(data stored in SCRATCH zone)

EMBL: AM920435

ID   AM920435; SV 1; linear; genomic DNA; STD; FUN; 3652229 BP.
XX
AC   AM920435;
XX
PR   Project:PRJEA27927;
XX
DT   01-NOV-2008 (Rel. 97, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Penicillium chrysogenum Wisconsin 54-1255 complete genome, contig Pc00c20
XX
KW   .
XX
OS   Penicillium rubens Wisconsin 54-1255
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium;
OC   Penicillium chrysogenum species complex.
XX
RN   [1]
RP   1-3652229
RA   van den Berg M.A.;
RT   ;
RL   Submitted (22-NOV-2007) to the INSDC.
RL   van den Berg M.A., DAI/INNO (624-0270), DSM Anti-Infectives, Alexander
RL   Fleminglaan 1, Delftn, 2613 AX, NETHERLANDS.
XX
RN   [2]
RP   1-3652229
RX   DOI; 10.1038/nbt.1498.
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.M.,
RA   Driessen A.J., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.H.,
RA   Joardar V., Kiel J.A., Kovalchuk A., Martin J.F., Nierman W.C.,
RA   Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.N.,
RA   Veenhuis M., von Dohren H., Wagner C., Wortman J., Bovenberg R.A.;
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum";
RL   Nat. Biotechnol. 26(10):1161-1168(2008).
XX
RN   [3]
RP   1740643-1742799
RX   PUBMED; 8051058.
RA   Foster B.A., Thomas S.M., Mahr J.A., Renosto F., Patel H.C., Segel I.H.;
RT   "Cloning and sequencing of ATP sulfurylase from Penicillium chrysogenum.
RT   Identification of a likely allosteric domain";
RL   J Biol Chem 269(31):19777-19786(1994).
XX
RN   [4]
RP   2674904-2676663
RX   DOI; 10.1007/s002840010189.
RX   PUBMED; 11136133.
RA   Diez B., Marcos A.T., Rodriguez M., de la Fuente J.L., Barredo J.L.;
RT   "Structural and phylogenetic analysis of the gamma-actin encoding gene from
RT   the penicillin-producing fungus Penicillium chrysogenum";
RL   Curr. Microbiol. 42(2):117-121(2001).
XX
RN   [5]
RX   DOI; 10.1111/j.1600-0854.2006.00479.x.
RX   PUBMED; 16978390.
RA   Kiel J.A., Veenhuis M., van der Klei I.J.;
RT   "PEX genes in fungal genomes: common, rare or redundant";
RL   Traffic 10:1291-1303(2006).
XX
RN   [6]
RP   2569880-2571928
RX   DOI; 10.1016/j.fgb.2004.02.006.
RX   PUBMED; 15275666.
RA   Kiel J.A., van den Berg M.A., Bovenberg R.A., van der Klei I.J.,
RA   Veenhuis M.;
RT   "Penicillium chrysogenum Pex5p mediates differential sorting of PTS1
RT   proteins to microbodies of the methylotrophic yeast Hansenula polymorpha";
RL   Fungal Genet. Biol. 41(7):708-720(2004).
XX
DR   MD5; 9d0ce4a8dbf532288bcbcd6b0db18611.
DR   BioSample; SAMEA2272345.
DR   EnsemblGenomes-Gn; ENSRNA049576358.
DR   EnsemblGenomes-Gn; ENSRNA049576455.
DR   EnsemblGenomes-Gn; ENSRNA049576512.
DR   EnsemblGenomes-Gn; ENSRNA049576563.
DR   EnsemblGenomes-Gn; ENSRNA049576622.
DR   EnsemblGenomes-Gn; ENSRNA049576728.
DR   EnsemblGenomes-Gn; ENSRNA049576823.
DR   EnsemblGenomes-Gn; ENSRNA049576868.
DR   EnsemblGenomes-Gn; ENSRNA049576963.
DR   EnsemblGenomes-Gn; ENSRNA049577031.
DR   EnsemblGenomes-Gn; ENSRNA049577081.
DR   EnsemblGenomes-Gn; ENSRNA049577153.
DR   EnsemblGenomes-Gn; ENSRNA049577232.
DR   EnsemblGenomes-Gn; ENSRNA049577275.
DR   EnsemblGenomes-Gn; ENSRNA049577342.
DR   EnsemblGenomes-Gn; ENSRNA049577433.
DR   EnsemblGenomes-Gn; ENSRNA049577527.
DR   EnsemblGenomes-Gn; ENSRNA049577595.
DR   EnsemblGenomes-Gn; ENSRNA049577657.
DR   EnsemblGenomes-Gn; ENSRNA049640321.
DR   EnsemblGenomes-Gn; ENSRNA049640330.
DR   EnsemblGenomes-Gn; ENSRNA049640341.
DR   EnsemblGenomes-Gn; ENSRNA049640350.
DR   EnsemblGenomes-Gn; ENSRNA049640368.
DR   EnsemblGenomes-Gn; ENSRNA049640377.
DR   EnsemblGenomes-Gn; ENSRNA049640400.
DR   EnsemblGenomes-Gn; ENSRNA049640414.
DR   EnsemblGenomes-Gn; ENSRNA049640432.
DR   EnsemblGenomes-Gn; ENSRNA049640441.
DR   EnsemblGenomes-Gn; ENSRNA049640462.
DR   EnsemblGenomes-Gn; ENSRNA049640482.
DR   EnsemblGenomes-Gn; ENSRNA049640500.
DR   EnsemblGenomes-Gn; ENSRNA049640513.
DR   EnsemblGenomes-Gn; PCH_Pc20e00010.
DR   EnsemblGenomes-Gn; PCH_Pc20e00030.
DR   EnsemblGenomes-Gn; PCH_Pc20e00050.
DR   EnsemblGenomes-Gn; PCH_Pc20e00060.
DR   EnsemblGenomes-Gn; PCH_Pc20e00100.
DR   EnsemblGenomes-Gn; PCH_Pc20e00110.
DR   EnsemblGenomes-Gn; PCH_Pc20e00120.
DR   EnsemblGenomes-Gn; PCH_Pc20e00130.
DR   EnsemblGenomes-Gn; PCH_Pc20e00140.
DR   EnsemblGenomes-Gn; PCH_Pc20e00150.
DR   EnsemblGenomes-Gn; PCH_Pc20e00160.
DR   EnsemblGenomes-Gn; PCH_Pc20e00180.
DR   EnsemblGenomes-Gn; PCH_Pc20e00190.
DR   EnsemblGenomes-Gn; PCH_Pc20e00200.
DR   EnsemblGenomes-Gn; PCH_Pc20e00210.
DR   EnsemblGenomes-Gn; PCH_Pc20e00220.
DR   EnsemblGenomes-Gn; PCH_Pc20e00230.
DR   EnsemblGenomes-Gn; PCH_Pc20e00240.
DR   EnsemblGenomes-Gn; PCH_Pc20e00250.
DR   EnsemblGenomes-Gn; PCH_Pc20e00260.
DR   EnsemblGenomes-Gn; PCH_Pc20e00270.
DR   EnsemblGenomes-Gn; PCH_Pc20e00280.
DR   EnsemblGenomes-Gn; PCH_Pc20e00290.
DR   EnsemblGenomes-Gn; PCH_Pc20e00300.
DR   EnsemblGenomes-Gn; PCH_Pc20e00310.
DR   EnsemblGenomes-Gn; PCH_Pc20e00320.
DR   EnsemblGenomes-Gn; PCH_Pc20e00330.
DR   EnsemblGenomes-Gn; PCH_Pc20g00030.
DR   EnsemblGenomes-Gn; PCH_Pc20g00380.
DR   EnsemblGenomes-Gn; PCH_Pc20g00500.
DR   EnsemblGenomes-Gn; PCH_Pc20g00820.
DR   EnsemblGenomes-Gn; PCH_Pc20g01130.
DR   EnsemblGenomes-Gn; PCH_Pc20g01170.
DR   EnsemblGenomes-Gn; PCH_Pc20g01210.
DR   EnsemblGenomes-Gn; PCH_Pc20g01990.
DR   EnsemblGenomes-Gn; PCH_Pc20g02170.
DR   EnsemblGenomes-Gn; PCH_Pc20g02290.
DR   EnsemblGenomes-Gn; PCH_Pc20g02300.
DR   EnsemblGenomes-Gn; PCH_Pc20g02310.
DR   EnsemblGenomes-Gn; PCH_Pc20g02320.
DR   EnsemblGenomes-Gn; PCH_Pc20g02920.
DR   EnsemblGenomes-Gn; PCH_Pc20g03040.
DR   EnsemblGenomes-Gn; PCH_Pc20g03370.
DR   EnsemblGenomes-Gn; PCH_Pc20g03740.
DR   EnsemblGenomes-Gn; PCH_Pc20g03880.
DR   EnsemblGenomes-Gn; PCH_Pc20g04100.
DR   EnsemblGenomes-Gn; PCH_Pc20g04170.
DR   EnsemblGenomes-Gn; PCH_Pc20g04180.
DR   EnsemblGenomes-Gn; PCH_Pc20g04230.
DR   EnsemblGenomes-Gn; PCH_Pc20g04420.
DR   EnsemblGenomes-Gn; PCH_Pc20g04470.
DR   EnsemblGenomes-Gn; PCH_Pc20g04500.
DR   EnsemblGenomes-Gn; PCH_Pc20g04570.
DR   EnsemblGenomes-Gn; PCH_Pc20g04640.
DR   EnsemblGenomes-Gn; PCH_Pc20g04770.
DR   EnsemblGenomes-Gn; PCH_Pc20g04950.
DR   EnsemblGenomes-Gn; PCH_Pc20g05220.
DR   EnsemblGenomes-Gn; PCH_Pc20g05230.
DR   EnsemblGenomes-Gn; PCH_Pc20g05240.
DR   EnsemblGenomes-Gn; PCH_Pc20g05250.
DR   EnsemblGenomes-Gn; PCH_Pc20g05390.
DR   EnsemblGenomes-Gn; PCH_Pc20g05450.
DR   EnsemblGenomes-Gn; PCH_Pc20g05650.
DR   EnsemblGenomes-Gn; PCH_Pc20g05660.
DR   EnsemblGenomes-Gn; PCH_Pc20g05680.
DR   EnsemblGenomes-Gn; PCH_Pc20g05710.
DR   EnsemblGenomes-Gn; PCH_Pc20g05720.
DR   EnsemblGenomes-Gn; PCH_Pc20g05730.
DR   EnsemblGenomes-Gn; PCH_Pc20g06380.
DR   EnsemblGenomes-Gn; PCH_Pc20g06470.
DR   EnsemblGenomes-Gn; PCH_Pc20g06480.
DR   EnsemblGenomes-Gn; PCH_Pc20g06680.
DR   EnsemblGenomes-Gn; PCH_Pc20g07310.
DR   EnsemblGenomes-Gn; PCH_Pc20g07330.
DR   EnsemblGenomes-Gn; PCH_Pc20g07580.
DR   EnsemblGenomes-Gn; PCH_Pc20g07620.
DR   EnsemblGenomes-Gn; PCH_Pc20g08280.
DR   EnsemblGenomes-Gn; PCH_Pc20g08650.
DR   EnsemblGenomes-Gn; PCH_Pc20g08660.
DR   EnsemblGenomes-Gn; PCH_Pc20g08680.
DR   EnsemblGenomes-Gn; PCH_Pc20g08690.
DR   EnsemblGenomes-Gn; PCH_Pc20g08700.
DR   EnsemblGenomes-Gn; PCH_Pc20g08710.
DR   EnsemblGenomes-Gn; PCH_Pc20g08730.
DR   EnsemblGenomes-Gn; PCH_Pc20g08740.
DR   EnsemblGenomes-Gn; PCH_Pc20g08760.
DR   EnsemblGenomes-Gn; PCH_Pc20g08770.
DR   EnsemblGenomes-Gn; PCH_Pc20g08780.
DR   EnsemblGenomes-Gn; PCH_Pc20g08790.
DR   EnsemblGenomes-Gn; PCH_Pc20g08800.
DR   EnsemblGenomes-Gn; PCH_Pc20g08810.
DR   EnsemblGenomes-Gn; PCH_Pc20g08820.
DR   EnsemblGenomes-Gn; PCH_Pc20g08830.
DR   EnsemblGenomes-Gn; PCH_Pc20g08840.
DR   EnsemblGenomes-Gn; PCH_Pc20g08850.
DR   EnsemblGenomes-Gn; PCH_Pc20g08860.
DR   EnsemblGenomes-Gn; PCH_Pc20g08870.
DR   EnsemblGenomes-Gn; PCH_Pc20g08880.
DR   EnsemblGenomes-Gn; PCH_Pc20g08890.
DR   EnsemblGenomes-Gn; PCH_Pc20g08900.
DR   EnsemblGenomes-Gn; PCH_Pc20g08920.
DR   EnsemblGenomes-Gn; PCH_Pc20g08930.
DR   EnsemblGenomes-Gn; PCH_Pc20g08940.
DR   EnsemblGenomes-Gn; PCH_Pc20g08950.
DR   EnsemblGenomes-Gn; PCH_Pc20g09520.
DR   EnsemblGenomes-Gn; PCH_Pc20g09670.
DR   EnsemblGenomes-Gn; PCH_Pc20g09720.
DR   EnsemblGenomes-Gn; PCH_Pc20g09770.
DR   EnsemblGenomes-Gn; PCH_Pc20g09790.
DR   EnsemblGenomes-Gn; PCH_Pc20g10040.
DR   EnsemblGenomes-Gn; PCH_Pc20g10190.
DR   EnsemblGenomes-Gn; PCH_Pc20g10250.
DR   EnsemblGenomes-Gn; PCH_Pc20g10580.
DR   EnsemblGenomes-Gn; PCH_Pc20g10600.
DR   EnsemblGenomes-Gn; PCH_Pc20g10750.
DR   EnsemblGenomes-Gn; PCH_Pc20g11000.
DR   EnsemblGenomes-Gn; PCH_Pc20g11160.
DR   EnsemblGenomes-Gn; PCH_Pc20g11340.
DR   EnsemblGenomes-Gn; PCH_Pc20g11350.
DR   EnsemblGenomes-Gn; PCH_Pc20g11380.
DR   EnsemblGenomes-Gn; PCH_Pc20g12100.
DR   EnsemblGenomes-Gn; PCH_Pc20g12880.
DR   EnsemblGenomes-Gn; PCH_Pc20g12900.
DR   EnsemblGenomes-Gn; PCH_Pc20g12940.
DR   EnsemblGenomes-Gn; PCH_Pc20g12950.
DR   EnsemblGenomes-Gn; PCH_Pc20g13130.
DR   EnsemblGenomes-Gn; PCH_Pc20g13230.
DR   EnsemblGenomes-Gn; PCH_Pc20g13490.
DR   EnsemblGenomes-Gn; PCH_Pc20g13630.
DR   EnsemblGenomes-Gn; PCH_Pc20g14070.
DR   EnsemblGenomes-Gn; PCH_Pc20g14440.
DR   EnsemblGenomes-Gn; PCH_Pc20g14510.
DR   EnsemblGenomes-Gn; PCH_Pc20g14620.
DR   EnsemblGenomes-Gn; PCH_Pc20g14770.
DR   EnsemblGenomes-Gn; PCH_Pc20g14870.
DR   EnsemblGenomes-Gn; PCH_Pc20g14930.
DR   EnsemblGenomes-Gn; PCH_Pc20g14990.
DR   EnsemblGenomes-Gn; PCH_Pc20g15320.
DR   EnsemblGenomes-Gn; PCH_Pc20g15340.
DR   EnsemblGenomes-Gn; PCH_Pc20g15350.
DR   EnsemblGenomes-Gn; PCH_Pc20g15600.
DR   EnsemblGenomes-Gn; PCH_Pc20g15780.
DR   EnsemblGenomes-Tr; CAP85446.
DR   EnsemblGenomes-Tr; CAP85528.
DR   EnsemblGenomes-Tr; CAP85717.
DR   EnsemblGenomes-Tr; CAP85739.
DR   EnsemblGenomes-Tr; CAP85894.
DR   EnsemblGenomes-Tr; CAP86087.
DR   EnsemblGenomes-Tr; CAP86091.
DR   EnsemblGenomes-Tr; CAP86157.
DR   EnsemblGenomes-Tr; CAP86296.
DR   EnsemblGenomes-Tr; CAP86306.
DR   EnsemblGenomes-Tr; CAP86308.
