT                   /number=2
FT   misc_RNA        635255..635398
FT                   /gene="small non coding RNA"
FT                   /locus_tag="PCH_Pc16e00060"
FT                   /product="small non coding RNA"
FT                   /inference="profile:QRNA:2.01"
FT   mRNA            <635906..>636211
FT                   /gene="Pc16g02840"
FT                   /locus_tag="PCH_Pc16g02840"
FT   CDS_pept        635906..>636211
FT                   /gene="Pc16g02840"
FT                   /locus_tag="PCH_Pc16g02840"
FT                   /product="hypothetical protein [truncated ORF]"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02840"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92954"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J8"
FT                   /protein_id="CAP92954.1"
FT                   /translation="MLSLALLQSLQGDLNELTRGIQYLCLIRRIVTGEFRQLRDVPIAV
FT                   GRPFAGGVIKNGAVIVSNNLQIVQGSFARVVVHGLEGCGRGRKGFSEAEILARPPIR"
FT   exon            635906..>636211
FT                   /gene="Pc16g02840"
FT                   /locus_tag="PCH_Pc16g02840"
FT                   /number=1
FT   gap             636254..636353
FT                   /estimated_length=unknown
FT   mRNA            join(<636356..636616,636668..>636886)
FT                   /gene="Pc16g02850"
FT                   /locus_tag="PCH_Pc16g02850"
FT   CDS_pept        join(<636356..636616,636668..636886)
FT                   /gene="Pc16g02850"
FT                   /locus_tag="PCH_Pc16g02850"
FT                   /note="Title: similarity to hypothetical protein An04g09580
FT                   - Aspergillus niger [truncated ORF]"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02850"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92955"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J9"
FT                   /protein_id="CAP92955.1"
FT                   /translation="VLLQRQKQPRARDREKKLSTKHPSRARQVLTSGTRKHTTSFSRVT
FT                   AIDKMEGGFRKAFLMKRADGTDVIAKVPCHIASPPLLTTAGESGDTLPFLYLVFFLESS
FT                   DGSNAVPNSLSWRKLRISLCSTPMASEAEKHTVFQPPGPFDAALPSNYILQKGWL"
FT   exon            <636356..636616
FT                   /gene="Pc16g02850"
FT                   /locus_tag="PCH_Pc16g02850"
FT                   /number=1
FT   intron          636617..636667
FT                   /gene="Pc16g02850"
FT                   /locus_tag="PCH_Pc16g02850"
FT                   /number=1
FT   exon            636668..>636886
FT                   /gene="Pc16g02850"
FT                   /locus_tag="PCH_Pc16g02850"
FT                   /number=2
FT   mRNA            <637049..>638086
FT                   /gene="Pc16g02860"
FT                   /locus_tag="PCH_Pc16g02860"
FT   CDS_pept        <637049..638086
FT                   /gene="Pc16g02860"
FT                   /locus_tag="PCH_Pc16g02860"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An02g10120 - Aspergillus niger [truncated ORF]"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02860"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92956"
FT                   /db_xref="GOA:B6H7K0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K0"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP92956.1"
FT                   /translation="MTREQIIYDVGPFRSSTKNTDTQLNVYVSNKRFKIDLFTSSFSRS
FT                   PVLLAEYLRHVRRQEPEWIPDESEVDLDVEFEDPLDEMHDWVLQPFLPIFREIAPLDPS
FT                   QKYTLEDCLFAEELHYTVEVVGDNLVPVYLGNTKNMKHHLIGARLPSSVDYSAFSIYHP
FT                   REVQVPISAESAALPGIPRKVFIHGQPQPSFFKIVYGGDMGITTREILTYSKIRMAKFD
FT                   PPILTSQLEGLVQDDDGYVMGLLLSYINCDGVTLNCINGRDPKFSELRQKWVDQISHTI
FT                   EHMHSHNIIWGDAKAANVLIDANEDAYLIDFGGGYTKGWVEKEKSDSTEGDLQGLENIK
FT                   RFLFR"
FT   exon            <637049..>638086
FT                   /gene="Pc16g02860"
FT                   /locus_tag="PCH_Pc16g02860"
FT                   /number=1
FT   gap             638478..638577
FT                   /estimated_length=unknown
FT   mRNA            <641734..>642885
FT                   /gene="Pc16g02870"
FT                   /locus_tag="PCH_Pc16g02870"
FT   CDS_pept        641734..642885
FT                   /gene="Pc16g02870"
FT                   /locus_tag="PCH_Pc16g02870"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1323_scaffold_5.tfa_520cg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02870"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92957"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K1"
FT                   /protein_id="CAP92957.1"
FT                   /translation="MAAEKRFLVPDEKILSDIFPGVVGLKPSSCNVISNTFDICTFSVQ
FT                   VEVIPLIVRLETEKSETSKSRLATVAALSRLGHLQLNDIVPSIQQIGTATTIDTKVNYL
FT                   VTEYLTGTVLLEDIWNTLDETNQLELVDSVVCAMDKLQKLGDIKNVYKYLTATPYISND
FT                   KTPVAIGGPGIGYFPDIKDFLEGILQKHKRPGCKLLGTDGGLSIQSEYDDIGQIDLSHS
FT                   DLDELQHCVVFCHNDLEPRNILVRKSSSGKYKLAGVIDWEMAGFFPFAYEYGVKDTYLG
FT                   RENLYFSWYTMFKGKASYLLPQMECHTKFIKAVRIIEKSKKKAMSRNVGVRVQEKWIQR
FT                   EKVEESSDIREGWIRKAGEKSQVFTKEDMKELENEVLKELGYI"
FT   exon            641734..642885
FT                   /gene="Pc16g02870"
FT                   /locus_tag="PCH_Pc16g02870"
FT                   /number=1
FT   mRNA            join(<643493..643508,643567..643603,643700..>645002)
FT                   /gene="Pc16g02880"
FT                   /locus_tag="PCH_Pc16g02880"
FT   CDS_pept        join(643493..643508,643567..643603,643700..645002)
FT                   /gene="Pc16g02880"
FT                   /locus_tag="PCH_Pc16g02880"
FT                   /note="Title: strong similarity to hypothetical
FT                   cysteine-binding protein fliY - Haloferax volcanii"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02880"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92958"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K2"
FT                   /inference="similar to AA sequence:TREMBL:AF315625.1"
FT                   /protein_id="CAP92958.1"
FT                   /translation="MAGTGARAVCSVANDASRYGVGCPGYKRPWQFKDEGPRLQKRYQK
FT                   KCSNARTHSEAINSNGIFTKFSIDERVHPALVHQSFISQQPQVFKEFICAAFPTMFFHN
FT                   EFRFGNGFNFADCVVKHFGSKQYHDASVSCLSAEYLGHLTGDPRLHQFGRQEYSKALGA
FT                   IRRALNSEEALSDSLLLAVILLSIYEMNTRTTRDAWVYHSRAVKQLLLRRRTTFCLSGV
FT                   GRVCHFAYRPFLIAAALYEGEPCFLADDNWQDLAAFLRMEDSQKQSEWAFYINVYETIF
FT                   MELVKCPGYIKEAREIVSVTSPKARLLAQRICIAGDRLRTLSDELRSLLASHNQRKEGI
FT                   IFRSFVGPQPNAFPETSPSLLLRAAVTATSILEELFIRLTTPAYAKGESPSSSRGTPQS
FT                   VGVSGAGGPLLDFRFTFELGGRTEKDNPCHFTWLDRVAGSMGLLGAEITYVE"
FT   exon            643493..643508
FT                   /gene="Pc16g02880"
FT                   /locus_tag="PCH_Pc16g02880"
FT                   /number=1
FT   intron          643509..643566
FT                   /gene="Pc16g02880"
FT                   /locus_tag="PCH_Pc16g02880"
FT                   /number=1
FT   exon            643567..643603
FT                   /gene="Pc16g02880"
FT                   /locus_tag="PCH_Pc16g02880"
FT                   /number=2
FT   intron          643604..643699
FT                   /gene="Pc16g02880"
FT                   /locus_tag="PCH_Pc16g02880"
FT                   /number=2
FT   exon            643700..645002
FT                   /gene="Pc16g02880"
FT                   /locus_tag="PCH_Pc16g02880"
FT                   /number=3
FT   mRNA            <645422..>646165
FT                   /gene="Pc16g02890"
FT                   /locus_tag="PCH_Pc16g02890"
FT   CDS_pept        645422..646165
FT                   /gene="Pc16g02890"
FT                   /locus_tag="PCH_Pc16g02890"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An11g02890 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02890"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92959"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K3"
FT                   /protein_id="CAP92959.1"
FT                   /translation="MPFSSRHERKPSRGRAHRKAGGSMTGDKDIWELDLERSGEINILQ
FT                   RYRLRQHLRRPSHDDSERPFISHRLYFIEEDLREVVQEEISIKEGLDVLEKCGKEKERL
FT                   DVLNTKYWLLERQWWHYHSCLEDGYELRGFELWRSHPKWYMHRDLIKDCASRQGCCARG
FT                   CGCCLRRKIDPTRAFGVGHCTFECGCCRRARGFEIPEGDKILLKEKCREEIGKLPTHRI
FT                   VRVAIWGLVGDSYDNPFDMIDAPPS"
FT   exon            645422..646165
FT                   /gene="Pc16g02890"
FT                   /locus_tag="PCH_Pc16g02890"
FT                   /number=1
FT   mRNA            join(<646701..646875,646923..647145,647210..>647441)
FT                   /gene="Pc16g02900"
FT                   /locus_tag="PCH_Pc16g02900"
FT   CDS_pept        join(646701..646875,646923..647145,647210..647441)
FT                   /gene="Pc16g02900"
FT                   /locus_tag="PCH_Pc16g02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02900"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92960"
FT                   /db_xref="GOA:B6H7K4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K4"
FT                   /protein_id="CAP92960.1"
FT                   /translation="MEDAKEVVAKHRWNGYKRLKRAVRKFLGNNIDRRQLQEATDQIDA
FT                   SETKFPTVAITTLSVFADVFFGLFLTHPFSPSASPPHNEESMALEVLHLADKRGPILAL
FT                   EVGGVVFLVLVLMRTLSLVYWYIRLKILLKLDPDGRYDNDTRWTVIDTLTDMEASQDPM
FT                   KASLPYSLDDEGLYFHPSDAEPSLCLPKSMTKKVFALVHDDQGHCI"
FT   exon            646701..646875
FT                   /gene="Pc16g02900"
FT                   /locus_tag="PCH_Pc16g02900"
FT                   /number=1
FT   intron          646876..646922
FT                   /gene="Pc16g02900"
FT                   /locus_tag="PCH_Pc16g02900"
FT                   /number=1
FT   exon            646923..647145
FT                   /gene="Pc16g02900"
FT                   /locus_tag="PCH_Pc16g02900"
FT                   /number=2
FT   intron          647146..647209
FT                   /gene="Pc16g02900"
FT                   /locus_tag="PCH_Pc16g02900"
FT                   /number=2
FT   exon            647210..647441
FT                   /gene="Pc16g02900"
FT                   /locus_tag="PCH_Pc16g02900"
FT                   /number=3
FT   mRNA            join(<648289..648719,648778..>649444)
FT                   /gene="Pc16g02910"
FT                   /locus_tag="PCH_Pc16g02910"
FT   CDS_pept        join(648289..648719,648778..649444)
FT                   /gene="Pc16g02910"
FT                   /locus_tag="PCH_Pc16g02910"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   F28J15.5 - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02910"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92961"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8P9"
FT                   /inference="similar to AA sequence:TREMBL:AC069472.9"
FT                   /protein_id="CAP92961.1"
FT                   /translation="MAKETKTRTLNVQPEKSQGEDDNKHVSFHPRQITLETFRNLLYQY
FT                   PSTVERVHRSKLMIKLQSKGKAKAPKRKAETKTSAAPATKADLDPSEEKHILEESDQFL
FT                   QLDRWRYEVLPKLIAERANGSAEGAHLVKEELIDIMEWKTKHGVSRPMLMGMVKSNPAT
FT                   TITKSTSTAFAALPDADPLVAPNDTFPKASLDALTAPIRGVGPATASLILSIATVFGDA
FT                   KKQVPFYSDDVYLWLCLMDFPEGPDVKEQKPSKHKKPNGELIVKYNMHEYRELWNASQA
FT                   LRARLNNAAGENSGDGPVSFIDIERAAYVLRNLAISDYFASQEAEDGSNVVKDVESPND
FT                   SLPKQPEKDSSELGTRRSKRTKKEA"
FT   exon            648289..648719
FT                   /gene="Pc16g02910"
FT                   /locus_tag="PCH_Pc16g02910"
FT                   /number=1
FT   intron          648720..648777
FT                   /gene="Pc16g02910"
FT                   /locus_tag="PCH_Pc16g02910"
FT                   /number=1
FT   exon            648778..649444
FT                   /gene="Pc16g02910"
FT                   /locus_tag="PCH_Pc16g02910"
FT                   /number=2
FT   mRNA            complement(join(<649670..650587,650708..650784,
FT                   650830..>650845))
FT                   /gene="Pc16g02920"
FT                   /locus_tag="PCH_Pc16g02920"
FT   CDS_pept        complement(join(649670..650587,650708..650784,
FT                   650830..650845))
FT                   /gene="Pc16g02920"
FT                   /locus_tag="PCH_Pc16g02920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02920"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92962"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q0"
FT                   /protein_id="CAP92962.1"
FT                   /translation="MSLNQAPISQSGRMLVPVEEKIKTSGDFWNWQRLRAAVFPFLPVN
FT                   IEDTLPLVDEHPTSMQTIESNMGEVIPHHKAVDIPIDSHGNLDEDCTENQDEVNEHELS
FT                   RQVRPAFDTALEENDTKVISNTCCTESPVVSSSESVEGATAKEDLPSPPTSPVPTTTNN
FT                   PTYPIYHNLIPPPPIPLDATTQSRIDKKFQSAIKETPTIRLIVDIPPHLVDWSNPITSI
FT                   TTTINPFLSHWETQNKVNLLAVEIRHGHAYAAIEVNNHNYDFKTAHKQTFVFPVYVLKV
FT                   GRGFRWRFYRAPAVDVSVMNEIKTVHYLHREEVGTPYLVFRVGGREPVSGESRED"
FT   exon            complement(649670..650587)
FT                   /gene="Pc16g02920"
FT                   /locus_tag="PCH_Pc16g02920"
FT                   /number=1
FT   intron          complement(650588..650707)
FT                   /gene="Pc16g02920"
FT                   /locus_tag="PCH_Pc16g02920"
FT                   /number=1
FT   exon            complement(650708..650784)
FT                   /gene="Pc16g02920"
FT                   /locus_tag="PCH_Pc16g02920"
FT                   /number=2
FT   intron          complement(650785..650829)
FT                   /gene="Pc16g02920"
FT                   /locus_tag="PCH_Pc16g02920"
FT                   /number=2
FT   exon            complement(650830..650845)
FT                   /gene="Pc16g02920"
FT                   /locus_tag="PCH_Pc16g02920"
FT                   /number=3
FT   mRNA            complement(<651563..>653518)
FT                   /gene="Pc16g02930"
FT                   /locus_tag="PCH_Pc16g02930"
FT   CDS_pept        complement(651563..653518)
FT                   /gene="Pc16g02930"
FT                   /locus_tag="PCH_Pc16g02930"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_18_scaffold_1.tfa_240cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02930"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92963"
FT                   /db_xref="GOA:B6H8Q1"
FT                   /db_xref="InterPro:IPR037807"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q1"
FT                   /protein_id="CAP92963.1"
FT                   /translation="MLAPNCTGINTLSLPQLKRKRSDSDSDATDAPAPTKVCADSVSTR
FT                   PTPTLIADSVAPTPSTPTTSSNSPVASARPPAQDAVARPSVTRLRETITAQLSLEVLLK
FT                   HNELRLIDQEIAKCQVALEQLRRCGEIPYPGSRVTGVSPDVSLGTGASVLAPGNGPAPM
FT                   SPAPWGVTEGPYARHYARWLLPDPRFDGGEVDSGMPNSLVEGRSTRGNPGEMGMLAGKT
FT                   RPQRGSTATKHTALSSGYPVVKEKSGPMLIRRKSDGVLVKLVCLDCRRDNFSSTQGFIN
FT                   HCRIAHNRNFASHDAAAMACGQSVQVDDAGTVVGGSAEPTANPTTPGYVHPLIRSTHVA
FT                   TTPWKSLRTPAKDSVTPRTPAAATTSAVATPPSTAEPAYRRRSEPIRQPPNPQFLASPA
FT                   TPHLSALMKSRGAGLNMDKLVEESRTPVDLGALFDDDSETDDSRPSGASHTSLGARAGR
FT                   QPMRMPASQTAGESESRKALDRGHSPPTEHATPSRPQSFLDLSLAGQSQSRESNSLDHQ
FT                   ALSPHAIESNQAPSLVSDDEDDYEVASDSDSPASSEEDEQEQEFRHIHVEDDERAAAPS
FT                   ATAEAKPGPSLASPAPQSGPPLSQPLKRSRSKKISSIVPFGDNDDQHVGYIHSPSADNA
FT                   AKAKRAAERKPNQSKR"
FT   exon            complement(651563..653518)
FT                   /gene="Pc16g02930"
FT                   /locus_tag="PCH_Pc16g02930"
FT                   /number=1
FT   mRNA            complement(join(<656118..656464,656704..>656737))
FT                   /gene="Pc16g02940"
FT                   /locus_tag="PCH_Pc16g02940"
FT   CDS_pept        complement(join(656118..656464,656704..656737))
FT                   /gene="Pc16g02940"
FT                   /locus_tag="PCH_Pc16g02940"
FT                   /note="Title: strong similarity to Vtc1 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02940"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92964"
FT                   /db_xref="GOA:B6H8Q2"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q2"
FT                   /inference="similar to AA sequence:PIR:S50575"
FT                   /inference="protein motif:COGS:COG5264"
FT                   /protein_id="CAP92964.1"
FT                   /translation="MSSQPLLQTAPGKRIALPTRVEPKVFFANERTFLSWLNFTVILGG
FT                   LAVGLLNFGDRIGRISAALFTIIAMGAMIYALVTFHWRAQSIRRRGQSGIDDRFGPTIL
FT                   AIALLAAVVVNFILRIKDGQMN"
FT   exon            complement(656118..656464)
FT                   /gene="Pc16g02940"
FT                   /locus_tag="PCH_Pc16g02940"
FT                   /number=1
FT   intron          complement(656465..656703)
FT                   /gene="Pc16g02940"
FT                   /locus_tag="PCH_Pc16g02940"
FT                   /number=1
FT   exon            complement(656704..656737)
FT                   /gene="Pc16g02940"
FT                   /locus_tag="PCH_Pc16g02940"
FT                   /number=2
FT   mRNA            complement(join(<658147..658571,658631..659639,
FT                   659704..659883,659945..>660190))
FT                   /gene="Pc16g02950"
FT                   /locus_tag="PCH_Pc16g02950"
FT   CDS_pept        complement(join(658147..658571,658631..659639,
FT                   659704..659883,659945..660190))
FT                   /gene="Pc16g02950"
FT                   /locus_tag="PCH_Pc16g02950"
FT                   /note="unknown EC_number=1.1.3.7"
FT                   /note="Title: strong similarity to aryl-alcohol oxidase
FT                   precursor aao - Pleurotus eryngii"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02950"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92965"
FT                   /db_xref="GOA:B6H8Q3"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q3"
FT                   /inference="similar to AA sequence:TREMBL:AF064069.1"
FT                   /inference="protein motif:PFAM:PF00732"
FT                   /inference="protein motif:PFAM:PF05199"
FT                   /inference="protein motif:COGS:COG2303"
FT                   /protein_id="CAP92965.1"
FT                   /translation="MAENPTCAIEEFTRTIFDYVICGGGTAGLTLAVRLSENPAVTVGV
FT                   IEAGKYRIGDPLVDTPAAFPQTFENPEYDWCVYSVPQEGNRGVAHHIPRGKLLGGSSGI
FT                   NYMMYVRGSTKDYDNWAELLEDDGWSGEHMQHYMRKHQTLEPIDPSITDRSTMPLVGEF
FT                   HGTSGPIRTGFNDSILPVENDIIKACEDVAGITNKPHDPWSGDHIGFYHTLGAVIRTGP
FT                   NKGKRSYAARGYYEENRATRPNLKVLCEALVNRVVLDGNKATGVSLTHEGVEYQVSARR
FT                   EVIVSGGTIQSPQILELSGIGDPEVLKAAGVECKVANSAVGGNVIDHALSFIVMEVQPG
FT                   IMTLDTLSQVPEAMAAARKQYAETGGGPLTAVSSMQGFFPAKSILSETELAEIIQSIRD
FT                   IKPNSAFHAKQLEQTIANLEDGHSANMQFVTVPGSMNPDAIGHQGNIILPRSADQPAGV
FT                   TLEACLQYPVSRGTIHIESADPTKHPIVNPNYGGHPADISLLAAFLRWCDKVTESEHVK
FT                   SSFLRRAFPDPKVNLQDMDAAREAVHDLVVGEYHISGSVAMGAALDSRLRVKGVEGLRV
FT                   VDASVLSNNVSGNIVSTVYAIAEKAADLIREDWDFSAAKETIA"
FT   exon            complement(658147..658571)
FT                   /gene="Pc16g02950"
FT                   /locus_tag="PCH_Pc16g02950"
FT                   /number=1
FT   intron          complement(658572..658630)
FT                   /gene="Pc16g02950"
FT                   /locus_tag="PCH_Pc16g02950"
FT                   /number=1
FT   exon            complement(658631..659639)
FT                   /gene="Pc16g02950"
FT                   /locus_tag="PCH_Pc16g02950"
FT                   /number=2
FT   intron          complement(659640..659703)
FT                   /gene="Pc16g02950"
FT                   /locus_tag="PCH_Pc16g02950"
FT                   /number=2
FT   exon            complement(659704..659883)
FT                   /gene="Pc16g02950"
FT                   /locus_tag="PCH_Pc16g02950"
FT                   /number=3
FT   intron          complement(659884..659944)
FT                   /gene="Pc16g02950"
FT                   /locus_tag="PCH_Pc16g02950"
FT                   /number=3
FT   exon            complement(659945..660190)
FT                   /gene="Pc16g02950"
FT                   /locus_tag="PCH_Pc16g02950"
FT                   /number=4
FT   mRNA            complement(<661257..>662447)
FT                   /gene="Pc16g02960"
FT                   /locus_tag="PCH_Pc16g02960"
FT   CDS_pept        complement(661257..662447)
FT                   /gene="Pc16g02960"
FT                   /locus_tag="PCH_Pc16g02960"
FT                   /note="Title: similarity to transcription activator Upc2
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02960"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92966"
FT                   /db_xref="GOA:B6H8Q4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q4"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /protein_id="CAP92966.1"
FT                   /translation="MPPLRAHTKSRNGCDQCRIRRVKCDEKGPPCSNCTTRELKCTYLK
FT                   VAARRAATHITPPSSTSDVLQSLDGHGSPVAAMPGPAVATIPVSAPTQTNSFGINNLEL
FT                   MHKFATETYKSLCISDSEMQIWKITVPTLALKHDYLMNGILALASLHIATTCGPSEVAL
FT                   MYYEAGLQYYNRSLTPFRNAIDSITPHNCDAVFAHSIVMIAIGIASPQLTGMKDECAST
FT                   TKNIVILFELLQGVKKILQVSKSWIKLELFSQGEFWKNTPAELDPDTEAALTHLSDLND
FT                   RVMVGVYSEQHRINKTVIAHLRHCYAKFAHSADPAPAFAWLAAVEKGFVDSLRCRQPFS
FT                   LLILMYWGVLLRELDGLRWWARDAGRVLVSELFDALRSGDPRWQSALGWVQRKMGL"
FT   exon            complement(661257..662447)
FT                   /gene="Pc16g02960"
FT                   /locus_tag="PCH_Pc16g02960"
FT                   /number=1
FT   mRNA            join(<663003..663076,663139..>666007)
FT                   /gene="Pc16g02970"
FT                   /locus_tag="PCH_Pc16g02970"
FT   CDS_pept        join(663003..663076,663139..666007)
FT                   /pseudo
FT                   /gene="Pc16g02970"
FT                   /locus_tag="PCH_Pc16g02970"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to two-component
FT                   sensor/response regulator like protein An18g01860
FT                   -Aspergillus niger [putative pseudogene]"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /inference="protein motif:COGS:COG0784"
FT                   /inference="protein motif:COGS:COG0642"
FT   exon            663003..663076
FT                   /gene="Pc16g02970"
FT                   /locus_tag="PCH_Pc16g02970"
FT                   /number=1
FT   intron          663077..663138
FT                   /gene="Pc16g02970"
FT                   /locus_tag="PCH_Pc16g02970"
FT                   /number=1
FT   exon            663139..666007
FT                   /gene="Pc16g02970"
FT                   /locus_tag="PCH_Pc16g02970"
FT                   /number=2
FT   mRNA            complement(<666767..>667450)
FT                   /gene="Pc16g02980"
FT                   /locus_tag="PCH_Pc16g02980"
FT   CDS_pept        complement(666767..667450)
FT                   /gene="Pc16g02980"
FT                   /locus_tag="PCH_Pc16g02980"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_65_scaffold_4.tfa_330wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02980"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92968"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L2"
FT                   /inference="protein motif:COGS:COG0500"
FT                   /inference="protein motif:COGS:COG2226"
FT                   /inference="protein motif:COGS:COG2230"
FT                   /protein_id="CAP92968.1"
FT                   /translation="MLAPAPIQAKASSSATELYLSQARASGSTEDCMALYEKWAASYDD
FT                   EVGDSAQEYVAPMLVAQAAIKYGLSNGATNSVILDAGCGTGLVGVALAMAQAKAIDGID
FT                   LSPAMLSIARKTGIYRDLTVADMNRPIDKTDGTYDLVSCVGTFTLGHVGPNPALRELVR
FT                   VAKHKGVVVSTILEQIWVPGGFKAEVEKLVAEGLVKVVTDELIDYVKGHGDKAVLLILE
FT                   KIDRD"
FT   exon            complement(666767..667450)
FT                   /gene="Pc16g02980"
FT                   /locus_tag="PCH_Pc16g02980"
FT                   /number=1
FT   mRNA            complement(join(<669863..670756,670809..670927,
FT                   670983..671226,671280..>671576))
FT                   /gene="Pc16g02990"
FT                   /locus_tag="PCH_Pc16g02990"
FT   CDS_pept        complement(join(669863..670756,670809..670927,
FT                   670983..671226,671280..671576))
FT                   /gene="Pc16g02990"
FT                   /locus_tag="PCH_Pc16g02990"
FT                   /note="Title: strong similarity to cytochrome P450 pisatin
FT                   demethylase PDAT9 - Nectria haematococca"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g02990"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92969"
FT                   /db_xref="GOA:B6H7L3"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L3"
FT                   /inference="similar to AA sequence:PIR:S45583"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /inference="protein motif:COGS:COG2124"
FT                   /protein_id="CAP92969.1"
FT                   /translation="MNTLLELTTKLALFVAILLTSRFLWNYLRSPLKSFPGPNLASFTN
FT                   IWRMQDVAKGRCDVTHNNLHRRYGSAVRMGPNVLSLSDPDLISVVYNTKNPWLKSDMYN
FT                   VNDVVVSGVRLKNLFSNQNESWHSTYIRPVKNLYSMSKVQDAESNIDITIKLLCEKLRA
FT                   RFVRPGKTCEMSDWISFFAWDTMSQVTFSKDLGILEAGSDYKGFLRRSNQTLDYFAAIC
FT                   QIPLLDYLFDKNPIMRIGPPTFLWANIFSLEQLHRRYQEGNHDGDFLSKFLELKQRNPE
FT                   LVNDNTVILWLLSNVLAGSDSTAGTMCATIYYVLRDPGVCQRLCDELRGANLSSPAQWK
FT                   EIKALKYLEAVMRESMRINPGVGLMLERIVPKGGLTLPDGRFVPEGTTVGMNPWVINRN
FT                   ETVFGAKTHEFIPERWLQNPGETEEAYQARFSKMKSTDFTFGAGSRACLGRYLSQLESF
FT                   KLIATLFNTFDVSLNCILRFRVNGILANWLHRWRSPVATMSGSSRIRGSLGRKAFLSTW
FT                   "
FT   exon            complement(669863..670756)
FT                   /gene="Pc16g02990"
FT                   /locus_tag="PCH_Pc16g02990"
FT                   /number=1
FT   mat_peptide     complement(join(669866..670756,670809..670927,
FT                   670983..671226,671280..671510))
FT                   /gene="Pc16g02990"
FT                   /locus_tag="PCH_Pc16g02990"
FT   intron          complement(670757..670808)
FT                   /gene="Pc16g02990"
FT                   /locus_tag="PCH_Pc16g02990"
FT                   /number=1
FT   exon            complement(670809..670927)
FT                   /gene="Pc16g02990"
FT                   /locus_tag="PCH_Pc16g02990"
FT                   /number=2
FT   intron          complement(670928..670982)
FT                   /gene="Pc16g02990"
FT                   /locus_tag="PCH_Pc16g02990"
FT                   /number=2
FT   exon            complement(670983..671226)
FT                   /gene="Pc16g02990"
FT                   /locus_tag="PCH_Pc16g02990"
FT                   /number=3
FT   intron          complement(671227..671279)
FT                   /gene="Pc16g02990"
FT                   /locus_tag="PCH_Pc16g02990"
FT                   /number=3
FT   exon            complement(671280..671576)
FT                   /gene="Pc16g02990"
FT                   /locus_tag="PCH_Pc16g02990"
FT                   /number=4
FT   sig_peptide     complement(671511..671576)
FT                   /gene="Pc16g02990"
FT                   /locus_tag="PCH_Pc16g02990"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<672254..672470,672527..672545,672615..>673344)
FT                   /gene="Pc16g03000"
FT                   /locus_tag="PCH_Pc16g03000"
FT   CDS_pept        join(672254..672470,672527..672545,672615..673344)
FT                   /gene="Pc16g03000"
FT                   /locus_tag="PCH_Pc16g03000"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig5_part_ii.tfa_2490wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03000"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92970"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L4"
FT                   /protein_id="CAP92970.1"
FT                   /translation="MFLLLYDLVACLYNVVSTLKVPKACGCFGSLLSCLSTALLFHSHL
FT                   SEIPLPRLHYHIPTSPFFVHFLIHASHAASGTAPGYRSNQARDTHHTTRQNSQPPTIAF
FT                   VNSESRQVVLERGRILESVEGNDLKWLWVQPRRDTLHLIGRKCYTLFRGLMMTPRVQLS
FT                   NSYCMRCILGSATDAVVAYSMPVLQLAEAIDSMKRIKKIGQNAIDVHRKELITEILAIV
FT                   LMVIPFAGKALGPLICSATPMARIALLVGEMGNGGLVVAALSAILGLIAGIDSGTGKLS
FT                   KGEALVEASNARGLLKASDLAKSPEGFRNFDQPLGCSQIS"
FT   sig_peptide     672254..672307
FT                   /gene="Pc16g03000"
FT                   /locus_tag="PCH_Pc16g03000"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            672254..672470
FT                   /gene="Pc16g03000"
FT                   /locus_tag="PCH_Pc16g03000"
FT                   /number=1
FT   mat_peptide     join(672308..672470,672527..672545,672615..673341)
FT                   /gene="Pc16g03000"
FT                   /locus_tag="PCH_Pc16g03000"
FT   intron          672471..672526
FT                   /gene="Pc16g03000"
FT                   /locus_tag="PCH_Pc16g03000"
FT                   /number=1
FT   exon            672527..672545
FT                   /gene="Pc16g03000"
FT                   /locus_tag="PCH_Pc16g03000"
FT                   /number=2
FT   intron          672546..672614
FT                   /gene="Pc16g03000"
FT                   /locus_tag="PCH_Pc16g03000"
FT                   /number=2
FT   exon            672615..673344
FT                   /gene="Pc16g03000"
FT                   /locus_tag="PCH_Pc16g03000"
FT                   /number=3
FT   mRNA            complement(join(<673857..674789,674845..675327,
FT                   675401..>675610))
FT                   /gene="Pc16g03010"
FT                   /locus_tag="PCH_Pc16g03010"
FT   CDS_pept        complement(join(673857..674789,674845..675327,
FT                   675401..675610))
FT                   /gene="Pc16g03010"
FT                   /locus_tag="PCH_Pc16g03010"
FT                   /note="Title: strong similarity to hypothetical
FT                   6-hydroxy-D-nicotine oxidase related protein 13E11.250
FT                   -Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92971"
FT                   /db_xref="GOA:B6H7L5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L5"
FT                   /inference="similar to AA sequence:PIR:T48777"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /inference="protein motif:COGS:COG0277"
FT                   /protein_id="CAP92971.1"
FT                   /translation="MHISSLIGGLSAIGGLTLAQAAVDSPVIEADDFSITGALEDLGVD
FT                   VSQIPALKSFAAIETRSTDKACAVACASLSFLFGSKVSAQETTGYNNFTSSFWSVQQEE
FT                   VQPHCVFRPTKNTEVSTAVLLSRLTGCEFAARSGGHAAFTGASSAPGGISIWFKDMSAV
FT                   TLNADKTVASIEPGNNWLTTYAALEPYGLAVIGGRASSIGVGGFVLGGGISYHSNLYGW
FT                   SCDNVESFEVVTASGLIVTASATSYPDLYWALRGGGNNFGLVTKYNMFTIPSPEMYGGA
FT                   RTFLETEFPQVINAWINVINNATVDGNAQQYVAFLQTQGMNLASAELTYVKNDPNPEIF
FT                   KQYRNISAISDNSSAKSLVEYVKYLETENPYGLREVYWPISAALDEKFANWVVNLFYSM
FT                   IPEVGNVAGAQPVLIYQGITEPMLNNMKNHSGNPLGLAGSSGPVHLLHISCWWKNESDD
FT                   KTVYAFVNKFMEKVTTEAKNVGVFNEYVYMNYASMFQDAVAGYGAANKAQLKKIAKKYD
FT                   PREVYQNLQPGYFKLDGPPVTPSF"
FT   exon            complement(673857..674789)
FT                   /gene="Pc16g03010"
FT                   /locus_tag="PCH_Pc16g03010"
FT                   /number=1
FT   mat_peptide     complement(join(673860..674789,674845..675327,
FT                   675401..675547))
FT                   /gene="Pc16g03010"
FT                   /locus_tag="PCH_Pc16g03010"
FT   intron          complement(674790..674844)
FT                   /gene="Pc16g03010"
FT                   /locus_tag="PCH_Pc16g03010"
FT                   /number=1
FT   exon            complement(674845..675327)
FT                   /gene="Pc16g03010"
FT                   /locus_tag="PCH_Pc16g03010"
FT                   /number=2
FT   intron          complement(675328..675400)
FT                   /gene="Pc16g03010"