DR   EnsemblGenomes-Tr; CAP86333.
DR   EnsemblGenomes-Tr; CAP86429.
DR   EnsemblGenomes-Tr; CAP86445.
DR   EnsemblGenomes-Tr; CAP86617.
DR   EnsemblGenomes-Tr; CAP86736.
DR   EnsemblGenomes-Tr; CAP86806.
DR   EnsemblGenomes-Tr; CAP86816.
DR   EnsemblGenomes-Tr; CAP86822.
DR   EnsemblGenomes-Tr; CAP86864.
DR   EnsemblGenomes-Tr; CAP86889.
DR   EnsemblGenomes-Tr; EFT00001517232.
DR   EnsemblGenomes-Tr; EFT00001517233.
DR   EnsemblGenomes-Tr; EFT00001517234.
DR   EnsemblGenomes-Tr; EFT00001517235.
DR   EnsemblGenomes-Tr; EFT00001517236.
DR   EnsemblGenomes-Tr; EFT00001517237.
DR   EnsemblGenomes-Tr; EFT00001517238.
DR   EnsemblGenomes-Tr; EFT00001517239.
DR   EnsemblGenomes-Tr; EFT00001517240.
DR   EnsemblGenomes-Tr; EFT00001517241.
DR   EnsemblGenomes-Tr; EFT00001517242.
DR   EnsemblGenomes-Tr; EFT00001517243.
DR   EnsemblGenomes-Tr; EFT00001517244.
DR   EnsemblGenomes-Tr; EFT00001517245.
DR   EnsemblGenomes-Tr; EFT00001517246.
DR   EnsemblGenomes-Tr; EFT00001517247.
DR   EnsemblGenomes-Tr; EFT00001517248.
DR   EnsemblGenomes-Tr; EFT00001517249.
DR   EnsemblGenomes-Tr; EFT00001517250.
DR   EnsemblGenomes-Tr; EFT00001517251.
DR   EnsemblGenomes-Tr; EFT00001517252.
DR   EnsemblGenomes-Tr; EFT00001517253.
DR   EnsemblGenomes-Tr; EFT00001517254.
DR   EnsemblGenomes-Tr; EFT00001517255.
DR   EnsemblGenomes-Tr; EFT00001517256.
DR   EnsemblGenomes-Tr; EFT00001517257.
DR   EnsemblGenomes-Tr; EFT00001517258.
DR   EnsemblGenomes-Tr; EFT00001517259.
DR   EnsemblGenomes-Tr; EFT00001517260.
DR   EnsemblGenomes-Tr; EFT00001517261.
DR   EnsemblGenomes-Tr; EFT00001517262.
DR   EnsemblGenomes-Tr; EFT00001517263.
DR   EnsemblGenomes-Tr; PCH_Pc20e00010-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00030-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00050-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00060-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00100-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00110-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00120-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00130-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00140-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00150-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00160-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00180-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00190-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00200-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00210-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00220-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00230-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00240-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00250-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00260-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00270-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00280-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00290-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00300-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00310-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00320-1.
DR   EnsemblGenomes-Tr; PCH_Pc20e00330-1.
DR   EnsemblGenomes-Tr; PCH_Pc20g00030.
DR   EnsemblGenomes-Tr; PCH_Pc20g00380.
DR   EnsemblGenomes-Tr; PCH_Pc20g00500.
DR   EnsemblGenomes-Tr; PCH_Pc20g00820.
DR   EnsemblGenomes-Tr; PCH_Pc20g01130.
DR   EnsemblGenomes-Tr; PCH_Pc20g01210.
DR   EnsemblGenomes-Tr; PCH_Pc20g02170.
DR   EnsemblGenomes-Tr; PCH_Pc20g02290.
DR   EnsemblGenomes-Tr; PCH_Pc20g02300.
DR   EnsemblGenomes-Tr; PCH_Pc20g02310.
DR   EnsemblGenomes-Tr; PCH_Pc20g02320.
DR   EnsemblGenomes-Tr; PCH_Pc20g02920.
DR   EnsemblGenomes-Tr; PCH_Pc20g03040.
DR   EnsemblGenomes-Tr; PCH_Pc20g03370.
DR   EnsemblGenomes-Tr; PCH_Pc20g03740.
DR   EnsemblGenomes-Tr; PCH_Pc20g04170.
DR   EnsemblGenomes-Tr; PCH_Pc20g04180.
DR   EnsemblGenomes-Tr; PCH_Pc20g04230.
DR   EnsemblGenomes-Tr; PCH_Pc20g04420.
DR   EnsemblGenomes-Tr; PCH_Pc20g04470.
DR   EnsemblGenomes-Tr; PCH_Pc20g04500.
DR   EnsemblGenomes-Tr; PCH_Pc20g04570.
DR   EnsemblGenomes-Tr; PCH_Pc20g04640.
DR   EnsemblGenomes-Tr; PCH_Pc20g04770.
DR   EnsemblGenomes-Tr; PCH_Pc20g04950.
DR   EnsemblGenomes-Tr; PCH_Pc20g05220.
DR   EnsemblGenomes-Tr; PCH_Pc20g05230.
DR   EnsemblGenomes-Tr; PCH_Pc20g05240.
DR   EnsemblGenomes-Tr; PCH_Pc20g05250.
DR   EnsemblGenomes-Tr; PCH_Pc20g05390.
DR   EnsemblGenomes-Tr; PCH_Pc20g05450.
DR   EnsemblGenomes-Tr; PCH_Pc20g05660.
DR   EnsemblGenomes-Tr; PCH_Pc20g05680.
DR   EnsemblGenomes-Tr; PCH_Pc20g05710.
DR   EnsemblGenomes-Tr; PCH_Pc20g05720.
DR   EnsemblGenomes-Tr; PCH_Pc20g05730.
DR   EnsemblGenomes-Tr; PCH_Pc20g06380.
DR   EnsemblGenomes-Tr; PCH_Pc20g06470.
DR   EnsemblGenomes-Tr; PCH_Pc20g06480.
DR   EnsemblGenomes-Tr; PCH_Pc20g06680.
DR   EnsemblGenomes-Tr; PCH_Pc20g07310.
DR   EnsemblGenomes-Tr; PCH_Pc20g07330.
DR   EnsemblGenomes-Tr; PCH_Pc20g08650.
DR   EnsemblGenomes-Tr; PCH_Pc20g08660.
DR   EnsemblGenomes-Tr; PCH_Pc20g08680.
DR   EnsemblGenomes-Tr; PCH_Pc20g08690.
DR   EnsemblGenomes-Tr; PCH_Pc20g08700.
DR   EnsemblGenomes-Tr; PCH_Pc20g08710.
DR   EnsemblGenomes-Tr; PCH_Pc20g08730.
DR   EnsemblGenomes-Tr; PCH_Pc20g08740.
DR   EnsemblGenomes-Tr; PCH_Pc20g08760.
DR   EnsemblGenomes-Tr; PCH_Pc20g08770.
DR   EnsemblGenomes-Tr; PCH_Pc20g08780.
DR   EnsemblGenomes-Tr; PCH_Pc20g08790.
DR   EnsemblGenomes-Tr; PCH_Pc20g08800.
DR   EnsemblGenomes-Tr; PCH_Pc20g08810.
DR   EnsemblGenomes-Tr; PCH_Pc20g08820.
DR   EnsemblGenomes-Tr; PCH_Pc20g08830.
DR   EnsemblGenomes-Tr; PCH_Pc20g08840.
DR   EnsemblGenomes-Tr; PCH_Pc20g08850.
DR   EnsemblGenomes-Tr; PCH_Pc20g08860.
DR   EnsemblGenomes-Tr; PCH_Pc20g08870.
DR   EnsemblGenomes-Tr; PCH_Pc20g08880.
DR   EnsemblGenomes-Tr; PCH_Pc20g08890.
DR   EnsemblGenomes-Tr; PCH_Pc20g08900.
DR   EnsemblGenomes-Tr; PCH_Pc20g08920.
DR   EnsemblGenomes-Tr; PCH_Pc20g08930.
DR   EnsemblGenomes-Tr; PCH_Pc20g08940.
DR   EnsemblGenomes-Tr; PCH_Pc20g08950.
DR   EnsemblGenomes-Tr; PCH_Pc20g09520.
DR   EnsemblGenomes-Tr; PCH_Pc20g09720.
DR   EnsemblGenomes-Tr; PCH_Pc20g10190.
DR   EnsemblGenomes-Tr; PCH_Pc20g10250.
DR   EnsemblGenomes-Tr; PCH_Pc20g10580.
DR   EnsemblGenomes-Tr; PCH_Pc20g10600.
DR   EnsemblGenomes-Tr; PCH_Pc20g10750.
DR   EnsemblGenomes-Tr; PCH_Pc20g11340.
DR   EnsemblGenomes-Tr; PCH_Pc20g11350.
DR   EnsemblGenomes-Tr; PCH_Pc20g11380.
DR   EnsemblGenomes-Tr; PCH_Pc20g12100.
DR   EnsemblGenomes-Tr; PCH_Pc20g12900.
DR   EnsemblGenomes-Tr; PCH_Pc20g12940.
DR   EnsemblGenomes-Tr; PCH_Pc20g12950.
DR   EnsemblGenomes-Tr; PCH_Pc20g13130.
DR   EnsemblGenomes-Tr; PCH_Pc20g13230.
DR   EnsemblGenomes-Tr; PCH_Pc20g13490.
DR   EnsemblGenomes-Tr; PCH_Pc20g13630.
DR   EnsemblGenomes-Tr; PCH_Pc20g14440.
DR   EnsemblGenomes-Tr; PCH_Pc20g14510.
DR   EnsemblGenomes-Tr; PCH_Pc20g14620.
DR   EnsemblGenomes-Tr; PCH_Pc20g14990.
DR   EnsemblGenomes-Tr; PCH_Pc20g15320.
DR   EnsemblGenomes-Tr; PCH_Pc20g15340.
DR   EnsemblGenomes-Tr; PCH_Pc20g15780.
DR   EuropePMC; PMC4852298; 27199956.
DR   EuropePMC; PMC5945893; 29748544.
DR   GOA; A7KAN7.
DR   InterPro; IPR039113; ATG29.
DR   InterPro; IPR039362; ATG29_sf.
DR   InterPro; IPR040666; Atg29_N.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00026; U6.
DR   RFAM; RF01515; Afu_514.
DR   UniProtKB/Swiss-Prot; A7KAN7; ATG29_PENRW.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3652229
FT                   /organism="Penicillium rubens Wisconsin 54-1255"
FT                   /strain="Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /clone="Pc00c20"
FT                   /db_xref="taxon:500485"
FT                   /citation=[1]
FT   mRNA            complement(join(<967..1004,1054..1224,1273..2107,
FT                   2138..>2641))
FT                   /gene="Pc20g00010"
FT                   /locus_tag="PCH_Pc20g00010"
FT   CDS_pept        complement(join(967..1004,1054..1224,1273..2107,
FT                   2138..2641))
FT                   /gene="Pc20g00010"
FT                   /locus_tag="PCH_Pc20g00010"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An08g08110 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85330"
FT                   /db_xref="GOA:B6HER0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER0"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /protein_id="CAP85330.1"
FT                   /translation="MSLRPCQPCRHSRIRCSREVPHCQTCVKRGRYSLCVYETKVSDQK
FT                   PALPEPRSKQQKQKQERASDEYHFRWRAFEPQSEQFPRYETSTNEKMQHAMEPANEEHI
FT                   KHMSQRYSEQGSLSPHETPPKSIAAAKAEKASIFQPKHVEDTSERPRSTPVPQPTELYA
FT                   QMIPPTTTLTVNKASLPPRPNFDLTISGRHICGPHTAHQLLLVLNYLFISSMLPADIGA
FT                   LWKVICRRHHDWEESFVLQHEQLQRWLISVRNILTNSDGLHTVTLEDIERQTRYILFIL
FT                   GENTSPHSSFIFECFRSEEPPYRPFGVRASIALICHAFGGIQADELEGYEAKEIWTRDQ
FT                   NFLSTMAFRLKESPLFGAEVSVNHLQSMILGLQKAFQCEEIRVSGMEFQTLRIESELEV
FT                   LGYYRRAFLAFNPILLPKILASLREANDLTTLLWHYQLINMERNLDRTNLALRLANIFM
FT                   SLAPERLDAAFQNTREIQLSKAXRVVAMEMMHVKSFEEAYKLNPTKPTTVRVFHVSP"
FT   exon            complement(967..1004)
FT                   /gene="Pc20g00010"
FT                   /locus_tag="PCH_Pc20g00010"
FT                   /number=1
FT   intron          complement(1005..1053)
FT                   /gene="Pc20g00010"
FT                   /locus_tag="PCH_Pc20g00010"
FT                   /number=1
FT   exon            complement(1054..1224)
FT                   /gene="Pc20g00010"
FT                   /locus_tag="PCH_Pc20g00010"
FT                   /number=2
FT   intron          complement(1225..1272)
FT                   /gene="Pc20g00010"
FT                   /locus_tag="PCH_Pc20g00010"
FT                   /number=2
FT   exon            complement(1273..2107)
FT                   /gene="Pc20g00010"
FT                   /locus_tag="PCH_Pc20g00010"
FT                   /number=3
FT   intron          complement(2108..2137)
FT                   /gene="Pc20g00010"
FT                   /locus_tag="PCH_Pc20g00010"
FT                   /number=3
FT   exon            complement(2138..2641)
FT                   /gene="Pc20g00010"
FT                   /locus_tag="PCH_Pc20g00010"
FT                   /number=4
FT   mRNA            complement(join(<4116..4212,4432..4586,4619..>4831))
FT                   /gene="Pc20g00020"
FT                   /locus_tag="PCH_Pc20g00020"
FT   CDS_pept        complement(join(4116..4212,4432..4586,4619..4831))
FT                   /gene="Pc20g00020"
FT                   /locus_tag="PCH_Pc20g00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85331"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER1"
FT                   /protein_id="CAP85331.1"
FT                   /translation="MGTDDHVRQYNAENSRYFSPHIRLHNPGGSGLAQGMLRVSSGLAQ
FT                   GWLKVGSRLAHGWLTVGSRLAHGWLRGMLRVSSGLAQGMLRVSSGSAQGWLKVGSRLAH
FT                   GWLTVGSRLAHGWLTVGSGSINDHASINKELWHCHRVPAAQKSRSKNGKR"
FT   exon            complement(4116..4212)
FT                   /gene="Pc20g00020"
FT                   /locus_tag="PCH_Pc20g00020"
FT                   /number=1
FT   intron          complement(4213..4431)
FT                   /gene="Pc20g00020"
FT                   /locus_tag="PCH_Pc20g00020"
FT                   /number=1
FT   exon            complement(4432..4586)
FT                   /gene="Pc20g00020"
FT                   /locus_tag="PCH_Pc20g00020"
FT                   /number=2
FT   intron          complement(4587..4618)
FT                   /gene="Pc20g00020"
FT                   /locus_tag="PCH_Pc20g00020"
FT                   /number=2
FT   exon            complement(4619..4831)
FT                   /gene="Pc20g00020"
FT                   /locus_tag="PCH_Pc20g00020"
FT                   /number=3
FT   gap             5553..5652
FT                   /estimated_length=unknown
FT   mRNA            <8076..>9332
FT                   /gene="Pc20g00030"
FT                   /locus_tag="PCH_Pc20g00030"
FT   CDS_pept        8076..9332
FT                   /pseudo
FT                   /gene="Pc20g00030"
FT                   /locus_tag="PCH_Pc20g00030"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to pol protein - Drosophila
FT                   melanogaster [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AF541948.2"
FT                   /inference="protein motif:COGS:COG2801"
FT   exon            8076..9332
FT                   /gene="Pc20g00030"
FT                   /locus_tag="PCH_Pc20g00030"
FT                   /number=1
FT   mRNA            complement(join(<14959..15522,15629..15667,15728..16016,
FT                   16081..16191,16269..>16609))
FT                   /gene="Pc20g00040"
FT                   /locus_tag="PCH_Pc20g00040"
FT   CDS_pept        complement(join(14959..15522,15629..15667,15728..16016,
FT                   16081..16191,16269..16609))
FT                   /gene="Pc20g00040"
FT                   /locus_tag="PCH_Pc20g00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85333"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER2"
FT                   /protein_id="CAP85333.1"
FT                   /translation="MPPRPFFPRAAKPNGKGAPKKSDGKRKANSESEDAEATPPKKKKM
FT                   TKEEIPQKLDEKRLAADLNTDYSKRRKNLRNIRPQMPKKQKWPKVKGVIREREDAPQGW
FT                   NPEEPDLMPDDFESQIQRCLERITENIMPHVYQHKLTELRAKQAERDALKATEPGLSWP
FT                   VVQRLDDLKFTLDWIMAENDKYKMADTVKSIIAQYRSGELDWHPEFVTYWHAGVQLCLP
FT                   RPFHWEEYRSIHDKCQGHEGFWVEGILGPAPGLSKSSVVRLSLRIPQDQPPAGTKLPSF
FT                   EFPFMDDTGSTHMSIFEDDINILQDNTNHPLPRCLGVGLHYTSDDRRVPALYRELEVNM
FT                   WSVDERGFMSNWEPIPVSIRSGHATRAGADRLSGSWLRHRFYTGTCPDQSMRLYVFNYN
FT                   PGIPPQGERTLPTATPAQLTAPFRTAALRPVGEFPHLDPNFASGHSLI"
FT   exon            complement(14959..15522)
FT                   /gene="Pc20g00040"
FT                   /locus_tag="PCH_Pc20g00040"
FT                   /number=1
FT   intron          complement(15523..15628)
FT                   /gene="Pc20g00040"
FT                   /locus_tag="PCH_Pc20g00040"
FT                   /number=1
FT   exon            complement(15629..15667)
FT                   /gene="Pc20g00040"
FT                   /locus_tag="PCH_Pc20g00040"
FT                   /number=2
FT   intron          complement(15668..15727)
FT                   /gene="Pc20g00040"
FT                   /locus_tag="PCH_Pc20g00040"
FT                   /number=2
FT   exon            complement(15728..16016)
FT                   /gene="Pc20g00040"
FT                   /locus_tag="PCH_Pc20g00040"
FT                   /number=3
FT   intron          complement(16017..16080)
FT                   /gene="Pc20g00040"
FT                   /locus_tag="PCH_Pc20g00040"
FT                   /number=3
FT   exon            complement(16081..16191)
FT                   /gene="Pc20g00040"