FT                   /locus_tag="PCH_Pc16g03010"
FT                   /number=2
FT   exon            complement(675401..675610)
FT                   /gene="Pc16g03010"
FT                   /locus_tag="PCH_Pc16g03010"
FT                   /number=3
FT   sig_peptide     complement(675548..675610)
FT                   /gene="Pc16g03010"
FT                   /locus_tag="PCH_Pc16g03010"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<676784..677204,677336..677422,677476..677673,
FT                   677741..>678090)
FT                   /gene="Pc16g03020"
FT                   /locus_tag="PCH_Pc16g03020"
FT   CDS_pept        join(676784..677204,677336..677422,677476..677673,
FT                   677741..678090)
FT                   /gene="Pc16g03020"
FT                   /locus_tag="PCH_Pc16g03020"
FT                   /note="Title: weak similarity to integral membrane protein
FT                   PTH11 - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92972"
FT                   /db_xref="GOA:B6H7L6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L6"
FT                   /inference="similar to AA sequence:TREMBL:AF119670.1"
FT                   /protein_id="CAP92972.1"
FT                   /translation="MGEAIAGTFGTGTIKGTGISLIVLTSLVVGTRFAGLIRSFKDLKA
FT                   EDYLLIVAYIFFLELSILYIYIAPAIFRIAAVSAGTIPPYATISEYGLRLQTVFFVTTS
FT                   SLWLCLWMVKFSLMAMYKRLLVGKKYIIAWWVIMGFCQCDTPRDHRAAVISLYYAYGVD
FT                   IATDLAIMILPIRLIWNLQMKTRQKLSIGGLFCFGWICIIVSTIRVVQLGETENGVPAP
FT                   SWLALWGTIEALIAVMIGCCPGLYRVLKNAISPSKTSYPYDSYNLRGRGGSGMPSNRSG
FT                   AFGRTDIPLNSFRGKEESYQSASAYRSTSPSSSQEKLADLDDRRNIMVNYGVAVTVENR
FT                   PRDYGQATRFV"
FT   exon            676784..677204
FT                   /gene="Pc16g03020"
FT                   /locus_tag="PCH_Pc16g03020"
FT                   /number=1
FT   intron          677205..677335
FT                   /gene="Pc16g03020"
FT                   /locus_tag="PCH_Pc16g03020"
FT                   /number=1
FT   exon            677336..677422
FT                   /gene="Pc16g03020"
FT                   /locus_tag="PCH_Pc16g03020"
FT                   /number=2
FT   intron          677423..677475
FT                   /gene="Pc16g03020"
FT                   /locus_tag="PCH_Pc16g03020"
FT                   /number=2
FT   exon            677476..677673
FT                   /gene="Pc16g03020"
FT                   /locus_tag="PCH_Pc16g03020"
FT                   /number=3
FT   intron          677674..677740
FT                   /gene="Pc16g03020"
FT                   /locus_tag="PCH_Pc16g03020"
FT                   /number=3
FT   exon            677741..678090
FT                   /gene="Pc16g03020"
FT                   /locus_tag="PCH_Pc16g03020"
FT                   /number=4
FT   mRNA            <678871..>680763
FT                   /gene="Pc16g03030"
FT                   /locus_tag="PCH_Pc16g03030"
FT   CDS_pept        678871..680763
FT                   /gene="Pc16g03030"
FT                   /locus_tag="PCH_Pc16g03030"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1492_0.tfa_6350cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92973"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L7"
FT                   /protein_id="CAP92973.1"
FT                   /translation="MRLSRNLFALVNILPPLTAHASPSIQETLIPPPSPEPIVVTELPL
FT                   PPVTPNSTEGSCTPELNPRRTGCLLRDSQIRSGDFLPDDNHVLVSLDFSGAPAAPDPAG
FT                   IYNGLQLIIVKADGETFPNGDPWKCITCGVPEGNKVGSTELAPYPQAFRDGSRVLVGSN
FT                   IVDCGDEQLASPGCTPDKVHIYPIRWNTKLDGSGPGGDIRELRLHPDNVHLGFNSFTFE
FT                   NGQLGQFAYFSRLQFNSDPSTGEPRTARYDLVNVTRLFSLQNPASISAHGNQLFINDSA
FT                   ISVGELRGFSGRGKEVTYVGSSVESCNIDVFAADLTTGRVRRLTSDPEYVDPVDISPDD
FT                   KWHVVLDTRGSGRQMFLAGMRGVPPIIDMAVITAVSSVRNNGARRFFQPWLLDHDGDRG
FT                   DYNGQQVNAAGDGSPGSVNDPNWNAGADPKWSRDGTRIAYYQKLVIPPACGGSNPLPCQ
FT                   NSTEPGGRIARLMLAHLTSREPLHLEPVAPVSDEVPWGTPYVPESPIPALSYPGIGNYT
FT                   LQGKVSGSARVTIADATGSTPTTIKVAYENYSDDGLHYIHGWEKVTSKMLSLTLNKVDW
FT                   YSNLTSTGQQHATKKTSPGGFHLEIDTMKNIFNSNGTLTTTIDGKSWRQPLNGA"
FT   sig_peptide     678871..678933
FT                   /gene="Pc16g03030"
FT                   /locus_tag="PCH_Pc16g03030"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            678871..680763
FT                   /gene="Pc16g03030"
FT                   /locus_tag="PCH_Pc16g03030"
FT                   /number=1
FT   mat_peptide     678934..680760
FT                   /gene="Pc16g03030"
FT                   /locus_tag="PCH_Pc16g03030"
FT   mRNA            complement(join(<682631..682833,682910..>683213))
FT                   /gene="Pc16g03040"
FT                   /locus_tag="PCH_Pc16g03040"
FT   CDS_pept        complement(join(682631..682833,682910..683213))
FT                   /gene="Pc16g03040"
FT                   /locus_tag="PCH_Pc16g03040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92974"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L8"
FT                   /protein_id="CAP92974.1"
FT                   /translation="MQSWISFLPYLLFQFSTCISGVQAKRGGGGGDSDDSYSDDNSGGS
FT                   SSTDSCATSKHPTIWKWDLIPSNADNYTSGDISGEDTSYDGSFFKGEASLHYTITEDKY
FT                   CRCRSNLAADLNTSDLALECCVCWRLQVTTMANQASRENPHKIPVLDSVYSGLRQNSTF
FT                   ILPTV"
FT   exon            complement(682631..682833)
FT                   /gene="Pc16g03040"
FT                   /locus_tag="PCH_Pc16g03040"
FT                   /number=1
FT   mat_peptide     complement(join(682634..682833,682910..683141))
FT                   /gene="Pc16g03040"
FT                   /locus_tag="PCH_Pc16g03040"
FT   intron          complement(682834..682909)
FT                   /gene="Pc16g03040"
FT                   /locus_tag="PCH_Pc16g03040"
FT                   /number=1
FT   exon            complement(682910..683213)
FT                   /gene="Pc16g03040"
FT                   /locus_tag="PCH_Pc16g03040"
FT                   /number=2
FT   sig_peptide     complement(683142..683213)
FT                   /gene="Pc16g03040"
FT                   /locus_tag="PCH_Pc16g03040"
FT                   /inference="protein motif:SignalP:2.0"
FT   rRNA            complement(683506..683624)
FT                   /gene="5S rRNA"
FT                   /locus_tag="PCH_Pc16e00070"
FT                   /product="5S ribosomal RNA"
FT   rRNA            complement(683806..683924)
FT                   /gene="5S rRNA"
FT                   /locus_tag="PCH_Pc16e00080"
FT                   /product="5S ribosomal RNA"
FT   mRNA            complement(<684107..>684541)
FT                   /gene="Pc16g03050"
FT                   /locus_tag="PCH_Pc16g03050"
FT   CDS_pept        complement(684107..684541)
FT                   /pseudo
FT                   /gene="Pc16g03050"
FT                   /locus_tag="PCH_Pc16g03050"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g11310 - Aspergillus niger [putative pseudogene]"
FT   exon            complement(684107..684541)
FT                   /gene="Pc16g03050"
FT                   /locus_tag="PCH_Pc16g03050"
FT                   /number=1
FT   mRNA            join(<685322..685426,685481..686066,686122..>686372)
FT                   /gene="Pc16g03060"
FT                   /locus_tag="PCH_Pc16g03060"
FT   CDS_pept        join(685322..685426,685481..686066,686122..686372)
FT                   /gene="Pc16g03060"
FT                   /locus_tag="PCH_Pc16g03060"
FT                   /note="unknown EC_number=1.3.1.45"
FT                   /note="Title: weak similarity to 2-hydroxyisoflavone
FT                   reductase - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92976"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L9"
FT                   /inference="similar to AA sequence:PIR:S57613"
FT                   /inference="protein motif:PFAM:PF02716"
FT                   /inference="protein motif:COGS:COG1088"
FT                   /inference="protein motif:COGS:COG0451"
FT                   /protein_id="CAP92976.1"
FT                   /translation="MVKVAVAGGTGGVGRTIVEELLRQDKHNVIILSRKSTPLPGLPSV
FT                   PVSAIDYDDIASVATFLREHSVDVVISTLSLFTEEVGKAQMNLIQAAIESSAVNRFIPS
FT                   EFAFNYSHPGLLDFHAAAQMRIDAADLLRSSHVDFTRFVFGWMLDTWNPVRAKSHMPPM
FT                   SWVLGFENRRARIPGDGKAPLTFLHSFDLAKFVAALLDEENRWPETSAFAGDRITFNEV
FT                   VELAESIMGQKWEVTYEPVSRLEKKDVVVFEQPEGSYDFGEGLRDVTAEFGLIVVKDMM
FT                   DASVDGLRNMDFPNVRPITVEAWMHQIWGKKA"
FT   exon            685322..685426
FT                   /gene="Pc16g03060"
FT                   /locus_tag="PCH_Pc16g03060"
FT                   /number=1
FT   intron          685427..685480
FT                   /gene="Pc16g03060"
FT                   /locus_tag="PCH_Pc16g03060"
FT                   /number=1
FT   exon            685481..686066
FT                   /gene="Pc16g03060"
FT                   /locus_tag="PCH_Pc16g03060"
FT                   /number=2
FT   intron          686067..686121
FT                   /gene="Pc16g03060"
FT                   /locus_tag="PCH_Pc16g03060"
FT                   /number=2
FT   exon            686122..686372
FT                   /gene="Pc16g03060"
FT                   /locus_tag="PCH_Pc16g03060"
FT                   /number=3
FT   mRNA            join(<687451..687653,687717..687923,687994..688098,
FT                   688187..688275,688305..688341,688371..>689454)
FT                   /gene="Pc16g03070"
FT                   /locus_tag="PCH_Pc16g03070"
FT   CDS_pept        join(687451..687653,687717..687923,687994..688098,
FT                   688187..688275,688305..688341,688371..689454)
FT                   /gene="Pc16g03070"
FT                   /locus_tag="PCH_Pc16g03070"
FT                   /note="unknown EC_number=3.1.1.-"
FT                   /note="Title: strong similarity to p-nitrobenzyl esterase
FT                   pnbA - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92977"
FT                   /db_xref="GOA:B6H7M0"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7M0"
FT                   /inference="similar to AA sequence:SWISSPROT:PNBA_BACSU"
FT                   /inference="protein motif:PFAM:PF00135"
FT                   /inference="protein motif:COGS:COG2272"
FT                   /inference="protein motif:COGS:COG0657"
FT                   /inference="protein motif:COGS:COG1506"
FT                   /protein_id="CAP92977.1"
FT                   /translation="MDDRELVSILHPGLGAVFKGVKTAEFLDQKSSSVAQFRGIKFARI
FT                   PTRFRRAILHENFPPIVDATNHGPICPQSIGQRKFEDLLNGASPESLAVAGQLESPVMD
FT                   EFECLNLVITAPVLKSTESVAEELFPVMIYIHGGGNFVGANSFWFNDGRHLVKKGMESN
FT                   LPTVIVALNYRLSALGWLSSQTLREYNAAFGDVGVGNYDDANKSTQAAMMFADKIHKHL
FT                   GIEWVYRNISGFGGDPNNITIFGESAGGFAVDNQIHSQLPCRFSQAILQSGVMSSHMSS
FT                   PLPLSDQDTLFDLVKARAHVNTVEELRDIPVDVLLQAFAKASSETGFSAVPTIDDEMFT
FT                   QSWAEHYSFANEDFRVIIGHTTYERSLFEILAHLHSEAKDNDQSFERICSSFLAHIEGM
FT                   EATELCEAYGYQDDIQPARLKQCLMKILEDIVFVTPINEATTRYIQKGLAVYRYIFDEP
FT                   NPFKGAFSGKSNHALDLPYLFGSASIFAGVENKDWEQDIQDSLQTKWLLFAHGIPPWPS
FT                   VSDGKFLVFGPHGTVNEHSSTELISKSLSISDDIFGSLELGYRAELSMLVWKHARLL"
FT   exon            687451..687653
FT                   /gene="Pc16g03070"
FT                   /locus_tag="PCH_Pc16g03070"
FT                   /number=1
FT   intron          687654..687716
FT                   /gene="Pc16g03070"
FT                   /locus_tag="PCH_Pc16g03070"
FT                   /number=1
FT   exon            687717..687923
FT                   /gene="Pc16g03070"
FT                   /locus_tag="PCH_Pc16g03070"
FT                   /number=2
FT   intron          687924..687993
FT                   /gene="Pc16g03070"
FT                   /locus_tag="PCH_Pc16g03070"
FT                   /number=2
FT   exon            687994..688098
FT                   /gene="Pc16g03070"
FT                   /locus_tag="PCH_Pc16g03070"
FT                   /number=3
FT   intron          688099..688186
FT                   /gene="Pc16g03070"
FT                   /locus_tag="PCH_Pc16g03070"
FT                   /number=3
FT   exon            688187..688275
FT                   /gene="Pc16g03070"
FT                   /locus_tag="PCH_Pc16g03070"
FT                   /number=4
FT   intron          688276..688304
FT                   /gene="Pc16g03070"
FT                   /locus_tag="PCH_Pc16g03070"
FT                   /number=4
FT   exon            688305..688341
FT                   /gene="Pc16g03070"
FT                   /locus_tag="PCH_Pc16g03070"
FT                   /number=5
FT   intron          688342..688370
FT                   /gene="Pc16g03070"
FT                   /locus_tag="PCH_Pc16g03070"
FT                   /number=5
FT   exon            688371..689454
FT                   /gene="Pc16g03070"
FT                   /locus_tag="PCH_Pc16g03070"
FT                   /number=6
FT   mRNA            complement(join(<691141..691331,691391..691556,
FT                   691609..691910,691966..692300,692440..>692618))
FT                   /gene="Pc16g03080"
FT                   /locus_tag="PCH_Pc16g03080"
FT   CDS_pept        complement(join(691141..691331,691391..691556,
FT                   691609..691910,691966..692300,692440..692618))
FT                   /gene="Pc16g03080"
FT                   /locus_tag="PCH_Pc16g03080"
FT                   /note="unknown EC_number=2.7.-.-"
FT                   /note="Title: strong similarity to cdc2/CDC28-like kinase 2
FT                   Clk2 - Mus musculus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92978"
FT                   /db_xref="GOA:B6H8X0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X0"
FT                   /inference="similar to AA sequence:TREMBL:AF033564.1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP92978.1"
FT                   /translation="MLTSFLQSLPRLGRRWTPLNFTNPNFIQLSASQAIEEETIPGYIA
FT                   GRYYPTRIGEILKDRYRRYVTLKIFIKSTSMGQQLDDELKIYKRIEGAPQKHPGRKYVR
FT                   SLLDSFDISGPEDKHRCLVHPPLWESMLDFLFRNPVQRLPTPILAVTLHRLFLALDYLH
FT                   TECKIIHTDIKADNIMFGIADDSVLSDFENTELQHPCPRKELDGRTIYTSRELRMPKNL
FT                   GAPILCDFGSAVIGDKEHSEDIQPDIYRAPEVILQAPWSYSVDIWNVGCVIWNLFEGGS
FT                   LFSGQDPEFQTYRSRAHLAEMIRLLGPPSPSFLARGNLTQRFFSQEGDLYAGELVGEHI
FT                   PLEQRETSLEGEEKEMFLRLMRKMLQWEPEKRSSAMELEQDEWVQAELHK"
FT   exon            complement(691141..691331)
FT                   /gene="Pc16g03080"
FT                   /locus_tag="PCH_Pc16g03080"
FT                   /number=1
FT   intron          complement(691332..691390)
FT                   /gene="Pc16g03080"
FT                   /locus_tag="PCH_Pc16g03080"
FT                   /number=1
FT   exon            complement(691391..691556)
FT                   /gene="Pc16g03080"
FT                   /locus_tag="PCH_Pc16g03080"
FT                   /number=2
FT   intron          complement(691557..691608)
FT                   /gene="Pc16g03080"
FT                   /locus_tag="PCH_Pc16g03080"
FT                   /number=2
FT   exon            complement(691609..691910)
FT                   /gene="Pc16g03080"
FT                   /locus_tag="PCH_Pc16g03080"
FT                   /number=3
FT   intron          complement(691911..691965)
FT                   /gene="Pc16g03080"
FT                   /locus_tag="PCH_Pc16g03080"
FT                   /number=3
FT   exon            complement(691966..692300)
FT                   /gene="Pc16g03080"
FT                   /locus_tag="PCH_Pc16g03080"
FT                   /number=4
FT   intron          complement(692301..692439)
FT                   /gene="Pc16g03080"
FT                   /locus_tag="PCH_Pc16g03080"
FT                   /number=4
FT   exon            complement(692440..692618)
FT                   /gene="Pc16g03080"
FT                   /locus_tag="PCH_Pc16g03080"
FT                   /number=5
FT   mRNA            join(<696176..696248,696299..698309,698371..>698773)
FT                   /gene="Pc16g03090"
FT                   /locus_tag="PCH_Pc16g03090"
FT   CDS_pept        join(696176..696248,696299..698309,698371..698773)
FT                   /gene="Pc16g03090"
FT                   /locus_tag="PCH_Pc16g03090"
FT                   /note="unknown EC_number=3.2.1.21"
FT                   /note="Title: strong similarity to beta-glucosidase
FT                   precursor BGLUC - Kluyveromyces marxianus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92979"
FT                   /db_xref="GOA:B6H8X1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X1"
FT                   /inference="similar to AA sequence:PIR:GLVK"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /inference="protein motif:COGS:COG1472"
FT                   /protein_id="CAP92979.1"
FT                   /translation="MPQTFDVEHVLANISEQDKIALLSGIDFWHTHPIPEFNVPSIRAT
FT                   DGPNGIRGTKFFAGIPAACLPCGTALGATWDRDLIYQAGELLGDECIAKGAHCWLGPTI
FT                   NMQRAPLGGRGFESFAEDPHLSGILAKSIILGCESKGVISTVKHFVGNDQEHERRAVDV
FT                   LVTQRALREIYLRPFQIVARDAKPGALMTSYNKINGKHVVEDERMLNLIREEWKWNPLV
FT                   MSDWYGTYTTIDSMNAGLDLEMPGVSRYRGKFIESAVQARLIKQSTVDARARKVLEFVK
FT                   QASQVQVSEVERGRDLPEDRALNRKLCANSIVLLKNEGILPLPREIKKIALIGSHMKCP
FT                   AISGGGSASLEPYYSVSLYDACREALPDAEVLYQVGAYAHKMLPVIDRLLSNAIIQFYN
FT                   EPMCKERHLISTEPVSTTAFQFMDYYAPGLNRALFWATLIGDFTPDTSGIWDFGLSVFG
FT                   TANLYIDDELVIDNTTSQTRGTAFFGKGTVEVLGSKELVAGTIYKVRIEFGSANTTTMK
FT                   TVGMVNFGGGAASLGACLRMNREEMIENAVEAATEADYTILCTGLNKDWESEGFDRMHM
FT                   DLPPGVDELISKVLKAAADKTVIVNQSGTPVTMPWADQARCIVQGWYGGNETGHGIADV
FT                   LFGEVNPCAKLPLSWPVDVKHNPAYLNYASVGGRVLYGEDIYGGYRFYEKTGREVLFPF
FT                   GHGLSYTTFNVSPNVTVAPEIFNMDVPTVATVQIKNTGKLAGAQILQLYISAPESSTPR
FT                   PSKELHGFEKVFVQPGEEKTVNIQLDRYATSFWDEIEDMWKSEQGTYEVLIGTSSQEVV
FT                   ARGKFQVDRTSYWRGL"
FT   exon            696176..696248
FT                   /gene="Pc16g03090"
FT                   /locus_tag="PCH_Pc16g03090"
FT                   /number=1
FT   intron          696249..696298
FT                   /gene="Pc16g03090"
FT                   /locus_tag="PCH_Pc16g03090"
FT                   /number=1
FT   exon            696299..698309
FT                   /gene="Pc16g03090"
FT                   /locus_tag="PCH_Pc16g03090"
FT                   /number=2
FT   intron          698310..698370
FT                   /gene="Pc16g03090"
FT                   /locus_tag="PCH_Pc16g03090"
FT                   /number=2
FT   exon            698371..698773
FT                   /gene="Pc16g03090"
FT                   /locus_tag="PCH_Pc16g03090"
FT                   /number=3
FT   mRNA            join(<698972..699098,699391..699486,699543..699933,
FT                   699988..700115,700162..700258,700305..>701064)
FT                   /gene="Pc16g03100"
FT                   /locus_tag="PCH_Pc16g03100"
FT   CDS_pept        join(698972..699098,699391..699486,699543..699933,
FT                   699988..700115,700162..700258,700305..701064)
FT                   /gene="Pc16g03100"
FT                   /locus_tag="PCH_Pc16g03100"
FT                   /note="Title: weak similarity to positive regulator qa-1F
FT                   -Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03100"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92980"
FT                   /db_xref="GOA:B6H8X2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X2"
FT                   /inference="similar to AA sequence:PIR:F31277"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /protein_id="CAP92980.1"
FT                   /translation="MDASSTARPRRNTRVLTACDACRLSKTRCDSARPVCAKCVQRDMI
FT                   LSWPIFPKEKSVSTFPMAAYSEKPDRFQTALHSLDPQRLLELREIFMTKIWTKNPIVDP
FT                   DQLDFYIARVLENGVDWSASSCLVLLIFALAAIWGNYPDDETREVSYNEPSFSPPVTYL
FT                   TISVPEHRMKESLTFLSMARKRISTAYLDDTLLGVQCLCLFGIWYQYNIEPIPGWKMFR
FT                   TASMLWQTYRLKHREGKTVRSAQEESLEQRLYWTCLKSEWYSIHHTPQILTQLADIQYL
FT                   SDFPYSLPSFPTRQPSNDSAGWVFSNPSSTDLEAASSYYYLAEIFLRRLLNRARNAVRV
FT                   LSPDIDPPTINTLAETLTQLEGQLQQWVDCLPHTLRFNMPLESAPGPKEGELMKLSRER
FT                   YVEVRELLCRAYLYLCIHVPLDAGMAALYGVKASEALLLAVYRIQTEVPFFRHPGSWGA
FT                   CRVRFNHALCLIAGFRAKLTQRPSAEYVTIPPDWADCVRVVIERLKIWGQEGGGIKELS
FT                   VLLEWLMHGNLELSN"
FT   exon            698972..699098
FT                   /gene="Pc16g03100"
FT                   /locus_tag="PCH_Pc16g03100"
FT                   /number=1
FT   intron          699099..699390
FT                   /gene="Pc16g03100"
FT                   /locus_tag="PCH_Pc16g03100"
FT                   /number=1
FT   exon            699391..699486
FT                   /gene="Pc16g03100"
FT                   /locus_tag="PCH_Pc16g03100"
FT                   /number=2
FT   intron          699487..699542
FT                   /gene="Pc16g03100"
FT                   /locus_tag="PCH_Pc16g03100"
FT                   /number=2
FT   exon            699543..699933
FT                   /gene="Pc16g03100"
FT                   /locus_tag="PCH_Pc16g03100"
FT                   /number=3
FT   intron          699934..699987
FT                   /gene="Pc16g03100"
FT                   /locus_tag="PCH_Pc16g03100"
FT                   /number=3
FT   exon            699988..700115
FT                   /gene="Pc16g03100"
FT                   /locus_tag="PCH_Pc16g03100"
FT                   /number=4
FT   intron          700116..700161
FT                   /gene="Pc16g03100"
FT                   /locus_tag="PCH_Pc16g03100"
FT                   /number=4
FT   exon            700162..700258
FT                   /gene="Pc16g03100"
FT                   /locus_tag="PCH_Pc16g03100"
FT                   /number=5
FT   intron          700259..700304
FT                   /gene="Pc16g03100"
FT                   /locus_tag="PCH_Pc16g03100"
FT                   /number=5
FT   exon            700305..701064
FT                   /gene="Pc16g03100"
FT                   /locus_tag="PCH_Pc16g03100"
FT                   /number=6
FT   mRNA            join(<701821..702031,702164..702304,702354..702615,
FT                   702667..702936,703001..703308,703359..703589,
FT                   703640..>703764)
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT   CDS_pept        join(701821..702031,702164..702304,702354..702615,
FT                   702667..702936,703001..703308,703359..703589,
FT                   703640..703764)
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /note="Title: strong similarity to high affinity glucose
FT                   transporter HGT1 - Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92981"
FT                   /db_xref="GOA:B6H8X3"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X3"
FT                   /inference="similar to AA sequence:SWISSPROT:HGT1_KLULA"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP92981.1"
FT                   /translation="MVIVGKQREENLAEPVLANLLADDRTPWYKKPNLRRLYFILFPAC
FT                   MGIEITSGFDSQIINTVQIVYTWNKCAAYSLGAILSLPFVPYVNQLVGRRWTIMFGSGV
FT                   SLVGALIQGFSNGVGMYIVARIILGFGIPFCIVAGSSLLGELGYPKERPILTSLFNSSY
FT                   FIGQIIAAAVGLGTVTIASDWAWRIPSLLQIAPAMVQIATVMFLPESPRYLVSKDRYDD
FT                   AFDILTKYHAEGDRSSTIVKAELAQIERTIKLELEESKQSWWDMFRTAGMRRRLFISAF
FT                   LGLFTQWSGNTLISYYLSDLLNMVGITDGVIKSKINIGIACWGLICGTALALTAPRFKR
FT                   RPMYLTCASALLCVYIAWTISMERFLATKAQSAAIATIFFIFAYSPAYNLGYNALTYTY
FT                   LVELFPYMGRSRGLSWFQFYGRGANFFATYVNPIGLARIAWKWLLVYCCWLLFELVFIY
FT                   FFFPETAGRTLEELSFLFEDKEKANEVAAAVHKQLDEDDEKKTVTAHVEVQDTKNAV"
FT   exon            701821..702031
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /number=1
FT   intron          702032..702163
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /number=1
FT   exon            702164..702304
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /number=2
FT   intron          702305..702353
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /number=2
FT   exon            702354..702615
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /number=3
FT   intron          702616..702666
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /number=3
FT   exon            702667..702936
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /number=4
FT   intron          702937..703000
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /number=4
FT   exon            703001..703308
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /number=5
FT   intron          703309..703358
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /number=5
FT   exon            703359..703589
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /number=6
FT   intron          703590..703639
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /number=6
FT   exon            703640..703764
FT                   /gene="Pc16g03110"
FT                   /locus_tag="PCH_Pc16g03110"
FT                   /number=7
FT   mRNA            complement(<704441..>705280)
FT                   /gene="Pc16g03120"
FT                   /locus_tag="PCH_Pc16g03120"
FT   CDS_pept        complement(704441..705280)
FT                   /gene="Pc16g03120"
FT                   /locus_tag="PCH_Pc16g03120"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An07g02450 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92982"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X4"
FT                   /protein_id="CAP92982.1"
FT                   /translation="MPVATLHLLTLAKSTDAQSFLQQLRQSPSTRVIVASRPRHVVIHP
FT                   NILDNDPLASNPWDLLVLLQITQPNAQDPIPSALRGLITNEYIITTGVPSKLLSDYQAR
FT                   DSRLKNDASSIPLTGSLDKVVRGGSKEASQNLEVSPQLLRFMDELWKTHKGPVTMLNLL
FT                   HFHHPDGKKNYYQYGQAFIPVAGKRGGSAKLVGNVVPPAPEKRDSRGSRNRSQQDWWNE
FT                   ISIVHYPSIRHFCDMLAGEDYQAINERYRLSVSALDALLPFISIEFVEWCNDYLGTS"
FT   exon            complement(704441..705280)
FT                   /gene="Pc16g03120"
FT                   /locus_tag="PCH_Pc16g03120"
FT                   /number=1
FT   mat_peptide     complement(704444..705229)
FT                   /gene="Pc16g03120"
FT                   /locus_tag="PCH_Pc16g03120"
FT   sig_peptide     complement(705230..705280)
FT                   /gene="Pc16g03120"
FT                   /locus_tag="PCH_Pc16g03120"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(<705975..>706925)
FT                   /gene="Pc16g03130"
FT                   /locus_tag="PCH_Pc16g03130"
FT   CDS_pept        complement(705975..706925)
FT                   /gene="Pc16g03130"
FT                   /locus_tag="PCH_Pc16g03130"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1190_scaffold_2.tfa_540wg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92983"
FT                   /db_xref="GOA:B6H8X5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X5"
FT                   /protein_id="CAP92983.1"
FT                   /translation="MAGESGPVEVSRPIAMVIAGLFALACWNVLQILVSIINTFKRRRG
FT                   LYFWSMVIATLGILVHALSTFLRYFALAPNFPMCVLICISWYSMVTGQSVVLYSRLHLV
FT                   TNYDSYSRWVLGMIIFNFCVLHVPTTILFLGINLDVKSFIRPFNIYERVQLAGFAAQET
FT                   IISGLYIWETMTSLRPVLAMKGRRGQKVVINLLVVNTLAVLLDAALLATEYTNHFDVQT
FT                   TLKPVVYSIKLMLEFTVLNSLLLVIRTNPSAIEEVEQLHDDLHIDTGCSGKHFNNTAVF
FT                   IGDPAKSDQGDQGVQISPVRSDPSWISFDHQVKPA"
FT   exon            complement(705975..706925)
FT                   /gene="Pc16g03130"
FT                   /locus_tag="PCH_Pc16g03130"
FT                   /number=1
FT   mRNA            complement(join(<708377..709089,709150..>709432))
FT                   /gene="Pc16g03140"
FT                   /locus_tag="PCH_Pc16g03140"
FT   CDS_pept        complement(join(708377..709089,709150..709432))
FT                   /gene="Pc16g03140"
FT                   /locus_tag="PCH_Pc16g03140"
FT                   /note="unknown EC_number=1.1.1.1"
FT                   /note="Title: strong similarity to thermostable alcohol
FT                   dehydrogenase adhT - Bacillus stearothermophilus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92984"
FT                   /db_xref="GOA:B6H8X6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X6"
FT                   /inference="similar to AA sequence:PIR:S45605"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /inference="protein motif:COGS:COG1064"
FT                   /inference="protein motif:COGS:COG1063"
FT                   /protein_id="CAP92984.1"
FT                   /translation="MSVTFEVFRGSKEGKIVADKTTRTLQPNEVYIETTHSGLCGTDEH
FT                   YLSSGMALGHEGVGIVRQVGRDVTNVKVGARVGYGYTHYVCGNCDKCLTGWDQYCENKK
FT                   EYGSHDHDLGSFSGGTVWDAGCVVPIPDGYDSADAAPLMCAGATVWTCLTEYGVKPTDR
FT                   VAIMGIGGLGHLAIKLASAMGCHVVVLSSSETKREEAFGFGASEYHVFRKGEEMKDFKP
FT                   VNHLLLCGSANVDYPSLIPLMDVHGSIYPLTVDFSHSPVPLLFMNLKGIRIQGSLVASR
FT                   NSLRTLVKFAADKKITPTTMTFPLTKDGVESAMQTLRDGKMRYRGVLVRE"
FT   exon            complement(708377..709089)
FT                   /gene="Pc16g03140"
FT                   /locus_tag="PCH_Pc16g03140"
FT                   /number=1
FT   intron          complement(709090..709149)
FT                   /gene="Pc16g03140"
FT                   /locus_tag="PCH_Pc16g03140"
FT                   /number=1
FT   exon            complement(709150..709432)
FT                   /gene="Pc16g03140"
FT                   /locus_tag="PCH_Pc16g03140"
FT                   /number=2
FT   gap             709534..709633
FT                   /estimated_length=unknown
FT   mRNA            <711675..>713447
FT                   /gene="Pc16g03150"
FT                   /locus_tag="PCH_Pc16g03150"
FT   CDS_pept        711675..713447
FT                   /gene="Pc16g03150"
FT                   /locus_tag="PCH_Pc16g03150"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   PA1259 - Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92985"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="InterPro:IPR012047"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X7"
FT                   /inference="similar to AA sequence:PIR:A83489"
FT                   /inference="protein motif:PFAM:PF01989"
FT                   /inference="protein motif:PFAM:PF04412"
FT                   /inference="protein motif:COGS:COG1679"
FT                   /inference="protein motif:COGS:COG1786"
FT                   /protein_id="CAP92985.1"
FT                   /translation="MGPYVASVFEGTTHVRGKASGTLIASGLELSFWGGVNSQTGEVID
FT                   RHHDLSGHYLQDTVLAIPGGRGSCSGSGVMLELLLNNKGPKAILFERQDDILTLGVMVA
FT                   EEIFGKAIPVVTMKPNDFRAILGMRGKIIYIDSDRVSDAPFHDTHPDHTQEPTKNYFVD
FT                   GMQMSDFDKELLQGLHGEASCTAIRIILRMASLLGATELMNVTQVHVDCCLYTGPGSLL
FT                   FAEKLRDWGGKVRVPTTLNSISIDQNRWREQGVGNSFGEAATKLANAYTDMGATPTFTC
FT                   APYQLKTAPRQGEQVAWAESNAVVYANSVLGARTMKYPDFLDICIALTGRAPRGGAHLD
FT                   INRLASLILRVGLPDVDTIDDSFYPILGYKVGSLAANRIPVIVGLQTLAPSRDDLKAFG
FT                   AAFATVSSAPMFHMLGVTPEATSLSAVVDEARQIPSVDIKMEHLIDDWQRLNSASEQQA
FT                   IDLVSLGNPHFSFKEMKRLAHLCEGRTKAQEVSVIVTCGRSSYGLASQAGVVELLENFG
FT                   VKFMTDTCWCMITEPIVPATTNAIMTNSAKYAHYGPGLTERKFFLGSLMQCVEAACRTS
FT                   YTKEMPQWLLNTDD"
FT   exon            711675..713447
FT                   /gene="Pc16g03150"
FT                   /locus_tag="PCH_Pc16g03150"
FT                   /number=1
FT   mRNA            join(<713967..714030,714084..714205,714279..714412,
FT                   714477..714599,714695..715309,715364..715450,
FT                   715510..>715579)
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT   CDS_pept        join(713967..714030,714084..714205,714279..714412,
FT                   714477..714599,714695..715309,715364..715450,
FT                   715510..715579)
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /note="unknown EC_number=2.6.1.1"
FT                   /note="Title: strong similarity to aspartate transaminase
FT                   -Sus scrofa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03160"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92986"
FT                   /db_xref="GOA:B6H8X8"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X8"
FT                   /inference="similar to AA sequence:PIR:XNPGDC"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /inference="protein motif:COGS:COG1448"
FT                   /inference="protein motif:COGS:COG0436"
FT                   /protein_id="CAP92986.1"
FT                   /translation="MGSIAATPFQSPFQDVPAGRTDGLAALVGQFREDTDPNRTDLLVG
FT                   VYKTEEGKAYVLPSVKEAKNRIFNDPDWHHEYRPSALGSQIYRDLSANLLFGRDHRLLR
FT                   EKSFNADARRKWRLPCGRSYVEKPLCAVEGEWEPRDFPSDRLLVLLPYFSSKTNRFDFE
FT                   SFSEAIKSLPAQSVILLQSGAQNPTGCDPTLDQWRELASIFSERGHLAFFDAAYPGFAS
FT                   GDIDTDLQAVRLFAEQEIPVVFVSTYGKSFGLYSERVGILSILVPNEEVGKNIETQLAL
FT                   LARAESGAPPDFGSRIIETVLSDEVLERQWRQEVRDMANQLKHRRDALREGLEKLGTPG
FT                   DWRHITDQNGMFSYVGLSVEQVTLLRNKYHVYLQDSGRISIAGLNNFNIDYTARSISAV
FT                   IKATA"
FT   exon            713967..714030
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /number=1
FT   intron          714031..714083
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /number=1
FT   exon            714084..714205
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /number=2
FT   intron          714206..714278
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /number=2
FT   exon            714279..714412
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /number=3
FT   intron          714413..714476
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /number=3
FT   exon            714477..714599
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /number=4
FT   intron          714600..714694
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /number=4
FT   exon            714695..715309
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /number=5
FT   intron          715310..715363
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /number=5
FT   exon            715364..715450
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /number=6
FT   intron          715451..715509
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /number=6
FT   exon            715510..715579
FT                   /gene="Pc16g03160"
FT                   /locus_tag="PCH_Pc16g03160"
FT                   /number=7
FT   tRNA            715890..715961
FT                   /gene="tRNA-Ala (AGC)"
FT                   /locus_tag="PCH_Pc16e00090"
FT                   /product="transfer RNA-Ala (AGC)"
FT                   /inference="profile:tRNAscan:1.4"
FT   mRNA            complement(<716612..>717457)
FT                   /gene="Pc16g03170"
FT                   /locus_tag="PCH_Pc16g03170"
FT   CDS_pept        complement(716612..717457)
FT                   /gene="Pc16g03170"
FT                   /locus_tag="PCH_Pc16g03170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03170"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92987"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X9"
FT                   /protein_id="CAP92987.1"
FT                   /translation="MAFSGFAEPTLLDLVPTLVGESNFTEWTTALKWTLDSRDIRYYQL
FT                   LTGVWSEPNAVDSAQPTSTEVEARAQWDTASRYLLPLLNATVHQTAKFYILDANNARTA
FT                   YANLHRAFAARSYAAGFANFLKFINTTYTSNQPQAFVNEWRAALGELQECNSTKLTPLL
FT                   IFYHFLHAVSANPAAHPWLDGFLNSKVSTDTTIEATFADFVVSEDRRLNALNQAHSFSL
FT                   NKGKHLPFFCEFHQRQAGHSSENCFRNPANHAPVNKPASAPAPATVPAQGPATQDPPAK
FT                   "
FT   exon            complement(716612..717457)
FT                   /gene="Pc16g03170"
FT                   /locus_tag="PCH_Pc16g03170"
FT                   /number=1
FT   mRNA            complement(join(<717866..717966,718056..718147,
FT                   718197..718256,718498..718667,718740..718859,
FT                   718937..719077,719171..>719221))
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT   CDS_pept        complement(join(717866..717966,718056..718147,
FT                   718197..718256,718498..718667,718740..718859,
FT                   718937..719077,719171..719221))
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92988"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y0"
FT                   /protein_id="CAP92988.1"
FT                   /translation="MAIYSAGYLTTSYVRILEDRHVKIETMPVLEQKTGPLYPEILAIM
FT                   RRYNLNVASAFQCGKMTMATPLANTRNLRMHPPPYPGGDSRPDPFWASQPGHHECCCSV
FT                   QRGQCAGGDKLGNLRVKNDTVICETTTAFALGDVVAPRSLVLMPRARRFFTHNRDKKPA
FT                   DIRSAKSISGSESGLLHKLPRSKHDMRVQPRQENIVLHFMSNRYGRVPGPQMPYAMFQI
FT                   WAIPYPYALYGDIDCRGRQSSY"
FT   exon            complement(717866..717966)
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /number=1
FT   intron          complement(717967..718055)
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /number=1
FT   exon            complement(718056..718147)
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /number=2
FT   intron          complement(718148..718196)
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /number=2
FT   exon            complement(718197..718256)
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /number=3
FT   intron          complement(718257..718497)
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /number=3
FT   exon            complement(718498..718667)
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /number=4
FT   intron          complement(718668..718739)
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /number=4
FT   exon            complement(718740..718859)
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /number=5
FT   intron          complement(718860..718936)
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /number=5
FT   exon            complement(718937..719077)
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /number=6
FT   intron          complement(719078..719170)
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /number=6
FT   exon            complement(719171..719221)
FT                   /gene="Pc16g03180"
FT                   /locus_tag="PCH_Pc16g03180"
FT                   /number=7
FT   mRNA            <719554..>720083
FT                   /gene="Pc16g03190"
FT                   /locus_tag="PCH_Pc16g03190"
FT   CDS_pept        719554..720083
FT                   /pseudo
FT                   /gene="Pc16g03190"
FT                   /locus_tag="PCH_Pc16g03190"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical protein An18g02770
FT                   - Aspergillus niger [putative pseudogene]"
FT   exon            719554..720083
FT                   /gene="Pc16g03190"
FT                   /locus_tag="PCH_Pc16g03190"
FT                   /number=1
FT   mRNA            complement(<720269..>720913)
FT                   /gene="Pc16g03200"
FT                   /locus_tag="PCH_Pc16g03200"
FT   CDS_pept        complement(720269..720913)
FT                   /pseudo
FT                   /gene="Pc16g03200"
FT                   /locus_tag="PCH_Pc16g03200"
FT                   /note="putative pseudogene"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An18g02770 - Aspergillus niger [putative pseudogene]"
FT   exon            complement(720269..720913)
FT                   /gene="Pc16g03200"
FT                   /locus_tag="PCH_Pc16g03200"
FT                   /number=1
FT   mRNA            join(<722187..722881,722934..723021,723090..>723917)
FT                   /gene="Pc16g03210"
FT                   /locus_tag="PCH_Pc16g03210"
FT   CDS_pept        join(722187..722881,722934..723021,723090..723917)
FT                   /gene="Pc16g03210"
FT                   /locus_tag="PCH_Pc16g03210"
FT                   /note="Title: similarity to hypothetical protein ncu09467.1
FT                   - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92991"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y1"
FT                   /inference="protein motif:COGS:COG0577"
FT                   /inference="protein motif:COGS:COG5022"
FT                   /inference="protein motif:COGS:COG5263"
FT                   /inference="protein motif:COGS:COG3264"
FT                   /inference="protein motif:COGS:COG0542"
FT                   /inference="protein motif:COGS:COG1196"
FT                   /protein_id="CAP92991.1"
FT                   /translation="MSSTTPETMTQRSPVSTKVEHEDFLMNKIIEQFRQLTFDPDFQKA
FT                   SATYSQVKDQQDQIQIRDEKLDKLQKHIKAQEENELVALSRFSAVNQALTTQKEKAEKE
FT                   NASLRKAVIEREKSLTEISRRIQELQGQIQTQLSERSQDERRMTSIIAQHKLDIGSLQR
FT                   RLTERDTSVDEMKATTANLESLLAKEQTKSVCLETEKKSLDENMQMARSRLEKFDAFIL
FT                   ESHQIDEQSIIDRFEGIWDYAINEIWTVLRQNLSDENLKNDRAWKKFRLDTAAAIRDGA
FT                   IQGQPAPLSASNSDAAKGMRLAVMLGILSREIDNEIFQPSYFPSETGNFRMSLNKLAKS
FT                   DNEKERFYRSVLLSIDRDGQETELQSRAKSVVQNVSHYLYELLSTAQYGELKERIKNVV
FT                   DRAIEVWRPIQNSTKRYETEFDPVDWAHDEDSLFQFPVGGEDTIGAEHQDDHLCVIFPG
FT                   LFSLERDDALILTSVVPLMSSQRLYVAANQELREEVRGQSSPTTKQPSRKRQNSVAKAQ
FT                   SQSNGIGFLGGHSSGGSSN"
FT   exon            722187..722881
FT                   /gene="Pc16g03210"
FT                   /locus_tag="PCH_Pc16g03210"
FT                   /number=1
FT   intron          722882..722933
FT                   /gene="Pc16g03210"
FT                   /locus_tag="PCH_Pc16g03210"
FT                   /number=1
FT   exon            722934..723021
FT                   /gene="Pc16g03210"
FT                   /locus_tag="PCH_Pc16g03210"
FT                   /number=2
FT   intron          723022..723089
FT                   /gene="Pc16g03210"
FT                   /locus_tag="PCH_Pc16g03210"
FT                   /number=2
FT   exon            723090..723917
FT                   /gene="Pc16g03210"
FT                   /locus_tag="PCH_Pc16g03210"
FT                   /number=3
FT   mRNA            complement(join(<727456..727818,727869..728104,
FT                   728160..728364,728439..728493,728545..728809,
FT                   728871..729024,729075..729192,729247..729383,
FT                   729424..729485,729553..729692,729748..729848,
FT                   729900..730085,730145..730247,730307..>730464))
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT   CDS_pept        complement(join(727456..727818,727869..728104,
FT                   728160..728364,728439..728493,728545..728809,
FT                   728871..729024,729075..729192,729247..729383,
FT                   729424..729485,729553..729692,729748..729848,
FT                   729900..730085,730145..730247,730307..730464))
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An09g03750 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92992"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y2"
FT                   /protein_id="CAP92992.1"
FT                   /translation="MGESKENLFNVWTYDKAEKTKITDRIVIGSIKDNATLADIREALI
FT                   KSKLDSKKARFPFCSKDGARIGDDAKWQLYKELTAGAPTKQSSKNGDDEQPTEGASKEG
FT                   DTPTLSITAHDVYFELSEEETNRKYGELGANVQKLLDTPLDLELGKDKVNLLRANIADF
FT                   ELEGYNHKQWKSKASSTDAISAGSLSDADWDIVSRTTHFLNGHRMVFLENAGGRRKFQR
FT                   IDKAPYPARSLDEMGMAGPNVTLPTDNPKTKILYKYPLYTVTDDSYVNVFETANALSNS
FT                   LASSNFSSMDVEASIGGGLFGYSAAAKGGFSKSDSDALATSEQSKQRTMNITYNFPRVV
FT                   LHLDNDTLELTKGCKEALDHIIKLREDPKVASWQERRAIIKFYQKFGHFFATNVELGGK
FT                   LFSKEEFSSSDVGKTAEKSNAMKISAALSFSSPVVQASASYSQESQSASGSASQTSNMS
FT                   KALSWEAVGGDTTLCNNPPEWSSTVKPFKNWRVINQKDVMAIAEFIGTFPDYGKIPEMF
FT                   KMISNESSQKTPCRFLLQADPGDDGKIKGIQYYGLRKDNGQTRNEGMFDTLRDWCLKDE
FT                   EVVNAFGVDGINKSTNNAKYKFKQDTYTDGWHEWVGIDPQSSRTVGGGCIFELDVETQL
FT                   GRPPRLTYNTPYKLFNKATKSYLAADVGWDAKIAGRTMGLLFYSRSDARIGTFVFQKAN
FT                   QPSATGTIDEGANVSLHLCDENNVPIGQVKRNINDQSTLGVERSDCELKFLFVTNNAYM
FT                   RYDESDN"
FT   exon            complement(727456..727818)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=1
FT   intron          complement(727819..727868)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=1
FT   exon            complement(727869..728104)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=2
FT   intron          complement(728105..728159)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=2
FT   exon            complement(728160..728364)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=3
FT   intron          complement(728365..728438)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=3
FT   exon            complement(728439..728493)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=4
FT   intron          complement(728494..728544)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=4
FT   exon            complement(728545..728809)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=5
FT   intron          complement(728810..728870)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=5
FT   exon            complement(728871..729024)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=6
FT   intron          complement(729025..729074)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=6
FT   exon            complement(729075..729192)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=7
FT   intron          complement(729193..729246)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=7
FT   exon            complement(729247..729383)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=8
FT   intron          complement(729384..729423)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=8
FT   exon            complement(729424..729485)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=9
FT   intron          complement(729486..729552)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=9
FT   exon            complement(729553..729692)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=10
FT   intron          complement(729693..729747)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=10
FT   exon            complement(729748..729848)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=11
FT   intron          complement(729849..729899)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=11
FT   exon            complement(729900..730085)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=12
FT   intron          complement(730086..730144)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=12
FT   exon            complement(730145..730247)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=13
FT   intron          complement(730248..730306)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=13
FT   exon            complement(730307..730464)
FT                   /gene="Pc16g03220"
FT                   /locus_tag="PCH_Pc16g03220"
FT                   /number=14
FT   mRNA            complement(<732278..>733354)
FT                   /gene="Pc16g03230"
FT                   /locus_tag="PCH_Pc16g03230"
FT   CDS_pept        complement(732278..733354)
FT                   /gene="Pc16g03230"
FT                   /locus_tag="PCH_Pc16g03230"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An14g04510 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92993"
FT                   /db_xref="GOA:B6H8Y3"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR039903"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y3"
FT                   /protein_id="CAP92993.1"
FT                   /translation="MAPLSEIIKLEPEREPWCAGYAPSQGRRCHARTNARGRSSAMMLL
FT                   NDGSKDLRVGRNIDTLLEDLAPHVLCIRFHKSQASDLVRRWKRQVRTYLDSQVVSTPYT
FT                   RPVRTSSQRIFEPAEANMEERIAILHQELRDAEEEVRRLKLAQSGLPVNTNPRHYEGRN
FT                   MSAVVNSSSTGSTSSRNPPVNCLNETLRGDLTESSTNRSAIAVPRPVQAQASRQTSAAS
FT                   ISSTRSLNTATMPRIFSSPGNTASQGETFQPNRREIEGECGICLNDLDGPQDEDLDAGE
FT                   GSENSGGYDHGDNDQDKDDEEDNYDGYDDDGDDDEPLNELVWCKARCGVNFHKRCIDQW
FT                   LETDQAPTCPACRSNWKH"
FT   exon            complement(732278..733354)
FT                   /gene="Pc16g03230"
FT                   /locus_tag="PCH_Pc16g03230"
FT                   /number=1
FT   mRNA            join(<737147..737190,737258..737410,737470..>737545)
FT                   /gene="Pc16g03240"
FT                   /locus_tag="PCH_Pc16g03240"
FT   CDS_pept        join(737147..737190,737258..737410,737470..737545)
FT                   /gene="Pc16g03240"
FT                   /locus_tag="PCH_Pc16g03240"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig_1_158_scaffold_13.tfa_510wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92994"
FT                   /db_xref="InterPro:IPR018824"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y4"
FT                   /protein_id="CAP92994.1"
FT                   /translation="MSTEDRLNQMRGYKATLSNPNVSEEAKQNAQAMLNELGGDQPREE
FT                   LYQARGDQNKDPMRVSAGLKAAQHNPGVTEGGKQEAAEKMEGPGD"
FT   exon            737147..737190
FT                   /gene="Pc16g03240"
FT                   /locus_tag="PCH_Pc16g03240"
FT                   /number=1
FT   intron          737191..737257
FT                   /gene="Pc16g03240"
FT                   /locus_tag="PCH_Pc16g03240"
FT                   /number=1
FT   exon            737258..737410
FT                   /gene="Pc16g03240"
FT                   /locus_tag="PCH_Pc16g03240"
FT                   /number=2
FT   intron          737411..737469
FT                   /gene="Pc16g03240"
FT                   /locus_tag="PCH_Pc16g03240"
FT                   /number=2
FT   exon            737470..737545
FT                   /gene="Pc16g03240"
FT                   /locus_tag="PCH_Pc16g03240"
FT                   /number=3
FT   mRNA            join(<739329..739937,739986..>740216)
FT                   /gene="Pc16g03250"
FT                   /locus_tag="PCH_Pc16g03250"
FT   CDS_pept        join(739329..739937,739986..740216)
FT                   /gene="Pc16g03250"
FT                   /locus_tag="PCH_Pc16g03250"
FT                   /note="Title: strong similarity to aquaporin 3 AQP3 - Homo
FT                   sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92995"
FT                   /db_xref="GOA:B6H8Y5"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y5"
FT                   /inference="similar to AA sequence:SWISSPROT:AQP3_HUMAN"
FT                   /inference="protein motif:PFAM:PF00230"
FT                   /inference="protein motif:COGS:COG0580"
FT                   /protein_id="CAP92995.1"
FT                   /translation="MIHRRVLKPYAAEFLGTALLIVIGDGVVAQCLLSDYNYGTWLSIN
FT                   VAWAAAVSLSSYLSDPSPTINPAVTLCLALVRPYEGQWKQVPGKLAAQFLGGFVGAAIV
FT                   YINYRSAIKAWDPEYTIPGGSILSPVGHHSAGIFSTYPGAFFESNWEAVFSEMLGSAVL
FT                   MFGCLSISDPRNAHRLPAPQIALFLLLLMIGAALGWQTGYAINPARDFGPRLFSAIIYG
FT                   REVFTAANCYFVVPLFAPIVGCVLGAATYDGMLFEGEGSRIADALDEAENHGSLRLQ"
FT   sig_peptide     739329..739415
FT                   /gene="Pc16g03250"
FT                   /locus_tag="PCH_Pc16g03250"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            739329..739937
FT                   /gene="Pc16g03250"
FT                   /locus_tag="PCH_Pc16g03250"
FT                   /number=1
FT   mat_peptide     join(739416..739937,739986..740213)
FT                   /gene="Pc16g03250"
FT                   /locus_tag="PCH_Pc16g03250"
FT   intron          739938..739985
FT                   /gene="Pc16g03250"
FT                   /locus_tag="PCH_Pc16g03250"
FT                   /number=1
FT   exon            739986..740216
FT                   /gene="Pc16g03250"
FT                   /locus_tag="PCH_Pc16g03250"
FT                   /number=2
FT   mRNA            complement(join(<740462..741422,741494..741547,
FT                   741607..>741695))
FT                   /gene="Pc16g03260"
FT                   /locus_tag="PCH_Pc16g03260"
FT   CDS_pept        complement(join(740462..741422,741494..741547,
FT                   741607..741695))
FT                   /gene="Pc16g03260"
FT                   /locus_tag="PCH_Pc16g03260"
FT                   /EC_number="4.3.1.17"
FT                   /note="Title: strong similarity to L-serine dehydratase
FT                   Cha1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92996"
FT                   /db_xref="GOA:B6H8Y6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y6"
FT                   /inference="similar to AA sequence:TREMBL:SCCHRIII.12"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /inference="protein motif:COGS:COG0133"
FT                   /inference="protein motif:COGS:COG0031"
FT                   /inference="protein motif:COGS:COG1171"
FT                   /protein_id="CAP92996.1"
FT                   /translation="MGHFDKHELKKPWIETPLIESATLSKAAGCRIFLKLESLQPSGSF
FT                   KSRGIGNLILTSLSDPSNNGRTLHFFSSSAGNAGMAAVIAARDLGCPCTVVVPLSVKPT
FT                   MIEKIRAAGASDVIRHGASWFEADAYLRENFIENEDSKLDPLVRNIYVPPFDHHDIWRG
FT                   AGTLIDEIVKQLPRHNGEPDTDRSFPADAIVCSVGGGGLLNGIIDGLERHLPAYQPRTL
FT                   PNKEAKKVRVLAAETAGADSLAHSVRKSYLHTLPAITSQAITLGALCVARQTLKNAQSP
FT                   PPGVEVTSIVGTDADAAKGVVRLCDELRLEVELACGISVQVGLDRLREVMPELTPDSRV
FT                   IIIVCGGNDVSPEIISDYRQKLANGWR"
FT   exon            complement(740462..741422)
FT                   /gene="Pc16g03260"
FT                   /locus_tag="PCH_Pc16g03260"
FT                   /number=1
FT   intron          complement(741423..741493)
FT                   /gene="Pc16g03260"
FT                   /locus_tag="PCH_Pc16g03260"
FT                   /number=1
FT   exon            complement(741494..741547)
FT                   /gene="Pc16g03260"
FT                   /locus_tag="PCH_Pc16g03260"
FT                   /number=2
FT   intron          complement(741548..741606)
FT                   /gene="Pc16g03260"
FT                   /locus_tag="PCH_Pc16g03260"
FT                   /number=2
FT   exon            complement(741607..741695)
FT                   /gene="Pc16g03260"
FT                   /locus_tag="PCH_Pc16g03260"
FT                   /number=3
FT   mRNA            complement(join(<742138..742417,742485..>742987))
FT                   /gene="Pc16g03270"
FT                   /locus_tag="PCH_Pc16g03270"
FT   CDS_pept        complement(join(742138..742417,742485..742987))
FT                   /gene="Pc16g03270"
FT                   /locus_tag="PCH_Pc16g03270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92997"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y7"
FT                   /protein_id="CAP92997.1"
FT                   /translation="MYKVFTLISLFLPVHVTATPQNHDHALLRRDACDGIDSMPVLYHD
FT                   YLSDVCPPKHLNNSEGICDHVDYRSNSCVGFCQLRTRFVYGREFPLDVWCNGPPCKIAD
FT                   FTRIMTRSVDIEPQFEKGLNDGISGGWQSKTTADVGPRGMSYKMPLKAGQCGYWSWVPI
FT                   KKTVCGTMSYQQTEAHRCVDDMHTVENYCVDALQRYPDGTVDGETIFVYTDCMTRLPLP
FT                   MDQQTIIYRLPGVALNQGEHPSAQELGGYPSDSEQQVL"
FT   exon            complement(742138..742417)
FT                   /gene="Pc16g03270"
FT                   /locus_tag="PCH_Pc16g03270"
FT                   /number=1
FT   mat_peptide     complement(join(742141..742417,742485..742933))
FT                   /gene="Pc16g03270"
FT                   /locus_tag="PCH_Pc16g03270"
FT   intron          complement(742418..742484)
FT                   /gene="Pc16g03270"
FT                   /locus_tag="PCH_Pc16g03270"
FT                   /number=1
FT   exon            complement(742485..742987)
FT                   /gene="Pc16g03270"
FT                   /locus_tag="PCH_Pc16g03270"
FT                   /number=2
FT   sig_peptide     complement(742934..742987)
FT                   /gene="Pc16g03270"
FT                   /locus_tag="PCH_Pc16g03270"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<743910..744154,744210..744322,744501..744578,
FT                   744631..>744791)
FT                   /gene="Pc16g03280"
FT                   /locus_tag="PCH_Pc16g03280"
FT   CDS_pept        join(743910..744154,744210..744322,744501..744578,
FT                   744631..744791)
FT                   /gene="Pc16g03280"
FT                   /locus_tag="PCH_Pc16g03280"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An03g01670 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92998"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N3"
FT                   /protein_id="CAP92998.1"
FT                   /translation="MSLRNLALLALLGLVNAQDKIGFGPYFSLGPTSSWIREAKTTLVL
FT                   PEVPSPQKDRLALWPGMGTSGGDLIQALAVSFSDPAANCGATAGQWCTWASTLQGTQLG
FT                   GKQVPANAGDEVTMHCSGQAQGWGTAVECQDDACKGTAAAHVYADTTIILDAADSSFGD
FT                   TLAINEATSSGLKTTDNGKTWTVSTINVQAHTYNL"
FT   sig_peptide     743910..743960
FT                   /gene="Pc16g03280"
FT                   /locus_tag="PCH_Pc16g03280"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            743910..744154
FT                   /gene="Pc16g03280"
FT                   /locus_tag="PCH_Pc16g03280"
FT                   /number=1
FT   mat_peptide     join(743961..744154,744210..744322,744501..744578,
FT                   744631..744788)
FT                   /gene="Pc16g03280"
FT                   /locus_tag="PCH_Pc16g03280"
FT   intron          744155..744209
FT                   /gene="Pc16g03280"
FT                   /locus_tag="PCH_Pc16g03280"
FT                   /number=1
FT   exon            744210..744322
FT                   /gene="Pc16g03280"
FT                   /locus_tag="PCH_Pc16g03280"
FT                   /number=2
FT   intron          744323..744500
FT                   /gene="Pc16g03280"
FT                   /locus_tag="PCH_Pc16g03280"
FT                   /number=2
FT   exon            744501..744578
FT                   /gene="Pc16g03280"
FT                   /locus_tag="PCH_Pc16g03280"
FT                   /number=3
FT   intron          744579..744630
FT                   /gene="Pc16g03280"
FT                   /locus_tag="PCH_Pc16g03280"
FT                   /number=3
FT   exon            744631..744791
FT                   /gene="Pc16g03280"
FT                   /locus_tag="PCH_Pc16g03280"
FT                   /number=4
FT   mRNA            join(<745934..745960,746072..746110,746168..746242,
FT                   746327..746592,746770..746777,746876..>746895)
FT                   /gene="Pc16g03290"
FT                   /locus_tag="PCH_Pc16g03290"
FT   CDS_pept        join(745934..745960,746072..746110,746168..746242,
FT                   746327..746592,746770..746777,746876..746895)
FT                   /gene="Pc16g03290"
FT                   /locus_tag="PCH_Pc16g03290"
FT                   /EC_number="3.6.4.2"
FT                   /note="Title: weak similarity to cytoplasmic dynein light
FT                   chain dlc1p - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03290"
FT                   /db_xref="EnsemblGenomes-Tr:CAP92999"
FT                   /db_xref="GOA:B6H7N4"
FT                   /db_xref="InterPro:IPR005334"
FT                   /db_xref="InterPro:IPR038586"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N4"
FT                   /inference="similar to AA sequence:TREMBL:AF196291.1"
FT                   /protein_id="CAP92999.1"
FT                   /translation="MSAEGASASPIPIEDLTKITDEACENALATTKGYDHENVGDWNSK
FT                   IINSILKALITATAPDASKPPSYRFTVNSTIVQQGVIDPSVAADGALSNAGKRGMHSAS
FT                   GAFWDVNRDGMWTYKYTGAEDRGMDIVVCVTCPMDMSRNM"
FT   exon            745934..745960
FT                   /gene="Pc16g03290"
FT                   /locus_tag="PCH_Pc16g03290"
FT                   /number=1
FT   intron          745961..746071
FT                   /gene="Pc16g03290"
FT                   /locus_tag="PCH_Pc16g03290"
FT                   /number=1
FT   exon            746072..746110
FT                   /gene="Pc16g03290"
FT                   /locus_tag="PCH_Pc16g03290"
FT                   /number=2
FT   intron          746111..746167
FT                   /gene="Pc16g03290"
FT                   /locus_tag="PCH_Pc16g03290"
FT                   /number=2
FT   exon            746168..746242
FT                   /gene="Pc16g03290"
FT                   /locus_tag="PCH_Pc16g03290"
FT                   /number=3
FT   intron          746243..746326
FT                   /gene="Pc16g03290"
FT                   /locus_tag="PCH_Pc16g03290"
FT                   /number=3
FT   exon            746327..746592
FT                   /gene="Pc16g03290"
FT                   /locus_tag="PCH_Pc16g03290"
FT                   /number=4
FT   intron          746593..746769
FT                   /gene="Pc16g03290"
FT                   /locus_tag="PCH_Pc16g03290"
FT                   /number=4
FT   exon            746770..746777
FT                   /gene="Pc16g03290"
FT                   /locus_tag="PCH_Pc16g03290"
FT                   /number=5
FT   intron          746778..746875
FT                   /gene="Pc16g03290"
FT                   /locus_tag="PCH_Pc16g03290"
FT                   /number=5
FT   exon            746876..746895
FT                   /gene="Pc16g03290"
FT                   /locus_tag="PCH_Pc16g03290"
FT                   /number=6
FT   mRNA            complement(join(<747192..747449,747678..747833,
FT                   747889..748384,748480..748501,748576..>748597))
FT                   /gene="Pc16g03300"
FT                   /locus_tag="PCH_Pc16g03300"
FT   CDS_pept        complement(join(747192..747449,747678..747833,
FT                   747889..748384,748480..748501,748576..748597))
FT                   /gene="Pc16g03300"
FT                   /locus_tag="PCH_Pc16g03300"
FT                   /note="Title: strong similarity to G beta-like protein Lst8
FT                   - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03300"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93000"
FT                   /db_xref="GOA:B6H7N5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR037588"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N5"
FT                   /inference="similar to AA sequence:PIR:S45461"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP93000.1"
FT                   /translation="MSVILCTAGYDHTIRFWEALSGICSRTIQHPDSQVNRLCITPDKR
FT                   FLAAAGHNNVKLFDIKSTNPNPVITFEGHTNNITGVAFHCEGKWMVTSSEDGTVKVWDT
FT                   RTGSLQRNYVHRAAVNDVVIHPNQGELISGDHAGMVRVWDLGESVCTHQLIPEEDTAVL
FT                   SVSVASDGSLLCAGNKKGNVYLWRMVQTDDTTRIIPVCTFQAHKDYLTRVLLSPDVKHL
FT                   ATCSADHTAKTFTSSPDGPPMDPVNHTLFLETTLANHQRWVWDCAFSADSAYLVTVSSD
FT                   HYARLWELGTGNIIRQYSGHHRGAVCVALNDYSEPR"
FT   exon            complement(747192..747449)
FT                   /gene="Pc16g03300"
FT                   /locus_tag="PCH_Pc16g03300"
FT                   /number=1
FT   intron          complement(747450..747677)
FT                   /gene="Pc16g03300"
FT                   /locus_tag="PCH_Pc16g03300"
FT                   /number=1
FT   exon            complement(747678..747833)
FT                   /gene="Pc16g03300"
FT                   /locus_tag="PCH_Pc16g03300"
FT                   /number=2
FT   intron          complement(747834..747888)
FT                   /gene="Pc16g03300"
FT                   /locus_tag="PCH_Pc16g03300"
FT                   /number=2
FT   exon            complement(747889..748384)
FT                   /gene="Pc16g03300"
FT                   /locus_tag="PCH_Pc16g03300"
FT                   /number=3
FT   intron          complement(748385..748479)
FT                   /gene="Pc16g03300"
FT                   /locus_tag="PCH_Pc16g03300"
FT                   /number=3
FT   exon            complement(748480..748501)
FT                   /gene="Pc16g03300"
FT                   /locus_tag="PCH_Pc16g03300"
FT                   /number=4