FT                   /locus_tag="PCH_Pc20g00040"
FT                   /number=4
FT   intron          complement(16192..16268)
FT                   /gene="Pc20g00040"
FT                   /locus_tag="PCH_Pc20g00040"
FT                   /number=4
FT   exon            complement(16269..16609)
FT                   /gene="Pc20g00040"
FT                   /locus_tag="PCH_Pc20g00040"
FT                   /number=5
FT   mRNA            complement(join(<17741..17783,17945..>20094))
FT                   /gene="Pc20g00050"
FT                   /locus_tag="PCH_Pc20g00050"
FT   CDS_pept        complement(join(17741..17783,17945..20094))
FT                   /gene="Pc20g00050"
FT                   /locus_tag="PCH_Pc20g00050"
FT                   /note="Title: similarity to hypothetical protein An08g01250
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85334"
FT                   /db_xref="GOA:B6HER3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER3"
FT                   /protein_id="CAP85334.1"
FT                   /translation="METADGAVHLRQLPRSSDNRQDAPEYTRHDSSSESPPLHDEELPS
FT                   YSEARSTGQILGRGHSTLLHRSAWVSVFTIIYVGLVLYAWAMTVILSIRPLKDKTWAYS
FT                   FETSRSNYYYEADFDQERKIYRSMRTIQTFIQVVTLPWISTVCASAAVIYAQNQKDPMG
FT                   LRLRQVTTLADRRWMDFSLYPALMYGKWRQYGSTLLATAIFIWVFGLIIFPIQSVFLSS
FT                   QSVKVRTLTQQSASIYDFSPARSLYSSHNTGKDVLRVRNALNKANGDIYQPNLWSNNSG
FT                   VQFLTLNDLSSQTYYSQVPSGFNTGLIRQFAPRVNSTATYETIRASDFPVDCSSRPGAF
FT                   YADYSSSYSPRTHSTSSYSWGVTACMPANMTKSPWQMARNRQDFSEVLYLNMTQEEYRS
FT                   GNYQYLFQVTVNTTAGFFELPNYMNKGVPGPLLDQDPVELCDQHCLSQLNTFYSGSYYR
FT                   RDGVTVEGTLKAASLDPFSTDRKGPLLSAALASFGPGSFIDTFIATAAALEADDKVTGD
FT                   VSSNLRYACVANPPLTNLMGSSPLECVSVGIDIDGNWYPVGSEIARWISLFQKDAKSIP
FT                   KAFTSAAFLANQEFLSSQRGKWSIAHDLGADMNLPSISPAGTIVVTVLMALYLLPLLAL
FT                   SLYAGLSHRWTERLDSFVMLRFGAFAGDKVFPLLIGRKSDKVDELDEMSGVVRDVATYP
FT                   GDEVIKIGRLGFGEGSKLREGRRSKHSRQLPMLFHD"
FT   exon            complement(17741..17783)
FT                   /gene="Pc20g00050"
FT                   /locus_tag="PCH_Pc20g00050"
FT                   /number=1
FT   intron          complement(17784..17944)
FT                   /gene="Pc20g00050"
FT                   /locus_tag="PCH_Pc20g00050"
FT                   /number=1
FT   exon            complement(17945..20094)
FT                   /gene="Pc20g00050"
FT                   /locus_tag="PCH_Pc20g00050"
FT                   /number=2
FT   mRNA            complement(join(<21371..22115,22174..>22409))
FT                   /gene="Pc20g00060"
FT                   /locus_tag="PCH_Pc20g00060"
FT   CDS_pept        complement(join(21371..22115,22174..22409))
FT                   /gene="Pc20g00060"
FT                   /locus_tag="PCH_Pc20g00060"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   ncu06607.1 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85335"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER4"
FT                   /protein_id="CAP85335.1"
FT                   /translation="MYYARPAALSAVLLQVLPTLAAPAPGGSGNPGEWSQDGFWGSPGH
FT                   GDSAGIGPGGFDNSHCGHNANGNNVGSTVTVTDCPATPTATVTVTIDGDGNGSATVTET
FT                   ISACTATVTTGDDGRSASTTTETETVISTISSCTATTTDITTLTEDGPTVTTTVTTPGP
FT                   VSTTTEFVGTSTVTEPGVTEYETVTDTITHTDTSTVTNNQVVTSTVTSTETQTLQVTTT
FT                   VTADDCSNTGTSDDLDYGSCSDPTINWLYGLDGRTEYSYTTNNQDDFPFGSSPTIDSPA
FT                   DLICNRLRSPCNAPQATIDQCYAAESAVASLSGQEAADTWNDLMT"
FT   exon            complement(21371..22115)
FT                   /gene="Pc20g00060"
FT                   /locus_tag="PCH_Pc20g00060"
FT                   /number=1
FT   mat_peptide     complement(join(21374..22115,22174..22346))
FT                   /gene="Pc20g00060"
FT                   /locus_tag="PCH_Pc20g00060"
FT   intron          complement(22116..22173)
FT                   /gene="Pc20g00060"
FT                   /locus_tag="PCH_Pc20g00060"
FT                   /number=1
FT   exon            complement(22174..22409)
FT                   /gene="Pc20g00060"
FT                   /locus_tag="PCH_Pc20g00060"
FT                   /number=2
FT   sig_peptide     complement(22347..22409)
FT                   /gene="Pc20g00060"
FT                   /locus_tag="PCH_Pc20g00060"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<22478..22653,22684..22818,23041..23110,23218..>23382)
FT                   /gene="Pc20g00070"
FT                   /locus_tag="PCH_Pc20g00070"
FT   CDS_pept        join(22478..22653,22684..22818,23041..23110,23218..23382)
FT                   /gene="Pc20g00070"
FT                   /locus_tag="PCH_Pc20g00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85336"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER5"
FT                   /protein_id="CAP85336.1"
FT                   /translation="MGLCRSSPYRNRRLKECDVDDLENNGEDAQLYTLASMLNYITGRS
FT                   HLPIRHFENKGTQSFKNVNSHGSSWEHAAGYFIRMKYPWSLRPITTGLVLEGRGDGIVR
FT                   KIKESRVIMAWIHAKRAPTGITKYGLYHEMEKTPELKLCKNMIAMGWKGGSWVRRLGHI
FT                   PELPNCSFFGERAMVLSM"
FT   exon            22478..22653
FT                   /gene="Pc20g00070"
FT                   /locus_tag="PCH_Pc20g00070"
FT                   /number=1
FT   intron          22654..22683
FT                   /gene="Pc20g00070"
FT                   /locus_tag="PCH_Pc20g00070"
FT                   /number=1
FT   exon            22684..22818
FT                   /gene="Pc20g00070"
FT                   /locus_tag="PCH_Pc20g00070"
FT                   /number=2
FT   intron          22819..23040
FT                   /gene="Pc20g00070"
FT                   /locus_tag="PCH_Pc20g00070"
FT                   /number=2
FT   exon            23041..23110
FT                   /gene="Pc20g00070"
FT                   /locus_tag="PCH_Pc20g00070"
FT                   /number=3
FT   intron          23111..23217
FT                   /gene="Pc20g00070"
FT                   /locus_tag="PCH_Pc20g00070"
FT                   /number=3
FT   exon            23218..23382
FT                   /gene="Pc20g00070"
FT                   /locus_tag="PCH_Pc20g00070"
FT                   /number=4
FT   mRNA            complement(join(<24030..24430,24501..24669,24727..>25296))
FT                   /gene="Pc20g00080"
FT                   /locus_tag="PCH_Pc20g00080"
FT   CDS_pept        complement(join(24030..24430,24501..24669,24727..25296))
FT                   /gene="Pc20g00080"
FT                   /locus_tag="PCH_Pc20g00080"
FT                   /note="unknown EC_number=4.2.2.10"
FT                   /note="Title: strong similarity to pectin lyase pelA
FT                   -Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85337"
FT                   /db_xref="GOA:B6HER6"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER6"
FT                   /inference="similar to AA sequence:PIR:S17979"
FT                   /inference="protein motif:PFAM:PF00544"
FT                   /inference="protein motif:COGS:COG3866"
FT                   /protein_id="CAP85337.1"
FT                   /translation="MKFSLGLLFAAVAVASSPAKRADAVSVTGSPPGFAYGVTGGGDAT
FT                   PVYPTDVKHLIELLGSDDPQVIIIDKTFDFIGTEGTTKGNICKAYGSFEDGCQSTIDIG
FT                   KGCDGKPSEPYEWDTAGTTGITVQSDKTIIGVGNKGVLLGKGLRIVRASNIIVQNIMIT
FT                   NLNPQLVWGGDAITLSGTSKVWIDHVTTQYTGRVHYVFGHEANAHVTISNSFMNGATNF
FT                   STSCDGQNYWGLELVGADDQITFANNYVYRTSGRSPALSGKTLFHAVNSVWEDNSGHAI
FT                   EGTDDGQGLFEGCVFNNVTQIVGDFVGQLFSSPSATANKECAGYLKRDCVTNIQTNNGD
FT                   QFTNADTKFFSNFAGLNIATASAASAAQASVPTNAGNTL"
FT   exon            complement(24030..24430)
FT                   /gene="Pc20g00080"
FT                   /locus_tag="PCH_Pc20g00080"
FT                   /number=1
FT   mat_peptide     complement(join(24033..24430,24501..24669,24727..25224))
FT                   /gene="Pc20g00080"
FT                   /locus_tag="PCH_Pc20g00080"
FT   intron          complement(24431..24500)
FT                   /gene="Pc20g00080"
FT                   /locus_tag="PCH_Pc20g00080"
FT                   /number=1
FT   exon            complement(24501..24669)
FT                   /gene="Pc20g00080"
FT                   /locus_tag="PCH_Pc20g00080"
FT                   /number=2
FT   intron          complement(24670..24726)
FT                   /gene="Pc20g00080"
FT                   /locus_tag="PCH_Pc20g00080"
FT                   /number=2
FT   exon            complement(24727..25296)
FT                   /gene="Pc20g00080"
FT                   /locus_tag="PCH_Pc20g00080"
FT                   /number=3
FT   sig_peptide     complement(25225..25296)
FT                   /gene="Pc20g00080"
FT                   /locus_tag="PCH_Pc20g00080"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<27837..27881,27948..28316,28359..>28502))
FT                   /gene="Pc20g00090"
FT                   /locus_tag="PCH_Pc20g00090"
FT   CDS_pept        complement(join(27837..27881,27948..28316,28359..28502))
FT                   /gene="Pc20g00090"
FT                   /locus_tag="PCH_Pc20g00090"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig40.tfa_150wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85338"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER7"
FT                   /protein_id="CAP85338.1"
FT                   /translation="MMPPSDSLRHQLHKLAEVRASRNTSSISTSTPTSTSTPGTAPPPY
FT                   TLSNDMDDPWASPINIYIDHSITVTGDENTIMVSSPGMDSPTDPTHQEAPRLSSIAAVI
FT                   IAALNRANALHDDMGYPRPVNIRALAGIRVNGRNNRVCVGGEINKSQNETADAGVRESN
FT                   GRKRRASSEPVDAPSAQRSRSF"
FT   exon            complement(27837..27881)
FT                   /gene="Pc20g00090"
FT                   /locus_tag="PCH_Pc20g00090"
FT                   /number=1
FT   intron          complement(27882..27947)
FT                   /gene="Pc20g00090"
FT                   /locus_tag="PCH_Pc20g00090"
FT                   /number=1
FT   exon            complement(27948..28316)
FT                   /gene="Pc20g00090"
FT                   /locus_tag="PCH_Pc20g00090"
FT                   /number=2
FT   intron          complement(28317..28358)
FT                   /gene="Pc20g00090"
FT                   /locus_tag="PCH_Pc20g00090"
FT                   /number=2
FT   exon            complement(28359..28502)
FT                   /gene="Pc20g00090"
FT                   /locus_tag="PCH_Pc20g00090"
FT                   /number=3
FT   mRNA            complement(join(<29126..29245,29350..30159,30215..>30328))
FT                   /gene="Pc20g00100"
FT                   /locus_tag="PCH_Pc20g00100"
FT   CDS_pept        complement(join(29126..29245,29350..30159,30215..30328))
FT                   /gene="Pc20g00100"
FT                   /locus_tag="PCH_Pc20g00100"
FT                   /product="peroxin-20 Pex20-Penicillium chrysogenum"
FT                   /note="Gene-ID: Pex20"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00100"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85339"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER8"
FT                   /citation=[5]
FT                   /inference="similar to AA sequence:UNIPROT:A4GFN0_PENCH"
FT                   /protein_id="CAP85339.1"
FT                   /translation="MGDALCGPSNALQNFQKHTSVDRTLQQDRLTSRQSPVQGFRSQNS
FT                   QEGILDPEFAAFEGNLAGPALPNLQHPAHFGAPSQHAAVHHPAAHGASNASWASDFQNL
FT                   QISGPSHPVSQLQRPHIAPAAAHGGWHAEFMAQQQGPMSLAQQTPQMHGAYQPSFTPSY
FT                   QMYGSSMNQMQPLQGMQTEQQNTQQFDESAFEAAFDQARADMELQGVDIAQQDNQEHLQ
FT                   ETNKVDISEPAIQEQIRLGSDLIPQSDKQNPETQSRDADELARTAGQLLDSVRNEQSEK
FT                   FQQSNFLALMRRIRDREVEVEGDDFRETAQSLHPGGRYYPGQPHPDLPGSDIPSSSKEP
FT                   SNPIARV"
FT   exon            complement(29126..29245)
FT                   /gene="Pc20g00100"
FT                   /locus_tag="PCH_Pc20g00100"
FT                   /number=1
FT   intron          complement(29246..29349)
FT                   /gene="Pc20g00100"
FT                   /locus_tag="PCH_Pc20g00100"
FT                   /number=1
FT   exon            complement(29350..30159)
FT                   /gene="Pc20g00100"
FT                   /locus_tag="PCH_Pc20g00100"
FT                   /number=2
FT   intron          complement(30160..30214)
FT                   /gene="Pc20g00100"
FT                   /locus_tag="PCH_Pc20g00100"
FT                   /number=2
FT   exon            complement(30215..30328)
FT                   /gene="Pc20g00100"
FT                   /locus_tag="PCH_Pc20g00100"
FT                   /number=3
FT   mRNA            join(<30653..30655,30728..30772,30856..30971,31034..31064,
FT                   31136..31545,31611..>31935)
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT   CDS_pept        join(30653..30655,30728..30772,30856..30971,31034..31064,
FT                   31136..31545,31611..31935)
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT                   /note="Title: strong similarity to transport vesicle
FT                   formation protein Sec13 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85340"
FT                   /db_xref="GOA:B6HER9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037363"
FT                   /db_xref="InterPro:IPR037596"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER9"
FT                   /inference="similar to AA sequence:PIR:A45442"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP85340.1"
FT                   /translation="MATPQVISNSGHEEMIHDAGLDYYGRRLATCSSDKTIKIFEIEGE
FT                   SHRLVETLKGHEGAVWCVAWAHPKFGTILASSSYDGKVLIWREQPQNATSPSGGSTWTK
FT                   VFDFSLHTASVNMVSWAPHESGCLLACASSDGHISVLEFRDNNWTHQTFHAHGMGVNSI
FT                   SWAPAAFAGSLISSNPGPGQQRRFVTGGSDNLVKIWEYNAESKSYNLTQTLEGHSDWVR
FT                   DVAWSPSILSKSYIASAAQDKTVRIWTSDASNPGQWSSQTLEFDTVLWRVSWSLSGNIL
FT                   AVSGGDNKVSLWKENLKGEWEKVKDIEE"
FT   exon            30653..30655
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT                   /number=1
FT   intron          30656..30727
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT                   /number=1
FT   exon            30728..30772
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT                   /number=2
FT   intron          30773..30855
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT                   /number=2
FT   exon            30856..30971
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT                   /number=3
FT   intron          30972..31033
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT                   /number=3
FT   exon            31034..31064
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT                   /number=4
FT   intron          31065..31135
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT                   /number=4
FT   exon            31136..31545
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT                   /number=5
FT   intron          31546..31610
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT                   /number=5
FT   exon            31611..31935
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT                   /number=6
FT   mRNA            complement(join(<32204..32634,32682..32764,32813..33117,
FT                   33179..33598,33633..>33653))
FT                   /gene="Pc20g00120"
FT                   /locus_tag="PCH_Pc20g00120"
FT   CDS_pept        complement(join(32204..32634,32682..32764,32813..33117,
FT                   33179..33598,33633..33653))
FT                   /gene="Pc20g00120"
FT                   /locus_tag="PCH_Pc20g00120"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An04g00350 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85341"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES0"
FT                   /protein_id="CAP85341.1"
FT                   /translation="MCLYICNILQDIACCLPNDRDILHLSQSCKEMWEKVFSSESGIWR
FT                   DRFGKHYDIAPGRRSGELKYEYQIRAIVLRSPIQFKGEEDARQYLWMEVMQTMLEESLK
FT                   LPVGPGATSKTLQRIHETLKGVDFLSEFRKGRNCSPLFYALQLCLSSFALDPTITEPCR
FT                   RTDYDIKQVYSYADEVGKAFIDHDNLDLAKLLDLRNFWQRHLLNASELTFQESFSELPA
FT                   DMTPKARKDIPTEASRLSPSWLGYYCNVRSACIHPLSDLQKANQRQTCADLETHGYSTT
FT                   LTNGETLDLQPSSGQFWPAQCSKIIPPAGGVDTERVYFDGKQRSYDATHEVGNPVFGFT
FT                   EEIAVPHGGFEGWTRICFTVVEADEDDDEEEQPFSAVMDGEGWIHGYEAVIVPGGRMML
FT                   GRWVDMKEPDARGPFIFWDV"
FT   exon            complement(32204..32634)
FT                   /gene="Pc20g00120"
FT                   /locus_tag="PCH_Pc20g00120"
FT                   /number=1
FT   intron          complement(32635..32681)
FT                   /gene="Pc20g00120"
FT                   /locus_tag="PCH_Pc20g00120"
FT                   /number=1
FT   exon            complement(32682..32764)
FT                   /gene="Pc20g00120"
FT                   /locus_tag="PCH_Pc20g00120"
FT                   /number=2
FT   intron          complement(32765..32812)
FT                   /gene="Pc20g00120"
FT                   /locus_tag="PCH_Pc20g00120"
FT                   /number=2
FT   exon            complement(32813..33117)
FT                   /gene="Pc20g00120"
FT                   /locus_tag="PCH_Pc20g00120"
FT                   /number=3
FT   intron          complement(33118..33178)
FT                   /gene="Pc20g00120"
FT                   /locus_tag="PCH_Pc20g00120"
FT                   /number=3
FT   exon            complement(33179..33598)
FT                   /gene="Pc20g00120"
FT                   /locus_tag="PCH_Pc20g00120"
FT                   /number=4
FT   intron          complement(33599..33632)
FT                   /gene="Pc20g00120"
FT                   /locus_tag="PCH_Pc20g00120"
FT                   /number=4
FT   exon            complement(33633..33653)
FT                   /gene="Pc20g00120"
FT                   /locus_tag="PCH_Pc20g00120"
FT                   /number=5
FT   mRNA            complement(join(<34136..35300,35423..35719,35796..>35986))
FT                   /gene="Pc20g00130"
FT                   /locus_tag="PCH_Pc20g00130"
FT   CDS_pept        complement(join(34136..35300,35423..35719,35796..35986))
FT                   /gene="Pc20g00130"
FT                   /locus_tag="PCH_Pc20g00130"
FT                   /note="Title: strong similarity to myo-inositol transport
FT                   protein Itr2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85342"
FT                   /db_xref="GOA:B6HF24"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF24"
FT                   /inference="similar to AA sequence:PIR:B40538"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP85342.1"
FT                   /translation="MSGADEQDQSGPHAPLLASSRPSSDHDDNEHDESLASELEYSGGW
FT                   FIWALTFSAGISGLLFGYDTGVISSTLVTIGSDLSGRTLTTLDKSLITSCTSLFALIAS
FT                   PFTGVLADKFGRRKVILGADLLFALGALVQAFTSQVWGMILGRSIVGLAVGSASAVTPL
FT                   YISELAPSHARGRLVTILSLFITGGQVVAYIVGWLFSSTTGGWRWIVGIGAFPAFFQLA
FT                   ILALLPETPRWLVQAGFDAQAKTVLIKIYQDCPGHDKVVDRVLRNISGEIAQEASEMGL
FT                   QEVSDMGLTKSRGTKPQWLHDTIQRGQQLLHGGNRRALIIAMMLQAVQQLCGFNSLMYF
FT                   SATIFSSLSFSSPTLTSLSVAMTNFVFTLLAFVLIDKIGRRRILLYSIPVMVVALVVCA
FT                   FSFSSVDNKWNSQPPSGRQDNHDSVSSVVPLAILFCLTVYTAAYALGLGNVPWQQSELF
FT                   PLNVRSLGSGLATATNWGSNFIIGLTFLPMMEWISPSWTFALYAFVCVVGWVAVWAIYP
FT                   EMSGLSLEEVKGLLADGWGVTESLQRRHLSQHI"
FT   exon            complement(34136..35300)
FT                   /gene="Pc20g00130"
FT                   /locus_tag="PCH_Pc20g00130"
FT                   /number=1
FT   intron          complement(35301..35422)
FT                   /gene="Pc20g00130"
FT                   /locus_tag="PCH_Pc20g00130"
FT                   /number=1
FT   exon            complement(35423..35719)
FT                   /gene="Pc20g00130"
FT                   /locus_tag="PCH_Pc20g00130"
FT                   /number=2
FT   intron          complement(35720..35795)
FT                   /gene="Pc20g00130"
FT                   /locus_tag="PCH_Pc20g00130"
FT                   /number=2
FT   exon            complement(35796..35986)
FT                   /gene="Pc20g00130"
FT                   /locus_tag="PCH_Pc20g00130"
FT                   /number=3
FT   mRNA            complement(join(<36401..36752,36808..37276,37330..37416,
FT                   37466..37639,37688..37991,38044..38124,38190..38912,
FT                   38979..>39041))
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT   CDS_pept        complement(join(36401..36752,36808..37276,37330..37416,
FT                   37466..37639,37688..37991,38044..38124,38190..38912,
FT                   38979..39041))
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /note="Title: strong similarity to positive effector of
FT                   Gcn2p Gcn20 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85343"
FT                   /db_xref="GOA:B6HF25"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF25"
FT                   /inference="similar to AA sequence:PIR:S56146"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /inference="protein motif:COGS:COG1123"
FT                   /protein_id="CAP85343.1"
FT                   /translation="MESELQSQIPGLDHIITEYSVGYLTHAANLYVDDACAESPLTEAA
FT                   ESVTELLVSASGDFSPQNYEAIGNLVTRFITTLSSSDGDPERRQMPFKAKKLEQTINVG
FT                   AQRNMSSTLGLTGNTVDLESANARKMESKVDKKKLEKAERKIRAKQDKKSMKNVTYEAS
FT                   RLLNQPDEAMSYEEFFMAVNPLQMGSDSQAKSKDIKLDNIDISISGLRILTDAAFTLAY
FT                   GRRYGLVGQNGIGKSTLLRALSRREIPIPTHVSILHVEQEITGDDTPALQAVLDADVWR
FT                   KHLLSEQAKISEQLAAIEEERSSLADTSKDAARLDEQREGLDITLSDIYGKLSEMESDK
FT                   AESRAASILAGLGFSQERQQYATKTFSGGWRMRLSLARALFCEPDLLLLDEPSNMLDVP
FT                   SITFLSNYLQGYPSTVLVVSHDRAFLNEVATDIIHQHSERLDYYRGANFESFYATKEER
FT                   RKTAKREYEKQMGERAHLQAFIDKFRYNAAKSSEAQSRIKKLERMPVLEAPEAEYTVHF
FT                   AFPGVEKLSPPIVQMSDVCFGYTKDKPLLRDVDLDVQLDSRIGIVGPNGAGKTTVLKLL
FT                   TNQLEPTSGLISTNSRLRIGFFAQHHVDALDMTTSAVGFMTKTYPGKTDEEYRRHLGAF
FT                   GITGTTGLQRMELLSGGQKSRVAFACLSLTNPHILVLDEPSNHLDIEGMDALSDALRVF
FT                   EGGVVMVSHDVTMLQNVCTSLWVCDGGTVHKFDGTVNAYKKKIAAQADAAGVVAKH"
FT   exon            complement(36401..36752)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=1
FT   intron          complement(36753..36807)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=1
FT   exon            complement(36808..37276)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=2
FT   intron          complement(37277..37329)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=2
FT   exon            complement(37330..37416)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=3
FT   intron          complement(37417..37465)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=3
FT   exon            complement(37466..37639)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=4
FT   intron          complement(37640..37687)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=4
FT   exon            complement(37688..37991)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=5
FT   intron          complement(37992..38043)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=5
FT   exon            complement(38044..38124)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=6
FT   intron          complement(38125..38189)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=6
FT   exon            complement(38190..38912)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=7
FT   intron          complement(38913..38978)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=7
FT   exon            complement(38979..39041)
FT                   /gene="Pc20g00140"
FT                   /locus_tag="PCH_Pc20g00140"
FT                   /number=8
FT   mRNA            join(<42568..42585,42688..>45747)
FT                   /gene="Pc20g00150"
FT                   /locus_tag="PCH_Pc20g00150"
FT   CDS_pept        join(42568..42585,42688..45747)
FT                   /gene="Pc20g00150"
FT                   /locus_tag="PCH_Pc20g00150"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An04g00300 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85344"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF26"
FT                   /protein_id="CAP85344.1"
FT                   /translation="MDHISTLCALSTVGIAPTGLALGRAERTQRPSLFRRKTHAQGIPE
FT                   PLSVNTEPTADVARPKTAIPSRSPAAEWLAAKEEESFQGSQGSDLSKAPLSFSGARRRR
FT                   RGQTLTNPPLRIPEHESTDSSVGTHTRRPSTGWLRRLSMASFPAETPTASSPATPSFNG
FT                   STSPLISHSPRQRRPANKLVKRPTSQHTTTYALTLNPICGPSPAALRRPATSHQRSESM
FT                   ILRTPLTTDFDTYFPKAPVEGPTIEEFELDKQKRWTPFFVPKGGKLAERLSRRFSTSTA
FT                   PKVQSVRQIVSDQGALPALVMANVISPTTAAPRDDRSVPHTPIEFHNPFQTAPSEFGPK
FT                   QPVAPEQPAERSLHRQSYSVNDVEPKIEPKIVMANTVTAHGTPIMGLVRGGSLKRVKGR
FT                   TFSVPPSELSQEENNVAIPSSPEPEPRRNITDPSVFRAPYPISQPGWADSALERRSQVG
FT                   PRSVSQDYNVGLGSRAGSRQMTSDAVALSAWQQASRPGGQTYGSLRRRPKGFSISGSDP
FT                   ASTLIGSDATRVFTSSDGYETDMMSDYWDSVRTRETNRSGAKGLRIETMFDKAGTSLAN
FT                   EEATTLESLLPRGSFAARSLDKDPQLFTDPLLSAPPLVQTSMGENPSIPDDDALSMIGA
FT                   LPSDDRDCFPSSLTRSLAKYAEEPELRVGADNDMPGSFMGELDSDINKKTNIFDWSEQT
FT                   HPNRETSDSGTRPRTMQGKHEGVIDRNSRAVCRKAPSTVHLRSQSVPVASELPINESRQ
FT                   TSGKFGTWGLGSKGVSEDWDSDFDFDESEDTPVAENKPLVEPDINRQSMTVPKAILERQ
FT                   ASLRGQFGQVQELTLLVEELKRLRHQANVLGVVNGPSSELWAEAEQIVNLATIDDEEER
FT                   RSPPGSPQSLTFSFDESDDDGLNASSKRNSDVLWDIPRGENSEPTLPLAQLARDSPKSK
FT                   SVLDILQPRQQEPSSAFNGLELASRAKKLPFDTSSLKNLVVRAGVVTRALKEVIRKADG
FT                   VATSPQDFQDPPFRRIFDKPSHDDIASFEAALADMS"
FT   sig_peptide     join(42568..42585,42688..42744)
FT                   /gene="Pc20g00150"
FT                   /locus_tag="PCH_Pc20g00150"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            42568..42585
FT                   /gene="Pc20g00150"
FT                   /locus_tag="PCH_Pc20g00150"
FT                   /number=1
FT   intron          42586..42687
FT                   /gene="Pc20g00150"
FT                   /locus_tag="PCH_Pc20g00150"
FT                   /number=1
FT   exon            42688..45747
FT                   /gene="Pc20g00150"
FT                   /locus_tag="PCH_Pc20g00150"
FT                   /number=2
FT   mat_peptide     42745..45744
FT                   /gene="Pc20g00150"
FT                   /locus_tag="PCH_Pc20g00150"
FT   mRNA            <48329..>50347
FT                   /gene="Pc20g00160"
FT                   /locus_tag="PCH_Pc20g00160"
FT   CDS_pept        48329..50347
FT                   /gene="Pc20g00160"
FT                   /locus_tag="PCH_Pc20g00160"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An04g00270 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00160"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85345"
FT                   /db_xref="GOA:B6HF27"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF27"
FT                   /protein_id="CAP85345.1"
FT                   /translation="MPHAHHAGLVMRNHVRRDVIPPHRLPFLVPSTSSIATELPSLVAR
FT                   AEASTTVTGEKPTSNLTTTVLPVVLGAGVPILCAIVVLIVLHRRHVKKLLREDAMDKHK
FT                   SLDFGMDTVGPATRRKGPGMPPMSEPTHTKGLSLDVGPYLMPPGLKNSPESLRSMSIDD
FT                   DKYRPATASIRSYPRGSRFEGADDGNSGLLQNAQRMSRSSPPLYSSPIESHGRSLDQHN
FT                   DYLGEVPGVTHPPAAQQPGMAIGSPNANRIPSPEPLPHLDSSLGLNFGLDNTHGNTYNN
FT                   QHEERLNFPLPEPSQSRDLDHNQAPASQLPRISLPDSVVTSSDYGDDRKSQYTLPTVNI
FT                   HGTEDVQQHNALSHDNKNPELPEEPQNLDAAYDNRRDTRRMTLGLRPLPPEDPADNPEQ
FT                   RANRIRSFYKEYFDESKNGQEPTYYEDFGPEFYEGGGNAGFIYDPITGDYYDATHGVAP
FT                   FAEPMTRRAMTPPPRAPPRFQGAARHMATNSAGYNGMPGPRAFSSASGRMPGPRGPKKP
FT                   IPPPSPLQILPTPHMLTDDSLMTAMDFAPANGFKDRRAGRPETPTGGVRHYIPGVRAHT
FT                   PLASAFDELAVMPSPHALRKSGTFTNLDFVPPPRFKNEGAGSDAGSIRSARTVVSAHHQ
FT                   NNIRMGNYRVSRLPAEAVGTKDDMMATLRPKWDMNNT"
FT   exon            48329..50347
FT                   /gene="Pc20g00160"
FT                   /locus_tag="PCH_Pc20g00160"
FT                   /number=1
FT   mRNA            <51962..>53227
FT                   /gene="Pc20g00170"
FT                   /locus_tag="PCH_Pc20g00170"
FT   CDS_pept        51962..53227
FT                   /gene="Pc20g00170"
FT                   /locus_tag="PCH_Pc20g00170"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig40.tfa_80cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00170"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85346"
FT                   /db_xref="GOA:B6HF28"
FT                   /db_xref="InterPro:IPR014805"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF28"
FT                   /inference="protein motif:COGS:COG2812"
FT                   /inference="protein motif:COGS:COG3210"
FT                   /inference="protein motif:COGS:COG0457"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /inference="protein motif:COGS:COG3468"
FT                   /inference="protein motif:COGS:COG3942"
FT                   /inference="protein motif:COGS:COG1530"
FT                   /inference="protein motif:COGS:COG1511"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP85346.1"