FT   intron          complement(748502..748575)
FT                   /gene="Pc16g03300"
FT                   /locus_tag="PCH_Pc16g03300"
FT                   /number=4
FT   exon            complement(748576..748597)
FT                   /gene="Pc16g03300"
FT                   /locus_tag="PCH_Pc16g03300"
FT                   /number=5
FT   mRNA            join(<749457..750071,750129..>750560)
FT                   /gene="Pc16g03310"
FT                   /locus_tag="PCH_Pc16g03310"
FT   CDS_pept        join(749457..750071,750129..750560)
FT                   /gene="Pc16g03310"
FT                   /locus_tag="PCH_Pc16g03310"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An08g01160 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03310"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93001"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N6"
FT                   /protein_id="CAP93001.1"
FT                   /translation="MGSIDPNHAAFGLDQPAFDEQAFLNGLANLDADGPFNASNGFNYE
FT                   GNPDLMKSFDEYFASIPLDNLDMPGLDQPMSATPANCSAQPVSNNLPVHAPHMQMAYDP
FT                   SIGVAYTPEDTDADKVRKWENLIAQANLANAGVPPSAPEPIAGETVEQVTQVPDSPNSL
FT                   FDSPRSPSVEIIRTPSPTPPTPSPPQPPAATVATFSAAPNATANAARAVQLPRALTSQK
FT                   GYVQHVSPFAPVATISPPASSAANSRELENARLRIQSLAKERSFYQRNLRKATTIDPKT
FT                   GKTSLQKLHAENLSLRRTNANQAQKLQDMKDEINQEKSKFAALGAQYNEVAKRLHKAMV
FT                   ELRELKGQ"
FT   exon            749457..750071
FT                   /gene="Pc16g03310"
FT                   /locus_tag="PCH_Pc16g03310"
FT                   /number=1
FT   intron          750072..750128
FT                   /gene="Pc16g03310"
FT                   /locus_tag="PCH_Pc16g03310"
FT                   /number=1
FT   exon            750129..750560
FT                   /gene="Pc16g03310"
FT                   /locus_tag="PCH_Pc16g03310"
FT                   /number=2
FT   mRNA            complement(join(<750631..750955,750998..751084,
FT                   751128..751143,751221..751284,751320..>751460))
FT                   /gene="Pc16g03320"
FT                   /locus_tag="PCH_Pc16g03320"
FT   CDS_pept        complement(join(750631..750955,750998..751084,
FT                   751128..751143,751221..751284,751320..751460))
FT                   /gene="Pc16g03320"
FT                   /locus_tag="PCH_Pc16g03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03320"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93002"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N7"
FT                   /protein_id="CAP93002.1"
FT                   /translation="MRSVVNAQYLPSQFVEPVSGSLIPTSRLVGIIVVIKGWEYQERTG
FT                   DQGLRRVDGREGYLGLMREVDERGESAVWKRVLQSRRSSSRKKSGTMCAGSQHIRRETV
FT                   IRTHHEYRYEGTVFRIVRWLNPSRAFTALSSPQLVQVDYWCLQPGGLGITSFTSFQGWN
FT                   NPGERTSPKSHTSKVGCTGTYKQVSGYGLPSGSDYACIRNIGTENEC"
FT   exon            complement(750631..750955)
FT                   /gene="Pc16g03320"
FT                   /locus_tag="PCH_Pc16g03320"
FT                   /number=1
FT   intron          complement(750956..750997)
FT                   /gene="Pc16g03320"
FT                   /locus_tag="PCH_Pc16g03320"
FT                   /number=1
FT   exon            complement(750998..751084)
FT                   /gene="Pc16g03320"
FT                   /locus_tag="PCH_Pc16g03320"
FT                   /number=2
FT   intron          complement(751085..751127)
FT                   /gene="Pc16g03320"
FT                   /locus_tag="PCH_Pc16g03320"
FT                   /number=2
FT   exon            complement(751128..751143)
FT                   /gene="Pc16g03320"
FT                   /locus_tag="PCH_Pc16g03320"
FT                   /number=3
FT   intron          complement(751144..751220)
FT                   /gene="Pc16g03320"
FT                   /locus_tag="PCH_Pc16g03320"
FT                   /number=3
FT   exon            complement(751221..751284)
FT                   /gene="Pc16g03320"
FT                   /locus_tag="PCH_Pc16g03320"
FT                   /number=4
FT   intron          complement(751285..751319)
FT                   /gene="Pc16g03320"
FT                   /locus_tag="PCH_Pc16g03320"
FT                   /number=4
FT   exon            complement(751320..751460)
FT                   /gene="Pc16g03320"
FT                   /locus_tag="PCH_Pc16g03320"
FT                   /number=5
FT   tRNA            753770..753841
FT                   /gene="tRNA-Arg (ACG)"
FT                   /locus_tag="PCH_Pc16e00100"
FT                   /product="transfer RNA-Arg (ACG)"
FT                   /inference="profile:tRNAscan:1.4"
FT   mRNA            join(<754317..754499,754567..>755292)
FT                   /gene="Pc16g03330"
FT                   /locus_tag="PCH_Pc16g03330"
FT   CDS_pept        join(754317..754499,754567..755292)
FT                   /gene="Pc16g03330"
FT                   /locus_tag="PCH_Pc16g03330"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig46_part_ii.tfa_1620wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03330"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93003"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N8"
FT                   /protein_id="CAP93003.1"
FT                   /translation="MPLRIIEGESPEPVPWGSLPLDIYLLSEWETPHPSQPTESPSARR
FT                   RRLIRQFLALGLEGRRPYQARTETPPTPTKAQIAEILLPVRPEALRPYAAYTTCLEEGL
FT                   WLRLCYKKEEAHESIWSHNEDVAYVGPDGVVLDDEEIFGGLDLAAALEIFPERVTNGGS
FT                   SGHIKLREETLREILGDLEDDTGSGEEDYSDDIKEKVAEFRASRAKNPLLKYGLYHAAC
FT                   VVTHAFVEDEVALDGGGLLHVFWDDCGNVVRQWRVEDDGAEDNFDGAWAEGAWKENFIN
FT                   GIGELGPAYHEGGMRGPPYNV"
FT   exon            754317..754499
FT                   /gene="Pc16g03330"
FT                   /locus_tag="PCH_Pc16g03330"
FT                   /number=1
FT   intron          754500..754566
FT                   /gene="Pc16g03330"
FT                   /locus_tag="PCH_Pc16g03330"
FT                   /number=1
FT   exon            754567..755292
FT                   /gene="Pc16g03330"
FT                   /locus_tag="PCH_Pc16g03330"
FT                   /number=2
FT   mRNA            join(<755459..755505,755557..755758,755818..>755895)
FT                   /gene="Pc16g03340"
FT                   /locus_tag="PCH_Pc16g03340"
FT   CDS_pept        join(755459..755505,755557..755758,755818..755895)
FT                   /gene="Pc16g03340"
FT                   /locus_tag="PCH_Pc16g03340"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig_1_86_scaffold_5.tfa_150cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93004"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B6H934"
FT                   /protein_id="CAP93004.1"
FT                   /translation="MGALTWRMGITSHLTISVWNPAVGEGCGSLKIEYYVCVGVSGDMI
FT                   PSTTAKKTTTTSDGGRVTVVPGDGCYDVAADHGISLTNFYSWNPSVRDDCSELKFDSYA
FT                   CVGI"
FT   sig_peptide     join(755459..755505,755557..755581)
FT                   /gene="Pc16g03340"
FT                   /locus_tag="PCH_Pc16g03340"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            755459..755505
FT                   /gene="Pc16g03340"
FT                   /locus_tag="PCH_Pc16g03340"
FT                   /number=1
FT   intron          755506..755556
FT                   /gene="Pc16g03340"
FT                   /locus_tag="PCH_Pc16g03340"
FT                   /number=1
FT   exon            755557..755758
FT                   /gene="Pc16g03340"
FT                   /locus_tag="PCH_Pc16g03340"
FT                   /number=2
FT   mat_peptide     join(755582..755758,755818..755892)
FT                   /gene="Pc16g03340"
FT                   /locus_tag="PCH_Pc16g03340"
FT   intron          755759..755817
FT                   /gene="Pc16g03340"
FT                   /locus_tag="PCH_Pc16g03340"
FT                   /number=2
FT   exon            755818..755895
FT                   /gene="Pc16g03340"
FT                   /locus_tag="PCH_Pc16g03340"
FT                   /number=3
FT   mRNA            join(<756722..756849,756930..757082,757142..757603,
FT                   757695..>758634)
FT                   /gene="Pc16g03350"
FT                   /locus_tag="PCH_Pc16g03350"
FT   CDS_pept        join(756722..756849,756930..757082,757142..757603,
FT                   757695..758634)
FT                   /gene="Pc16g03350"
FT                   /locus_tag="PCH_Pc16g03350"
FT                   /note="Title: strong similarity to polyamine transport
FT                   protein Tpo1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93005"
FT                   /db_xref="GOA:B6H935"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H935"
FT                   /inference="similar to AA sequence:PIR:S64779"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP93005.1"
FT                   /translation="MADQDEIRGNSVYEPEQPVTETSSPVEKPVAPKEQKKSGLMAKIG
FT                   RMLNQDVSEEMPAYKDIQIHTWDGPDDPENPFNWSLKYKWLLTITVCFISILTGLPAGT
FT                   YGSGNDWMGKEFNVQNEPFPNLYWATTSWNMGAAFWPLIFVPLTEASGRMPGYFVAYVI
FT                   LVISLFPSAFAKNFATLVVTRFFGGGASSVSINIVGGSISDVWLGDHARSLPMSIFGFT
FT                   SVVGIALGPFIGSAIVQIQKSEPWRWIFYVQIIYNAALIPVFWLILNETRPDVILKKRA
FT                   RKIRKETNLPVYAAAEIDAPSKLRLLKISFQRPTSMLLTEPVVTFFTLWISFAWGILYL
FT                   FFSSVVQTYSTNYGWGTLSTGLVQLAISVGAIIGTMINPLQDWYYLRSSRRNKEKPGKP
FT                   IPEARLYTSIPGSLLFAAGLFWYGWASQPDIHWIVPTIGITAAGIGIYSIYMAVVNYLT
FT                   DAYERYAASALSAASLGRNAFGAFLPLASPQLFSNLGFGWAGTLLGFIGIALSVVPVIL
FT                   VWKGPQIRERSKFMREAMWEPEEKVEVDRSGKEDLGPSAEGVA"
FT   exon            756722..756849
FT                   /gene="Pc16g03350"
FT                   /locus_tag="PCH_Pc16g03350"
FT                   /number=1
FT   intron          756850..756929
FT                   /gene="Pc16g03350"
FT                   /locus_tag="PCH_Pc16g03350"
FT                   /number=1
FT   exon            756930..757082
FT                   /gene="Pc16g03350"
FT                   /locus_tag="PCH_Pc16g03350"
FT                   /number=2
FT   intron          757083..757141
FT                   /gene="Pc16g03350"
FT                   /locus_tag="PCH_Pc16g03350"
FT                   /number=2
FT   exon            757142..757603
FT                   /gene="Pc16g03350"
FT                   /locus_tag="PCH_Pc16g03350"
FT                   /number=3
FT   intron          757604..757694
FT                   /gene="Pc16g03350"
FT                   /locus_tag="PCH_Pc16g03350"
FT                   /number=3
FT   exon            757695..758634
FT                   /gene="Pc16g03350"
FT                   /locus_tag="PCH_Pc16g03350"
FT                   /number=4
FT   mRNA            complement(join(<759033..759747,759809..759895,
FT                   759964..759993,760170..>760291))
FT                   /gene="Pc16g03360"
FT                   /locus_tag="PCH_Pc16g03360"
FT   CDS_pept        complement(join(759033..759747,759809..759895,
FT                   759964..759993,760170..760291))
FT                   /gene="Pc16g03360"
FT                   /locus_tag="PCH_Pc16g03360"
FT                   /note="Title: strong similarity to Oxodicarboxylate carrier
FT                   Odc2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03360"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93006"
FT                   /db_xref="GOA:B6H936"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:B6H936"
FT                   /inference="similar to AA sequence:PIR:S60949"
FT                   /inference="protein motif:PFAM:PF00153"
FT                   /protein_id="CAP93006.1"
FT                   /translation="MSETAQKPLPFVYQFAAGAVAGVSEVCVSCFRFEKRFRLDSYPLD
FT                   VLKTRIQLQTGAPVPGVDHYNGMFDCFRKIVKNEGASRLYRGISAPILMEAPKRATKFA
FT                   ANDSWGAFYRNLFGVDKQTQSLATLTGATAGATEAFVVVPFELVKIRLQDKAQAHKYNG
FT                   MFDVVKKIVAAEGPLAMYNGLESTMWRHVLWNAGYFGCIFQVRAQLPAVEPGNKNQQMR
FT                   NDLIAGSIGGTTGTILNTPMDVVKSRIQNTTKVPGQVAKYNWAWPALGTVMKEEGFSAL
FT                   YKGFTPKVLRLGPGGGILLVVYTGVMDFFRKMRDGN"
FT   exon            complement(759033..759747)
FT                   /gene="Pc16g03360"
FT                   /locus_tag="PCH_Pc16g03360"
FT                   /number=1
FT   intron          complement(759748..759808)
FT                   /gene="Pc16g03360"
FT                   /locus_tag="PCH_Pc16g03360"
FT                   /number=1
FT   exon            complement(759809..759895)
FT                   /gene="Pc16g03360"
FT                   /locus_tag="PCH_Pc16g03360"
FT                   /number=2
FT   intron          complement(759896..759963)
FT                   /gene="Pc16g03360"
FT                   /locus_tag="PCH_Pc16g03360"
FT                   /number=2
FT   exon            complement(759964..759993)
FT                   /gene="Pc16g03360"
FT                   /locus_tag="PCH_Pc16g03360"
FT                   /number=3
FT   intron          complement(759994..760169)
FT                   /gene="Pc16g03360"
FT                   /locus_tag="PCH_Pc16g03360"
FT                   /number=3
FT   exon            complement(760170..760291)
FT                   /gene="Pc16g03360"
FT                   /locus_tag="PCH_Pc16g03360"
FT                   /number=4
FT   mRNA            complement(join(<760674..761293,761381..>762050))
FT                   /gene="Pc16g03370"
FT                   /locus_tag="PCH_Pc16g03370"
FT   CDS_pept        complement(join(760674..761293,761381..762050))
FT                   /gene="Pc16g03370"
FT                   /locus_tag="PCH_Pc16g03370"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   G11A3.030 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93007"
FT                   /db_xref="UniProtKB/TrEMBL:B6H937"
FT                   /inference="similar to AA sequence:TREMBLNEW:BX842619.3"
FT                   /protein_id="CAP93007.1"
FT                   /translation="MQILHALTVFCSLPQFATLISAEKINPSGDQESKEAETPLPASLI
FT                   LRRNAAIASQLAAGPALGVKKMSDDEGEKFFLDYWSFGNDSSSGNITEGHVSDDGFSPA
FT                   RFVAQSYPFAPSYSLGTDGDSQFLPWENSHSANNLLEKRDFKCPAGTWACTSIGRSDRC
FT                   CGSGETCEIVADTGHGDVGCCPSWKTCSGMIGSCQSGYTACSQALGGGCCIPGYDCVEG
FT                   GCAYITTITVTLHSTVMLSTVTYSTKPQDTTSTSASFSFPTTSSHSSKTTTNDGLAPPA
FT                   RPTNLSTVTSATRGDDVCPTGFYACSAVYHGGCCRTGRDCDTTSCPTISSTTVVSDGVT
FT                   IVAPAATTTEHTSGNRCAHGWFHCADTVGGGCCPMGFACGSSCTARDTAFATTVAKEQA
FT                   TASSGGSVVHRVSKMMLGMMIGMSVGVWIL"
FT   exon            complement(760674..761293)
FT                   /gene="Pc16g03370"
FT                   /locus_tag="PCH_Pc16g03370"
FT                   /number=1
FT   mat_peptide     complement(join(760677..761293,761381..761984))
FT                   /gene="Pc16g03370"
FT                   /locus_tag="PCH_Pc16g03370"
FT   intron          complement(761294..761380)
FT                   /gene="Pc16g03370"
FT                   /locus_tag="PCH_Pc16g03370"
FT                   /number=1
FT   exon            complement(761381..762050)
FT                   /gene="Pc16g03370"
FT                   /locus_tag="PCH_Pc16g03370"
FT                   /number=2
FT   sig_peptide     complement(761985..762050)
FT                   /gene="Pc16g03370"
FT                   /locus_tag="PCH_Pc16g03370"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<762896..764691,764848..765850,
FT                   765945..>766010))
FT                   /gene="Pc16g03380"
FT                   /locus_tag="PCH_Pc16g03380"
FT   CDS_pept        complement(join(762896..764691,764848..765850,
FT                   765945..766010))
FT                   /gene="Pc16g03380"
FT                   /locus_tag="PCH_Pc16g03380"
FT                   /note="Title: strong similarity to actin-interacting
FT                   protein Aip3 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93008"
FT                   /db_xref="GOA:B6H938"
FT                   /db_xref="InterPro:IPR005613"
FT                   /db_xref="InterPro:IPR022782"
FT                   /db_xref="UniProtKB/TrEMBL:B6H938"
FT                   /inference="similar to AA sequence:PIR:S53397"
FT                   /inference="protein motif:PFAM:PF03915"
FT                   /protein_id="CAP93008.1"
FT                   /translation="MASQQSGRSSSASSRSQSSKSQIEKSVTHLLVATKQLLETLTQWS
FT                   RKQASENDVSDVYVRLGYEFNLACRAFSAIGVDTSDLGPVPDLLRTILEDTLSQDASSQ
FT                   SLDRYLPRIRDIIINLLKGLKKKQARLRSRHQREDGRPVPGRQASAGSIASGQAIGQLY
FT                   DEAAASTMPSTAQSTSQSPRRSNRRYGSGGSLEDQPAIARTSSAPSTSEPRANFTERET
FT                   SRREAQQMLSQPTPFDNDTTPRANAPNNTAPSTYITPTGFSAPPPPPPPKEDDALGALQ
FT                   RSGELERRASRRFSAYQIQKHLGTSTNGVPVLPTQNSPIPNRGRDVRESLNAVRLRGSF
FT                   AHTRQRSNNRLQEAAKMEATIVPPPIIPVPQEKPTLEDAFEPAKPTPQTPKGDSFGPSA
FT                   EVGTPLSAIQFATEQPSPGKELTLFLQYKSKIKKYVLPEGIAELTIGRLQLAFIEKFAW
FT                   NTHDNGVDLPEIYIQDPISGIRHELEDLADVKDRSVLVLNVDNLDEVKKHFDDSLGSVR
FT                   LLVEGVKETLSGQGNIIQRVSDRQLEAAKEIARLAASPPANSAPAAIGGNSKASIAGSG
FT                   SQIAELQSLRRDLAVLRQTYSNFTADITGSMSAVRAKASKVRTAADDVATPSYEGDAGR
FT                   ARVNTGKKELAAESERLVARVDDLQDLVEDLRKDVVTRGVRPLPRQLEGVSRDISMVMK
FT                   EIKKMQDFLGREKPIWTKIWEKELQLVCEERDQLTMQEDLAADLQDDLEKATQTFALVE
FT                   QATKEQVLTNATGGTAVRAPSRTLGIDPTIDPMKAKDGVLGEVRALQPNHESRLEAIER
FT                   AEKARKKELETRRIGLFQKELGAFVEEGKLKKSGGFEETERLRTAKDDRIRKEVWDRQQ
FT                   ARNAEMEKAEAEAAAAQAAEQNKEGEGDDDQQEGEKEVTREDGDEAEEAAEKAEEPKSP
FT                   SSDAAKPLPKSPEEDNGTSEQPSA"
FT   exon            complement(762896..764691)
FT                   /gene="Pc16g03380"
FT                   /locus_tag="PCH_Pc16g03380"
FT                   /number=1
FT   intron          complement(764692..764847)
FT                   /gene="Pc16g03380"
FT                   /locus_tag="PCH_Pc16g03380"
FT                   /number=1
FT   exon            complement(764848..765850)
FT                   /gene="Pc16g03380"
FT                   /locus_tag="PCH_Pc16g03380"
FT                   /number=2
FT   intron          complement(765851..765944)
FT                   /gene="Pc16g03380"
FT                   /locus_tag="PCH_Pc16g03380"
FT                   /number=2
FT   exon            complement(765945..766010)
FT                   /gene="Pc16g03380"
FT                   /locus_tag="PCH_Pc16g03380"
FT                   /number=3
FT   mRNA            join(<768867..769024,769293..769482,769536..769809,
FT                   769868..772201,772255..>772460)
FT                   /gene="Pc16g03390"
FT                   /locus_tag="PCH_Pc16g03390"
FT   CDS_pept        join(768867..769024,769293..769482,769536..769809,
FT                   769868..772201,772255..772460)
FT                   /gene="Pc16g03390"
FT                   /locus_tag="PCH_Pc16g03390"
FT                   /note="Title: similarity to poly(A)-binding protein
FT                   interacting factor Pbp1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03390"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93009"
FT                   /db_xref="InterPro:IPR009604"
FT                   /db_xref="InterPro:IPR025852"
FT                   /db_xref="UniProtKB/TrEMBL:B6H939"
FT                   /inference="similar to AA sequence:PIR:S64492"
FT                   /inference="protein motif:COGS:COG5180"
FT                   /protein_id="CAP93009.1"
FT                   /translation="MASALNSVAANNASGNASAGAPNPGRSTLRSSNSTKGSDNRRQSG
FT                   SPIDGGQRRTNSHKAWTQGTNPITQRSSYTSSNGNMTHQKQSGSSRLNQKESNTPDSHA
FT                   HDRLVFLFASFTGLHTTITTKSGEKFTGIFSSSTMEPNELSFLLKMVQRTSQEGQPRAN
FT                   GISDVATPYIGSAPEHIMSFDIKDVVDIAVPNVTTAEVSAKEPNGASQGFRTDSDISGN
FT                   LAMRERTLQRWEPAETDIDMSLETSNTSAGWDQFEANERLFGAKTNYDENIYTTRLDRS
FT                   DPNYKQKQAEAARIAREIEGQDVDNSHMREERGLVAPDTGDQDEEDKYSGVRREDKAFP
FT                   PLLSGQPNKYMPPGRRQAAPQSTATPSASTKQPVAPVPTAPIPIPSQAVAKETTPADQQ
FT                   TELVASLQPTTDTEQKSALGKGVTPPVSTASPAPAGKRTAPENATANVEVEVLDHFRQF
FT                   ANSEKIKMQERRRNQASYDRTMKLNELMKFSKSFKLSTPVPKDLVPILAKDRLKQEAIM
FT                   QRALQQGDDKATPKVTTPPTEQQPPTRGAGPSGAVPPSAPADRQNYNRTRQGYPPAGPL
FT                   AGAGGRFPQQVPPGRPGVGMLSHRLADNLQQRKGAGMGPVPTPLPIQDARGPPTGPASD
FT                   QQRITSPVKSQAGSSAATKFNVKAMEFKPNPAASTFTPGTSGTAASPRPFSRNRSVSRA
FT                   TTPTAFFGSRKPLPVSERPSISDQFNPIKRMKKEHAETAERLIMLNGGIPPPYKTLPTW
FT                   DIADGSEEKTYDEMFKQPVAVPTVPPQGRSVSNNTNIPQQHQVPFHFQQGNPAMPPSSG
FT                   PSNGPHGLHSQGPHGPSHVDDHHRMQLSASNSQVFPSPRMQHGYPSPMAPHAQLSFPQP
FT                   VPQFYGGPQPGHIRPFQGGGPQFVNGAPMMVQQASNGPYMGVPQGMSPYNAQMPMYSPN
FT                   PGHAYPQHTPQPHSGYPSPSRGAPMMMHQNSQSGQPPQSMMFMPGQPGYPQQSGHMPPN
FT                   RGNYPQQPHFSSSPHQSHHFPPNQHRTPSNGFNQMPQMPPQMPAATPATTPGASHPAEA
FT                   TDEGK"
FT   exon            768867..769024
FT                   /gene="Pc16g03390"
FT                   /locus_tag="PCH_Pc16g03390"
FT                   /number=1
FT   intron          769025..769292
FT                   /gene="Pc16g03390"
FT                   /locus_tag="PCH_Pc16g03390"
FT                   /number=1
FT   exon            769293..769482
FT                   /gene="Pc16g03390"
FT                   /locus_tag="PCH_Pc16g03390"
FT                   /number=2
FT   intron          769483..769535
FT                   /gene="Pc16g03390"
FT                   /locus_tag="PCH_Pc16g03390"
FT                   /number=2
FT   exon            769536..769809
FT                   /gene="Pc16g03390"
FT                   /locus_tag="PCH_Pc16g03390"
FT                   /number=3
FT   intron          769810..769867
FT                   /gene="Pc16g03390"
FT                   /locus_tag="PCH_Pc16g03390"
FT                   /number=3
FT   exon            769868..772201
FT                   /gene="Pc16g03390"
FT                   /locus_tag="PCH_Pc16g03390"
FT                   /number=4
FT   intron          772202..772254
FT                   /gene="Pc16g03390"
FT                   /locus_tag="PCH_Pc16g03390"
FT                   /number=4
FT   exon            772255..772460
FT                   /gene="Pc16g03390"
FT                   /locus_tag="PCH_Pc16g03390"
FT                   /number=5
FT   mRNA            complement(join(<772518..772643,773044..773228,
FT                   773363..773426,773527..773666,773758..773905,
FT                   773994..774101,774180..774448,774656..774781,
FT                   775039..>775141))
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT   CDS_pept        complement(join(772518..772643,773044..773228,
FT                   773363..773426,773527..773666,773758..773905,
FT                   773994..774101,774180..774448,774656..774781,
FT                   775039..775141))
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93010"
FT                   /db_xref="UniProtKB/TrEMBL:B6H940"
FT                   /protein_id="CAP93010.1"
FT                   /translation="MWQVGDCLGCPGARVGAANGQGFNMRPVVRMRSIVNAHSHQSTVD
FT                   SPIEQSKCPVAFPRVSIQPATQVALSNDANSELCSDHDDILLRSHSRQPTSHNNIPTAW
FT                   PPLFQQNTNVSRRNAGTLQRDPSQRTHGWWPRWTKRRWSWIMGDIVYIYASVRPELVSQ
FT                   LGLVHLGIVSLKCFGDSVHRAGSMARESMGNGEAAPLSGGKVWVVGGNSYGVLGGLGVE
FT                   RILAGGVLLAMRNTGFSIVFSPTPWGGIPNGEVCWLGCGLEVFGFCDAWWCFGGLFWGL
FT                   FMAGVWAEESAMGRSTAGWFAAADICNSYLASSTSTVSGGHRSVGAICTVKFTHLQPHV
FT                   TASLAPPDRSPSSTSPFDQPSSPPRRNPLQTYFPPWKMQSPNSNVLRTASVTGKQMKTR
FT                   SWKSNRGIGVGGCQQCRARASHS"
FT   exon            complement(772518..772643)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=1
FT   intron          complement(772644..773043)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=1
FT   exon            complement(773044..773228)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=2
FT   intron          complement(773229..773362)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=2
FT   exon            complement(773363..773426)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=3
FT   intron          complement(773427..773526)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=3
FT   exon            complement(773527..773666)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=4
FT   intron          complement(773667..773757)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=4
FT   exon            complement(773758..773905)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=5
FT   intron          complement(773906..773993)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=5
FT   exon            complement(773994..774101)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=6
FT   intron          complement(774102..774179)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=6
FT   exon            complement(774180..774448)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=7
FT   intron          complement(774449..774655)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=7
FT   exon            complement(774656..774781)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=8
FT   intron          complement(774782..775038)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=8
FT   exon            complement(775039..775141)
FT                   /gene="Pc16g03400"
FT                   /locus_tag="PCH_Pc16g03400"
FT                   /number=9
FT   mRNA            join(<775158..775280,775353..775490,775548..775658,
FT                   775718..775864,775934..776307,776371..776665,
FT                   776716..776919,776970..777142,777195..>777960)
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT   CDS_pept        join(775158..775280,775353..775490,775548..775658,
FT                   775718..775864,775934..776307,776371..776665,
FT                   776716..776919,776970..777142,777195..777960)
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /note="Title: strong similarity to hypothetical 105-kDa
FT                   kinase-like protein - Mus musculus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93011"
FT                   /db_xref="GOA:B6H941"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR032682"
FT                   /db_xref="UniProtKB/TrEMBL:B6H941"
FT                   /inference="similar to AA sequence:TREMBL:AF276514.1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP93011.1"
FT                   /translation="MDFLKSAIGSAIAKGGGLPFSLGDRVDIGDTVWALHNGTKRDDGS
FT                   ACSVFAFDINGNKSRLPLAKNAVRKSRTLRHPGVIKVLDTIETEHNLYIVTERVVPLSW
FT                   PVKRRSLSEETAKWGLYTVASTLKFINDDAASVHGAVRASSVFTSESGEWKLGGFDILS
FT                   SMKEDDAIIYTYGSSVPDAARYTPPEVVKTGWDTIKRNPLAAVDAYGLGILIFEVFNGG
FT                   FSGGDQAGKTTNIPPSMQQSYKRLCTANPKLRLSPGHFVEQGKKQGGFFQTPLIRMTED
FT                   IDSLGLKNDAEREEFINELDDLSGDFPEEFFKMKVLPELLKSVEFGGGGPKVLGATLKI
FT                   GAKLSAEEFNAKLTPVIVRLFGNPDRALRVCLLDNLPSMIDNLPQRVVNDKIFPQMTSG
FT                   FTDVAPVVREQTVKAVLTIVNKLNDRIVNGELLKFLARTANDEQPGIRTNTTICLGRIA
FT                   KNLSQSTRSKVLIAAFTRSIRDPFVHARNAGLLALSATIDVFSEEDCAVRILPAICPAL
FT                   LDKEKLIRDQANKTLDLYVQRTRKYASTMPDTVLPPAAPAEVNKPDARVGTPSDNSWAG
FT                   WAISSFTNKIATANGEIEPTANTNKTLDPDTARSASVPRPSKPTPPTELPKQVLRPTAQ
FT                   PLNRSMSDRPAPVVHDEEPEEEGDDVFDAWGAMDDDEKDDDPFTAAVATPKPTSPVPSS
FT                   TKAPVVPYDDGGEPDFAGWLAAKSQTKAKNPLPKGLTKTASANAVTTRSTISSAKPRTV
FT                   VAPKKIDTKPKDEEADDWGDAWD"
FT   exon            775158..775280
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=1
FT   intron          775281..775352
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=1
FT   exon            775353..775490
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=2
FT   intron          775491..775547
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=2
FT   exon            775548..775658
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=3
FT   intron          775659..775717
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=3
FT   exon            775718..775864
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=4
FT   intron          775865..775933
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=4
FT   exon            775934..776307
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=5
FT   intron          776308..776370
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=5
FT   exon            776371..776665
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=6
FT   intron          776666..776715
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=6
FT   exon            776716..776919
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=7
FT   intron          776920..776969
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=7
FT   exon            776970..777142
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=8
FT   intron          777143..777194
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=8
FT   exon            777195..777960
FT                   /gene="Pc16g03410"
FT                   /locus_tag="PCH_Pc16g03410"
FT                   /number=9
FT   mRNA            complement(<778253..>780637)
FT                   /gene="Pc16g03420"
FT                   /locus_tag="PCH_Pc16g03420"
FT   CDS_pept        complement(778253..780637)
FT                   /gene="Pc16g03420"
FT                   /locus_tag="PCH_Pc16g03420"
FT                   /note="Title: weak similarity to normocyte binding protein
FT                   2a - Plasmodium falciparum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93012"
FT                   /db_xref="UniProtKB/TrEMBL:B6H942"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /inference="protein motif:COGS:COG0557"
FT                   /inference="protein motif:COGS:COG0542"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP93012.1"
FT                   /translation="MSKGKRRRRHSKAVQQTQPPAPSLPTPVTEPGRQRKRKRNHHKAK
FT                   KRPLSSSQVYRKDGLNSESPQGGSSNHPPTDQERKNPRSVHSSQVKVQEQRSPAKRSTT
FT                   PLQRAPKTKGGYGSDSEFEFEYINKAQAQLKPRVALRSPPSSPQKVAGPKNTTPVSGNE
FT                   RGNDVRAISADGDSESERERELASPSPLLPSPQRALPLENTTPVSNHDRQRTSRGASLS
FT                   NTTLESQPVFTPEPERRSSQSSGTSLERVVGHEEATPASYSVYGHRIRESSASDTDVEP
FT                   ENASEAEPGHGPEWSLSSSSPCNKTARNRKRPNAHIASRRKAAPLPAPSSLDCLPEIES
FT                   EPTLPSMDNLTFSESALRNFRVDHWRKACEPKEPPLPSRSDLSKVIGPSSPSVFVLMSE
FT                   FQPPESEVESRYASPSPTQITPASSPPVPPTVPRVRSRVRSRLPSPQRWLSRLGRPVQK
FT                   PALRETVWTSRLRPTCEIYFTNKPLLINSMRYPHLSAEFPPDAHGNPEFEFWDNSDDDS
FT                   DFELPEDIEPPEAKRRRLWSSEDSPETELAERESSLESEELSELELLESSEPEAHIDLE
FT                   PLLLDIAGSSDPQPLPELERSSDTGRSSNRESEHPHPPTSIRDELPVRQSRQLNKRIDE
FT                   AIARDKEENPKFWGGSWMKEYERGVPIKERAEAEYKEEMAKKKEEAETKKREKQERDRI
FT                   LKEKRERKRKEMAEQKVRLEREKQKRMEEQERQQKERQKREELERRRAKARAGKRPKNV
FT                   ESALQEMLDERETTDVEMSVDPEGLKVAQTAYRLYMRKKAR"
FT   exon            complement(778253..780637)
FT                   /gene="Pc16g03420"
FT                   /locus_tag="PCH_Pc16g03420"
FT                   /number=1
FT   mRNA            complement(<781313..>782782)
FT                   /gene="Pc16g03430"
FT                   /locus_tag="PCH_Pc16g03430"
FT   CDS_pept        complement(781313..782782)
FT                   /gene="Pc16g03430"
FT                   /locus_tag="PCH_Pc16g03430"
FT                   /note="Title: strong similarity to monoamine oxidase MAO
FT                   -Oncorhynchus mykiss"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93013"
FT                   /db_xref="GOA:B6H943"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6H943"
FT                   /inference="similar to AA sequence:PIR:I51346"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /inference="protein motif:COGS:COG1231"
FT                   /inference="protein motif:COGS:COG3349"
FT                   /inference="protein motif:COGS:COG1249"
FT                   /protein_id="CAP93013.1"
FT                   /translation="MRLVLSRSSFSVMHLFLIAIPLCHALVATPSIPEVDVAIIGGGLS
FT                   GLSAAKELAAANKSIVVLEARDRVGGRVLNANLAGKDVQELGGEYIGPTQNRVLALAAE
FT                   LGLPTYKTYTEGNSTFYRNGTARHYKDGLGGIPPVGLDTLVELAVFMTDINNLASTVDL
FT                   EEPWNTPNATALDSMTLETYVNSKLSTSDSRVLLDVAIPAILSTEMKEPSLLYSLWCIA
FT                   AAGDETGPGTINRLIGVDGGAQDSRVSGGTQLLATLLAERLGSENIYLDTPVRKVQLKE
FT                   SRYLVSSDENTVSARHVVCAMSPPLVTRITFDPPLPAGRDQLNQRMPMGALGKAIAIYP
FT                   SAWWRDEGLNGVGVSDTGAIRVTYDNSPADGSFGAMMGFIEADEMRKLDTASEDEVKRQ
FT                   VKQSFANLFGPRVDDATDVLIQRWDLEEFSRGGPSALMPPGVLTQYGSYLRAPVGRIHF
FT                   AGTETSLRWIGYMDGAISSGERVAGEILENW"
FT   exon            complement(781313..782782)
FT                   /gene="Pc16g03430"
FT                   /locus_tag="PCH_Pc16g03430"
FT                   /number=1
FT   mat_peptide     complement(781316..782707)
FT                   /gene="Pc16g03430"
FT                   /locus_tag="PCH_Pc16g03430"
FT   sig_peptide     complement(782708..782782)
FT                   /gene="Pc16g03430"
FT                   /locus_tag="PCH_Pc16g03430"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<783190..784491,784542..784560,
FT                   784730..>785049))
FT                   /gene="Pc16g03440"
FT                   /locus_tag="PCH_Pc16g03440"
FT   CDS_pept        complement(join(783190..784491,784542..784560,
FT                   784730..785049))
FT                   /gene="Pc16g03440"
FT                   /locus_tag="PCH_Pc16g03440"
FT                   /note="Title: similarity to Uncoordinated protein 89
FT                   (isoform b) - Caenorhabditis elegans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93014"
FT                   /db_xref="UniProtKB/TrEMBL:B6H944"
FT                   /inference="protein motif:COGS:COG1643"
FT                   /inference="protein motif:COGS:COG5271"
FT                   /inference="protein motif:COGS:COG5021"
FT                   /inference="protein motif:COGS:COG1511"
FT                   /inference="protein motif:COGS:COG0265"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /inference="protein motif:COGS:COG3942"
FT                   /inference="protein motif:COGS:COG0553"
FT                   /inference="protein motif:COGS:COG5210"
FT                   /inference="protein motif:COGS:COG5024"
FT                   /inference="protein motif:COGS:COG4547"
FT                   /protein_id="CAP93014.1"
FT                   /translation="MASDQRFQRTVQAVAEAVQTFAVGTFDFAESIKKIWGPQTQPDAV
FT                   ETSDPLPVEGMQDVQTVDQLRDRTPVSQDSDHLSTHSHSYPLSEAMDDGESYVMHERIA
FT                   PSEQIPCQMIPADGIGKILHYKMEAGIYLTMQNGFGQIERQRFVDVFREAAELLGISLP
FT                   SPIADLPQQQVGSKRVYQGSDDQQPVAKRQRTQDLLQEDVQGAPEDGEFSSSEEEEVAQ
FT                   IKVQLNRQERSPVKIPDQVPVVHKMTQEYVIHPEEENTGSSSFTQKESSEHSSSEEDGD
FT                   DYFSEEEEEGVQNPTKEVSQAEHNAKAKTAIRPQDEHSELSSCSSEDESSEDDSSERES
FT                   DDEAEPRQQQTTKEDSPKGPTYNSKEPIQSPDDKSSDSSAEDESSDELSEAELEEQIEK
FT                   HLATPEAFFQMEPILLEDSDAFESSASSSEDESSSEESDDEQEEPKQQPTTKEQPPNKG
FT                   GTHNSKEPIQLTNDKSSNSSSEDESSEEESGDEPEGPKKQPAVKSEPQRREERPEEPIE
FT                   VAGGESPSPSSSSSSSSEDESSEDSEIET"
FT   exon            complement(783190..784491)
FT                   /gene="Pc16g03440"
FT                   /locus_tag="PCH_Pc16g03440"
FT                   /number=1
FT   intron          complement(784492..784541)
FT                   /gene="Pc16g03440"
FT                   /locus_tag="PCH_Pc16g03440"
FT                   /number=1
FT   exon            complement(784542..784560)
FT                   /gene="Pc16g03440"
FT                   /locus_tag="PCH_Pc16g03440"
FT                   /number=2
FT   intron          complement(784561..784729)
FT                   /gene="Pc16g03440"
FT                   /locus_tag="PCH_Pc16g03440"
FT                   /number=2
FT   exon            complement(784730..785049)
FT                   /gene="Pc16g03440"
FT                   /locus_tag="PCH_Pc16g03440"
FT                   /number=3
FT   mRNA            join(<786192..786440,786504..786625,786684..787255,
FT                   787304..>787932)
FT                   /gene="Pc16g03450"
FT                   /locus_tag="PCH_Pc16g03450"
FT   CDS_pept        join(786192..786440,786504..786625,786684..787255,
FT                   787304..787932)
FT                   /gene="Pc16g03450"
FT                   /locus_tag="PCH_Pc16g03450"
FT                   /note="Title: strong similarity to hypothetical conserved
FT                   protein CAD21291.1 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93015"
FT                   /db_xref="GOA:B6H945"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:B6H945"
FT                   /inference="similar to AA sequence:TREMBL:NCG15G9.4"
FT                   /inference="protein motif:PFAM:PF02417"
FT                   /inference="protein motif:COGS:COG2059"
FT                   /protein_id="CAP93015.1"
FT                   /translation="MPLAPFSQALSSLARLNEKRASRVSSENEGSVKPLPTRLLDVFLR
FT                   TWDLGFTAFGGPPVHFQILHSRFVEGKGDKEKWVDEQTYQELFAICQGLPGPGSTKMVF
FT                   CLALLHAGFIPAMLVFLIWALPGAIGMYALSLGVQSMSETLPEPAYALLSGLNASTVGI
FT                   VALAAVQLAEKAIRDKISRILVIFGACAGLCYNALWYFPVLMVIGGFATTIWDGWMYQQ
FT                   FLRAKLAWKNRHHRPQQADEANGDSIAMDDTALEENGVQRSETPRSRRADRRVEGLPQN
FT                   TGNTTSPTPPVEAALQQHIIRIRVGVLIMCLFFASFIAILVARGQLAAPPLVLDLFANM
FT                   YLAGTVIFGGGPVVIPLLRSYVVDPGWVSSRDFLIGLAIIQAFPGPNFNFAVFLGALAL
FT                   QRSQFPTVFGAFLGGLGIFLPGITLAVAIQSFWRVLRKKKYVVDFLRGVNATAVGLVFT
FT                   AVYRLWEIGYLTSERNNGQSLGKEPWWVVVAAVTYSGSAWFKVPPPVAIVMGAILGLCW
FT                   YGAVGR"
FT   exon            786192..786440
FT                   /gene="Pc16g03450"
FT                   /locus_tag="PCH_Pc16g03450"
FT                   /number=1
FT   intron          786441..786503
FT                   /gene="Pc16g03450"
FT                   /locus_tag="PCH_Pc16g03450"
FT                   /number=1
FT   exon            786504..786625
FT                   /gene="Pc16g03450"
FT                   /locus_tag="PCH_Pc16g03450"
FT                   /number=2
FT   intron          786626..786683
FT                   /gene="Pc16g03450"
FT                   /locus_tag="PCH_Pc16g03450"
FT                   /number=2
FT   exon            786684..787255
FT                   /gene="Pc16g03450"
FT                   /locus_tag="PCH_Pc16g03450"
FT                   /number=3
FT   intron          787256..787303
FT                   /gene="Pc16g03450"
FT                   /locus_tag="PCH_Pc16g03450"
FT                   /number=3
FT   exon            787304..787932
FT                   /gene="Pc16g03450"
FT                   /locus_tag="PCH_Pc16g03450"
FT                   /number=4
FT   mRNA            join(<788358..788621,788704..>789392)
FT                   /pseudo
FT                   /gene="Pc16g03460"
FT                   /locus_tag="PCH_Pc16g03460"
FT                   /note="submitted as non-pseudo"
FT   CDS_pept        join(788358..788621,788704..789392)
FT                   /pseudo
FT                   /gene="Pc16g03460"
FT                   /locus_tag="PCH_Pc16g03460"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_51_scaffold_3.tfa_150wg - Aspergillus nidulans"
FT   sig_peptide     788358..788459
FT                   /gene="Pc16g03460"
FT                   /locus_tag="PCH_Pc16g03460"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            788358..788621
FT                   /gene="Pc16g03460"
FT                   /locus_tag="PCH_Pc16g03460"
FT                   /number=1
FT   mat_peptide     join(788460..788621,788704..789389)
FT                   /gene="Pc16g03460"
FT                   /locus_tag="PCH_Pc16g03460"
FT   intron          788622..788703
FT                   /gene="Pc16g03460"
FT                   /locus_tag="PCH_Pc16g03460"
FT                   /number=1
FT   exon            788704..789392
FT                   /gene="Pc16g03460"
FT                   /locus_tag="PCH_Pc16g03460"
FT                   /number=2
FT   mRNA            join(<790621..791033,791093..>791204)
FT                   /gene="Pc16g03470"
FT                   /locus_tag="PCH_Pc16g03470"
FT   CDS_pept        join(790621..791033,791093..791204)
FT                   /gene="Pc16g03470"
FT                   /locus_tag="PCH_Pc16g03470"
FT                   /note="Title: similarity to hypothetical protein mg02561.1
FT                   - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93017"
FT                   /db_xref="UniProtKB/TrEMBL:B6H946"
FT                   /protein_id="CAP93017.1"
FT                   /translation="MVHQTDMLAPPEAASFYITPEYADKLANKTIPWVRQKLDTDNLGD
FT                   RLFATSRVQEADPDDILQRNKYRTIILGALMIRAGARIKAADLQHLRDLVPQINCTSRR
FT                   MLFDHGFRTPGKVQFLAALDYYQPGVPRSFQEPSCFMCGKIEDDIGHTPLQCKKCKVAT
FT                   YCGKVSRMDTS"
FT   exon            790621..791033
FT                   /gene="Pc16g03470"
FT                   /locus_tag="PCH_Pc16g03470"
FT                   /number=1
FT   intron          791034..791092
FT                   /gene="Pc16g03470"
FT                   /locus_tag="PCH_Pc16g03470"
FT                   /number=1
FT   exon            791093..791204
FT                   /gene="Pc16g03470"
FT                   /locus_tag="PCH_Pc16g03470"
FT                   /number=2
FT   mRNA            <792281..>793333
FT                   /gene="Pc16g03480"
FT                   /locus_tag="PCH_Pc16g03480"
FT   CDS_pept        792281..793333
FT                   /gene="Pc16g03480"
FT                   /locus_tag="PCH_Pc16g03480"
FT                   /note="Title: weak similarity to ecto-ATPase c-cam105
FT                   -Rattus norvegicus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93018"
FT                   /db_xref="UniProtKB/TrEMBL:B6H947"
FT                   /inference="similar to AA sequence:SWISSPROT:ECTO_RAT"
FT                   /protein_id="CAP93018.1"
FT                   /translation="MTRLTTIFTTLYALYSLPLISAWTFVWRNAANNPTVEKGTDAQSC
FT                   KAIDHAKGKDFKFDAEDSLFRIYMYGSPNCTDDNIESAEDYLARNSTSPLRAFAVIDLR
FT                   GANTSTGGELTPFPGADWFKSSPNSPIITAMGERLVAENCGKYRVGPGPQWSEVDRESY
FT                   QCWQKKLGYTGTDANGWPGKTTWDQLKVSLTDGNDGGSSKTTETPPSATTSTATSTGTG
FT                   TGTGTPTSTSVPDTDTSSGSALSGGEIAGSVVGSVAGLGLVGAMIYLSRRIFRHRAPAS
FT                   GDEGPEPDSEGGAMAVGGSKRWAREKLPFEVEADPAKNRKKYISELPGDTAAAELSDSR
FT                   RVLELGDSRT"
FT   sig_peptide     792281..792346
FT                   /gene="Pc16g03480"
FT                   /locus_tag="PCH_Pc16g03480"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            792281..793333
FT                   /gene="Pc16g03480"
FT                   /locus_tag="PCH_Pc16g03480"
FT                   /number=1
FT   mat_peptide     792347..793330
FT                   /gene="Pc16g03480"
FT                   /locus_tag="PCH_Pc16g03480"
FT   mRNA            complement(join(<793702..794442,794658..>794946))
FT                   /gene="Pc16g03490"
FT                   /locus_tag="PCH_Pc16g03490"
FT   CDS_pept        complement(join(793702..794442,794658..794946))
FT                   /pseudo
FT                   /gene="Pc16g03490"
FT                   /locus_tag="PCH_Pc16g03490"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An02g04650 - Aspergillus niger [putative pseudogene]"
FT   exon            complement(793702..794442)
FT                   /gene="Pc16g03490"
FT                   /locus_tag="PCH_Pc16g03490"
FT                   /number=1
FT   intron          complement(794443..794657)
FT                   /gene="Pc16g03490"
FT                   /locus_tag="PCH_Pc16g03490"
FT                   /number=1
FT   exon            complement(794658..794946)
FT                   /gene="Pc16g03490"
FT                   /locus_tag="PCH_Pc16g03490"
FT                   /number=2
FT   mRNA            complement(join(<795163..795495,795553..>795885))
FT                   /gene="Pc16g03500"
FT                   /locus_tag="PCH_Pc16g03500"
FT   CDS_pept        complement(join(795163..795495,795553..795885))
FT                   /pseudo
FT                   /gene="Pc16g03500"
FT                   /locus_tag="PCH_Pc16g03500"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPAC869.06c - Schizosaccharomyces pombe [putative
FT                   pseudogene]"
FT                   /inference="similar to AA sequence:PIR:T39117"
FT                   /inference="protein motif:PFAM:PF03794"
FT                   /inference="protein motif:COGS:COG5592"
FT                   /inference="protein motif:COGS:COG2846"
FT                   /inference="protein motif:COGS:COG3945"
FT                   /inference="protein motif:COGS:COG2461"
FT   exon            complement(795163..795495)
FT                   /gene="Pc16g03500"
FT                   /locus_tag="PCH_Pc16g03500"
FT                   /number=1
FT   intron          complement(795496..795552)
FT                   /gene="Pc16g03500"
FT                   /locus_tag="PCH_Pc16g03500"
FT                   /number=1
FT   exon            complement(795553..795885)
FT                   /gene="Pc16g03500"
FT                   /locus_tag="PCH_Pc16g03500"
FT                   /number=2
FT   mRNA            complement(<798588..>799796)
FT                   /gene="Pc16g03510"
FT                   /locus_tag="PCH_Pc16g03510"
FT   CDS_pept        complement(798588..799796)
FT                   /pseudo
FT                   /gene="Pc16g03510"
FT                   /locus_tag="PCH_Pc16g03510"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An18g05700 - Aspergillus niger [putative pseudogene]"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /inference="protein motif:COGS:COG1064"
FT                   /inference="protein motif:COGS:COG0604"
FT                   /inference="protein motif:COGS:COG1062"
FT                   /inference="protein motif:COGS:COG1063"
FT   exon            complement(798588..799796)
FT                   /gene="Pc16g03510"
FT                   /locus_tag="PCH_Pc16g03510"
FT                   /number=1
FT   mRNA            complement(<801679..>803790)
FT                   /gene="Pc16g03520"
FT                   /locus_tag="PCH_Pc16g03520"
FT   CDS_pept        complement(801679..803790)
FT                   /gene="Pc16g03520"
FT                   /locus_tag="PCH_Pc16g03520"
FT                   /note="unknown EC_number=2.7.3.-"
FT                   /note="Title: strong similarity to histidine kinase tcsA
FT                   -Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93022"
FT                   /db_xref="GOA:B6H948"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6H948"
FT                   /inference="similar to AA sequence:TREMBL:ANI271843.2"
FT                   /inference="protein motif:PFAM:PF00785"
FT                   /inference="protein motif:PFAM:PF00512"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /inference="protein motif:COGS:COG0642"
FT                   /inference="protein motif:COGS:COG5002"
FT                   /protein_id="CAP93022.1"
FT                   /translation="MALTSGLQALTVDDTSRPACKPLITTPVGEEETAPAEPNRSSNSK
FT                   EKKMETPQECVGLDASLSRIYRYHPIPTLIVDKSLCVVEVSDSHCAFSGQSRDELVGTC
FT                   VCDVPVHTIPAPDTPTLYGALRTAIVSEKVQILDGIHVKSKNSIYQLRITPIFEKSSLI
FT                   YVVLEAQNAPQDHCVGTDEQHANMNEIYKILVDTMKDYAIFMLDTRGNVTTWNLGAELL
FT                   KGYSPSEIIGKHFSIFYSPADLDIDKPGRGLARALRQGRMEDEGWRYRQDGSRFWANVL
FT                   ITPIYQLGRHMGFVKVTRDLTERKAAEQRMIVAFEESAKMKTDFLANMSHELRTPMNGM
FT                   QLALAMMKDSDLTEQQLEYASIIEDSTSVLLRIINDVLDYSKLSSGSFSLHSDVVEIKG
FT                   ILDAVMRNCRSLLKPGVELSCLIPPDLPKFMRGDPLRYRQVIQNMLGNSVKFTETGYIR
FT                   VSTTFSPVESDPETYTVTTEFADSGVGIPDCALNTLFTPFTRFADSSTRKYQGTGLGLS
FT                   ICKSLAELMDGTVGYRPGPQNKGSVFWFTARMGRVGTGYSNAQPAIPSTDDAKDLLNRV
FT                   RGIAPRKRVLLVEDNLVNQTVMLKLLQSLEFERIDVAGDGAEAVRQVKQTPLSYNVVLM
FT                   DISMPVTDGLEATSQIRGMGIDVPIVALTANALKGDMETYLANGMNDYIGKPVNRDQLL
FT                   QVLWKWIGA"
FT   exon            complement(801679..803790)
FT                   /gene="Pc16g03520"
FT                   /locus_tag="PCH_Pc16g03520"
FT                   /number=1
FT   mRNA            complement(<804873..>805734)
FT                   /gene="Pc16g03530"
FT                   /locus_tag="PCH_Pc16g03530"
FT   CDS_pept        complement(804873..805734)
FT                   /pseudo
FT                   /gene="Pc16g03530"
FT                   /locus_tag="PCH_Pc16g03530"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to transcription factor
FT                   like protein An02g06940 - Aspergillus niger [putative
FT                   pseudogene]"
FT   exon            complement(804873..805734)
FT                   /gene="Pc16g03530"
FT                   /locus_tag="PCH_Pc16g03530"
FT                   /number=1
FT   mRNA            complement(join(<807170..807365,807395..807410,
FT                   808056..808260,808322..808329,808360..808519,
FT                   808623..808676,808788..808916,808975..808980,
FT                   809162..809611,809678..>809749))
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT   CDS_pept        complement(join(807170..807365,807395..807410,
FT                   808056..808260,808322..808329,808360..808519,
FT                   808623..808676,808788..808916,808975..808980,
FT                   809162..809611,809678..809749))
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93024"
FT                   /db_xref="UniProtKB/TrEMBL:B6H949"
FT                   /protein_id="CAP93024.1"
FT                   /translation="MSLLLIHYIRNFGYTTKDGASSWQRKGPTALRKRCGDYPICYFNA
FT                   LSHDQEISGVQVASVSLRLPIYCAVNYSLSGINLWALRRYVRQFQPDNVERSRSSGLRA
FT                   AVHCAYETAPLSIFDNHKWRDPHLAPVGLFIYMLVGTKDIHHAIADDVDLVSLPANISL
FT                   LSPSIQYNALRWTHNAFIGAEVHIFGNFALQVPGSAILIHKCEADAFYLSSKTFSKKYL
FT                   EVQERPLEMIMDQLRIISLSKIELTWASFRHQRIPSGDSEVAQLLWFPEDISSRPAVGL
FT                   VPGSRKLTLGPKGTFVWVAPLCGNTAATLDHKDDLQVGIATIVKNPARLTYSIIVSITI
FT                   AQRPVRLWQTTAFARRIRLLEVILVSRLVQPLAAELHTKVMGYRPSALSFQQPLALPSI
FT                   CLWEVHFSILQGDLPREQPGISFSSYDPGERY"
FT   exon            complement(807170..807365)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=1
FT   intron          complement(807366..807394)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=1
FT   exon            complement(807395..807410)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=2
FT   intron          complement(807411..808055)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=2
FT   exon            complement(808056..808260)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=3
FT   intron          complement(808261..808321)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=3
FT   exon            complement(808322..808329)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=4
FT   intron          complement(808330..808359)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=4
FT   exon            complement(808360..808519)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=5
FT   intron          complement(808520..808622)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=5
FT   exon            complement(808623..808676)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=6
FT   intron          complement(808677..808787)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=6
FT   exon            complement(808788..808916)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=7
FT   intron          complement(808917..808974)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=7
FT   exon            complement(808975..808980)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=8
FT   intron          complement(808981..809161)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=8
FT   exon            complement(809162..809611)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=9
FT   intron          complement(809612..809677)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=9
FT   exon            complement(809678..809749)
FT                   /gene="Pc16g03540"
FT                   /locus_tag="PCH_Pc16g03540"
FT                   /number=10
FT   mRNA            join(<809986..810007,810201..810266,810382..810489,
FT                   810587..810694,810788..811010,811113..811202,
FT                   811638..>811704)
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT   CDS_pept        join(809986..810007,810201..810266,810382..810489,
FT                   810587..810694,810788..811010,811113..811202,
FT                   811638..811704)
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03550"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93025"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T5"
FT                   /protein_id="CAP93025.1"
FT                   /translation="MDLWGEAGAIALMIIGDESRHWVQSLSDGVDPVKYPKLDFLSPTP
FT                   IPGDTAFLDRSPRQQQYNSGATGLDVAVASWAVTLPVVKTFTDYFTPASIRARDFAAKD
FT                   PRTYAPIVSHFLQQSLDDWMPSSVASCARLAAPWSCFTVSEAMPSIGIQFYRLVRNVLP
FT                   IEDFWSWVTSYSIRFYGICLADSTNASLSALSIHHPLFTLLSRGQSRDQHEQLSQSEPP
FT                   TYLPT"
FT   exon            809986..810007
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /number=1
FT   intron          810008..810200
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /number=1
FT   exon            810201..810266
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /number=2
FT   intron          810267..810381
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /number=2
FT   exon            810382..810489
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /number=3
FT   intron          810490..810586
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /number=3
FT   exon            810587..810694
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /number=4
FT   intron          810695..810787
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /number=4
FT   exon            810788..811010
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /number=5
FT   intron          811011..811112
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /number=5
FT   exon            811113..811202
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /number=6
FT   intron          811203..811637
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /number=6
FT   exon            811638..811704
FT                   /gene="Pc16g03550"
FT                   /locus_tag="PCH_Pc16g03550"
FT                   /number=7
FT   mRNA            join(<812947..813329,813389..813495,813562..814222,
FT                   814275..>815358)
FT                   /gene="Pc16g03560"
FT                   /locus_tag="PCH_Pc16g03560"
FT   CDS_pept        join(812947..813329,813389..813495,813562..814222,
FT                   814275..815358)
FT                   /gene="Pc16g03560"
FT                   /locus_tag="PCH_Pc16g03560"
FT                   /note="Title: similarity to thiamine repressible gene thi1p
FT                   - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03560"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93026"
FT                   /db_xref="GOA:B6H7S2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S2"
FT                   /inference="similar to AA sequence:PIR:S41962"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP93026.1"
FT                   /translation="MDSKEARTFSPHDNALGATSNETPASSVQSWFDRHPNTLESNVSS
FT                   ALSSNPSQPLTESLASQPPIEKIAIPRGPDRRIWKSNRRVSRACDICREQKVKCSGDRP
FT                   ACRRCHEGDITCIYTDGKREEEARQSAQLMSQVRVYEDLLRSLHPLLDRQLAIQIEKVV
FT                   STPSTTPKTTPDTQQVQRNPIQPTDHTIEDFNRSENTQAAGLLGRPSEVAWLSRLHCEM
FT                   DQHMKPEYPLGRSEQTPLLSTNYFLDDLQNPMAYPNEFLEWPSEEAASQLVDSYFHIVH
FT                   ASFPFVGKLYFLKQFRIFYANPRKQPGWAWMAVFNLVLAIATRHSSLMRKEPEAGTGTH
FT                   MSYFTRAWQLCMRNYAMFDHPNLQQVQVESLMSLYMLSIGHVNRAWRMCGVAMRSAVAM
FT                   GIHLRSESESISYISKETRYRLWWALYSLDIQLCSMTGRPPNMSLEYCTAFLPAPHREE
FT                   DFHEDHVSRFIADDHTRRALFSSFISRAFKLDGQGNNLHAEPLHHSAISEEDDVPRIAS
FT                   VASTAKPNASVYFLYRLSLTCIGRAALDEIHSPSTASLSWDELESTIAKNNASADDWLA
FT                   ELPHIYHFEKPSPNCPFVRQRTSLAFQFYSIKLIILEPCLRRAIRVSFDGPCSKHCQSM
FT                   ATLCMQVAGSVINLLCDKVDVRWLYGYCPWWSIVHYIMQCSTILLVGLVGQIDLGEIQN
FT                   AATVRNVKKACGWLFEMSKTDDYSKRAWGIYSRLAAHHNPDLVLPSTSTS"
FT   exon            812947..813329
FT                   /gene="Pc16g03560"
FT                   /locus_tag="PCH_Pc16g03560"
FT                   /number=1
FT   intron          813330..813388
FT                   /gene="Pc16g03560"
FT                   /locus_tag="PCH_Pc16g03560"
FT                   /number=1
FT   exon            813389..813495
FT                   /gene="Pc16g03560"
FT                   /locus_tag="PCH_Pc16g03560"
FT                   /number=2
FT   intron          813496..813561
FT                   /gene="Pc16g03560"
FT                   /locus_tag="PCH_Pc16g03560"
FT                   /number=2
FT   exon            813562..814222
FT                   /gene="Pc16g03560"
FT                   /locus_tag="PCH_Pc16g03560"
FT                   /number=3
FT   intron          814223..814274
FT                   /gene="Pc16g03560"
FT                   /locus_tag="PCH_Pc16g03560"
FT                   /number=3
FT   exon            814275..815358
FT                   /gene="Pc16g03560"
FT                   /locus_tag="PCH_Pc16g03560"
FT                   /number=4
FT   mRNA            complement(<815712..>816176)
FT                   /gene="Pc16g03570"
FT                   /locus_tag="PCH_Pc16g03570"
FT   CDS_pept        complement(815712..816176)
FT                   /pseudo
FT                   /gene="Pc16g03570"
FT                   /locus_tag="PCH_Pc16g03570"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to protein encoded by ORF1 of
FT                   transposon Ant1 - Aspergillus niger [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:S80872.1"
FT                   /inference="protein motif:COGS:COG3335"
FT   exon            complement(815712..816176)
FT                   /gene="Pc16g03570"
FT                   /locus_tag="PCH_Pc16g03570"
FT                   /number=1
FT   mRNA            <816215..>816769
FT                   /gene="Pc16g03580"
FT                   /locus_tag="PCH_Pc16g03580"
FT   CDS_pept        816215..816769
FT                   /gene="Pc16g03580"
FT                   /locus_tag="PCH_Pc16g03580"
FT                   /note="Title: similarity to hypothetical protein An08g10210
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03580"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93028"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S3"
FT                   /protein_id="CAP93028.1"
FT                   /translation="MRFTFAPDTFRLISHTQWLQTGFNLVLGCKLAVTGAKYAPRSPHV
FT                   RDLCSALNMPGVLRAALQRIQWLSKDRVTVDGKQHSKYFYEAWLCRILVWFEQKYHLVP
FT                   SEDTTQISTGPSTLANSATSQDVPLTGENYGATQVAQVDDTALWPDFLWNISTDDILNG
FT                   YMGFPDMPYPTLQPGYHVPLP"
FT   exon            816215..816769
FT                   /gene="Pc16g03580"
FT                   /locus_tag="PCH_Pc16g03580"
FT                   /number=1
FT   mRNA            complement(join(<816879..817155,817205..>817364))
FT                   /pseudo
FT                   /gene="Pc16g03590"
FT                   /locus_tag="PCH_Pc16g03590"
FT                   /note="submitted as non-pseudo"
FT   CDS_pept        complement(join(816879..817155,817205..817364))
FT                   /pseudo
FT                   /gene="Pc16g03590"
FT                   /locus_tag="PCH_Pc16g03590"
FT                   /note="submitted as non-pseudo"
FT                   /note="unknown EC_number=1.1.1.-"
FT                   /note="Title: weak similarity to short-chain alcohol
FT                   dehydrogenase adhA - Aspergillus parasiticus"
FT                   /inference="similar to AA sequence:TREMBL:APU76621.1"
FT   exon            complement(816879..817155)
FT                   /gene="Pc16g03590"
FT                   /locus_tag="PCH_Pc16g03590"
FT                   /number=1
FT   intron          complement(817156..817204)
FT                   /gene="Pc16g03590"
FT                   /locus_tag="PCH_Pc16g03590"
FT                   /number=1
FT   exon            complement(817205..817364)
FT                   /gene="Pc16g03590"
FT                   /locus_tag="PCH_Pc16g03590"
FT                   /number=2
FT   mRNA            complement(join(<817614..817837,817906..>818299))
FT                   /gene="Pc16g03600"
FT                   /locus_tag="PCH_Pc16g03600"
FT   CDS_pept        complement(join(817614..817837,817906..818299))
FT                   /gene="Pc16g03600"
FT                   /locus_tag="PCH_Pc16g03600"
FT                   /note="unknown EC_number=2.3.1.-"
FT                   /note="Title: strong similarity to phosphinothricin
FT                   acetyltransferase like protein An04g09830 - Aspergillus
FT                   niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03600"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93030"
FT                   /db_xref="GOA:B6H7S4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S4"
FT                   /inference="similar to AA sequence:TREMBL:SCO939123.30"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="CAP93030.1"
FT                   /translation="MGSATNSLVLELATPEDIPAITEVWFASFTQPVIGKLFPNTPGMH
FT                   QWHRDWHLGDIQKPHHRYLRVVDTESKDEQGRPRLVAFGKWDLAMPDERGRRFPQWHAD
FT                   SPYQECEDFIAELEQARKRVMGDEKHYYLDTLGTHPDYQRRGAGSMLVQWGCDLADKDG
FT                   VAAYVDASKEGASLYLKHGFVNFNPPGSDVAAMARRKAAPSC"
FT   exon            complement(817614..817837)
FT                   /gene="Pc16g03600"
FT                   /locus_tag="PCH_Pc16g03600"
FT                   /number=1
FT   intron          complement(817838..817905)
FT                   /gene="Pc16g03600"
FT                   /locus_tag="PCH_Pc16g03600"
FT                   /number=1
FT   exon            complement(817906..818299)
FT                   /gene="Pc16g03600"
FT                   /locus_tag="PCH_Pc16g03600"
FT                   /number=2
FT   mRNA            <818395..>818739
FT                   /gene="Pc16g03610"
FT                   /locus_tag="PCH_Pc16g03610"
FT   CDS_pept        818395..818739
FT                   /gene="Pc16g03610"
FT                   /locus_tag="PCH_Pc16g03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03610"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93031"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S5"
FT                   /protein_id="CAP93031.1"
FT                   /translation="MGNGWGMFPGEIWPRDENKTRLMVAGDMGMGFKGRVGQGHIKRKR
FT                   EETGADKRVAMGAWIYNSSNDKDTLKNAAYARGLAACRDEDFCFGPRQPHVSSYDALNH
FT                   DFPMEPGPQG"
FT   exon            818395..818739
FT                   /gene="Pc16g03610"
FT                   /locus_tag="PCH_Pc16g03610"
FT                   /number=1
FT   mRNA            complement(join(<818882..819316,819614..819838,
FT                   819915..>820181))
FT                   /gene="Pc16g03620"
FT                   /locus_tag="PCH_Pc16g03620"
FT   CDS_pept        complement(join(818882..819316,819614..819838,
FT                   819915..820181))
FT                   /gene="Pc16g03620"
FT                   /locus_tag="PCH_Pc16g03620"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_55_scaffold_3.tfa_640wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93032"
FT                   /db_xref="GOA:B6H7S6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S6"