FT                   /translation="MASPSKAAGAAAAAAAIASSAAETVVQTSGSPETSSETSAAQPST
FT                   SSTETTSSSAPAPTTSSSTEPTTTSSTTSSTSSTPTTEPTTSTPDPTSTSPTSTSTSST
FT                   SSSTSSTSSTSSTTTAPSTTSSEEKTTFTSTEGTTVVVVTSTQIASNTGATSTTSSSAT
FT                   DSAALATSGTAAGSGGLSPSGTIAVAVVVPVVSVALIILALLFFWRKRKANKAAEEERR
FT                   KEVEEYGFNPNNDPTLPGIGGVVVPKDDESSGYRGWGTTSAGRKASTNLSSGMGGLAMS
FT                   EGSSPGYHHAATPSEGTVQYSDGARPDSGEIVEPIGVLGAAPVAANNRNGDIHRGPSNA
FT                   SSAYSAANRSDASEESHMSAVHPSAGYYGENPYYGDINTHGAYGGDDYQPVIRDVQARR
FT                   NTRIENPGVYPRQGNAGIAQNF"
FT   sig_peptide     51962..52027
FT                   /gene="Pc20g00170"
FT                   /locus_tag="PCH_Pc20g00170"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            51962..53227
FT                   /gene="Pc20g00170"
FT                   /locus_tag="PCH_Pc20g00170"
FT                   /number=1
FT   mat_peptide     52028..53224
FT                   /gene="Pc20g00170"
FT                   /locus_tag="PCH_Pc20g00170"
FT   mRNA            join(<54698..54729,54775..54859,54919..55044,55106..55156,
FT                   55220..57704,57760..57929,57992..>58204)
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT   CDS_pept        join(54698..54729,54775..54859,54919..55044,55106..55156,
FT                   55220..57704,57760..57929,57992..58204)
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /note="Title: strong similarity to ankyrin repeat protein
FT                   Nuc-2 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85347"
FT                   /db_xref="GOA:B6HF29"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF29"
FT                   /inference="similar to AA sequence:PIR:S72479"
FT                   /inference="protein motif:PFAM:PF03105"
FT                   /inference="protein motif:COGS:COG0666"
FT                   /inference="protein motif:COGS:COG0584"
FT                   /protein_id="CAP85347.1"
FT                   /translation="MYVCPSVSVTGKFGKQIQRRQLDLPEYAASFVNYKALKKLIKQLS
FT                   ATPTIPAQRTAEEIARANADPQGALRANKEVFFFRLEREIEKVNTFYLQKESEFSLRLR
FT                   TLVDKKRVTQSRATSNSKAPSNFAAMFEGFQQFDGDLNKLQQFVEINETAMSKILKKWD
FT                   KTSKSRMKELYLHRAVEVQPCFNREVLRDLADRATTARLELEAWAEGENIQYDASRPLD
FT                   RTATLGSEEDEMDSQILQSASTGNLQTLREWLARLQQLPDARERATRTFLTAINGFSDE
FT                   VLGLLLESKLVDIHAEDDINERNCLHEAAISGRLFVFHAGLQAGVDFARADVYGRIPLH
FT                   YACMHGRVDMVRHLLAAGPHTVDIMDHDNFTPLIHSIVKGQLACAEQVLCSNARVDPEP
FT                   ESPPMKGMDHRPLKGPDHIPLNLACQHGSLPIARMLLERNAKLLPDAEGLYPQHMVARA
FT                   SQSPELLLLLKEHGADLDQKDKLYQWTPLFHAASEGCVPCLRTLLECGVDAQVPDEKGL
FT                   SSMYYAAWEGHLECMLLLWAQPSGKKPTLGPLDILNGVRMQEPGPMGDMSVVTSVSELE
FT                   MADGIPDLELPPPIIPLRRYGHNFLDKKVFVQLLFDQGNVGSIAFDQAGRHPAARMTIS
FT                   SKLSDLIPRTVMLPIQEETRTISFHVDNLDTFAVDFEIFPTFGSKVIAKSVALPDIFRA
FT                   ESSSTGSGCLPLFDPRLRTIGQLRFNFQVIKPYHGDPLEITHFATYWKATSALDSDHNG
FT                   LVTGSSLSGDYVQLFVQLTQDRVAVLYPQFMINHHGVDIPVSHLTYAQFQAIGADCGAN
FT                   HTEILKFLETEATNDMPQTHRLLAASFLSLRDVLQQLPIDLNVNISLLYPSPTEEKKLH
FT                   MTSLADVNSFADVILTDVFDHARVARDKNPEFMRSVVFTSYNPNICSALNWKQPNYPVL
FT                   LCNDLGQIRDLAGNVDSMPHVNSSGRASMSIKESARIAQSNNFMGLICRSSLLNVVPAL
FT                   VETIKELGLVLVADTSDEVSQPDRLEELPTDTMGVAEWAYRMPDGVNGVMRANGILRFN
FT                   DMIDM"
FT   exon            54698..54729
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /number=1
FT   intron          54730..54774
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /number=1
FT   exon            54775..54859
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /number=2
FT   intron          54860..54918
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /number=2
FT   exon            54919..55044
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /number=3
FT   intron          55045..55105
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /number=3
FT   exon            55106..55156
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /number=4
FT   intron          55157..55219
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /number=4
FT   exon            55220..57704
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /number=5
FT   intron          57705..57759
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /number=5
FT   exon            57760..57929
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /number=6
FT   intron          57930..57991
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /number=6
FT   exon            57992..58204
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /number=7
FT   mRNA            complement(join(<58635..58786,58852..>59425))
FT                   /gene="Pc20g00190"
FT                   /locus_tag="PCH_Pc20g00190"
FT   CDS_pept        complement(join(58635..58786,58852..59425))
FT                   /gene="Pc20g00190"
FT                   /locus_tag="PCH_Pc20g00190"
FT                   /note="unknown EC_number=2.3.1.88"
FT                   /note="Title: weak similarity to
FT                   methionine-N-acetyltransferase Nat2 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85348"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF30"
FT                   /inference="similar to AA sequence:TREMBL:SCNAT2N.1"
FT                   /protein_id="CAP85348.1"
FT                   /translation="MSLRPTLLKQWISRPSEILKSTPSLTSYLHPSARPSLAHRSIIFP
FT                   SAGQATRRSLTTARLPTRTRPGPSSFHPKQRRFNSGSAGGGGKGSGAGAGAGASEKASL
FT                   SQRLKKLSREYGWAALGVYLGLSALDFPFCFAAVRLLGVERIGYYEHVVVGFVKDKLKS
FT                   VWPQTKSSEAEDGQGQLAQAEERNQEEASIWTQLVFAYAIHKSFVFIRVPLTAAVTPKV
FT                   VKTLRGWGWDIGKRKPKST"
FT   exon            complement(58635..58786)
FT                   /gene="Pc20g00190"
FT                   /locus_tag="PCH_Pc20g00190"
FT                   /number=1
FT   intron          complement(58787..58851)
FT                   /gene="Pc20g00190"
FT                   /locus_tag="PCH_Pc20g00190"
FT                   /number=1
FT   exon            complement(58852..59425)
FT                   /gene="Pc20g00190"
FT                   /locus_tag="PCH_Pc20g00190"
FT                   /number=2
FT   mRNA            join(<59860..60643,60718..>60824)
FT                   /gene="Pc20g00200"
FT                   /locus_tag="PCH_Pc20g00200"
FT   CDS_pept        join(59860..60643,60718..60824)
FT                   /gene="Pc20g00200"
FT                   /locus_tag="PCH_Pc20g00200"
FT                   /note="Title: strong similarity to ribosomal protein of the
FT                   large subunit Yml9 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00200"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85349"
FT                   /db_xref="GOA:B6HF31"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF31"
FT                   /inference="similar to AA sequence:TREMBL:SCMRPL9G.1"
FT                   /inference="protein motif:PFAM:PF00297"
FT                   /inference="protein motif:COGS:COG0087"
FT                   /protein_id="CAP85349.1"
FT                   /translation="MSPRLGGLLQLSPVWGAPLITPRIPVRSFGIRSLNPPKPSRFNIG
FT                   PGLPVLESTSTAALRRKANSLPLRTGAIGIKKGMTAIYDPESGKRIPCTVLQLDRVEVI
FT                   SHKTRERHGYYAVQVGAGWKHPSNVTKSMLGHFSVNGISPKRHIFEFRVKDEAGLIPVG
FT                   QSIEAGWFQEGQFVDARSNTKGKGFAGVMKRHGFGGQDRSHGVSLTHRSMGSSGPGQGG
FT                   GSRVYPGKKMAGNMGNTQNTVQNLKILKVDSENGIVVVSGAVSGPKGCVVRIQDAIKKP
FT                   WPEVPQAEATEPATA"
FT   sig_peptide     59860..59907
FT                   /gene="Pc20g00200"
FT                   /locus_tag="PCH_Pc20g00200"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            59860..60643
FT                   /gene="Pc20g00200"
FT                   /locus_tag="PCH_Pc20g00200"
FT                   /number=1
FT   mat_peptide     join(59908..60643,60718..60821)
FT                   /gene="Pc20g00200"
FT                   /locus_tag="PCH_Pc20g00200"
FT   intron          60644..60717
FT                   /gene="Pc20g00200"
FT                   /locus_tag="PCH_Pc20g00200"
FT                   /number=1
FT   exon            60718..60824
FT                   /gene="Pc20g00200"
FT                   /locus_tag="PCH_Pc20g00200"
FT                   /number=2
FT   mRNA            complement(join(<61071..61160,61234..>61695))
FT                   /gene="Pc20g00210"
FT                   /locus_tag="PCH_Pc20g00210"
FT   CDS_pept        complement(join(61071..61160,61234..61695))
FT                   /gene="Pc20g00210"
FT                   /locus_tag="PCH_Pc20g00210"
FT                   /note="Title: similarity to hypothetical membrane protein
FT                   YIL157c - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85350"
FT                   /db_xref="GOA:B6HF32"
FT                   /db_xref="InterPro:IPR014807"
FT                   /db_xref="InterPro:IPR042432"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF32"
FT                   /inference="similar to AA sequence:PIR:S48377"
FT                   /protein_id="CAP85350.1"
FT                   /translation="MVFSRAFTRRAALARQSARPNIASRRTMIAAPGPNTGPLLERRAD
FT                   RELPNPNPGRKWLYTLPIFIIATGAGMLGIFNYQKSSSSIVNSTLYALRTSPRAREILG
FT                   DEIYFAQQIPWISGEMNQLHGRIDISFWVKGTKSQGKMKFRSIRPDRMSYFRTEEWSLE
FT                   TEDGTVVQLLDNDSDPFRKN"
FT   exon            complement(61071..61160)
FT                   /gene="Pc20g00210"
FT                   /locus_tag="PCH_Pc20g00210"
FT                   /number=1
FT   intron          complement(61161..61233)
FT                   /gene="Pc20g00210"
FT                   /locus_tag="PCH_Pc20g00210"
FT                   /number=1
FT   exon            complement(61234..61695)
FT                   /gene="Pc20g00210"
FT                   /locus_tag="PCH_Pc20g00210"
FT                   /number=2
FT   mRNA            join(<61865..62005,62062..62380,62432..>62526)
FT                   /gene="Pc20g00220"
FT                   /locus_tag="PCH_Pc20g00220"
FT   CDS_pept        join(61865..62005,62062..62380,62432..62526)
FT                   /gene="Pc20g00220"
FT                   /locus_tag="PCH_Pc20g00220"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An04g00190 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85351"
FT                   /db_xref="GOA:B6HF33"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF33"
FT                   /protein_id="CAP85351.1"
FT                   /translation="MAAVRLRKAFRYPEESEGEREELDEEQQERVIEQLQSQNDARNAQ
FT                   YSMIFTALPVLAATVFVPSVLSASSQAERLFSLLGLASLLTTAYIMKCFPLHPDRKGKK
FT                   PMTFHTERIARLHAALVPGTSAVCLLLAVVYLSTEPSYAVHPVLYLIPGAMLAVILLAQ
FT                   KVMLSVDLASLKDLQYEYKGA"
FT   exon            61865..62005
FT                   /gene="Pc20g00220"
FT                   /locus_tag="PCH_Pc20g00220"
FT                   /number=1
FT   intron          62006..62061
FT                   /gene="Pc20g00220"
FT                   /locus_tag="PCH_Pc20g00220"
FT                   /number=1
FT   exon            62062..62380
FT                   /gene="Pc20g00220"
FT                   /locus_tag="PCH_Pc20g00220"
FT                   /number=2
FT   intron          62381..62431
FT                   /gene="Pc20g00220"
FT                   /locus_tag="PCH_Pc20g00220"
FT                   /number=2
FT   exon            62432..62526
FT                   /gene="Pc20g00220"
FT                   /locus_tag="PCH_Pc20g00220"
FT                   /number=3
FT   mRNA            complement(join(<62861..64872,64947..>65214))
FT                   /gene="Pc20g00230"
FT                   /locus_tag="PCH_Pc20g00230"
FT   CDS_pept        complement(join(62861..64872,64947..65214))
FT                   /gene="Pc20g00230"
FT                   /locus_tag="PCH_Pc20g00230"
FT                   /note="Title: strong similarity to hypothetical
FT                   c-module-binding factor B21O8.50 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85352"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR018866"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF34"
FT                   /inference="similar to AA sequence:TREMBL:NCB21O8.5"
FT                   /inference="protein motif:PFAM:PF02373"
FT                   /protein_id="CAP85352.1"
FT                   /translation="MPAHRTRLAFEPLSPLLDIHRVVESTPNFEFAMDITCDAIEDFPL
FT                   EDFEKLVLYQVVLSGRPLVIRGFHQRLDKRIFSEKWLRAKYAKKVEEVRDLVKKKTFNF
FT                   SMGHYLDNLSLLTRQVTVHNYTHKDLQRLYLKDIDCPPEWHAYLENLLPPFLFYLNEGP
FT                   KGFEGSASGKTNLSEIPKSTQGDPIAPSGDLMSSLPPSMRAENLMCYIGHEGTYTPAHQ
FT                   EMCASLGHNIMVEASDGSVENGKPTVPGSSIWLMTETKDRRIVSEYWMSVLGHDIDIED
FT                   FFAPLHAWEIAPFKTWVVEQRPGDLILVPPLAAHQVWNRGTRTTKVAWNRTTVDTLELA
FT                   LHEALPHARMVCRDEQYKNKAIVYFALERYSKLLRQAKKVDHPVVVQLWDDFKRLFNLY
FT                   KGILLSESFSQKNPEKNVEYHEFQSNVTCSFCRCNIFNRFLTCPGCANALGGEEDPYDI
FT                   CMDCYVMGRSCACISHLKWMEQFPWKLLTERYETWRRLIISSDENNKDLKVQFPTFIVA
FT                   RGQVGKKSVAEICQEQLVRRPWNDPKKPKPVVDNTNEDAGSESEGNSRSKKRRKMRQSL
FT                   MAKSDDVHRCHVCLHFEVNWKLAPCSNCDQRYCYGSLFRAFEISPQEAMEKHHWLCPKC
FT                   RKECSCGACQRDPSMKPYEPNCTILGHDTSKVADPRSIETLVDFRKSNLWWLKKFGDDV
FT                   HGRIQKRQKEAEEAELERQKTLEDQGFSFETSPFDPPQNGNGNDENPLGFDDNDGGIPV
FT                   DPSLMT"
FT   exon            complement(62861..64872)
FT                   /gene="Pc20g00230"
FT                   /locus_tag="PCH_Pc20g00230"
FT                   /number=1
FT   intron          complement(64873..64946)
FT                   /gene="Pc20g00230"
FT                   /locus_tag="PCH_Pc20g00230"
FT                   /number=1
FT   exon            complement(64947..65214)
FT                   /gene="Pc20g00230"
FT                   /locus_tag="PCH_Pc20g00230"
FT                   /number=2
FT   mRNA            <66030..>67286
FT                   /gene="Pc20g00240"
FT                   /locus_tag="PCH_Pc20g00240"
FT   CDS_pept        66030..67286
FT                   /gene="Pc20g00240"
FT                   /locus_tag="PCH_Pc20g00240"
FT                   /note="unknown EC_number=2.5.-.-"
FT                   /note="Title: strong similarity to para-hydroxybenzoate
FT                   polyprenyltransferase Coq2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85353"
FT                   /db_xref="GOA:B6HF35"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF35"
FT                   /inference="similar to AA sequence:PIR:S20056"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /inference="protein motif:COGS:COG0382"