FT                   /protein_id="CAP93032.1"
FT                   /translation="MGTRFKDDTKDPAVNVTNWVLLVTIIFSVSARLGTKIRLFKRLTT
FT                   DDLLIIASLVFGIGQSIVVSLAVGSGYGKHFKDVSSADMQQVMKNLFAGSVLYLLSLTF
FT                   SKLSLVVFIRSLTPSAKDKWLARGVETIVYVWALVTIFGTAFQCSLPRTWDFQSGHCFN
FT                   LCDDRNNWRDRHPQEKHERQRSNISDVRNHHFRSDHAVPQYCDGLLGTTEPLPVLDAIE
FT                   RAQALWRGRPDFLELQDALAITRAVQVARSQEQIRKPRDLPSVYATRSNSGHAGLGGRQ
FT                   SVKPGAHNGVANTPLGYHELQVADHLS"
FT   exon            complement(818882..819316)
FT                   /gene="Pc16g03620"
FT                   /locus_tag="PCH_Pc16g03620"
FT                   /number=1
FT   intron          complement(819317..819613)
FT                   /gene="Pc16g03620"
FT                   /locus_tag="PCH_Pc16g03620"
FT                   /number=1
FT   exon            complement(819614..819838)
FT                   /gene="Pc16g03620"
FT                   /locus_tag="PCH_Pc16g03620"
FT                   /number=2
FT   intron          complement(819839..819914)
FT                   /gene="Pc16g03620"
FT                   /locus_tag="PCH_Pc16g03620"
FT                   /number=2
FT   exon            complement(819915..820181)
FT                   /gene="Pc16g03620"
FT                   /locus_tag="PCH_Pc16g03620"
FT                   /number=3
FT   mRNA            join(<821097..821207,821264..821334,821415..821558,
FT                   821616..821698,821761..822158,822220..822552,
FT                   822606..>823088)
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT   CDS_pept        join(821097..821207,821264..821334,821415..821558,
FT                   821616..821698,821761..822158,822220..822552,
FT                   822606..823088)
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /note="Title: strong similarity to choline permease Hnm1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03630"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93033"
FT                   /db_xref="GOA:B6H7S7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S7"
FT                   /inference="similar to AA sequence:PIR:S11175"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /inference="protein motif:COGS:COG0833"
FT                   /inference="protein motif:COGS:COG0531"
FT                   /protein_id="CAP93033.1"
FT                   /translation="MVAYEFKTTTSVTSRGGGPVDRDNAHLQRMGKRPVLKRNFGILSI
FT                   LGFSCTILGTWEGLLGVFPYPKPAVLQRSLTDISGGSGGAIYAYIFGWVGCFANFMVLS
FT                   ELASMAPTAGGQYHWAAMLAPGRLQKFLSFITGWFAVLGWQSAFAACAFLTGKMIQGAA
FT                   ILGNNLYNALPWEGTLIVWGSLSLALAVNLVGGNLLPRIEVIILVVHILGFFGIIIPLV
FT                   YMADHNTKEQAFLSFQNGGGFATQGLSWFVGMTSCAFAFAGGDAAVHMSEEVANASTVI
FT                   PNALMISVGINGCLGFGMIIVMMFCTDSDLGGKLGKITGYNFMGIFMEATDSVPGSLTM
FT                   ISIVIIIYVCSLMGLLAAASRQLWSFSRDRGVPGWRLWSQISSTRQLPIFAILLTVTVA
FT                   TLLSLINIGSNTAMEDIVSMAVAGIYLSYLMVSVLLFYRRVRGDISRYNDNEDDIVNVP
FT                   GAKLVWGPFHCPGIVGTVINGYAIIYLTIVVFFSFWPSTMDPTVETMNWSVLAIGGSSL
FT                   LAVIYYVVHARHIYKGPVMEVSL"
FT   exon            821097..821207
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /number=1
FT   intron          821208..821263
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /number=1
FT   exon            821264..821334
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /number=2
FT   intron          821335..821414
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /number=2
FT   exon            821415..821558
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /number=3
FT   intron          821559..821615
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /number=3
FT   exon            821616..821698
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /number=4
FT   intron          821699..821760
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /number=4
FT   exon            821761..822158
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /number=5
FT   intron          822159..822219
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /number=5
FT   exon            822220..822552
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /number=6
FT   intron          822553..822605
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /number=6
FT   exon            822606..823088
FT                   /gene="Pc16g03630"
FT                   /locus_tag="PCH_Pc16g03630"
FT                   /number=7
FT   mRNA            complement(join(<823977..824077,824138..824265,
FT                   824323..824449,824502..824530,824584..>824783))
FT                   /gene="Pc16g03640"
FT                   /locus_tag="PCH_Pc16g03640"
FT   CDS_pept        complement(join(823977..824077,824138..824265,
FT                   824323..824449,824502..824530,824584..824783))
FT                   /gene="Pc16g03640"
FT                   /locus_tag="PCH_Pc16g03640"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_113_scaffold_8.tfa_300wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03640"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93034"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S8"
FT                   /protein_id="CAP93034.1"
FT                   /translation="MQLLSLFTSLALVSAVVSSPAADLNVNVARADDQHGSYIVSGLGA
FT                   RKQEILKAGGNTRDMAIAMLETDNMTTDYKYGDGKTGDGTNFGVFKQNWFILRNSAADF
FT                   LGQTVDQVDNGVILNTDLAKDIKARHEGEAKYGYEKWFSGHRNGETGLKNPGTDDIKTY
FT                   MSGVAWIQQQLESDEKYQSDDTRFYVQVVAI"
FT   exon            complement(823977..824077)
FT                   /gene="Pc16g03640"
FT                   /locus_tag="PCH_Pc16g03640"
FT                   /number=1
FT   mat_peptide     complement(join(823980..824077,824138..824265,
FT                   824323..824449,824502..824530,824584..824720))
FT                   /gene="Pc16g03640"
FT                   /locus_tag="PCH_Pc16g03640"
FT   intron          complement(824078..824137)
FT                   /gene="Pc16g03640"
FT                   /locus_tag="PCH_Pc16g03640"
FT                   /number=1
FT   exon            complement(824138..824265)
FT                   /gene="Pc16g03640"
FT                   /locus_tag="PCH_Pc16g03640"
FT                   /number=2
FT   intron          complement(824266..824322)
FT                   /gene="Pc16g03640"
FT                   /locus_tag="PCH_Pc16g03640"
FT                   /number=2
FT   exon            complement(824323..824449)
FT                   /gene="Pc16g03640"
FT                   /locus_tag="PCH_Pc16g03640"
FT                   /number=3
FT   intron          complement(824450..824501)
FT                   /gene="Pc16g03640"
FT                   /locus_tag="PCH_Pc16g03640"
FT                   /number=3
FT   exon            complement(824502..824530)
FT                   /gene="Pc16g03640"
FT                   /locus_tag="PCH_Pc16g03640"
FT                   /number=4
FT   intron          complement(824531..824583)
FT                   /gene="Pc16g03640"
FT                   /locus_tag="PCH_Pc16g03640"
FT                   /number=4
FT   exon            complement(824584..824783)
FT                   /gene="Pc16g03640"
FT                   /locus_tag="PCH_Pc16g03640"
FT                   /number=5
FT   sig_peptide     complement(824721..824783)
FT                   /gene="Pc16g03640"
FT                   /locus_tag="PCH_Pc16g03640"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<826476..826751,826805..827637,
FT                   827690..827995,828058..>828241))
FT                   /gene="Pc16g03650"
FT                   /locus_tag="PCH_Pc16g03650"
FT   CDS_pept        complement(join(826476..826751,826805..827637,
FT                   827690..827995,828058..828241))
FT                   /gene="Pc16g03650"
FT                   /locus_tag="PCH_Pc16g03650"
FT                   /note="Title: strong similarity to myo-inositol transporter
FT                   2 itr2p - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03650"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93035"
FT                   /db_xref="GOA:B6H7S9"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S9"
FT                   /inference="similar to AA sequence:PIR:T38125"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP93035.1"
FT                   /translation="MSLDKEEKQLEDISKDNVEQIEHAEHFDLKDQSDLSSIEATAASK
FT                   TAWLICIVVSIGGLLFGYDTGYISAVLVTIGSSLGHVLSSSEQEMVTSLTSGGALVGAV
FT                   GAGLTADRFGRRLPIWGACVVFVIGTALQTAAFSVGQFATGRFVVGLGVGSASMIVPLY
FT                   IGELAPAQYRGRMVAFNNMSVTFGQFLASALGAGFAEAKGEAWRATVGLGAAPALALAG
FT                   LLFVCPESPRQLVTHGKREAAEAVLLRIYPTSTVGQRQAKIRSIELSLQEVSMDKESLW
FT                   VTFKRIFTTPSTGRAVLTACMIMAISQLGGFNTLMYYAATLFSIVGFSNATAVGITVSG
FT                   TNFVFSILNLLLVDKFGRRIILTITVLGMSLCMIVAVIAFRYIPIDTETLVVESNNIGW
FT                   PGILVLVAIICYVACYSSGVATIAWIGTELIPLEVRAMGTMLNTVTCWSTNIIISSTFL
FT                   SMMKAWTPSGAFGFYAGICFFGWVFVVFFYPECKGMPLEAVREVFSTGFGVRYSKKWQK
FT                   DHKDDVKVQTIVLGH"
FT   exon            complement(826476..826751)
FT                   /gene="Pc16g03650"
FT                   /locus_tag="PCH_Pc16g03650"
FT                   /number=1
FT   intron          complement(826752..826804)
FT                   /gene="Pc16g03650"
FT                   /locus_tag="PCH_Pc16g03650"
FT                   /number=1
FT   exon            complement(826805..827637)
FT                   /gene="Pc16g03650"
FT                   /locus_tag="PCH_Pc16g03650"
FT                   /number=2
FT   intron          complement(827638..827689)
FT                   /gene="Pc16g03650"
FT                   /locus_tag="PCH_Pc16g03650"
FT                   /number=2
FT   exon            complement(827690..827995)
FT                   /gene="Pc16g03650"
FT                   /locus_tag="PCH_Pc16g03650"
FT                   /number=3
FT   intron          complement(827996..828057)
FT                   /gene="Pc16g03650"
FT                   /locus_tag="PCH_Pc16g03650"
FT                   /number=3
FT   exon            complement(828058..828241)
FT                   /gene="Pc16g03650"
FT                   /locus_tag="PCH_Pc16g03650"
FT                   /number=4
FT   misc_RNA        828936..829064
FT                   /gene="small non coding RNA"
FT                   /locus_tag="PCH_Pc16e00110"
FT                   /product="small non coding RNA"
FT                   /inference="profile:QRNA:2.01"
FT   mRNA            join(<829700..829947,830003..830340,830400..830719,
FT                   830775..831015,831075..>831265)
FT                   /gene="Pc16g03660"
FT                   /locus_tag="PCH_Pc16g03660"
FT   CDS_pept        join(829700..829947,830003..830340,830400..830719,
FT                   830775..831015,831075..831265)
FT                   /gene="Pc16g03660"
FT                   /locus_tag="PCH_Pc16g03660"
FT                   /note="Title: weak similarity to serine protein kinase
FT                   SRPK1 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93036"
FT                   /db_xref="GOA:B6H7T0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP93036.1"
FT                   /translation="MNTIRPSIPRLSALLRKKPFPTPSPGPPLLPGILIDEEISPVYDS
FT                   KYFYPAKPGEVLADRYQILVKVGWGVSSTVWLARDLQGHFEESESVVALKIANSNASSA
FT                   GHEREVEEHISTADPSHRGRSLIRTLLDSFEIKGSEGSYSCLVYPPMREPLSMYQRRFG
FT                   DRKMPLPLIKTYIRALLTGLDYLHQKCRIVHTDLKLENIMVSFEDATVLADFMDSQLER
FT                   PMAFKIDSTGRPVYQSRSDFGPLKSLSSIPQLVDFGLATRLEEDDDWGVWPIQPDHYRA
FT                   PEVILGNGWQMPADIWNLGVLLWDMIEGKELFQHIHDQQGRYDAKLHIAEMIALLGPPH
FT                   PEVIQRYQFMREYSWPQPVRREDGRLCETAEEYFGGPFFDNNGRFLYEDMIPDWKLGDT
FT                   VSFLEGEEREAFLDLAKQMLVWHPNIRKTAGQLAGHPFLQLKQTSV"
FT   exon            829700..829947
FT                   /gene="Pc16g03660"
FT                   /locus_tag="PCH_Pc16g03660"
FT                   /number=1
FT   intron          829948..830002
FT                   /gene="Pc16g03660"
FT                   /locus_tag="PCH_Pc16g03660"
FT                   /number=1
FT   exon            830003..830340
FT                   /gene="Pc16g03660"
FT                   /locus_tag="PCH_Pc16g03660"
FT                   /number=2
FT   intron          830341..830399
FT                   /gene="Pc16g03660"
FT                   /locus_tag="PCH_Pc16g03660"
FT                   /number=2
FT   exon            830400..830719
FT                   /gene="Pc16g03660"
FT                   /locus_tag="PCH_Pc16g03660"
FT                   /number=3
FT   intron          830720..830774
FT                   /gene="Pc16g03660"
FT                   /locus_tag="PCH_Pc16g03660"
FT                   /number=3
FT   exon            830775..831015
FT                   /gene="Pc16g03660"
FT                   /locus_tag="PCH_Pc16g03660"
FT                   /number=4
FT   intron          831016..831074
FT                   /gene="Pc16g03660"
FT                   /locus_tag="PCH_Pc16g03660"
FT                   /number=4
FT   exon            831075..831265
FT                   /gene="Pc16g03660"
FT                   /locus_tag="PCH_Pc16g03660"
FT                   /number=5
FT   mRNA            complement(<831736..>833853)
FT                   /gene="Pc16g03670"
FT                   /locus_tag="PCH_Pc16g03670"
FT   CDS_pept        complement(831736..833853)
FT                   /gene="Pc16g03670"
FT                   /locus_tag="PCH_Pc16g03670"
FT                   /note="unknown EC_number=4.3.1.5"
FT                   /note="Title: strong similarity to phenylalanine
FT                   ammonia-lyase Pal - Rhodosporidium toruloides"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93037"
FT                   /db_xref="GOA:B6H7T1"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005922"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR023144"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T1"
FT                   /inference="similar to AA sequence:PIR:A56628"
FT                   /inference="protein motif:PFAM:PF00221"
FT                   /inference="protein motif:COGS:COG2986"
FT                   /protein_id="CAP93037.1"
FT                   /translation="MTLKRHSQSAHMNATLQLLGRVRDLKNKKRSIVLNGNDLDIASTV
FT                   AVARHGVEPTISTDECLAKRLEISVDTLADVISRKCVIYGVNTGFGGSADTRTNELIDL
FT                   QTHLLQFIQSGIITTADKDPASNSEREPSHVMPLAWVRAAIVARTNQNLRGHSAIRKCV
FT                   LKSLIDLLHNDITPLIPLRGTISASGDLMPMAYIAGAIMGNPDVFVQVGKGAQAIVMPS
FT                   SEALKMSGLSPSGLGPKEGLGLINGTAPSAALASLALYNTQQLALLSQMLTAFASECLA
FT                   GNVEWAHPFVHATRPHAGQIEVASNIRRFLKGSKFVVGLESQEASGDGLCQDRYSTRTA
FT                   PQWIGPYIEDLLLAQHQLEVELNSTSDNPLVDTSKQEDGSSGKVYSGGNFQAAAVTSAM
FT                   DKARLAIQMIGRMLWSQVTEMINPATNNGLEANLNATAQENFTMKGIDINMSAYMSELA
FT                   ALVHPVSAHVMSAEMHNQGINSLALISARRTMEAADLLAHMSACHIYVSCQGVEIRANH
FT                   LRFLSTLRTKMKDFTANGALYGLGLDDSQLETLCTSLLPIVQSSWYRANSNTWKDRVLS
FT                   VVDAVALAVNEFVASHSPDCSVSTMMAFKKRFHGLVSSTAEQMFYPGPTISPEEVAMQL
FT                   GGGTAQIYTWVRSNLNIPMNRGLQDDPLFNAQKGLPTKGKRSIGSSVSMVYESLIKGEM
FT                   MDVILEGWTQD"
FT   exon            complement(831736..833853)
FT                   /gene="Pc16g03670"
FT                   /locus_tag="PCH_Pc16g03670"
FT                   /number=1
FT   mRNA            join(<835571..835680,835752..836864,836931..837505,
FT                   837621..>839113)
FT                   /gene="Pc16g03680"
FT                   /locus_tag="PCH_Pc16g03680"
FT   CDS_pept        join(835571..835680,835752..836864,836931..837505,
FT                   837621..839113)
FT                   /gene="Pc16g03680"
FT                   /locus_tag="PCH_Pc16g03680"
FT                   /note="Title: weak similarity to ankyrin ANK1 - Homo
FT                   sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03680"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93038"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T2"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /inference="protein motif:COGS:COG0666"
FT                   /protein_id="CAP93038.1"
FT                   /translation="MSFGFGVGDFLAVVTLANEIRKKFVDAPAQFKAISDEVRDLSLVV
FT                   HNVAIDLSGKELSSQQDAELRGIARNCRNVLTDAETMIDNYGVLAPNNKKQNLVKRAWK
FT                   RLTWEPNDIQELRLRITSNVVLLNAFNGKITQNTVTRLAQHQDDQERQVVLDWLSPMNY
FT                   ATLQKDYINRREQGTGQWLLESPEFEWWITGVNSNRTLFCPGIPGAGKTILTSIVVDEL
FT                   YGRYGNDSDVGIAYVYCNFQRHNEQDAASLLGNILKQMVQRKHTVPSSARALYNTHMHT
FT                   GTRPSINEISEVMHSLSTASDFSSIFIVIDALDECQISDRSRDILLDVVISMQAKRGCN
FT                   VYLFATSRFIPEIIEMFNEQPTVEIRARENDVKRYIQGNLTMLPSFVSRSSDLQEEISD
FT                   AIAKAVDGMFLLAQLYLNSLVGKRSAKAIRSALEGLSCSTRPYGFAYDDVMERIKGQVP
FT                   DQIELAMQVLAWITCATRQLTTTELQVALTVEVGESDLDKENLPDLDDIVSVCAGLVTV
FT                   DKQSNIIRLVHYTAQEYFERNQSTWFPKAHDDIGNICVTYISFDVFKTEHRLTPKELEM
FT                   RLRQYPLGPYAAASWGHHFRASWGLTRLLVTDSTPPKSLRRVDSSFYQAEQPFLTTGLH
FT                   IAAYFGLPNIAQRFISLGTLVDSNDAVQETPLCWAAQHGRDNLVRLLIENGANPNHKDG
FT                   LGYTPLHFAALNDYDEIAGFILDNGGDPMCGDAQVYLPFHIAVMTGSEKVARLLLQRGV
FT                   HPHARDFEDHTPLWLASIFGHESTASLLLDWDVQPQSVDLDACLSTAAEYGYDKLVQLF
FT                   LNKGADIDVTDYMGRTPLMLALLAVNESVIRLLLHLDIDLEVKNRQGRTALSLAAKLGN
FT                   WDAVRQLLEKGANPNSYDIDGRTAVFLAACQQDATVLTLLLPSGISTFERDRYGRTPLH
FT                   VAANRGHSECVRALLDAGIDCEVKDNFGRTALSDALTRGRNDAANIIRAFSIKDPIDMD
FT                   ELACRTAQLTGAPRGVSCDICCAHILIGEAFYYCRLCNGGNFDICELCHHGGARCLHST
FT                   HNLEQLQEQRSLQIRPRIQLLQLMSPKCRPNSRSWIEEASIFRESLNG"
FT   exon            835571..835680
FT                   /gene="Pc16g03680"
FT                   /locus_tag="PCH_Pc16g03680"
FT                   /number=1
FT   intron          835681..835751
FT                   /gene="Pc16g03680"
FT                   /locus_tag="PCH_Pc16g03680"
FT                   /number=1
FT   exon            835752..836864
FT                   /gene="Pc16g03680"
FT                   /locus_tag="PCH_Pc16g03680"
FT                   /number=2
FT   intron          836865..836930
FT                   /gene="Pc16g03680"
FT                   /locus_tag="PCH_Pc16g03680"
FT                   /number=2
FT   exon            836931..837505
FT                   /gene="Pc16g03680"
FT                   /locus_tag="PCH_Pc16g03680"
FT                   /number=3
FT   intron          837506..837620
FT                   /gene="Pc16g03680"
FT                   /locus_tag="PCH_Pc16g03680"
FT                   /number=3
FT   exon            837621..839113
FT                   /gene="Pc16g03680"
FT                   /locus_tag="PCH_Pc16g03680"
FT                   /number=4
FT   mRNA            <839511..>839990
FT                   /gene="Pc16g03690"
FT                   /locus_tag="PCH_Pc16g03690"
FT   CDS_pept        839511..839990
FT                   /gene="Pc16g03690"
FT                   /locus_tag="PCH_Pc16g03690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03690"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93039"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T3"
FT                   /protein_id="CAP93039.1"
FT                   /translation="MPTGVGTIQFSAHWRPMPPTERQLRSCILLAYQLLTYFDNAKNPH
FT                   QELQAPELTNDIIYITHTYDTPHLPKENPFPADWLLRRELAKTIREFQRLVAVIPSKRF
FT                   PPEAVLKRPISSDQHEAQKHGRYPSQSGITQITCVSYDSCKGLAKSLAAITYFHR"
FT   exon            839511..839990
FT                   /gene="Pc16g03690"
FT                   /locus_tag="PCH_Pc16g03690"
FT                   /number=1
FT   mRNA            complement(<840147..>841022)
FT                   /gene="Pc16g03700"
FT                   /locus_tag="PCH_Pc16g03700"
FT   CDS_pept        complement(840147..841022)
FT                   /gene="Pc16g03700"
FT                   /locus_tag="PCH_Pc16g03700"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An01g10470 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03700"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93040"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T4"
FT                   /protein_id="CAP93040.1"
FT                   /translation="MSKSRDGYVVHHFSHFELLCACAKILVESLQTKSANQWIVVLGLP
FT                   QSAIGKLDEDHSCLGGVEYRFAWEGNAGLIKIVPSFEHDSVTDGFTRVLDLHLIGMGLV
FT                   SATSRKWVATTTYKPTANKGKQADQGFLPPPRRPSAPGLPPGRPTLIIETGLSESLSQL
FT                   RQDALWWLSNSSGAVRIVLVISISKRKDRVFIEIWQLAPPNSPRPLTRAYIQTLCQQSP
FT                   NIPPLVQQQAASQQAYCAHEIEISANGVTGAPLTLPFVAVYDRPPAQGEGDIVLVEQDF
FT                   LDVTSDLLCS"
FT   exon            complement(840147..841022)
FT                   /gene="Pc16g03700"
FT                   /locus_tag="PCH_Pc16g03700"
FT                   /number=1
FT   mRNA            complement(join(<841684..841846,841895..841969,
FT                   842024..>842547))
FT                   /gene="Pc16g03710"
FT                   /locus_tag="PCH_Pc16g03710"
FT   CDS_pept        complement(join(841684..841846,841895..841969,
FT                   842024..842547))
FT                   /gene="Pc16g03710"
FT                   /locus_tag="PCH_Pc16g03710"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An17g00600 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03710"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93041"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T6"
FT                   /protein_id="CAP93041.1"
FT                   /translation="MSSLESPTRPESPVDVVDVGPSRWAIVSKLQERTNILSQQDVTDG
FT                   LGPAYVTEKFLCSSLDSSNTPAFMRVYKQVPIAGTEIKKASVRAAQAVKSYEPIELVAL
FT                   KSLQEKGCDVIPRLLAYQCDEQAEDDTVPGGFIAYVIWEKVPGESLNTQKFWGYSLSER
FT                   EEIRLKFREAYKAVQACGYGLFPGIKKIIYHRPTQTIYLSGFSGPYRTEDTQWSDDIYC
FT                   AYGLVRPPTALDQIFPITSTDLKYDDKGWRW"
FT   exon            complement(841684..841846)
FT                   /gene="Pc16g03710"
FT                   /locus_tag="PCH_Pc16g03710"
FT                   /number=1
FT   intron          complement(841847..841894)
FT                   /gene="Pc16g03710"
FT                   /locus_tag="PCH_Pc16g03710"
FT                   /number=1
FT   exon            complement(841895..841969)
FT                   /gene="Pc16g03710"
FT                   /locus_tag="PCH_Pc16g03710"
FT                   /number=2
FT   intron          complement(841970..842023)
FT                   /gene="Pc16g03710"
FT                   /locus_tag="PCH_Pc16g03710"
FT                   /number=2
FT   exon            complement(842024..842547)
FT                   /gene="Pc16g03710"
FT                   /locus_tag="PCH_Pc16g03710"
FT                   /number=3
FT   mRNA            join(<842863..843022,843107..843179,843256..843333,
FT                   843379..843498,843634..>843799)
FT                   /gene="Pc16g03720"
FT                   /locus_tag="PCH_Pc16g03720"
FT   CDS_pept        join(842863..843022,843107..843179,843256..843333,
FT                   843379..843498,843634..843799)
FT                   /gene="Pc16g03720"
FT                   /locus_tag="PCH_Pc16g03720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03720"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93042"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T7"
FT                   /protein_id="CAP93042.1"
FT                   /translation="MGIFEDHDSSLRLGTFGSFAEVIGGVNTRPNSLSECDLQGVDGGL
FT                   RRPAAPAAVLLEVMIPLAALRSSLFDIWVQVRGDARQQARAGRNYTALLVRSTDSYHMR
FT                   GHCSSGNCRTTAGRLLPQSESGLIRHLRRGYRYARRVACQGQGSNRTPQRFPRESLEET
FT                   VGPRRGEVGLNALVTEEGDAIVSFSVDSECSDLVA"
FT   exon            842863..843022
FT                   /gene="Pc16g03720"
FT                   /locus_tag="PCH_Pc16g03720"
FT                   /number=1
FT   intron          843023..843106
FT                   /gene="Pc16g03720"
FT                   /locus_tag="PCH_Pc16g03720"
FT                   /number=1
FT   exon            843107..843179
FT                   /gene="Pc16g03720"
FT                   /locus_tag="PCH_Pc16g03720"
FT                   /number=2
FT   intron          843180..843255
FT                   /gene="Pc16g03720"
FT                   /locus_tag="PCH_Pc16g03720"
FT                   /number=2
FT   exon            843256..843333
FT                   /gene="Pc16g03720"
FT                   /locus_tag="PCH_Pc16g03720"
FT                   /number=3
FT   intron          843334..843378
FT                   /gene="Pc16g03720"
FT                   /locus_tag="PCH_Pc16g03720"
FT                   /number=3
FT   exon            843379..843498
FT                   /gene="Pc16g03720"
FT                   /locus_tag="PCH_Pc16g03720"
FT                   /number=4
FT   intron          843499..843633
FT                   /gene="Pc16g03720"
FT                   /locus_tag="PCH_Pc16g03720"
FT                   /number=4
FT   exon            843634..843799
FT                   /gene="Pc16g03720"
FT                   /locus_tag="PCH_Pc16g03720"
FT                   /number=5
FT   mRNA            complement(<844520..>845128)
FT                   /gene="Pc16g03730"
FT                   /locus_tag="PCH_Pc16g03730"
FT   CDS_pept        complement(844520..845128)
FT                   /pseudo
FT                   /gene="Pc16g03730"
FT                   /locus_tag="PCH_Pc16g03730"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical protein An15g02550
FT                   - Aspergillus niger [putative pseudogene]"
FT   exon            complement(844520..845128)
FT                   /gene="Pc16g03730"
FT                   /locus_tag="PCH_Pc16g03730"
FT                   /number=1
FT   mRNA            join(<845730..845738,846076..>846390)
FT                   /gene="Pc16g03740"
FT                   /locus_tag="PCH_Pc16g03740"
FT   CDS_pept        join(845730..845738,846076..846390)
FT                   /gene="Pc16g03740"
FT                   /locus_tag="PCH_Pc16g03740"
FT                   /note="Title: weak similarity to siderophore biosynthesis
FT                   repressor sREA - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93044"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T8"
FT                   /inference="similar to AA sequence:TREMBL:AF095898.1"
FT                   /protein_id="CAP93044.1"
FT                   /translation="MQMSAISTGINNAGSLLGYHYIPGGAEECDGCPAYNNQICKSAAA
FT                   GAAPIQSPWGPIISSRRTLYLSHIVRIDSTEKATGTIRYRSSYLANRSPTALIEAKSQK
FT                   EGY"
FT   exon            845730..845738
FT                   /gene="Pc16g03740"
FT                   /locus_tag="PCH_Pc16g03740"
FT                   /number=1
FT   intron          845739..846075
FT                   /gene="Pc16g03740"
FT                   /locus_tag="PCH_Pc16g03740"
FT                   /number=1
FT   exon            846076..846390
FT                   /gene="Pc16g03740"
FT                   /locus_tag="PCH_Pc16g03740"
FT                   /number=2
FT   mRNA            complement(join(<846616..847687,847752..>848317))
FT                   /gene="Pc16g03750"
FT                   /locus_tag="PCH_Pc16g03750"
FT   CDS_pept        complement(join(846616..847687,847752..848317))
FT                   /gene="Pc16g03750"
FT                   /locus_tag="PCH_Pc16g03750"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_61_scaffold_4.tfa_2170cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03750"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93045"
FT                   /db_xref="GOA:B6H7T9"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T9"
FT                   /inference="protein motif:PFAM:PF06100"
FT                   /inference="protein motif:COGS:COG4716"
FT                   /protein_id="CAP93045.1"
FT                   /translation="MEKTKKARIRGKRDPKQTEAWILGTGTASLASAFYLIKHAKAPPR
FT                   KVHILESCDSLQEIWHHKGDPTSGYDQFAGCLPVPIGEPLKELLSCIPSAFPTTSRRAS
FT                   FLHAIQSAEVNRTFATQVNNTCIVVQKDGKLQNIVTSSLDLNFKQRLNLVRFMLKGEGR
FT                   LGRNHISDFFPQNFFETSFWAIWSAQFGLQPWHSATEFRRALRHYLGDFHNLSILNCLD
FT                   ITGYYQFESIFLPICLFLESLDVDFQFDTKVRAIVTTSNNDTRTISRLELSQNGFLTHK
FT                   DLGPHDIVIATLGSTESGAAVGSNDHQPVMLSFDACDQFDENWSLWLTLAPIGRDFGNP
FT                   YAFCTRRPQSMVESFTITTKEVNFFNYLTSLSQSTLATGALIVLRESRWKLNLCIPAQP
FT                   VFQYQPEDVRVLWGFAIFPEGIGDYVKKPMLQCSGAEIMTELLKHLNYPSELVFRHTVN
FT                   IPRVMPRMSAIILAHSRDERPEVVPRNTSNIGLVGQFVEIPQYSCIDMSYAARSAQMVV
FT                   SRLMGIDIPSAEVKRSLTALLIRILLWK"
FT   exon            complement(846616..847687)
FT                   /gene="Pc16g03750"
FT                   /locus_tag="PCH_Pc16g03750"
FT                   /number=1
FT   intron          complement(847688..847751)
FT                   /gene="Pc16g03750"
FT                   /locus_tag="PCH_Pc16g03750"
FT                   /number=1
FT   exon            complement(847752..848317)
FT                   /gene="Pc16g03750"
FT                   /locus_tag="PCH_Pc16g03750"
FT                   /number=2
FT   mRNA            <848990..>851065
FT                   /gene="Pc16g03760"
FT                   /locus_tag="PCH_Pc16g03760"
FT   CDS_pept        848990..851065
FT                   /pseudo
FT                   /gene="Pc16g03760"
FT                   /locus_tag="PCH_Pc16g03760"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to polyketide synthase PKS1
FT                   - Cochliobolus heterostrophus [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:CHU68040.1"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /inference="protein motif:COGS:COG3321"
FT   exon            848990..851065
FT                   /gene="Pc16g03760"
FT                   /locus_tag="PCH_Pc16g03760"
FT                   /number=1
FT   mRNA            <851671..>852510
FT                   /gene="Pc16g03770"
FT                   /locus_tag="PCH_Pc16g03770"
FT   CDS_pept        851671..852510
FT                   /gene="Pc16g03770"
FT                   /locus_tag="PCH_Pc16g03770"
FT                   /note="Title: strong similarity to conserved hypothetical
FT                   protein - Brucella suis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03770"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93047"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7U0"
FT                   /inference="similar to AA sequence:TREMBL:AE014346.4"
FT                   /inference="protein motif:PFAM:PF06038"
FT                   /inference="protein motif:COGS:COG3257"
FT                   /inference="protein motif:COGS:COG0662"
FT                   /inference="protein motif:COGS:COG1917"
FT                   /inference="protein motif:COGS:COG2207"
FT                   /inference="protein motif:COGS:COG3837"
FT                   /inference="protein motif:COGS:COG2140"
FT                   /protein_id="CAP93047.1"
FT                   /translation="MGNDQKLGAYYAPKGGLPPQTQILTDRAMFTEAYAVIPKGTFSDI
FT                   VTSFLPFWDKTRLWVIARPLSGFAETFSQYIMEVQPGGGSDRGETDDSAQGVVFVVEGE
FT                   VTITLGSQKHTLAEGGYAYLPPKSGWTLRNTGATTARFHWIRKAYEYVEGLDKPEPLFL
FT                   NEKDIPPTPMPNTNGAWATTRFVDPSDLRHDMHVTIVTFEPGGLIPFAETHVMEHGLYV
FT                   LEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYAGGPGKFRYLLYKDVNRQMKLSRL"
FT   exon            851671..852510
FT                   /gene="Pc16g03770"
FT                   /locus_tag="PCH_Pc16g03770"
FT                   /number=1
FT   mRNA            complement(join(<853030..853970,854037..>854145))
FT                   /gene="Pc16g03780"
FT                   /locus_tag="PCH_Pc16g03780"
FT   CDS_pept        complement(join(853030..853970,854037..854145))
FT                   /gene="Pc16g03780"
FT                   /locus_tag="PCH_Pc16g03780"
FT                   /note="unknown EC_number=1.3.1.-"
FT                   /note="Title: strong similarity to enoyl reductase of the
FT                   lovastatin biosynthesis lovC - Aspergillus terreus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03780"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93048"
FT                   /db_xref="GOA:B6H7Y7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Y7"
FT                   /inference="similar to AA sequence:TREMBL:AF141925.2"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /inference="protein motif:COGS:COG1064"
FT                   /inference="protein motif:COGS:COG1063"
FT                   /inference="protein motif:COGS:COG1062"
FT                   /inference="protein motif:COGS:COG0604"
FT                   /protein_id="CAP93048.1"
FT                   /translation="MATQSAIVVQGPGRATLEDVPLPEVPDDYILVKTKAVALNPTDWR
FT                   HIDFVPCTGATVGCDYSGIVEAVGPRVKKAFKKGDRVAGFVHGSNAVRNNGGAFAQYVI
FT                   AKGDLQILIPESMSFEAAATFGVGLTTVGQNLYQSMELPFPGNQDSESDDTNILIYGGA
FT                   TATGTLAIQLAKLSGLRVVTTCSEANRSFMFELGADAVFDYHDPLVGEQIREDTDDALE
FT                   FVLDTISTPQSAAICSAAISSAGGSYNALLDVASARDDVDSHVSMAYDVLGEPYRMGTN
FT                   ERAPDSTNFEFGVKWWGLAQKLIEERRIHPHPYQVKPGGLAGALAGLQILREGKVRASK
FT                   LVYRVDESE"
FT   exon            complement(853030..853970)
FT                   /gene="Pc16g03780"
FT                   /locus_tag="PCH_Pc16g03780"
FT                   /number=1
FT   intron          complement(853971..854036)
FT                   /gene="Pc16g03780"
FT                   /locus_tag="PCH_Pc16g03780"
FT                   /number=1
FT   exon            complement(854037..854145)
FT                   /gene="Pc16g03780"
FT                   /locus_tag="PCH_Pc16g03780"
FT                   /number=2
FT   mRNA            join(<854618..854677,854767..854963,855072..855111,
FT                   855191..>855244)
FT                   /gene="Pc16g03790"
FT                   /locus_tag="PCH_Pc16g03790"
FT   CDS_pept        join(854618..854677,854767..854963,855072..855111,
FT                   855191..855244)
FT                   /gene="Pc16g03790"
FT                   /locus_tag="PCH_Pc16g03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03790"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93049"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Y8"
FT                   /protein_id="CAP93049.1"
FT                   /translation="MPPSHNSQMPHGIVILIAKEVELVSNRGLGEESDSTAGEEKQKEK
FT                   KGKEKRKRGRQGIFTLACWNRLEWRLEASPGNTVTDTRIVSGKQTTFRKVWNSLGNMDS
FT                   TSQNPDVIRAPT"
FT   exon            854618..854677
FT                   /gene="Pc16g03790"
FT                   /locus_tag="PCH_Pc16g03790"
FT                   /number=1
FT   intron          854678..854766
FT                   /gene="Pc16g03790"
FT                   /locus_tag="PCH_Pc16g03790"
FT                   /number=1
FT   exon            854767..854963
FT                   /gene="Pc16g03790"
FT                   /locus_tag="PCH_Pc16g03790"
FT                   /number=2
FT   intron          854964..855071
FT                   /gene="Pc16g03790"
FT                   /locus_tag="PCH_Pc16g03790"
FT                   /number=2
FT   exon            855072..855111
FT                   /gene="Pc16g03790"
FT                   /locus_tag="PCH_Pc16g03790"
FT                   /number=3
FT   intron          855112..855190
FT                   /gene="Pc16g03790"
FT                   /locus_tag="PCH_Pc16g03790"
FT                   /number=3
FT   exon            855191..855244
FT                   /gene="Pc16g03790"
FT                   /locus_tag="PCH_Pc16g03790"
FT                   /number=4
FT   mRNA            join(<855495..855698,855758..855902,855964..856232,
FT                   856290..856652,856717..857644,857721..862063,
FT                   862121..862790,862853..>863004)
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT   CDS_pept        join(855495..855698,855758..855902,855964..856232,
FT                   856290..856652,856717..857644,857721..862063,
FT                   862121..862790,862853..863004)
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /note="Title: strong similarity to polyketide synthase PKS1
FT                   - Cochliobolus heterostrophus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03800"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93050"
FT                   /db_xref="GOA:B6H7Y9"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Y9"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /inference="protein motif:PFAM:PF00698"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /inference="protein motif:COGS:COG3321"
FT                   /protein_id="CAP93050.1"
FT                   /translation="MPGRPTSAPTEMEGIAVIGMGCRFSGGATSVENFWQMLCDGRTGH
FT                   GTVPTSRYEASAWHHPSHERKGAINHDSGFFLQEDPSRFDAPFFSITAKEAAGMDPAQR
FT                   LLLEVAYETFENSGIPIDTLPGSNTAVYSGSMTNDYELLSTRDIYDMPHNSATGNGRTM
FT                   LANRLSWFFDLQGPSIMMDTACSSSLTAVHLAAQSLRSGECGMALVTGASLILHPNFTQ
FT                   RLSYMHMMSADGISHSFDESANGYGRGEGIGAVLLKPLSAALADGDNIRAVIRGTGINQ
FT                   DGRTPGITLPSPTSQANLIRSVYERHGISMRDTSYFEAHGTGTPVGDPTELSAVGATLG
FT                   QARTPTDEPIYVGSVKTNFGHTEGAAGVASLIKVVLCLEKGMLVPNAGFKNINPKIRLD
FT                   DWRLRLSDKTMPWPDHLPQRASINSFGFGGSNAHLILESTKEALGGNAEDKEPAPHVVV
FT                   FSTFDQAGIERASQNWSTFLQRQQKTEQEIPLKDLAHTMLTRRSQLGFRSFAVANSQDQ
FT                   LQTILDKGLPKFPRASRKAQTRLAFVFTGQGGQWAGMGRELLRISTFRESIARSQDILS
FT                   SLGCPFDMVEEIKAEAKDSQINRPDRSQPITCALQIALVDLLASWSVYPNAVVGHSSGE
FT                   IAAGYAAGYLSREDAMRVAWFRGFFSQQIAQSDRRGGMLATGISAADAQKYLQELPPRS
FT                   VVVACVNSPASTTLSGDVDLIDKLEARLQQDGHFARKLRIDTAYHSPHMEDLVEVVGNA
FT                   INCIKPEDRYSGSIPMLSSVTKERVYPAELGGSYWVRNMISSVEFTAAVSQLANLSESI
FT                   KSRRRPVPIKWTALVEIGPHAVLKGPVTQILQSVNPSMASLPYYSLVSRNQHALRTALE
FT                   VAGSLWSTGHTVDLAAVNSSVDTTSPKMVADLPSYPWNHQTSFWHEPVETAQLRQRKHP
FT                   RHDILGAAVDYQNALEPRWRNFLRLSENPWMADHVVAGSIVFPAAGMLVMATEAARQLA
FT                   DDQANIKGIEFQDLRFMRGVVIPDEERGLETLLQVSPHPGMPGWYQFGIFSLPSGGAWI
FT                   QHAKGAFIARYENRDNDEHNANWEAALERIKNTQTVAKMADVRQSREWLSHTGGLTVGP
FT                   AFQTITGVSFCDAEPRLWLSGVVTDTKQSMPFEKESPSFIHPTTLDCLFQSALLSCSDA
FT                   LSNNNANIPVGVDNIYISNAFQPQAGEQFVVHTETKWRDGKSRSHCIASDPSWSQPWIT
FT                   FEGVHLGRLPFNPNSQKKVEATSESRYSSIVWDEHLESPLVTNQIHDGNKKMAVQASRL
FT                   QLTDWIKRLCHTNGDAKALITTSETSNSWIENLQELISSAGKRPCLGKVTIASCGPNDQ
FT                   VNGITPAENSLPGTQLMPLATLDELPSSSLAQEKYDLVVIDEPRLWEDKLTQVILSCLP
FT                   NILEHGGLAAMRVSDTDLDSAAEKLQRFDGLEIHSTTQNRKFIIARRTPVSWTTDSEIY
FT                   VLSPADNSNSFPVFEHLEKIFATHNVRLVPVGLGQVATLAGKTVISLLDLAAPWVAGWT
FT                   ENDLERLRELIRVQYVLWVSPCWSQGAVDNIGSGATGGLLRTLRNEQWNTTIPHLLVDV
FT                   EDMEDKFGLACGILQVMQLTTQESARRPDLEYRLANGRLLVPRVLETPAVDEAMHTLIN
FT                   GPRPVLSDLTLDPRPLELKFQDADNARWEEQQLSEEQLRPDHSEIKVEMATIFDLHGEQ
FT                   GKTPETVLPMFEIVGTVTRIGSDVHDSAVGDKVLTLASANSGLSTTMRVSESDTIRIPA
FT                   NTDATKAISTPLAYLNAYQILTQVGRLSSSSSVLLVGSVNQTLQAMIDYALAMNMQVIV
FT                   ATDSLDSTESLRSRYPVLADRILGVQGSLETSVSRLTNGCGVDATICFLGGYAGRNAAR
FT                   CLVQGGQYINLSSEMKLSALPESFVDSGCTFSSPRLQKAFSEKPGNLHASLRHVIDFMK
FT                   QHRMLDRVESYSLFPISDLQGALKHCKATNTRAIMDLQAPGRVPIVLPLPDLTGLPAGG
FT                   TYILAGGLGNLGLALADTLVQSGARHLVFLGRSGGTQPSQQLALDQLRDRGCCIDVLRC
FT                   DISQQGDIDHLSYKIRSKNWTVAGVIQCTTVLRDAMFEKMTFDDWTQSTQSKIRGTLNL
FT                   HHLFSEKEGLTFFVALSSVASVIGNMGQANYSAGNGFIDALMEWRRSHGLPGHSINIGL
FT                   VPDASGLSDIAEDQEQRRRRYKHLEGTEIMTHELQTLLRVIINSKLSLPSQIIAGMTDS
FT                   LSRSNGSTPWVLDRKFDHRLCLAVEDTQDSIQTSTLLKECDSIDAATEIVLNTLSEYLA
FT                   DAMATTADAIDSDLPLSALGVDSLKATAVQNWVSRELGAELSSFEFLGSQPTKALARKI
FT                   ASTSSFVSVPS"
FT   exon            855495..855698
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=1
FT   intron          855699..855757
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=1
FT   exon            855758..855902
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=2
FT   intron          855903..855963
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=2
FT   exon            855964..856232
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=3
FT   intron          856233..856289
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=3
FT   exon            856290..856652
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=4
FT   intron          856653..856716
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=4
FT   exon            856717..857644
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=5
FT   intron          857645..857720
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=5
FT   exon            857721..862063
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=6
FT   intron          862064..862120
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=6
FT   exon            862121..862790
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=7
FT   intron          862791..862852
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=7
FT   exon            862853..863004
FT                   /gene="Pc16g03800"
FT                   /locus_tag="PCH_Pc16g03800"
FT                   /number=8
FT   mRNA            <864367..>866034
FT                   /gene="Pc16g03810"
FT                   /locus_tag="PCH_Pc16g03810"
FT   CDS_pept        864367..866034
FT                   /gene="Pc16g03810"
FT                   /locus_tag="PCH_Pc16g03810"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   F28J12.200 - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03810"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93051"
FT                   /db_xref="GOA:B6H7Z0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z0"
FT                   /inference="similar to AA sequence:PIR:T04550"
FT                   /protein_id="CAP93051.1"
FT                   /translation="MADAEKNDLCMPAPPAKAIVVDHDMPTGPDHEQTIVVDHDMAIAP
FT                   DSEQIIVIDDDLAIDPDLEKVTDNNDASKETPIPPNGHDSSDATDLEAQQTEPRRKRFA
FT                   RFRYAMFTVYRRLFTVVFCANLAVFLYVMIADRRLLALVNATAVNLVACGLARHPMMVN
FT                   AIYRAVCSIPRSAPLSLRRRCAKAAHYGGVHSGCGTASLVWYIGFVAMVSQIYWTNSPI
FT                   STVTDASFSAAPIAVAYVILVLLFVMIVVAYPTFRRKMHDLFELTHRFTSWLILALFVA
FT                   LVMIFAHEVGRAEKHSLGHAVVTLPAFWLLIVAILAVAHPWLLLRRVPVKAEPLSKHAV
FT                   RLSFDFTPISFAKGVQVSKHPLRDWHSFAGFPDPIPADAKPVAKNASRKKPFVKGHGHK
FT                   RSWSIVVSKAGDWTADTIREPPTHLWKRGSLMRGVGYGLRMFNRIIIVTTGSGIGPCLG
FT                   FLGDKKRPLIKVIWQTRDPLKTYGQDVLDLVHQMGPDPIIFDTSRDGRVDMLPVVRQQV
FT                   KEFQAEAVFVISNPKMTQNIVYEFESQGIPAYGPIFDS"
FT   exon            864367..866034
FT                   /gene="Pc16g03810"
FT                   /locus_tag="PCH_Pc16g03810"
FT                   /number=1
FT   mRNA            join(<867608..868722,868775..868952,869209..>869295)
FT                   /gene="Pc16g03820"
FT                   /locus_tag="PCH_Pc16g03820"
FT   CDS_pept        join(867608..868722,868775..868952,869209..869295)
FT                   /gene="Pc16g03820"
FT                   /locus_tag="PCH_Pc16g03820"
FT                   /note="Title: similarity to hypothetical protein
FT                   1145_scaffold_2.tfa_290cg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03820"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93052"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z1"
FT                   /protein_id="CAP93052.1"
FT                   /translation="MHSSQLKKRHVVRSETLQDLVPSLPAAPLTSTLFTVLPAEIRNRI
FT                   YTLALESEDVLTDDSSRSLYKQNAFYYRPGYKQPKRIQTALLQTCQQIYAEASLLPPAV
FT                   NEHTFWFYRSPPHVNDASSPLNYFRKMTPKQRAQVQHLHLFTQQYFLEDNHWSQIWDGL
FT                   KIGAEGRSSRGECRIAPKKMTITFRHTDWWYWENNDPLGIDPFRPGRTHAADMGRAVSP
FT                   HAAARSWGNQFSSLPCLEELVIEFETIMRKRDQLDAIIQQALEWNFPMQADKGLYLVAD
FT                   PTSKRAYTWIGAKEAELQRQRPAWPVDTEAGSESQSGQEQPIPAAPALVPFDHPSDMGT
FT                   NIDTNIGNRQVGADTEKFYVVFLTWKKRRVQESDVDGISWYIYFAFELDSLLSLSWGGS
FT                   GLGFCNCDTENASSTAYNLVFIYMFLGSTKVKNPLPYKGAVSPTSAFVTSLAWVTPISF
FT                   M"
FT   exon            867608..868722
FT                   /gene="Pc16g03820"
FT                   /locus_tag="PCH_Pc16g03820"
FT                   /number=1
FT   intron          868723..868774
FT                   /gene="Pc16g03820"
FT                   /locus_tag="PCH_Pc16g03820"
FT                   /number=1
FT   exon            868775..868952
FT                   /gene="Pc16g03820"
FT                   /locus_tag="PCH_Pc16g03820"
FT                   /number=2
FT   intron          868953..869208
FT                   /gene="Pc16g03820"
FT                   /locus_tag="PCH_Pc16g03820"
FT                   /number=2
FT   exon            869209..869295
FT                   /gene="Pc16g03820"
FT                   /locus_tag="PCH_Pc16g03820"
FT                   /number=3
FT   mRNA            complement(<869776..>870426)
FT                   /gene="Pc16g03830"
FT                   /locus_tag="PCH_Pc16g03830"
FT   CDS_pept        complement(869776..870426)
FT                   /gene="Pc16g03830"
FT                   /locus_tag="PCH_Pc16g03830"
FT                   /note="Title: similarity to hypothetical protein An12g06250
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03830"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93053"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z2"
FT                   /protein_id="CAP93053.1"
FT                   /translation="MFGPLDKATIRSIDFNRTSRCMLQDMREETWGWVVYRTTYRSDPA
FT                   FHKAIEILTSWIKAGVYEDLNEYGLENPDPTPNDQLWARHQLTVIEEGGTLDGASLDIV
FT                   RGHFEGWVKAQDKQDTWNKYRACLVIDEAAVQRLGEAMTPEEHQEKHGERRYTELRQWF
FT                   LPAVEAFLELEEGETDFEGWMNCSVFNLIRLWTSLDDGMYMEDASNEVQDGVY"
FT   exon            complement(869776..870426)
FT                   /gene="Pc16g03830"
FT                   /locus_tag="PCH_Pc16g03830"
FT                   /number=1
FT   mRNA            complement(join(<870809..871016,871134..>871366))
FT                   /gene="Pc16g03840"
FT                   /locus_tag="PCH_Pc16g03840"
FT   CDS_pept        complement(join(870809..871016,871134..871366))
FT                   /gene="Pc16g03840"
FT                   /locus_tag="PCH_Pc16g03840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03840"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93054"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z3"
FT                   /protein_id="CAP93054.1"
FT                   /translation="MEMPQRLGLDESEHLYGRNSFILPDMEIYIEIWPQRLELDESEHL
FT                   YNVNSFILSDIDIYMVCTVEMPQRLGLDESEHFLKSGKIRQNQAKLRHPPYKIRHPTPG
FT                   RYTPSQIPLFVFVNYKVLDLVLGKCSTSVKKWINNASSGLIQ"
FT   exon            complement(870809..871016)
FT                   /gene="Pc16g03840"
FT                   /locus_tag="PCH_Pc16g03840"
FT                   /number=1
FT   intron          complement(871017..871133)
FT                   /gene="Pc16g03840"
FT                   /locus_tag="PCH_Pc16g03840"
FT                   /number=1
FT   exon            complement(871134..871366)
FT                   /gene="Pc16g03840"
FT                   /locus_tag="PCH_Pc16g03840"
FT                   /number=2
FT   mRNA            complement(join(<871894..877242,877290..>877643))
FT                   /gene="Pc16g03850"
FT                   /locus_tag="PCH_Pc16g03850"
FT   CDS_pept        complement(join(871894..877242,877290..877643))
FT                   /gene="Pc16g03850"
FT                   /locus_tag="PCH_Pc16g03850"
FT                   /note="Title: similarity to peptide synthase pesA
FT                   -Metarhizium anisopliae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03850"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93055"
FT                   /db_xref="GOA:B6H7Z4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z4"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /inference="protein motif:PFAM:PF00668"
FT                   /inference="protein motif:COGS:COG1020"
FT                   /protein_id="CAP93055.1"
FT                   /translation="MGEYIEPSASPWVGEELTKPNDAGWSDCMTLPTLSDIKHEEIIAL
FT                   AWVLLLFRGTVQNEDGGFSWLKEGSLQGGSISDVIEGEGSSLRSALEAIRRRGQFDGEF
FT                   SDTLLFRNASLDNEWTFALEAKLASGVVYVRGTPQSRTATQPVESVLPHILADLILSIA
FT                   NNLDQSVAEAVRIGRQELSQLWKWNGTMPPTIDQCIQDIISEKAQSQLDRPAVVSWDGE
FT                   MTYRQLEERSTNLARHLVDLGLQTGKAVPLCFEKSMWTIVGVLAVMKAGGALVLMDPSQ
FT                   PEGRLSTIASEVEAGFILTSEAQATLGARIVPGGKQVIVGPQNDEAEFKSLSVDLPVVP
FT                   ASSTLYIQFTSGSTGKPKGVLISHSNYTSGALPRAEAVGYKEHSRVLDFPSYAFDVSVD
FT                   CMLCTLANGGCICVPSEDQRVNDLSGAIRKLNVNMAHMTPSVARVLAPDIMPSLEVIGL
FT                   GGEAISASDAAEWGQKTKIVIAYGPSECTVGCTINNDIPPGRSYTSIGQGVGGTTWVVD
FT                   PSNHDRLMPIGTVGELLIEGPVVGDGYLNNPEKTAEVFIEDPTWLVEGGGDVPGRKGRL
FT                   YKTGDLVRYDPDASGSVVFIGRADQQVKLRGQRVELGEIEHHVRNYFPAGASVAAEVIF
FT                   PGGKKADATLIVFVAEEKSETTGTTSEITSFSSSFQKLIAGIDDILATNLPRYMIPTAY
FT                   IPLNQMPLLVSLKTDRKQLRALGNDLTRRHIAEFRSSTVVKIAPRTEMERKLHGLWLKL
FT                   FGDETDIGVNDHFFSLGGDSLKAMRLVAAAREQSLAIQVTDIFQSPILESLALKVKEVE
FT                   NKGPLEVPPFSLLPAGWEADAARVEAASLCNLDPSEVEDVYPCTPLQEALMALSAKYTD
FT                   AYVAQRVIELQDIQTAKRLQSAFEQVSAECAILRTRIAQVPRRGLMQIVVHANTPWLNS
FT                   SNLAEYLSSDTLKGMSLGTELARFAIVNDETSGKTYIVLSIHHALYDGWSMPLVVDRVN
FT                   RAYRGESIGSPAPFKNFIKWLGETDRSFTEKFWETQLEGATSLQFPPIPYTGYQARADS
FT                   LLEHYVNLPRASSSSTTSIATAIRGAWGLLAAHYTSSDDIVFGETMTGRTAPVAAVEEI
FT                   EGPMITTVPVRVCIDRKARASSYLQQIHDQTVDRIPHEHMGLQHIRRLNADAREACELR
FT                   TGIVIHPTIGEVEPSSKEEPATAFVPTSEAEAAREALKFNSYALMLVFTVDTKGFLVMA
FT                   SFDSKTIDIPQMDQALKQFDRLVQQILEDPTQKIQHIFDSTIETDVAEQCRLAKIGPAS
FT                   LPTEEVYSAATSTWIVNPNDHECLVPPGGVGELLVEKEDEMTSGNPVANPTWCKQPTKL
FT                   YTTNQLAKYTNDGSVIILRAKDAQIGQLQPRNKNLNGGAAITTATQQKLQRVWSQVLDI
FT                   PCEDILLDDSFFDLGGDSIRAMKLVSEARMDGLQLTVTTIFDHRSLFDMADHAVEAQAA
FT                   VTTSQDYAPFSSLNVTDLDEFINKITPLLAQPEWKIVDVYPSRPLQEIAVQGTVQLPRY
FT                   SMRYELFYMDTKVDRAQLFQSCQELVSRNEILRTVFVDHEGVSLGVVVDDLPCQIVEYE
FT                   IESDVEEFSQKLCDVDVQSRIPLGSPFLKFLFVRHVDGPSSLIMRISHAQYDEICLPIL
FT                   LQQLSALYEGRRVPKSLPFSSYVGHVTRTNLPASIPYWRDLLQGSSMTRIQPDIPVVSA
FT                   AHFAISKDVNIAARPREITVATLPTAAWALCLARRLSLDDVTFGEVVSGRNIDLPNADS
FT                   IVGPSWQYVPVRVKFGKEWTVMDLLQLVQRQHLESAQYEGIGLKEIVKDCTDWPETVDW
FT                   FDSVVHQDVEHVEDLSFMAASSRMQTIYPHFEPLREIKVQAFPKGDTLCIEIVTVESWS
FT                   DFAVSLLDDMIDTVGQLVNQVDSKIL"
FT   exon            complement(871894..877242)
FT                   /gene="Pc16g03850"
FT                   /locus_tag="PCH_Pc16g03850"
FT                   /number=1
FT   intron          complement(877243..877289)
FT                   /gene="Pc16g03850"
FT                   /locus_tag="PCH_Pc16g03850"
FT                   /number=1
FT   exon            complement(877290..877643)
FT                   /gene="Pc16g03850"
FT                   /locus_tag="PCH_Pc16g03850"
FT                   /number=2
FT   mRNA            join(<878527..879492,879546..>879908)
FT                   /gene="Pc16g03860"
FT                   /locus_tag="PCH_Pc16g03860"
FT   CDS_pept        join(878527..879492,879546..879908)
FT                   /gene="Pc16g03860"
FT                   /locus_tag="PCH_Pc16g03860"
FT                   /note="Title: strong similarity to aerobactin biosynthesis
FT                   protein iucB - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03860"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93056"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z5"
FT                   /inference="similar to AA sequence:PIR:S44019"
FT                   /inference="protein motif:COGS:COG1670"
FT                   /inference="protein motif:COGS:COG0456"
FT                   /protein_id="CAP93056.1"
FT                   /translation="MSSSTLPLVRLPEPYKTTYELHVVSTDRNLRKFQLLRAPRGDEGI
FT                   PPPKPLDHASLKFTDLAQPDPSSTPDEGNNSPWARAQRSPVTYITWEGSDTPTVGQIWN
FT                   VVYAIETLRSEFEIFRGVLSGTGSEILARELEGVGLAIAHPEPSAAPGKPIPTTTNHLG
FT                   QLVFSRSSFWQGAGSPFGTRPAWVSDPGIYSYMRKPLSEYPCRPRQHTVTTGFPERRVH
FT                   ALHPVRPPKPSPGSCIYSRYIPHLDEFFSVYALDYTNEEHLGLFNKWQNDPRVAQGWNE
FT                   TGTLEQHREYLRKIQEDPHQIAVLAKFNDTFFSYHEIYWAKEDHLGAYYDAGDWDRGRH
FT                   SLVGDERFRGPHRTIAWWSGLMHYIFLDDPRTEYVTGEPKYSNLAPLTYDHATGMNLAK
FT                   LVDLPHKRSALILGSREKFFHVAPLRFDGSDTLDRNPFRSLKL"
FT   exon            878527..879492
FT                   /gene="Pc16g03860"
FT                   /locus_tag="PCH_Pc16g03860"
FT                   /number=1
FT   intron          879493..879545
FT                   /gene="Pc16g03860"
FT                   /locus_tag="PCH_Pc16g03860"
FT                   /number=1
FT   exon            879546..879908
FT                   /gene="Pc16g03860"
FT                   /locus_tag="PCH_Pc16g03860"
FT                   /number=2
FT   mRNA            join(<880563..880595,880644..881562,881621..>884634)
FT                   /gene="Pc16g03870"
FT                   /locus_tag="PCH_Pc16g03870"
FT   CDS_pept        join(880563..880595,880644..881562,881621..884634)
FT                   /gene="Pc16g03870"
FT                   /locus_tag="PCH_Pc16g03870"
FT                   /note="Title: strong similarity to multidrug resistance
FT                   protein atrD - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03870"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93057"
FT                   /db_xref="GOA:B6H7Z6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z6"
FT                   /inference="protein motif:PFAM:PF00664"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /inference="protein motif:COGS:COG1132"
FT                   /protein_id="CAP93057.1"
FT                   /translation="MAEDAPAQKRSWRDRAVFFRLFVYGEPSRSDIALLVLGLVSAIAS
FT                   GIPFPIMSIVFGQLVDEMNSTTCNVNDTNGDAYQAGINDKVLMIVYIGIAYLVLIYIYV
FT                   FSWNLTGERLAQRLREKYFKALLRQDVAFFDNLPAGEASSRITGDITTVQQGTSEKVGI
FT                   VINSLAFFVTAYVVAFIKDPKLAGMLVSLTPAYLIMSLLGGYFVQKYFGRALESMTKAS
FT                   SVALEAFSNTMVVHAFSANARLEEKFIEFLNPGRIAGIRKSIATATQAGLLYFIAFSAN
FT                   ALAFWQGSTKIADSVESNDSSMTVGATYTVIFILVDASLILSTVAPFIQSFDAASVAFT
FT                   KLKADIDHSSAIDGTSKDIGEVLPEVKGHVELRDVSFCFPSRPDKPVLQNLSLSCPAGK
FT                   QTAIVGLSGSGKSTVAGLATRFYDATEGTVMLDGHDVKDLNVRALRSHISLVQQEPCLL
FT                   DRSIFENIAMGLINSPAHTHLQPILTGTALIEIAAAVREGQALSAAALEHGDQAREVVD
FT                   LVESATKLADANVFIEKLQEGYGTSVGSSGNLISGGQKQRISLARALVKDPRILILDEA
FT                   TASLDSATEMRIQRALESVAVGRTVITIAHRLSTIRNADNIIVMRQGKLVEQGTHTELL
FT                   AANGAYAELIRLQNLNVENSQEGTSTRSASPVTQITEKVEPNLSVTDDVPDKDETVDTP
FT                   AAQESKPKETGGVVDTNRSFASTVGSLGSMFRPYSFVLVLAVTGAVVIGGTYCASAVIF
FT                   GNVVGKLSGCEEPQNIRDAGEFYGLMFFVLAIIEFFANFFSWSLFGWMAENVIYKVRVL
FT                   SLRAILEQDLQWHESNDRNPSLLLSLITKDSNALAGLTGSVVCTILSILINLFAAIIMS
FT                   HIIAWRIAIVCLAVVPLLLAAGWMRVTSLAQFEERHLEAFARSVGITVEAVNSIKTVMS
FT                   LSVEDEIMGTYRRSLAAPMREITRQSAWANVWLAIGYGLSNFLYGLAYWWGAKNIIAGY
FT                   YSQTQFFIVQLALLVSSQLWGQMFALAPDVSRAFQATRRLLNLLDLGTTKKLSAPIELL
FT                   PSKLLQSTSDVESTANAREKVDDTRNGISVSLKQVHFAYPARPDTRVLHGLDIDVKPGQ
FT                   FAALVGPSGAGKSTIISLVERLYSPESGTIHVDGRDVAYGDISFRDNIAYVPQQSVMFE
FT                   GTIRFNLALGARPGHEVTQDELEEACKLANIHDVISQLPDGYDTHCGPNGDRLSGGQKQ
FT                   RLAIARALIRKPKLLLLDESTSALDAESERLLQDGLEKAAKNMTVIAIAHRLYTIRKAD
FT                   VIFLIEDGRCVEQGTHTQLIERSETYRVNALNQTVDG"
FT   exon            880563..880595
FT                   /gene="Pc16g03870"
FT                   /locus_tag="PCH_Pc16g03870"
FT                   /number=1
FT   intron          880596..880643
FT                   /gene="Pc16g03870"
FT                   /locus_tag="PCH_Pc16g03870"
FT                   /number=1
FT   exon            880644..881562
FT                   /gene="Pc16g03870"
FT                   /locus_tag="PCH_Pc16g03870"
FT                   /number=2
FT   intron          881563..881620
FT                   /gene="Pc16g03870"
FT                   /locus_tag="PCH_Pc16g03870"
FT                   /number=2
FT   exon            881621..884634
FT                   /gene="Pc16g03870"
FT                   /locus_tag="PCH_Pc16g03870"
FT                   /number=3
FT   mRNA            complement(join(<884789..884829,884877..885539,
FT                   885592..885942,885998..>886193))
FT                   /gene="Pc16g03880"
FT                   /locus_tag="PCH_Pc16g03880"
FT   CDS_pept        complement(join(884789..884829,884877..885539,
FT                   885592..885942,885998..886193))
FT                   /gene="Pc16g03880"
FT                   /locus_tag="PCH_Pc16g03880"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_7_scaffold_1.tfa_250wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03880"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93058"
FT                   /db_xref="GOA:B6H7Z7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z7"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /inference="protein motif:COGS:COG1249"
FT                   /protein_id="CAP93058.1"
FT                   /translation="MPGLEEQPPFKVLIVGGSYSGLAATLNLIDLCHGRKCRFNLDENE
FT                   KGPGHTIPVQVTIVDERDGYYHLIGLPLAMASNADASTFWKKFDDIPALQSPDINHIQG
FT                   RVDSIDCKSRIARIRQNTSNDGHKIIEEKYDFMVACSGLRREWPSAPKSLTREAYLAET
FT                   AESVQTIEEASAGVVVIGGGAVGIEIAAEIKMVQPEAKVTLIHSRQQLLSSEDLPDEFK
FT                   EKTLEMLKESGVEVVMGARVQDTVRGDESAPAKYTLKLSDGRELAADHVINAVSRFAPT
FT                   SSYLPKEACDAEGYVRITPGLQFSADVPNKKYHYAAGDIVAWSGIKRGGQAMHQAHFAV
FT                   FNIHQQMLAERYNTEPKFVELVDVAPMMALALGKTAVGYFPAMGLSSGDEIRNMFFNDD
FT                   LGYEICWKWMRLGEATE"
FT   exon            complement(884789..884829)
FT                   /gene="Pc16g03880"
FT                   /locus_tag="PCH_Pc16g03880"
FT                   /number=1
FT   intron          complement(884830..884876)
FT                   /gene="Pc16g03880"
FT                   /locus_tag="PCH_Pc16g03880"
FT                   /number=1
FT   exon            complement(884877..885539)
FT                   /gene="Pc16g03880"
FT                   /locus_tag="PCH_Pc16g03880"
FT                   /number=2
FT   intron          complement(885540..885591)
FT                   /gene="Pc16g03880"
FT                   /locus_tag="PCH_Pc16g03880"
FT                   /number=2
FT   exon            complement(885592..885942)
FT                   /gene="Pc16g03880"
FT                   /locus_tag="PCH_Pc16g03880"
FT                   /number=3
FT   intron          complement(885943..885997)
FT                   /gene="Pc16g03880"
FT                   /locus_tag="PCH_Pc16g03880"
FT                   /number=3
FT   exon            complement(885998..886193)
FT                   /gene="Pc16g03880"
FT                   /locus_tag="PCH_Pc16g03880"
FT                   /number=4
FT   mRNA            join(<886545..886935,886987..>887288)
FT                   /gene="Pc16g03890"
FT                   /locus_tag="PCH_Pc16g03890"
FT   CDS_pept        join(886545..886935,886987..887288)
FT                   /gene="Pc16g03890"
FT                   /locus_tag="PCH_Pc16g03890"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   SPAC56E4.07 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03890"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93059"
FT                   /db_xref="GOA:B6H7Z8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z8"
FT                   /inference="similar to AA sequence:PIR:T38909"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /inference="protein motif:COGS:COG0454"
FT                   /inference="protein motif:COGS:COG1247"
FT                   /inference="protein motif:COGS:COG0456"
FT                   /protein_id="CAP93059.1"
FT                   /translation="MGFVVVPATLPDIRAIYDVWFAAFKGQLILDLIYPGTDINDEAFR
FT                   KVHTEGALEYWKGLSTEHTFQCIDTDTGKIAGMATWQVYWRERTAEERQKPWIGWLEGD
FT                   QRSRAEGFLEQLWEKREKWIGPKKHVYCHTVAVHPDYQGKGVGAQLMQWGMNVAEQLDL
FT                   PVYLESTVEGVPLYKKLGFQTLSEGIVFKPEITRVDKEVRAPLMAKMPTSAGNMTFEEW
FT                   AEGKTSSV"
FT   exon            886545..886935
FT                   /gene="Pc16g03890"
FT                   /locus_tag="PCH_Pc16g03890"
FT                   /number=1
FT   intron          886936..886986
FT                   /gene="Pc16g03890"
FT                   /locus_tag="PCH_Pc16g03890"
FT                   /number=1
FT   exon            886987..887288
FT                   /gene="Pc16g03890"
FT                   /locus_tag="PCH_Pc16g03890"
FT                   /number=2
FT   mRNA            join(<888312..889145,889206..>889889)
FT                   /gene="Pc16g03900"
FT                   /locus_tag="PCH_Pc16g03900"
FT   CDS_pept        join(888312..889145,889206..889889)
FT                   /exception="reasons given in citation"
FT                   /gene="Pc16g03900"
FT                   /locus_tag="PCH_Pc16g03900"
FT                   /note="putative sequencing error"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An18g01950 - Aspergillus niger [putative sequencing error]"
FT                   /db_xref="GOA:B6H7Z9"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z9"
FT                   /protein_id="CAP93060.1"
FT                   /translation="MAMRKAAPPYPSFFKWVASVLKDEQGRPFIVVRDQGKKKRQHGTE
FT                   AVKSHIVAAKTVASIVKSSLGPRGLDKILISPDGDITVTNDGATILGQMEITNNVAKLL
FT                   VELSQSQDEEIGDGTTGVVVLAAAMLEQASDLIDKGIHPIRIADGYDQACEIAVAELDR
FT                   ISDEITFSKDDTTNLLKVAKTSLGSKIVSKSHDQFAKIAVDAVLSVADFERKDVDFELI
FT                   KVDGKVGGSLEDSLLVRGVIVDKDFSHPQMPDEVRDAKLAILTCPFEPPKPKTKHKLDI
FT                   TSVEEFKKLQDYEKEKFTEMIQQLKESGANLVICQWGFDDEANHLLLQNDLPAVRWVGG
FT                   PEIELIAIATNGRIVPRFEDLSSDKLGTAGVVREMSFGTTREKMLVIEECANTRAVTIF
FT                   VRGSNKMIIDEAKRSLHDALCVVRNLVRDNRVVYGGGAAEIACSIAVEDAAVKSPGIEQ
FT                   YAMRAFADALDAVPLALSENSGLSPIETLASIKSRQVKEKNTRLGVDCMMTGTNGIRRS
FT                   FHIQFRSWANLDSSDMREHFAIDPLIGKRQQLLLATQLCRMVLKINNVIISGDDQSEF"
FT   sig_peptide     888312..888371
FT                   /gene="Pc16g03900"
FT                   /locus_tag="PCH_Pc16g03900"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            888312..889145
FT                   /gene="Pc16g03900"
FT                   /locus_tag="PCH_Pc16g03900"
FT                   /number=1
FT   mat_peptide     join(888372..889145,889206..889886)
FT                   /gene="Pc16g03900"
FT                   /locus_tag="PCH_Pc16g03900"
FT   intron          889146..889205
FT                   /gene="Pc16g03900"
FT                   /locus_tag="PCH_Pc16g03900"
FT                   /number=1
FT   exon            889206..889889
FT                   /gene="Pc16g03900"
FT                   /locus_tag="PCH_Pc16g03900"
FT                   /number=2
FT   mRNA            complement(join(<890263..891514,891580..891867,
FT                   891934..>892148))
FT                   /gene="Pc16g03910"
FT                   /locus_tag="PCH_Pc16g03910"
FT   CDS_pept        complement(join(890263..891514,891580..891867,
FT                   891934..892148))
FT                   /gene="Pc16g03910"
FT                   /locus_tag="PCH_Pc16g03910"
FT                   /note="Title: strong similarity to ferrioxamine B permease
FT                   Sit1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03910"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93061"