FT                   /inference="protein motif:COGS:COG0109"
FT                   /protein_id="CAP85353.1"
FT                   /translation="MLSTSSRLLRARLSPYRQKVNLTGLYNGRLPTFAHNAYSPTQLKD
FT                   PRFLASGSSIALRTTQVQVRHSSQLQSPATQPTETDSAEKNPATHYILPKTGLIASLPS
FT                   SWIPYAELVRLDKPTGTYYLFFPTLFSTLLAAPMAGAAPLHVLGTSALFFSGALIMRGA
FT                   GCAINDLWDRNLDPHVERTKFRPIARGALSPKNAILFTGSQLVAGLGVLLSFPTQCLWY
FT                   GIPSLPIVVAYPLAKRVTNYPQAVLGLAFSWGAIMGFPALGVDLLANHDALMAAGALYS
FT                   SCIAWTVLYDMIYAHMDIKDDVKAGIKSIALRHEHNTKAVLSGLAVTQVSLLAAAGVAA
FT                   GCGPVFFVGSCGSAVLSLGLMIWKVQLKNVRNCWWWFRNGCLLTGGGISLGLFAEYATQ
FT                   YLGLYNTTEPERVVAESTQ"
FT   exon            66030..67286
FT                   /gene="Pc20g00240"
FT                   /locus_tag="PCH_Pc20g00240"
FT                   /number=1
FT   mRNA            complement(join(<67334..67734,67794..>68109))
FT                   /gene="Pc20g00250"
FT                   /locus_tag="PCH_Pc20g00250"
FT   CDS_pept        complement(join(67334..67734,67794..68109))
FT                   /gene="Pc20g00250"
FT                   /locus_tag="PCH_Pc20g00250"
FT                   /note="Title: strong similarity to hypothetical thymidylate
FT                   synthase-like DNA metabolism protein SPAC15E1.04
FT                   -Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85354"
FT                   /db_xref="GOA:B6HF36"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF36"
FT                   /inference="similar to AA sequence:PIR:T37719"
FT                   /inference="protein motif:PFAM:PF02441"
FT                   /inference="protein motif:COGS:COG0452"
FT                   /protein_id="CAP85354.1"
FT                   /translation="MDSQVSPTPFIAEQYTNDNKTHVLLAAATINLRNIAEALCRNKNI
FT                   SVRILVSEPAEKFLAGQSLEQPVLGTLLQIDGVDAIYRDQDEWSPSWTRGGPVLHIELR
FT                   KWAHILLVAPMSANTMAKTANGIADNLLLSVIRAWDTTGVVDMGFKTQKPMIFAALDMD
FT                   PCTYRHPVTEKQLTVLRDQWGWSESNPEGWLTVLPPIEKNLAYGDVGAGSAGSMMDWRD
FT                   IVTVVQHYVAGLAQQS"
FT   exon            complement(67334..67734)
FT                   /gene="Pc20g00250"
FT                   /locus_tag="PCH_Pc20g00250"
FT                   /number=1
FT   intron          complement(67735..67793)
FT                   /gene="Pc20g00250"
FT                   /locus_tag="PCH_Pc20g00250"
FT                   /number=1
FT   exon            complement(67794..68109)
FT                   /gene="Pc20g00250"
FT                   /locus_tag="PCH_Pc20g00250"
FT                   /number=2
FT   mRNA            join(<68318..68341,68395..68689,68758..>68912)
FT                   /gene="Pc20g00260"
FT                   /locus_tag="PCH_Pc20g00260"
FT   CDS_pept        join(68318..68341,68395..68689,68758..68912)
FT                   /gene="Pc20g00260"
FT                   /locus_tag="PCH_Pc20g00260"
FT                   /note="Title: strong similarity to glutaredoxins Grx5
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85355"
FT                   /db_xref="GOA:B6HF37"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF37"
FT                   /inference="similar to AA sequence:PIR:S60931"
FT                   /inference="protein motif:PFAM:PF00462"
FT                   /inference="protein motif:COGS:COG0278"
FT                   /protein_id="CAP85355.1"
FT                   /translation="MFSRAVASAFRPVSRPTFLRPVRSAIQFPSGPSIPSVLHARLLSN
FT                   ETRTAIDKAVSSAPVVLFMKGTPETPQCGFSRATIQILGLQGVDPKKFVAFNVLEDAEL
FT                   RSGVKEYSEWPTIPQLYLEKEFIGGCDILMSMHQNGELAKLLETKGVLVAADE"
FT   exon            68318..68341
FT                   /gene="Pc20g00260"
FT                   /locus_tag="PCH_Pc20g00260"
FT                   /number=1
FT   intron          68342..68394
FT                   /gene="Pc20g00260"
FT                   /locus_tag="PCH_Pc20g00260"
FT                   /number=1
FT   exon            68395..68689
FT                   /gene="Pc20g00260"
FT                   /locus_tag="PCH_Pc20g00260"
FT                   /number=2
FT   intron          68690..68757
FT                   /gene="Pc20g00260"
FT                   /locus_tag="PCH_Pc20g00260"
FT                   /number=2
FT   exon            68758..68912
FT                   /gene="Pc20g00260"
FT                   /locus_tag="PCH_Pc20g00260"
FT                   /number=3
FT   mRNA            complement(join(<69223..69546,69601..70375,70435..70552,
FT                   70613..>70739))
FT                   /gene="Pc20g00270"
FT                   /locus_tag="PCH_Pc20g00270"
FT   CDS_pept        complement(join(69223..69546,69601..70375,70435..70552,
FT                   70613..70739))
FT                   /gene="Pc20g00270"
FT                   /locus_tag="PCH_Pc20g00270"
FT                   /note="unknown EC_number=2.7.7.14"
FT                   /note="Title: similarity to CTP:phosphoethanolamine
FT                   cytidylyltransferase ET - Rattus norvegicus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85356"
FT                   /db_xref="GOA:B6HF38"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR041723"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF38"
FT                   /inference="protein motif:PFAM:PF01467"
FT                   /inference="protein motif:COGS:COG0615"
FT                   /inference="protein motif:COGS:COG0669"
FT                   /inference="protein motif:COGS:COG2870"
FT                   /protein_id="CAP85356.1"
FT                   /translation="MDSTPIEEQVPLPGKWPVDPQEDVPISEDRLWVDGCFDFSHHGHA
FT                   GAMLQARQLGKALYVGIHSDEAILENKGPTVMSLEERVAAVDACRWATQSVPHAPYVTY
FT                   LPWVSHYGCKYVVHGDDITSDSDGNDCYRFVKAAGRFRVVKRTPGISTTDLVGRMLLCT
FT                   RNHFVKSVKGTLAGLEGYGSPEERQASAKDLLRRIKDYATDESGLQPGPQVWTWTGSGT
FT                   AKMDHVVEEAGLFETLVDGKGPKPGQRVVYVDGGFDLFSSGHIAFLRKVTELEESEGRQ
FT                   RGWYEPDQVAKRLKDHGEDYGPSYIVAGIHDDDVINHWKGLNYPIMNIFERGLCVLQCR
FT                   YINAVIFSAPFTPSEPYLKAIPWGTPDAVYHGPTTFIPLTYDPYTAPKKMGIFREAEQH
FT                   AFQHVNAGEIVGRILKSREAYEARQRAKLDKAIAEDLVKSQEAAQAAQ"
FT   exon            complement(69223..69546)
FT                   /gene="Pc20g00270"
FT                   /locus_tag="PCH_Pc20g00270"
FT                   /number=1
FT   intron          complement(69547..69600)
FT                   /gene="Pc20g00270"
FT                   /locus_tag="PCH_Pc20g00270"
FT                   /number=1
FT   exon            complement(69601..70375)
FT                   /gene="Pc20g00270"
FT                   /locus_tag="PCH_Pc20g00270"
FT                   /number=2
FT   intron          complement(70376..70434)
FT                   /gene="Pc20g00270"
FT                   /locus_tag="PCH_Pc20g00270"
FT                   /number=2
FT   exon            complement(70435..70552)
FT                   /gene="Pc20g00270"
FT                   /locus_tag="PCH_Pc20g00270"
FT                   /number=3
FT   intron          complement(70553..70612)
FT                   /gene="Pc20g00270"
FT                   /locus_tag="PCH_Pc20g00270"
FT                   /number=3
FT   exon            complement(70613..70739)
FT                   /gene="Pc20g00270"
FT                   /locus_tag="PCH_Pc20g00270"
FT                   /number=4
FT   mRNA            join(<71099..71301,71363..>72116)
FT                   /gene="Pc20g00280"
FT                   /locus_tag="PCH_Pc20g00280"
FT   CDS_pept        join(71099..71301,71363..72116)
FT                   /gene="Pc20g00280"
FT                   /locus_tag="PCH_Pc20g00280"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   B11A5.90 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85357"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF39"
FT                   /protein_id="CAP85357.1"
FT                   /translation="MIPSTFAPGITRRDTAKSSGGHEGAYGIPPPVISGGGLLGPQSAG
FT                   AIYQHIHEMAAKRISTLDYLRKAHEGRVYWFNTVHFSRADIARLPYFEARKLSRRAINY
FT                   LLLGLSLPTILDVNSTPFEYVRALNALLMEFEAFQQVHPPDGSSSSTLARARIPQMFKR
FT                   AAHAGTKTRRASSANEIGLPMQSSDPSDLKSTAGNLGSASSASVTSFPLTESSDLHPGE
FT                   EYTYLLTPSLPFEPDFFETFATLCDVLIDTYSRLAALVSSPSVCTVALGETFSKADARL
FT                   RKIMVAGAVREFEDASRNSVKSEVAGVSRVVLGGLLG"
FT   exon            71099..71301
FT                   /gene="Pc20g00280"
FT                   /locus_tag="PCH_Pc20g00280"
FT                   /number=1
FT   intron          71302..71362
FT                   /gene="Pc20g00280"
FT                   /locus_tag="PCH_Pc20g00280"
FT                   /number=1
FT   exon            71363..72116
FT                   /gene="Pc20g00280"
FT                   /locus_tag="PCH_Pc20g00280"
FT                   /number=2
FT   mRNA            complement(join(<72590..73009,73073..>73225))
FT                   /gene="Pc20g00290"
FT                   /locus_tag="PCH_Pc20g00290"
FT   CDS_pept        complement(join(72590..73009,73073..73225))
FT                   /gene="Pc20g00290"
FT                   /locus_tag="PCH_Pc20g00290"
FT                   /note="Title: strong similarity to intramitochondrial
FT                   sorting protein YLR168c - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00290"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85358"
FT                   /db_xref="GOA:B6HF40"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="InterPro:IPR037365"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF40"
FT                   /inference="similar to AA sequence:PIR:S37758"
FT                   /inference="protein motif:PFAM:PF04707"
FT                   /protein_id="CAP85358.1"
FT                   /translation="MKVFSSGCTFDYSWDEVSTANWRKYCPWNDKSTHVVGVDTLSRTV
FT                   DPSTGILRTERLITCNQSVPQWVLSLLGGTNTSHVYEISYVDPVAKKVTMCSTNLTWSN
FT                   VLSVRETVIYRQSSLSPATTTEFSQEAKITALCGGWQKIKNKVEEASVDRFRENAKIGR
FT                   EGFETVLEMSRRVFGEQRELEKQRLQS"
FT   exon            complement(72590..73009)
FT                   /gene="Pc20g00290"
FT                   /locus_tag="PCH_Pc20g00290"
FT                   /number=1
FT   intron          complement(73010..73072)
FT                   /gene="Pc20g00290"
FT                   /locus_tag="PCH_Pc20g00290"
FT                   /number=1
FT   exon            complement(73073..73225)
FT                   /gene="Pc20g00290"
FT                   /locus_tag="PCH_Pc20g00290"
FT                   /number=2
FT   mRNA            join(<73759..74041,74151..>74500)
FT                   /gene="Pc20g00300"
FT                   /locus_tag="PCH_Pc20g00300"
FT   CDS_pept        join(73759..74041,74151..74500)
FT                   /gene="Pc20g00300"
FT                   /locus_tag="PCH_Pc20g00300"
FT                   /note="Title: similarity to derepression of telomeric
FT                   silencing protein Dot5 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00300"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85359"
FT                   /db_xref="GOA:B6HF41"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF41"
FT                   /inference="similar to AA sequence:PIR:S48445"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /inference="protein motif:COGS:COG0450"
FT                   /inference="protein motif:COGS:COG1225"
FT                   /protein_id="CAP85359.1"
FT                   /translation="MVELRKRKAPAPLLVAEKKTKQAPKPKQDADATDNDTEKRPAQKV
FT                   PEVDDIIDIETFSGEFETNEGEKTTLKKLLEESKSGVVFFTYPKASTPGCTKQACLFRD
FT                   NYTHLTSTGLSIYGLSGDSPKANTTFKTRQNLPYPLMCDPKATLIAAIGFKKSPKGTTR
FT                   GIFAVDKKGKVLLRAAGGPDATVDAVQKIVANAPSVEDSKEEGDETA"
FT   exon            73759..74041
FT                   /gene="Pc20g00300"
FT                   /locus_tag="PCH_Pc20g00300"
FT                   /number=1
FT   intron          74042..74150
FT                   /gene="Pc20g00300"
FT                   /locus_tag="PCH_Pc20g00300"
FT                   /number=1
FT   exon            74151..74500
FT                   /gene="Pc20g00300"
FT                   /locus_tag="PCH_Pc20g00300"
FT                   /number=2
FT   mRNA            complement(join(<74747..74934,74982..75226,75288..75726,
FT                   75774..>75834))
FT                   /gene="Pc20g00310"
FT                   /locus_tag="PCH_Pc20g00310"
FT   CDS_pept        complement(join(74747..74934,74982..75226,75288..75726,
FT                   75774..75834))
FT                   /gene="Pc20g00310"
FT                   /locus_tag="PCH_Pc20g00310"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   ncu09821.1 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00310"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85360"
FT                   /db_xref="GOA:B6HF42"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF42"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /inference="protein motif:COGS:COG1028"
FT                   /protein_id="CAP85360.1"
FT                   /translation="MPVTQSIEREASGSKSQFAPGHKIPVQHLKKPGLQSDLGDPKPVS
FT                   THIPTEDYGYQTYKAAGKLEGKKAIITGGDSGIGRAIAILFAMEGASSVIVYLPEEESD
FT                   AQTTKKRVEEHGQQCHTLAIDLRQKENCRKVINTALEKMGGIDILVNNAAFQDMLSDIS
FT                   ELEESQWEKTFNTNIHSFFYLSKYVLPHMKEGSTIINCASVNPYIGRGDLLDYTSTKGA
FT                   IVAFTRGLSNQQIKKGIRVNCVCPGPIWTPLIPATMQTEAMEQFHAVPIGRPGQPSEVA
FT                   TCFVFLASQDSSYISGQCLHPNGGMMVNG"
FT   exon            complement(74747..74934)
FT                   /gene="Pc20g00310"
FT                   /locus_tag="PCH_Pc20g00310"
FT                   /number=1
FT   intron          complement(74935..74981)
FT                   /gene="Pc20g00310"
FT                   /locus_tag="PCH_Pc20g00310"
FT                   /number=1
FT   exon            complement(74982..75226)
FT                   /gene="Pc20g00310"
FT                   /locus_tag="PCH_Pc20g00310"
FT                   /number=2
FT   intron          complement(75227..75287)
FT                   /gene="Pc20g00310"
FT                   /locus_tag="PCH_Pc20g00310"
FT                   /number=2
FT   exon            complement(75288..75726)
FT                   /gene="Pc20g00310"
FT                   /locus_tag="PCH_Pc20g00310"
FT                   /number=3
FT   intron          complement(75727..75773)
FT                   /gene="Pc20g00310"
FT                   /locus_tag="PCH_Pc20g00310"
FT                   /number=3
FT   exon            complement(75774..75834)
FT                   /gene="Pc20g00310"
FT                   /locus_tag="PCH_Pc20g00310"
FT                   /number=4
FT   mRNA            <76813..>78951
FT                   /gene="Pc20g00320"
FT                   /locus_tag="PCH_Pc20g00320"
FT   CDS_pept        76813..78951
FT                   /gene="Pc20g00320"