FT                   /db_xref="GOA:B6H800"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H800"
FT                   /inference="similar to AA sequence:PIR:S50524"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP93061.1"
FT                   /translation="MASKETQIAQVTAADVTYPTEKETETAQPPAYAADGNSDQESLDQ
FT                   EAQAGVKGVQAAAAVWTKSHLILAYVIIWFIYFVTSIQEVVIRSLNPYVTSAFELHSLT
FT                   AATNIMANIIGGLSKIPLAKILDSWGRPQGMSLMLLIWVVGFIMMAGCNNVQTYAAAQV
FT                   FSSVGSQGVSYCLTVFISDTSSLKNRALMLSYATSPYIITTWIGGPIAQSVLGGPGWRW
FT                   GFGIFTIVVPVVVAPLCLLFFWNQHKAKKMGLLAPSRGPLTLSTIKQYCIEVDLIGIIL
FT                   LAGGMALFLLPFSLWSYQKDQWRSAMIICMIIFGGLLLIAFALYERFWAPVTFIPFNLL
FT                   MDRTVFFGGLMFVFEFFNSMVWGSYFGSMLQVVWGLDVTEASYVQAIYRVGSCLFCLLV
FT                   GVLIRWTGRFKWLAVYFSFPLMILGVGLMIKFRQPDAGIGYICMTQIFVAFAGGTTVIC
FT                   GELAMMAPSNHQHIAVILAMLNLFGSIGSAIGSTVSAAIWTSEFPKALAKYVPAEVNVA
FT                   KVYSDITAQLSYEWGSPARNAIAHAYGDAQRYMLITSVCMLVVAWGCAGMWRDIKIKDV
FT                   KQVKGRVI"
FT   exon            complement(890263..891514)
FT                   /gene="Pc16g03910"
FT                   /locus_tag="PCH_Pc16g03910"
FT                   /number=1
FT   intron          complement(891515..891579)
FT                   /gene="Pc16g03910"
FT                   /locus_tag="PCH_Pc16g03910"
FT                   /number=1
FT   exon            complement(891580..891867)
FT                   /gene="Pc16g03910"
FT                   /locus_tag="PCH_Pc16g03910"
FT                   /number=2
FT   intron          complement(891868..891933)
FT                   /gene="Pc16g03910"
FT                   /locus_tag="PCH_Pc16g03910"
FT                   /number=2
FT   exon            complement(891934..892148)
FT                   /gene="Pc16g03910"
FT                   /locus_tag="PCH_Pc16g03910"
FT                   /number=3
FT   mRNA            complement(join(<893255..893524,893573..>893635))
FT                   /gene="Pc16g03920"
FT                   /locus_tag="PCH_Pc16g03920"
FT   CDS_pept        complement(join(893255..893524,893573..893635))
FT                   /gene="Pc16g03920"
FT                   /locus_tag="PCH_Pc16g03920"
FT                   /EC_number="4.2.3.6"
FT                   /note="Title: weak similarity to trichodiene synthase
FT                   -Gibberella pulicaris"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03920"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93062"
FT                   /db_xref="GOA:B6H801"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR024652"
FT                   /db_xref="UniProtKB/TrEMBL:B6H801"
FT                   /inference="similar to AA sequence:SWISSPROT:TOX5_GIBPU"
FT                   /protein_id="CAP93062.1"
FT                   /translation="MVGLSPEVKAELPEIISMFFPLNDIISLYKEMDEMDKCNFVIKSA
FT                   RCKELTQVEVLRKLCGDTSDVIRTSRPPGKAHFGLSKVIEAFLPGYKTYHRHWFLTLEN
FT                   SSRLLL"
FT   exon            complement(893255..893524)
FT                   /gene="Pc16g03920"
FT                   /locus_tag="PCH_Pc16g03920"
FT                   /number=1
FT   intron          complement(893525..893572)
FT                   /gene="Pc16g03920"
FT                   /locus_tag="PCH_Pc16g03920"
FT                   /number=1
FT   exon            complement(893573..893635)
FT                   /gene="Pc16g03920"
FT                   /locus_tag="PCH_Pc16g03920"
FT                   /number=2
FT   mRNA            complement(join(<893980..894071,894343..894479,
FT                   894535..894610,894677..>894758))
FT                   /gene="Pc16g03930"
FT                   /locus_tag="PCH_Pc16g03930"
FT   CDS_pept        complement(join(893980..894071,894343..894479,
FT                   894535..894610,894677..894758))
FT                   /gene="Pc16g03930"
FT                   /locus_tag="PCH_Pc16g03930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03930"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93063"
FT                   /db_xref="UniProtKB/TrEMBL:B6H802"
FT                   /protein_id="CAP93063.1"
FT                   /translation="MPWCLGDPLAGVVRVYPRRSCEGSDTRCTKEGARLSSPLVKKGSW
FT                   ELAEPECRYIRWREWDKLWGLGSANLLLLKHMLTVYEDGAWIAVMPMSHGRKEGGSKGY
FT                   NAERLMETSRCTVECEMILNSCGS"
FT   exon            complement(893980..894071)
FT                   /gene="Pc16g03930"
FT                   /locus_tag="PCH_Pc16g03930"
FT                   /number=1
FT   intron          complement(894072..894342)
FT                   /gene="Pc16g03930"
FT                   /locus_tag="PCH_Pc16g03930"
FT                   /number=1
FT   exon            complement(894343..894479)
FT                   /gene="Pc16g03930"
FT                   /locus_tag="PCH_Pc16g03930"
FT                   /number=2
FT   intron          complement(894480..894534)
FT                   /gene="Pc16g03930"
FT                   /locus_tag="PCH_Pc16g03930"
FT                   /number=2
FT   exon            complement(894535..894610)
FT                   /gene="Pc16g03930"
FT                   /locus_tag="PCH_Pc16g03930"
FT                   /number=3
FT   intron          complement(894611..894676)
FT                   /gene="Pc16g03930"
FT                   /locus_tag="PCH_Pc16g03930"
FT                   /number=3
FT   exon            complement(894677..894758)
FT                   /gene="Pc16g03930"
FT                   /locus_tag="PCH_Pc16g03930"
FT                   /number=4
FT   mRNA            join(<894901..895012,895077..>896497)
FT                   /gene="Pc16g03940"
FT                   /locus_tag="PCH_Pc16g03940"
FT   CDS_pept        join(894901..895012,895077..896497)
FT                   /gene="Pc16g03940"
FT                   /locus_tag="PCH_Pc16g03940"
FT                   /note="Title: strong similarity to dicarboxylic amino acid
FT                   permease Dip5 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03940"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93064"
FT                   /db_xref="GOA:B6H803"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B6H803"
FT                   /inference="similar to AA sequence:PIR:S65298"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /inference="protein motif:COGS:COG0833"
FT                   /protein_id="CAP93064.1"
FT                   /translation="MAGDIEESPEKHSHGTSHKLPDLQRRLKSRHLQMIAMGGAIGTGL
FT                   FIGSGSAIATAGPVGALIAFTFIGSIVYSVMIALGEVATYLPIAGAFATYATRLVDPSL
FT                   GFAMGWIYWFSWASTFALELTATGLIIQYWDDAIPMAIFIAVFWVVIIILNMFPVSCYG
FT                   EVEFWLSSIKIITVVGFMIFAICINAGVGREGYLGFRYWVHPGPFRAYLIEDSGQDALA
FT                   KFVGFWAILIKAGFSYQGTELVGIAAGETENPRRNIPSAIRKTFFRIVFFFVFTIFFVG
FT                   IVVPSDDKRLTSDDSGTNADASPFVIAAKRAGVNVLPSIINAVLLTVVLSAANSNVYSG
FT                   SRILVGLAHEGFAPRFFLKTTKHGVPYASVGFTALFGLLGFLNVSNAGATVFNWLMQIA
FT                   GLAGFITWASLNICHLAFMKALAAQGIPRDTLPYKAPWQPFFSWYGLFFNILIIITQGF
FT                   TAFIPKFSVTDFFINYLSLMLFAVLYIGHKVVFRPGFVKPKQADIDTGRFEE"
FT   exon            894901..895012
FT                   /gene="Pc16g03940"
FT                   /locus_tag="PCH_Pc16g03940"
FT                   /number=1
FT   intron          895013..895076
FT                   /gene="Pc16g03940"
FT                   /locus_tag="PCH_Pc16g03940"
FT                   /number=1
FT   exon            895077..896497
FT                   /gene="Pc16g03940"
FT                   /locus_tag="PCH_Pc16g03940"
FT                   /number=2
FT   mRNA            complement(join(<897066..897189,897258..>897508))
FT                   /gene="Pc16g03950"
FT                   /locus_tag="PCH_Pc16g03950"
FT   CDS_pept        complement(join(897066..897189,897258..897508))
FT                   /gene="Pc16g03950"
FT                   /locus_tag="PCH_Pc16g03950"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig46_part_i.tfa_1210wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03950"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93065"
FT                   /db_xref="UniProtKB/TrEMBL:B6H862"
FT                   /protein_id="CAP93065.1"
FT                   /translation="MSMSVSANTRPQAGAPASPASRRLLIFQETCNPQNVAEIVYIPVN
FT                   KLGLPICGDGPELPSILLLPLRVLRVFTDIFNQPKYKGWAVVSAGPYRDVSEEGKFYAV
FT                   LLEQTQNTVHASHETHMGTP"
FT   exon            complement(897066..897189)
FT                   /gene="Pc16g03950"
FT                   /locus_tag="PCH_Pc16g03950"
FT                   /number=1
FT   intron          complement(897190..897257)
FT                   /gene="Pc16g03950"
FT                   /locus_tag="PCH_Pc16g03950"
FT                   /number=1
FT   exon            complement(897258..897508)
FT                   /gene="Pc16g03950"
FT                   /locus_tag="PCH_Pc16g03950"
FT                   /number=2
FT   mRNA            complement(join(<898326..898737,898855..900230,
FT                   900296..>900913))
FT                   /gene="Pc16g03960"
FT                   /locus_tag="PCH_Pc16g03960"
FT   CDS_pept        complement(join(898326..898737,898855..900230,
FT                   900296..900913))
FT                   /gene="Pc16g03960"
FT                   /locus_tag="PCH_Pc16g03960"
FT                   /note="Title: similarity to hypothetical protein B16B8.060
FT                   - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03960"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93066"
FT                   /db_xref="UniProtKB/TrEMBL:B6H863"
FT                   /inference="similar to AA sequence:TREMBLNEW:BX842634.6"
FT                   /protein_id="CAP93066.1"
FT                   /translation="MPSLTLTDPDMILPYEGERESQTPSPPRIAYLSHLNSRQPDHNAS
FT                   MSAPRQKKNFSRHAWTHDDVSVSRRLSDIGEELSPDRSEGFGDSDEHELASSPLLHERD
FT                   NQNKDNAAWSSSNSTISAGSRRASASRDVSEAHNGRDESPVHPEVARAQATAVVGTGAS
FT                   SVPASSAVASAAAEGKGPGEEFSSAILSSEAERILENAKKRLNLMENNLTRARSTTPRT
FT                   TASPSPSPSNSGYIQPMGMHQPVGGLYRSISRTDPKNSSLRRQSLIASQDTTNNRHSRV
FT                   HSETNFPSDSSFSNDKRISRSVSAMGASTSSSLHTDDRSFHYAPTRAYLTHRSSVSSMQ
FT                   PPRLAHEQEHHDQPAQSPVSAGGSSSDSPQGLGNSEEESKSSSEGFSPVYSSFGPPSRA
FT                   QSQLQVRDLQYQMKGLHIKISSLKVKNQEDNLRRRSLQSLRTPSPLTAADHWYANALEL
FT                   RDGQGSRGSNPRRNASSENIRRASNDAAEDRHRSDEHAAGHKSKRAGNWQGNEPADYAD
FT                   DQSVAETMYEDAEEGDFDEDIDREALNEILREPLDDDFENDMEAFPDVPSHTDATPHEM
FT                   REDAFDYEHFILHSALGNYTQQLRRVSNSSNGSVETTRPPYTARHSRTNSNMSDSTVAT
FT                   FATATEGERPDDEDDIDSVMYWDRRFNHGAHSYQPSPIQELEAEGDRSETPRGPRHESD
FT                   TNQVDPNNLSPQKLTGRSSSATAGSATPTSLVSSLVSTVRAASSTPSVGGINDDDTQML
FT                   EALFASLGNVCKDLQDITTSPDPDVKAARVLRRRLDAARRVLDGELDA"
FT   exon            complement(898326..898737)
FT                   /gene="Pc16g03960"
FT                   /locus_tag="PCH_Pc16g03960"
FT                   /number=1
FT   intron          complement(898738..898854)
FT                   /gene="Pc16g03960"
FT                   /locus_tag="PCH_Pc16g03960"
FT                   /number=1
FT   exon            complement(898855..900230)
FT                   /gene="Pc16g03960"
FT                   /locus_tag="PCH_Pc16g03960"
FT                   /number=2
FT   intron          complement(900231..900295)
FT                   /gene="Pc16g03960"
FT                   /locus_tag="PCH_Pc16g03960"
FT                   /number=2
FT   exon            complement(900296..900913)
FT                   /gene="Pc16g03960"
FT                   /locus_tag="PCH_Pc16g03960"
FT                   /number=3
FT   mRNA            complement(join(<901731..903439,903499..>903874))
FT                   /gene="Pc16g03970"
FT                   /locus_tag="PCH_Pc16g03970"
FT   CDS_pept        complement(join(901731..903439,903499..903874))
FT                   /gene="Pc16g03970"
FT                   /locus_tag="PCH_Pc16g03970"
FT                   /note="Title: strong similarity to hypothetical conserved
FT                   protein SPCP1E11.11 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03970"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93067"
FT                   /db_xref="GOA:B6H864"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR012959"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR040059"
FT                   /db_xref="UniProtKB/TrEMBL:B6H864"
FT                   /inference="similar to AA sequence:PIR:T41690"
FT                   /protein_id="CAP93067.1"
FT                   /translation="MAGLKRAVDGSEERNGKRSKTKEASTSKSKSVKSSSSSKKDSKKD
FT                   FKSTKSDKKPSKKVQKEESEDDDDFDIDDVSDEDIDALDALSDDEEMPDVSDEEEKQVS
FT                   DKKSDADDEDQQEAPKKANPNNNNSRESHIKQKALQQERKAAKPNADTVARSKKLWEQL
FT                   RRKSHVPLEQRKKLVKELFEIITNRVRDFVFKHDSVRVIQTALKYGNLEQRKLIAHELK
FT                   GTYKELAQSRYAKFLVGKLIVHGDDETRDLIIPEFYGHVKRLIRHPEGSWILDDIYRTV
FT                   ATKAQKDRLLREWYGPEFVIFQDENDTTSDLRKIIEAHPEKRGPIMNYLRELINLLVQK
FT                   KSTGFTMLHDAMLQYFLCTKPGSNEASEFIELLKGDEEGDLVKNLAFTKSGSRLMCLSL
FT                   AYSNAKDRKLLLRFFRDTVKVMAGDIYGHQVILAAYEVIDDTKLCAKSFFPELLNQNDG
FT                   EEARNEELCYQVNDLTARIAVLYPFVGERVKWLLPEVDNPVLEEVRDVRKETSKKDPAI
FT                   RRQELVKAASPTLLEFIAARASTLLETTFGCQFLAEVLFAADGDKTAALAAVAEAAKSH
FT                   TEARDTAHVGRLLKSLVQGGRFNPATKSIEKVEPALNFHAALYEQIKDEVMDWATGANP
FT                   FVIVALAESEDFEKKSELLKTLKKNKKALEQASASVVEKDGQKKPTPTSSGAKLLLSKI
FT                   "
FT   exon            complement(901731..903439)
FT                   /gene="Pc16g03970"
FT                   /locus_tag="PCH_Pc16g03970"
FT                   /number=1
FT   intron          complement(903440..903498)
FT                   /gene="Pc16g03970"
FT                   /locus_tag="PCH_Pc16g03970"
FT                   /number=1
FT   exon            complement(903499..903874)
FT                   /gene="Pc16g03970"
FT                   /locus_tag="PCH_Pc16g03970"
FT                   /number=2
FT   mRNA            complement(join(<904441..904806,904870..905007,
FT                   905063..905091,905175..>905325))
FT                   /gene="Pc16g03980"
FT                   /locus_tag="PCH_Pc16g03980"
FT   CDS_pept        complement(join(904441..904806,904870..905007,
FT                   905063..905091,905175..905325))
FT                   /gene="Pc16g03980"
FT                   /locus_tag="PCH_Pc16g03980"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g02380 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03980"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93068"
FT                   /db_xref="UniProtKB/TrEMBL:B6H865"
FT                   /protein_id="CAP93068.1"
FT                   /translation="MPPFRNFLGRKSQPNGDTTALDDNHLSPNQRPAPIPIRNSHDEPT
FT                   EYKLSVVNDSGVYLPPSPPERPSFWRRYPGSSKSVNHRDLVDDNEPFSISRESFDSYRR
FT                   SFDISARSPIIHPDAAPSRTSLDSRFSRLTPSVTQCNSLSKSEIMEEETFEEVGLNDEA
FT                   KPKKKGFLSRFGDSGNDAQTSGPKSSTSSFGFHIPGRKRGQSGGGSELASVKVAPSAPA
FT                   PTDET"
FT   exon            complement(904441..904806)
FT                   /gene="Pc16g03980"
FT                   /locus_tag="PCH_Pc16g03980"
FT                   /number=1
FT   intron          complement(904807..904869)
FT                   /gene="Pc16g03980"
FT                   /locus_tag="PCH_Pc16g03980"
FT                   /number=1
FT   exon            complement(904870..905007)
FT                   /gene="Pc16g03980"
FT                   /locus_tag="PCH_Pc16g03980"
FT                   /number=2
FT   intron          complement(905008..905062)
FT                   /gene="Pc16g03980"
FT                   /locus_tag="PCH_Pc16g03980"
FT                   /number=2
FT   exon            complement(905063..905091)
FT                   /gene="Pc16g03980"
FT                   /locus_tag="PCH_Pc16g03980"
FT                   /number=3
FT   intron          complement(905092..905174)
FT                   /gene="Pc16g03980"
FT                   /locus_tag="PCH_Pc16g03980"
FT                   /number=3
FT   exon            complement(905175..905325)
FT                   /gene="Pc16g03980"
FT                   /locus_tag="PCH_Pc16g03980"
FT                   /number=4
FT   mRNA            complement(join(<906101..906207,906281..906470,
FT                   906523..906912,906962..907326,907379..907490,
FT                   907560..908062,908115..>908616))
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT   CDS_pept        complement(join(906101..906207,906281..906470,
FT                   906523..906912,906962..907326,907379..907490,
FT                   907560..908062,908115..908616))
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g02420 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g03990"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93069"
FT                   /db_xref="GOA:B6H866"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:B6H866"
FT                   /protein_id="CAP93069.1"
FT                   /translation="MGRKPNQLILEFFHRGPKLEDASNRYQHTCKACGEVFPKGRIDSL
FT                   TNHLVKKCQAIPLRDRQRVLLRLHELPDLTDGDSNKDSPSGSKGKSADGGFPNRQNFDG
FT                   LNVLAEASRQVGASDVTKRGPGYTQSVTAGGKTVIVDPALEAEGFQGHSQGPDSKAEGT
FT                   ANAEGTPQSSNAPSIPALPSHTPGEHPASMSPPLGDASMSPESTSNARQSQLSMIAASA
FT                   NEMVPQGMSIDSDSDMKMNQWNQQLSTHEQLLFDSLQEHDPSLTAATQRAASYPRPIAM
FT                   NPNTQAKGFVNEFGNSTKPMKPKVRGRFTAERRREVQDVRKKGACLRCRMLKKPCSGDT
FT                   PCTTCASVESARLWKHPCLRTRLSDEFELYNANLNSTLAYHDTNSIKNQIKFEHYSGRI
FT                   EVTHFEESNSFMTFSGLQGHRTSVSALDPQLQALGDDQFAGPSQEVYLLDADSDDIPSK
FT                   LEMYIKKNASYFYERETSPFMKPTLLLAAELNQGKKDILLERVLELWVATHILVDTELT
FT                   WKTYYNPTLPPNSLHSLSQPSDEGRLPIEEVSDPESYGLLCSQLRAAMEKRASQLSKFV
FT                   INDLERRLLQRQKCGWFDTFIVAIILLNCVDRTCWLFRSWDNENFSQRWPLDKRPPYYF
FT                   NQSDRFADILEMLLRMRHIPPKATFRPDNGILKAVDGSDEHAIRWFDMIQITPYFIEER
FT                   KNAVFDPSDSRSLDCHHSASLLEPNNAT"
FT   exon            complement(906101..906207)
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /number=1
FT   intron          complement(906208..906280)
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /number=1
FT   exon            complement(906281..906470)
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /number=2
FT   intron          complement(906471..906522)
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /number=2
FT   exon            complement(906523..906912)
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /number=3
FT   intron          complement(906913..906961)
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /number=3
FT   exon            complement(906962..907326)
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /number=4
FT   intron          complement(907327..907378)
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /number=4
FT   exon            complement(907379..907490)
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /number=5
FT   intron          complement(907491..907559)
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /number=5
FT   exon            complement(907560..908062)
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /number=6
FT   intron          complement(908063..908114)
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /number=6
FT   exon            complement(908115..908616)
FT                   /gene="Pc16g03990"
FT                   /locus_tag="PCH_Pc16g03990"
FT                   /number=7
FT   mRNA            complement(join(<909559..910737,910791..911412,
FT                   911514..>911850))
FT                   /gene="Pc16g04000"
FT                   /locus_tag="PCH_Pc16g04000"
FT   CDS_pept        complement(join(909559..910737,910791..911412,
FT                   911514..911850))
FT                   /pseudo
FT                   /gene="Pc16g04000"
FT                   /locus_tag="PCH_Pc16g04000"
FT                   /note="putative pseudogene"
FT                   /note="unknown EC_number=2.7.7.7"
FT                   /note="Title: strong similarity to DNA polymerase lambda
FT                   POL lambda - Homo sapiens [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AF161019.1"
FT                   /inference="protein motif:COGS:COG1796"
FT   exon            complement(909559..910737)
FT                   /gene="Pc16g04000"
FT                   /locus_tag="PCH_Pc16g04000"
FT                   /number=1
FT   intron          complement(910738..910790)
FT                   /gene="Pc16g04000"
FT                   /locus_tag="PCH_Pc16g04000"
FT                   /number=1
FT   exon            complement(910791..911412)
FT                   /gene="Pc16g04000"
FT                   /locus_tag="PCH_Pc16g04000"
FT                   /number=2
FT   intron          complement(911413..911513)
FT                   /gene="Pc16g04000"
FT                   /locus_tag="PCH_Pc16g04000"
FT                   /number=2
FT   exon            complement(911514..911850)
FT                   /gene="Pc16g04000"
FT                   /locus_tag="PCH_Pc16g04000"
FT                   /number=3
FT   mRNA            <912015..>912297
FT                   /gene="Pc16g04010"
FT                   /locus_tag="PCH_Pc16g04010"
FT   CDS_pept        912015..912297
FT                   /pseudo
FT                   /gene="Pc16g04010"
FT                   /locus_tag="PCH_Pc16g04010"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to reverse transcriptase homolog
FT                   -Bombyx mori [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AB046668.1"
FT   exon            912015..912297
FT                   /gene="Pc16g04010"
FT                   /locus_tag="PCH_Pc16g04010"
FT                   /number=1
FT   gap             913901..914000
FT                   /estimated_length=unknown
FT   mRNA            complement(join(<914439..914526,914576..914650,
FT                   914704..>915398))
FT                   /gene="Pc16g04020"
FT                   /locus_tag="PCH_Pc16g04020"
FT   CDS_pept        complement(join(914439..914526,914576..914650,
FT                   914704..915398))
FT                   /gene="Pc16g04020"
FT                   /locus_tag="PCH_Pc16g04020"
FT                   /note="Title: strong similarity to sphingoid long-chain
FT                   base resistancy protein Rsb1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g04020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93072"
FT                   /db_xref="GOA:B6H9G8"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9G8"
FT                   /inference="similar to AA sequence:PIR:S66923"
FT                   /inference="protein motif:PFAM:PF04479"
FT                   /protein_id="CAP93072.1"
FT                   /translation="MSTICTEITSQCPVEATTYGYYPNLGGNIFFTIYFGLLGVCQLGL
FT                   GIYTRTWTFLAALGIGTLMEAAGYVGRILMHDNPWSTSGFRLQIFCLILAPTFIAAGIY
FT                   LTLKHIIIYIGPQYSRMNPKLFTWVFIGSDVGSIVLQAAGGGVANAAGTDQAMINTGNN
FT                   IIIAGIAFQVATMSVCGLLASDFFIASRKHLREGFQGEAATEKPQQRMWLVLVAEIGAY
FT                   TTVLIRCIYRLPEMAGGWGNKLMRNEMEFLVLDGMMIALACLVFTVVHPGLYLHTMRTG
FT                   RSRP"
FT   exon            complement(914439..914526)
FT                   /gene="Pc16g04020"
FT                   /locus_tag="PCH_Pc16g04020"
FT                   /number=1
FT   intron          complement(914527..914575)
FT                   /gene="Pc16g04020"
FT                   /locus_tag="PCH_Pc16g04020"
FT                   /number=1
FT   exon            complement(914576..914650)
FT                   /gene="Pc16g04020"
FT                   /locus_tag="PCH_Pc16g04020"
FT                   /number=2
FT   intron          complement(914651..914703)
FT                   /gene="Pc16g04020"
FT                   /locus_tag="PCH_Pc16g04020"
FT                   /number=2
FT   exon            complement(914704..915398)
FT                   /gene="Pc16g04020"
FT                   /locus_tag="PCH_Pc16g04020"
FT                   /number=3
FT   mRNA            join(<915645..915679,915780..>916803)
FT                   /gene="Pc16g04030"
FT                   /locus_tag="PCH_Pc16g04030"
FT   CDS_pept        join(915645..915679,915780..916803)
FT                   /gene="Pc16g04030"
FT                   /locus_tag="PCH_Pc16g04030"
FT                   /note="Title: weak similarity to RNA polymerase II
FT                   transcription factor Upc2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g04030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93073"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9G9"
FT                   /inference="similar to AA sequence:PIR:S61580"
FT                   /protein_id="CAP93073.1"
FT                   /translation="MDAINARSGVSSACTARELPCVYSTPCPRRYSPTETSLKPEPKPP
FT                   AKPAFISPKYHAQHLLLMHKFSTETYKSICGDHSDIEGWQVLIPKLAFEHEFLLHGIFS
FT                   IAALHMAATNADPEQVLSYLDTALQCNELAFAPFREALAHLTPLNCDAVFAQSAIVTII
FT                   GIALPRLNAQHRGESFSMIETMMTVFELLQGASKISQISKPWRQASIFFKYDWRENTTL
FT                   DPDVANAIAQLRMLNGPIESTDSAQNSINQEAIDSLEDSFAKFTNAPHPAPILAWLTYV
FT                   KREFVHGLRERQPFQLLILMNWAVLLNELEASFWWAKGCGKALVAELLTELKDHNEKWK
FT                   SALQWPQQMVGI"
FT   exon            915645..915679
FT                   /gene="Pc16g04030"
FT                   /locus_tag="PCH_Pc16g04030"
FT                   /number=1
FT   intron          915680..915779
FT                   /gene="Pc16g04030"
FT                   /locus_tag="PCH_Pc16g04030"
FT                   /number=1
FT   exon            915780..916803
FT                   /gene="Pc16g04030"
FT                   /locus_tag="PCH_Pc16g04030"
FT                   /number=2
FT   mRNA            complement(join(<916908..917159,917317..917736,
FT                   917785..918093,918144..918728,918775..920032,
FT                   920071..920757,920829..920978,921026..>922497))
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT   CDS_pept        complement(join(916908..917159,917317..917736,
FT                   917785..918093,918144..918728,918775..920032,
FT                   920071..920757,920829..920978,921026..922497))
FT                   /exception="reasons given in citation"
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /note="putative sequencing error"
FT                   /note="unknown EC_number=2.3.1.-"
FT                   /note="Title: strong similarity to polyketide synthase PKS1
FT                   - Cochliobolus heterostrophus [putative sequencing error]"
FT                   /db_xref="GOA:B6H9H0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H0"
FT                   /inference="similar to AA sequence:TREMBL:CHU68040.1"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /inference="protein motif:COGS:COG3321"
FT                   /protein_id="CAP93074.1"
FT                   /translation="MSSGPEKPKKVPRKHVTTACVPCRESKIRCDGATPHCQNCQRKGK
FT                   ECKYQHGDDKRNPHRQSHYLIFPRLKANVTRVSLRASTELFSARIDQLCHFIKEQGLEP
FT                   PPMNPEDEAGMNRVLDTLQIPRGFPQVSAVADEKRPPVEATASGVSSKSPSQDPPTVNP
FT                   KGQSPSTNPVACGASPAQDTASSGKVPSPEGWNPFGMVPGASDNQNFVHWGFTLPTAES
FT                   LDTIYANLNGGPRAPTMPRIPVNTEMNPDSYQLGMDMAQQPGSLLGQLPHEGDNDSDSG
FT                   EEDEAENDVIEQLSHRIGTLKIAGDGHLRFYGATSNLNLVDVSATQQRQRPDARTVRHD
FT                   GQDILNHLRVGQPVDQALEDHLVELYFTWQNPSTYIVDKEMYMTARTKWRNELDDTPFY
FT                   SEVLTNAMCAIGSAFEARYHPTFITFPKSLAEFFADRAKALLEIELDSPCVATVQALVI
FT                   MSCHEGASNRDARGWLYSGMSMRLAFDLGLHLDMTAYVNKGEITQLEADVRRATFWGSY
FT                   VADHFWGFYLGRPFRMNAGDIGVPKPGSALSPEKEENWHPYGHQAAHALSQNGLRNPME
FT                   LICRQFVVLWEMITPVGHILYGCSDISRHDLQRICYQVTEDLFAWKANLPSILQIDLND
FT                   DTSPILPHLMMLHMQYHQIIIFFHRPWLSKSYIQPRSPRQGPGYHHARRMCVESATAIA
FT                   RLLQLFEKHYTFRRMNNQVVAIIFSAALMLLFVTVSSSPMSPGKQGDSPTYPRSTEMVA
FT                   YLNLCFRALDELGQSFDNAKRTRDYLVTLQRRWQANMRRSGSATKRQNSSANLAALGSQ
FT                   KPSTQNTHASNAHGIDGWRKKSRLSVSGAPPNMQSTAPATTNHYSRLSQHTMPPQHQYH
FT                   QQSSYQQQAPFPVPRPDSQLGDLDWIPNSDMRLMSETQNGNALNDMGQIPSPPFPEDPS
FT                   MLSDIADIDAWWAPDNYTRTSMPP"
FT   exon            complement(916908..917159)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=1
FT   intron          complement(917160..917316)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=1
FT   exon            complement(917317..917736)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=2
FT   intron          complement(917737..917784)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=2
FT   exon            complement(917785..918093)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=3
FT   intron          complement(918094..918143)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=3
FT   exon            complement(918144..918728)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=4
FT   intron          complement(918729..918774)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=4
FT   exon            complement(918775..920032)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=5
FT   intron          complement(920033..920070)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=5
FT   exon            complement(920071..920757)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=6
FT   intron          complement(920758..920828)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=6
FT   exon            complement(920829..920978)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=7
FT   intron          complement(920979..921025)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=7
FT   exon            complement(921026..922497)
FT                   /gene="Pc16g04040"
FT                   /locus_tag="PCH_Pc16g04040"
FT                   /number=8
FT   mRNA            <922724..>923455
FT                   /gene="Pc16g04050"
FT                   /locus_tag="PCH_Pc16g04050"
FT   CDS_pept        922724..923455
FT                   /gene="Pc16g04050"
FT                   /locus_tag="PCH_Pc16g04050"
FT                   /note="Title: similarity to hypothetical protein PA3829
FT                   -Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g04050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93075"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H1"
FT                   /inference="similar to AA sequence:PIR:B83167"
FT                   /inference="protein motif:COGS:COG1073"
FT                   /inference="protein motif:COGS:COG2267"
FT                   /inference="protein motif:COGS:COG0596"
FT                   /protein_id="CAP93075.1"
FT                   /translation="MYDPRTTGLSDGEPRNNIDPFTQTDDYSDALSFLAVHPMVDQARM
FT                   GIWGMSLSGAVALACAAVDPRARFVVAVCPASEYSFAQAKIPSVLGKIAKDRESQLKGN
FT                   VPFYLPMLNRAGENPAGFNLGVDKDAALRILSAQDEKNPTRQALAANHVNRTTIQSYRK
FT                   LLMWSPAPIYRHLAVPVMFVVPELDQLISAARQQETFENLPGTTNQLHVEHGVGHMDVL
FT                   EGEQLPDLMKRKLLFIQGVVG"
FT   exon            922724..923455
FT                   /gene="Pc16g04050"
FT                   /locus_tag="PCH_Pc16g04050"
FT                   /number=1
FT   mRNA            join(<923691..924232,924414..925371,925422..>925535)
FT                   /gene="Pc16g04060"
FT                   /locus_tag="PCH_Pc16g04060"
FT   CDS_pept        join(923691..924232,924414..925371,925422..925535)
FT                   /gene="Pc16g04060"
FT                   /locus_tag="PCH_Pc16g04060"
FT                   /note="Title: strong similarity to hypothetical membrane
FT                   transport protein SPAC3H1.06c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc16g04060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP93076"
FT                   /db_xref="GOA:B6H867"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6H867"
FT                   /inference="similar to AA sequence:PIR:T38738"
FT