FT                   /locus_tag="PCH_Pc20g00320"
FT                   /note="Title: similarity to component of the U3 small
FT                   nucleolar ribonucleoprotein Mpp10 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00320"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85361"
FT                   /db_xref="GOA:B6HF43"
FT                   /db_xref="InterPro:IPR012173"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF43"
FT                   /inference="similar to AA sequence:PIR:S55189"
FT                   /inference="protein motif:PFAM:PF04006"
FT                   /inference="protein motif:COGS:COG5271"
FT                   /inference="protein motif:COGS:COG5384"
FT                   /inference="protein motif:COGS:COG3210"
FT                   /inference="protein motif:COGS:COG3468"
FT                   /inference="protein motif:COGS:COG5021"
FT                   /inference="protein motif:COGS:COG3264"
FT                   /protein_id="CAP85361.1"
FT                   /translation="MAKGQSKSKTVSASTAQASEQMPLSFALSSPWSFLRPTNDLHTNV
FT                   VDSAKHILDSLAGSVVDAQTARRQLNKKRKRSDLESDSVTQLQLKNLYVDGFTSNQIWE
FT                   QATRILQSTGDEIERDITLITQHGGYMESADSGQLEDISDPEGAQSDSDSQESMLEDLS
FT                   EGSGAEDDLDEGSDEEVDMGSDDDMEDIEDMDEDNSSVGSAEEEPEVFVEDKFGLNDGF
FT                   FSIDDFNKQSEALERQDAAGGPEQEDSDEEDLDWHSNPLIAGNAATIHDDDKSKNSRPT
FT                   EKEDESMDDSEEEGPTFGNADLNGDSDSDDEDAADMEDGEAAAWVNTSDIKYADFFAPP
FT                   PRKVSNKKHRALPKTQPDAPAIDESDVKRAMDDVRRDLFDDMDADSAEEEDENLDGSTD
FT                   PTAQRSTHEKQRARIADEIRRLEAANVAKKEWMYTGEARAVERPVNSLIEEDLEFERIG
FT                   KPVPVNTNETTEDIEELVKRRILAMEFDEVIRRRPGAEGQQAGRKPRFELDDTKPQQGL
FT                   AEMYETEHLRANDPNFVDTKDRKLMREHAEITSLWNELSSQLDTLCNWHYKPKVAQASI
FT                   NVVTDAPTIMMEEARPTAGGAAGGPVGLAPQEIYAPGDDGRVKGEVVLKTGASISKEEM
FT                   SREQKAKNRRQNKQTQKKADAAKPTQQKPGKAAEKQQMISDLKKGGVKVIDKEGRMTNI
FT                   DGGSVQEGAKNRGDNLKL"
FT   exon            76813..78951
FT                   /gene="Pc20g00320"
FT                   /locus_tag="PCH_Pc20g00320"
FT                   /number=1
FT   mRNA            complement(join(<79037..79514,79580..>79851))
FT                   /gene="Pc20g00330"
FT                   /locus_tag="PCH_Pc20g00330"
FT   CDS_pept        complement(join(79037..79514,79580..79851))
FT                   /gene="Pc20g00330"
FT                   /locus_tag="PCH_Pc20g00330"
FT                   /note="Title: strong similarity to hypothetical membrane
FT                   protein YNL024c - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00330"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85362"
FT                   /db_xref="GOA:B6HFD0"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR033684"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD0"
FT                   /inference="similar to AA sequence:PIR:S62936"
FT                   /inference="protein motif:COGS:COG3897"
FT                   /inference="protein motif:COGS:COG0500"
FT                   /inference="protein motif:COGS:COG2230"
FT                   /inference="protein motif:COGS:COG2226"
FT                   /inference="protein motif:COGS:COG2227"
FT                   /inference="protein motif:COGS:COG4123"
FT                   /inference="protein motif:COGS:COG2264"
FT                   /protein_id="CAP85362.1"
FT                   /translation="MIETPMTTPPGPELSPPSSPDGLKISESLAPPRELKAATTTDISF
FT                   DGLLKEPLLLKEDLKDGCGGQLWPAGMALAKYLLSRHAADLSDKTIVELGAGGGLVGLA
FT                   VARGCHLEQPIYITDQEPMFSLMKSNIQLNNLGPNATAAILNWGEPIPKQIPSKPNVII
FT                   AADCVYFEPAFPLLITTLQDLLGPNSVCYFCYKRRRRADMRFMKMAKKAFEMELVRDDP
FT                   GAEGYNRESIFIYTIRAKRLDQKSETR"
FT   exon            complement(79037..79514)
FT                   /gene="Pc20g00330"
FT                   /locus_tag="PCH_Pc20g00330"
FT                   /number=1
FT   intron          complement(79515..79579)
FT                   /gene="Pc20g00330"
FT                   /locus_tag="PCH_Pc20g00330"
FT                   /number=1
FT   exon            complement(79580..79851)
FT                   /gene="Pc20g00330"
FT                   /locus_tag="PCH_Pc20g00330"
FT                   /number=2
FT   mRNA            complement(join(<80608..80742,80801..81105,81164..>81179))
FT                   /gene="Pc20g00340"
FT                   /locus_tag="PCH_Pc20g00340"
FT   CDS_pept        complement(join(80608..80742,80801..81105,81164..81179))
FT                   /gene="Pc20g00340"
FT                   /locus_tag="PCH_Pc20g00340"
FT                   /note="Title: similarity to hypothetical protein
FT                   SPAC15E1.02c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85363"
FT                   /db_xref="GOA:B6HFD1"
FT                   /db_xref="InterPro:IPR013879"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD1"
FT                   /inference="similar to AA sequence:PIR:T37717"
FT                   /protein_id="CAP85363.1"
FT                   /translation="MTTLHYLPPVKPSAIALGTIFTHTASLGILAPVFGDTYHRAQAAN
FT                   SKEEFIKSKEAAGAAAAWGSSLAGSAVQTYGVAALINATGTLSYKGAAYLGTLIFFASS
FT                   APGIVSQVFSEKRPLDTIAVGAVSRVFETVGLSLFLTWWGTRTHPFD"
FT   exon            complement(80608..80742)
FT                   /gene="Pc20g00340"
FT                   /locus_tag="PCH_Pc20g00340"
FT                   /number=1
FT   mat_peptide     complement(join(80611..80742,80801..81016))
FT                   /gene="Pc20g00340"
FT                   /locus_tag="PCH_Pc20g00340"
FT   intron          complement(80743..80800)
FT                   /gene="Pc20g00340"
FT                   /locus_tag="PCH_Pc20g00340"
FT                   /number=1
FT   exon            complement(80801..81105)
FT                   /gene="Pc20g00340"
FT                   /locus_tag="PCH_Pc20g00340"
FT                   /number=2
FT   sig_peptide     complement(join(81017..81105,81164..81179))
FT                   /gene="Pc20g00340"
FT                   /locus_tag="PCH_Pc20g00340"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(81106..81163)
FT                   /gene="Pc20g00340"
FT                   /locus_tag="PCH_Pc20g00340"
FT                   /number=2
FT   exon            complement(81164..81179)
FT                   /gene="Pc20g00340"
FT                   /locus_tag="PCH_Pc20g00340"
FT                   /number=3
FT   mRNA            complement(join(<82109..82133,82187..82695,82771..>82830))
FT                   /gene="Pc20g00350"
FT                   /locus_tag="PCH_Pc20g00350"
FT   CDS_pept        complement(join(82109..82133,82187..82695,82771..82830))
FT                   /gene="Pc20g00350"
FT                   /locus_tag="PCH_Pc20g00350"
FT                   /note="unknown EC_number=1.6.5.3"
FT                   /note="Title: strong similarity to 21/29 kD subunit of
FT                   NADH:ubiquinone reductase - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85364"
FT                   /db_xref="InterPro:IPR016813"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD2"
FT                   /inference="similar to AA sequence:PIR:A34051"
FT                   /protein_id="CAP85364.1"
FT                   /translation="MARGIVNAAKSASNAISINQKYSVQSTGVWERIRRLLAIAPERST
FT                   GVPLNAQYRLPTPGSVPPLAYDDPVTLPAGDIADNPYWKRDVRRSYPQLSTVRQADAVG
FT                   LLTVGSQAAPKEDVLKIGQAGEQQLVAVKEQGEERGLAALFEQDKKSVQGVLGANGLPP
FT                   NPCNINAAPKPSQSKYELGTENGYPEKYTCRTFV"
FT   exon            complement(82109..82133)
FT                   /gene="Pc20g00350"
FT                   /locus_tag="PCH_Pc20g00350"
FT                   /number=1
FT   intron          complement(82134..82186)
FT                   /gene="Pc20g00350"
FT                   /locus_tag="PCH_Pc20g00350"
FT                   /number=1
FT   exon            complement(82187..82695)
FT                   /gene="Pc20g00350"
FT                   /locus_tag="PCH_Pc20g00350"
FT                   /number=2
FT   intron          complement(82696..82770)
FT                   /gene="Pc20g00350"
FT                   /locus_tag="PCH_Pc20g00350"
FT                   /number=2
FT   exon            complement(82771..82830)
FT                   /gene="Pc20g00350"
FT                   /locus_tag="PCH_Pc20g00350"
FT                   /number=3
FT   mRNA            complement(join(<84203..84642,84711..85199,85259..85647,
FT                   85704..85864,85920..85926,85982..>86175))
FT                   /gene="Dip5"
FT                   /locus_tag="PCH_Pc20g00360"
FT   CDS_pept        complement(join(84203..84642,84711..85199,85259..85647,
FT                   85704..85864,85920..85926,85982..86175))
FT                   /gene="Dip5"
FT                   /locus_tag="PCH_Pc20g00360"
FT                   /product="dicarboxylic amino acid permease Dip5-Penicillium
FT                   chrysogenum"
FT                   /note="Gene-ID: Dip5"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00360"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85365"
FT                   /db_xref="GOA:B6HFD3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD3"
FT                   /inference="similar to AA sequence:TREMBLNEW:AY456273.1"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /inference="protein motif:COGS:COG0833"
FT                   /protein_id="CAP85365.1"
FT                   /translation="MGHPDEINALEAQPGYVDNLGDFKESEQDEPVQLHRELKARHISM
FT                   IAIGGAIGTGLVVGTGSALTAGPGSLFIAYCFMGFVVWTVMCGLGEMAAWLPLSSGFTG
FT                   YAGRFCDPALGFTLGWCYYLKYIILPPTQLTAAALVITYWPRTSAENVNPGVWIAIFMV
FT                   AIIVINYFGVKIFGELEFWLSSFKVIVILGLILCSLIFALGGGPDHDRRGFRYWNKPGA
FT                   FATKYTDGALGKFLAFWSTMVQATFAFLGTELIGVTVGEAQNPRKTIPKAIKLTFWRII
FT                   VFYILSVLFLGMLVPYDSKELAFATEAESSAAASPFVVAMGQVAALPHIINGCILVFVF
FT                   SAANSDLYIATRTLYGLAREKKAPKIFARTNRAGVPIYSLALSASFCLLAFMSVSSTSK
FT                   EVFGYFTDMVSIFGLLTWVSLLITHIFFIRARRAQGVDQATLAYKAPLGIIGSCIALFF
FT                   CVLVLFTRSFGVFIHDPETYGNFDYKTFITSYIGIPLYVAAFAGWKIWNKTEIIKPHNA
FT                   DIWTGKAEIDREEAEYVAMVAIQDQNLSGWNKVYRKSLAWLF"
FT   exon            complement(84203..84642)
FT                   /gene="Dip5"
FT                   /locus_tag="PCH_Pc20g00360"
FT                   /number=1
FT   intron          complement(84643..84710)
FT                   /gene="Dip5"
FT                   /locus_tag="PCH_Pc20g00360"
FT                   /number=1
FT   exon            complement(84711..85199)
FT                   /gene="Dip5"
FT                   /locus_tag="PCH_Pc20g00360"
FT                   /number=2
FT   intron          complement(85200..85258)
FT                   /gene="Dip5"
FT                   /locus_tag="PCH_Pc20g00360"
FT                   /number=2
FT   exon            complement(85259..85647)
FT                   /gene="Dip5"
FT                   /locus_tag="PCH_Pc20g00360"
FT                   /number=3
FT   intron          complement(85648..85703)
FT                   /gene="Dip5"
FT                   /locus_tag="PCH_Pc20g00360"
FT                   /number=3
FT   exon            complement(85704..85864)
FT                   /gene="Dip5"
FT                   /locus_tag="PCH_Pc20g00360"
FT                   /number=4
FT   intron          complement(85865..85919)
FT                   /gene="Dip5"
FT                   /locus_tag="PCH_Pc20g00360"
FT                   /number=4
FT   exon            complement(85920..85926)
FT                   /gene="Dip5"
FT                   /locus_tag="PCH_Pc20g00360"
FT                   /number=5
FT   intron          complement(85927..85981)
FT                   /gene="Dip5"
FT                   /locus_tag="PCH_Pc20g00360"
FT                   /number=5
FT   exon            complement(85982..86175)
FT                   /gene="Dip5"
FT                   /locus_tag="PCH_Pc20g00360"
FT                   /number=6
FT   mRNA            complement(join(<87131..87150,87183..87345,87407..87476,
FT                   87539..87655,87826..>87836))
FT                   /gene="Pc20g00370"
FT                   /locus_tag="PCH_Pc20g00370"
FT   CDS_pept        complement(join(87131..87150,87183..87345,87407..87476,
FT                   87539..87655,87826..87836))
FT                   /gene="Pc20g00370"
FT                   /locus_tag="PCH_Pc20g00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85366"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD4"
FT                   /protein_id="CAP85366.1"
FT                   /translation="MTQNLIMILTTLLNNTNVYISVHMVNIPLSVVSLSCPTGLSSIAI
FT                   YLGNYLGTRGHDNIIWNRRREISPSSRDYDKEVLAGHKPREGGFGVWGFNSYKIHSPRE
FT                   AAKSLHSIFERELPIQHFLRTL"
FT   exon            complement(87131..87150)
FT                   /gene="Pc20g00370"
FT                   /locus_tag="PCH_Pc20g00370"
FT                   /number=1
FT   intron          complement(87151..87182)
FT                   /gene="Pc20g00370"
FT                   /locus_tag="PCH_Pc20g00370"
FT                   /number=1
FT   exon            complement(87183..87345)
FT                   /gene="Pc20g00370"
FT                   /locus_tag="PCH_Pc20g00370"
FT                   /number=2
FT   intron          complement(87346..87406)
FT                   /gene="Pc20g00370"
FT                   /locus_tag="PCH_Pc20g00370"
FT                   /number=2
FT   exon            complement(87407..87476)
FT                   /gene="Pc20g00370"
FT                   /locus_tag="PCH_Pc20g00370"
FT                   /number=3
FT   intron          complement(87477..87538)
FT                   /gene="Pc20g00370"
FT                   /locus_tag="PCH_Pc20g00370"
FT                   /number=3
FT   exon            complement(87539..87655)
FT                   /gene="Pc20g00370"
FT                   /locus_tag="PCH_Pc20g00370"
FT                   /number=4
FT   intron          complement(87656..87825)
FT                   /gene="Pc20g00370"
FT                   /locus_tag="PCH_Pc20g00370"
FT                   /number=4
FT   exon            complement(87826..87836)
FT                   /gene="Pc20g00370"
FT                   /locus_tag="PCH_Pc20g00370"
FT                   /number=5
FT   mRNA            join(<87884..87895,88027..88201,88275..88358,88401..88567,
FT                   88606..88997,89046..89215,89270..>89504)
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT   CDS_pept        join(87884..87895,88027..88201,88275..88358,88401..88567,
FT                   88606..88997,89046..89215,89270..89504)
FT                   /pseudo
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /note="submitted as non-pseudo"
FT                   /note="unknown EC_number=2.3.2.2"
FT                   /note="Title: similarity to gamma-glutamyl transpeptidase
FT                   GGT1 - Homo sapiens"
FT                   /inference="similar to AA sequence:PIR:EKHUEX"
FT                   /inference="protein motif:PFAM:PF01019"
FT                   /inference="protein motif:COGS:COG0405"
FT   exon            87884..87895
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /number=1
FT   intron          87896..88026
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /number=1
FT   exon            88027..88201
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /number=2
FT   intron          88202..88274
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /number=2
FT   exon            88275..88358
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /number=3
FT   intron          88359..88400
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /number=3
FT   exon            88401..88567
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /number=4
FT   intron          88568..88605
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /number=4
FT   exon            88606..88997
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /number=5
FT   intron          88998..89045
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /number=5
FT   exon            89046..89215
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /number=6
FT   intron          89216..89269
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /number=6
FT   exon            89270..89504
FT                   /gene="Pc20g00380"
FT                   /locus_tag="PCH_Pc20g00380"
FT                   /number=7
FT   mRNA            complement(join(<89756..89850,89909..90264,90331..90529,
FT                   90583..>90625))
FT                   /gene="Pc20g00390"
FT                   /locus_tag="PCH_Pc20g00390"
FT   CDS_pept        complement(join(89756..89850,89909..90264,90331..90529,
FT                   90583..90625))
FT                   /gene="Pc20g00390"
FT                   /locus_tag="PCH_Pc20g00390"
FT                   /note="unknown EC_number=1.6.5.3"
FT                   /note="Title: strong similarity to 19.3 kD subunit of
FT                   NADH:ubiquinone reductase PSST - Bos taurus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00390"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85368"
FT                   /db_xref="GOA:B6HFD5"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD5"
FT                   /inference="similar to AA sequence:PIR:S22371"
FT                   /inference="protein motif:PFAM:PF01058"
FT                   /inference="protein motif:COGS:COG0377"
FT                   /protein_id="CAP85368.1"
FT                   /translation="MFPMAKPAISGALSAARPRFVASLPRAQPLAALSTSSIKSATALE
FT                   RQPSASAQQLTASGKARREVPLPSQEKKEGAMQYALTTLDQIANWARQSSLWPMTFGLA
FT                   CCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRW
FT                   VISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTSEALMYGIFQLQKKMRHTR
FT                   ITRMWYRR"
FT   exon            complement(89756..89850)
FT                   /gene="Pc20g00390"
FT                   /locus_tag="PCH_Pc20g00390"
FT                   /number=1
FT   mat_peptide     complement(join(89759..89850,89909..90264,90331..90443))
FT                   /gene="Pc20g00390"
FT                   /locus_tag="PCH_Pc20g00390"
FT   intron          complement(89851..89908)
FT                   /gene="Pc20g00390"
FT                   /locus_tag="PCH_Pc20g00390"
FT                   /number=1
FT   exon            complement(89909..90264)
FT                   /gene="Pc20g00390"
FT                   /locus_tag="PCH_Pc20g00390"
FT                   /number=2
FT   intron          complement(90265..90330)
FT                   /gene="Pc20g00390"
FT                   /locus_tag="PCH_Pc20g00390"
FT                   /number=2
FT   exon            complement(90331..90529)
FT                   /gene="Pc20g00390"
FT                   /locus_tag="PCH_Pc20g00390"
FT                   /number=3
FT   sig_peptide     complement(join(90444..90529,90583..90625))
FT                   /gene="Pc20g00390"
FT                   /locus_tag="PCH_Pc20g00390"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(90530..90582)
FT                   /gene="Pc20g00390"
FT                   /locus_tag="PCH_Pc20g00390"
FT                   /number=3
FT   exon            complement(90583..90625)
FT                   /gene="Pc20g00390"
FT                   /locus_tag="PCH_Pc20g00390"
FT                   /number=4
FT   mRNA            join(<91003..91115,91151..91661,91733..>91921)
FT                   /gene="Pc20g00400"
FT                   /locus_tag="PCH_Pc20g00400"
FT   CDS_pept        join(91003..91115,91151..91661,91733..91921)
FT                   /gene="Pc20g00400"
FT                   /locus_tag="PCH_Pc20g00400"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1412_scaffold_7.tfa_160wg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85369"
FT                   /db_xref="GOA:B6HFD6"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD6"
FT                   /protein_id="CAP85369.1"
FT                   /translation="MPERVSPLPRGIGTTTPLLSTLLQSTRPLKGLLNSRALLELPPDH
FT                   SVQTRESVLNSKEPKWSRPVRIHCYLKSYYGNGGSQNCLHWRDWESSTHPYHLVPLELS
FT                   VLTRLQDNPLHISLFPPYSDSTIEFSFLLNSCLDIFDIRCKQTSIDQDLGLLHAIDERL
FT                   AAYGWLTTTGVKLLIIVDLFGQEEASAGKQAGAAINGLRDSDVKPAFRALQSAYIQLLQ
FT                   NPFYSPDDHVPIPGNTASSLSACQPISNKKFIADVKRIGDSWAPGSSL"
FT   exon            91003..91115
FT                   /gene="Pc20g00400"
FT                   /locus_tag="PCH_Pc20g00400"
FT                   /number=1
FT   intron          91116..91150
FT                   /gene="Pc20g00400"
FT                   /locus_tag="PCH_Pc20g00400"
FT                   /number=1
FT   exon            91151..91661
FT                   /gene="Pc20g00400"
FT                   /locus_tag="PCH_Pc20g00400"
FT                   /number=2
FT   intron          91662..91732
FT                   /gene="Pc20g00400"
FT                   /locus_tag="PCH_Pc20g00400"
FT                   /number=2
FT   exon            91733..91921
FT                   /gene="Pc20g00400"
FT                   /locus_tag="PCH_Pc20g00400"
FT                   /number=3
FT   mRNA            complement(join(<92130..93196,93257..>93404))
FT                   /gene="Pc20g00410"
FT                   /locus_tag="PCH_Pc20g00410"
FT   CDS_pept        complement(join(92130..93196,93257..93404))
FT                   /gene="Pc20g00410"
FT                   /locus_tag="PCH_Pc20g00410"
FT                   /note="unknown EC_number=2.3.1.39"
FT                   /note="Title: strong similarity to S-malonyltransferase
FT                   fabD - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85370"
FT                   /db_xref="GOA:B6HFD7"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD7"
FT                   /inference="similar to AA sequence:PIR:H69620"
FT                   /inference="protein motif:PFAM:PF00698"
FT                   /inference="protein motif:COGS:COG0331"
FT                   /inference="protein motif:COGS:COG3321"
FT                   /protein_id="CAP85370.1"
FT                   /translation="MLSRLHPRGHLRQRSIVHVTLQVLATRSRPTNPNLLPSRRDLHTA
FT                   LFFPGHGVQRVGMANSWIESFPNTAAKVLDEMDSTLGFKLSSIISDGPNSKLNKTENSQ
FT                   PAVMAISVLILRILEQEFGFNTKSRVDVTLGHSLGEFSALVAGGYLEFGDALKLVRGRA
FT                   EMMARCTRQLSEQSGESYGMVALLCEPEHLEGLLRTVQDFVGPESPGIEIDRDNRVPLI
FT                   QQVVVANINSKNQIVLSGSLDRIKILLVQMRQFGGHDPRAVRLKSDSPFHSPAMALAAD
FT                   YMRDAVENISITFPASIPCISNVSALPFQSKEDIRDLLSRQCIETVRWWDSIRYLHQER
FT                   GVRRWIGIGPGKVGRNLVGKEVGRVNTKGGGVWAVCDPREMSEIMVALEQTEAETGDTQ
FT                   PELAG"
FT   exon            complement(92130..93196)
FT                   /gene="Pc20g00410"
FT                   /locus_tag="PCH_Pc20g00410"
FT                   /number=1
FT   mat_peptide     complement(join(92133..93196,93257..93320))
FT                   /gene="Pc20g00410"
FT                   /locus_tag="PCH_Pc20g00410"
FT   intron          complement(93197..93256)
FT                   /gene="Pc20g00410"
FT                   /locus_tag="PCH_Pc20g00410"
FT                   /number=1
FT   exon            complement(93257..93404)
FT                   /gene="Pc20g00410"
FT                   /locus_tag="PCH_Pc20g00410"
FT                   /number=2
FT   sig_peptide     complement(93321..93404)
FT                   /gene="Pc20g00410"
FT                   /locus_tag="PCH_Pc20g00410"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            <94327..>98433
FT                   /gene="Pc20g00420"
FT                   /locus_tag="PCH_Pc20g00420"
FT   CDS_pept        94327..98433
FT                   /gene="Pc20g00420"
FT                   /locus_tag="PCH_Pc20g00420"
FT                   /note="Title: similarity to nuclear pore protein Nup133
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85371"
FT                   /db_xref="GOA:B6HFD8"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="InterPro:IPR037624"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD8"
FT                   /inference="similar to AA sequence:PIR:S38160"
FT                   /inference="protein motif:PFAM:PF04044"
FT                   /protein_id="CAP85371.1"
FT                   /translation="MFVPKAGGRNTRRRQRTSSDDSVKPPKAKRQRSVLRRPDESPSDT
FT                   NLGRELAKLATPTTPNGDIAPTDQMSELHLSTRVVKQGDVSGNNNEGTVVLVGYFISLR
FT                   VPSDSQVQTANLLGSKSSTDFYTVDQLPSLPDQIRGLQSGISNSIAFSHLGLRFVDTHP
FT                   LNAEPLKCFFGPGHDHALALTRSHAIVWPYSAPASSPSPSETFTVSIPESCRDPKGAVP
FT                   LGVLLSTATGDHPGLLVIIPSTGKVVYWETVSSAASLGLSRQKQNGIQGSTPGMLSGEY
FT                   ATDILNGEPSGIIVTFSSGRVAHITLRDPQGKPSVLVNFLRSTAGTGGGGIFGGLKNVF
FT                   AGGSWRKEVTAVRAGGSHQRGQRDVIIATSTGLVEIWDTHWNHGNTLKKRYDLKEEILA
FT                   ALPEYHAQPTNDTELKVADFAFSTLQSSDDAVQLSDGSWRLFLVVRSPQWLETRALFVA
FT                   QVHLSGNESRVMSTHAVDLRHIPASQLETSKPKIFVPKPEETAFILIGQSLVILSLTSV
FT                   EESPSSQLLLDSNKLPLPFQDTIHLRSGTDHEILGSMSEDQSNDSPCAACVLMLRNFGV
FT                   IRVTVLPRPGIEQDVDEPQVTAKHKLEQAVFFGTMAKNPLNLSSEGDLNFPPSEMEQAS
FT                   LEICRELLQSETRFIPTTAISLEQNLRLRAKALDDLASLLSRQGNPVSRPARWELLWAA
FT                   EKIAAQRAMWKVQEACKIKNGEEGPFLSHVIASMHDKFKTPINPQQGETDPVRQWFLRD
FT                   SYRMEHIIPWIKNAIKLGRSNTSNPARALSEKILAASELFLAVTETAFRYRDEHVALYG
FT                   LRGDFLEDGVLSDGYEDLPEFWTSRGVGYSEAGHLLDLELDSCRSWKTPASAADAPDTH
FT                   VLNQVAKNSYRHLRVIGQMHLERTRWLSAQGDPKLMDESVSIEQAHVEDRKWQLFKLAG
FT                   IDHLADAVELAESFRDMGALVELIIELQDQKATQHPQPPSDVSTNQTDIDADQLIAKYF
FT                   DKFGDIWADAYFSRQIAMGYPGTLFTMRKYQSAVTRFLRSNPAYSRLSWINDVIGEDDY
FT                   DTAATSLEDLAIGSEKDLWSHRVEISLAKLGKLATKERMDSPVVASTLQEDVKRLDDYV
FT                   EVDGIQDILYSHIQPILQGAIDRKAELELVLDQCGEHIFEDRPSLHEILSDALFTLIER
FT                   QVVGADGLIDILTLMGPAQLADDTEGELVRSEFHLALQVLDYGRYGQRDPSYLTALRRL
FT                   IWRRCLIKDDWVARGKAAEGPNGNASNLVADTTLYRSLTACLEGDFVPNINTWTIELTS
FT                   VPCLEPRNAGLHSLYTPLSPAEALMTDSDSDILVSRFRPEQKSRVASDLQTENDILRQC
FT                   IEVGKLDFWFQNLRETAEVHISPPE"
FT   exon            94327..98433
FT                   /gene="Pc20g00420"
FT                   /locus_tag="PCH_Pc20g00420"
FT                   /number=1
FT   mRNA            complement(join(<98838..99087,99147..99297,99409..>99541))
FT                   /gene="Pc20g00430"
FT                   /locus_tag="PCH_Pc20g00430"
FT   CDS_pept        complement(join(98838..99087,99147..99297,99409..99541))
FT                   /gene="Pc20g00430"
FT                   /locus_tag="PCH_Pc20g00430"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg00777.1 - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85372"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD9"
FT                   /protein_id="CAP85372.1"
FT                   /translation="MRSRVLPPLDCMIPSPVSFCFSSFHLFWDTIHHLPSHQTSTLTPM
FT                   TRSHKSNDREHQAEGMMGTRENIPRYFAKSGPTDADPRKTKKDGGGKGNWGRSGEEMQD
FT                   TDYSFANARRRSNSSTQGLADFNTKFEAFEPEPVFEEEAFDGADMTAGNDNTVTKVESA
FT                   SSNGSQADHVGRKY"
FT   exon            complement(98838..99087)
FT                   /gene="Pc20g00430"
FT                   /locus_tag="PCH_Pc20g00430"
FT                   /number=1
FT   intron          complement(99088..99146)
FT                   /gene="Pc20g00430"
FT                   /locus_tag="PCH_Pc20g00430"
FT                   /number=1
FT   exon            complement(99147..99297)
FT                   /gene="Pc20g00430"
FT                   /locus_tag="PCH_Pc20g00430"
FT                   /number=2
FT   intron          complement(99298..99408)
FT                   /gene="Pc20g00430"
FT                   /locus_tag="PCH_Pc20g00430"
FT                   /number=2
FT   exon            complement(99409..99541)
FT                   /gene="Pc20g00430"
FT                   /locus_tag="PCH_Pc20g00430"
FT                   /number=3
FT   mRNA            complement(join(<100966..101109,101176..101677,
FT                   101741..101766,101819..101903,102012..>102025))
FT                   /gene="Pc20g00440"
FT                   /locus_tag="PCH_Pc20g00440"
FT   CDS_pept        complement(join(100966..101109,101176..101677,
FT                   101741..101766,101819..101903,102012..102025))
FT                   /gene="Pc20g00440"
FT                   /locus_tag="PCH_Pc20g00440"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the small subunit Rp10b - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85373"
FT                   /db_xref="GOA:B6HFE0"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="InterPro:IPR027500"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HFE0"
FT                   /inference="similar to AA sequence:SWISSPROT:RS3B_YEAST"
FT                   /inference="protein motif:PFAM:PF01015"
FT                   /inference="protein motif:COGS:COG1890"
FT                   /protein_id="CAP85373.1"
FT                   /translation="MAVGKNKRLSKGKKGIKKRTVDPFTRKDEYSVKAPSTFQTRDVGK
FT                   TLVNRTSGLKNANDSLKGRIFEVSLADLQNDEDHAFRKVKLRVDEIQGKNCLTNFHGLD
FT                   FTTDKLRSLVRKWQSLIEANITVKTTDDYLLRLFAIAFTKRRPNQIKKTTYARSSQIRA
FT                   IRKKMTEIIQREASTCTLSQLTHKLIPEVIGREIEKSTQGIYPLQNVHIRKVKLLKSPK
FT                   FDLGALLALHGESATDDKGQKVEREFKETVLESV"
FT   exon            complement(100966..101109)
FT                   /gene="Pc20g00440"
FT                   /locus_tag="PCH_Pc20g00440"
FT                   /number=1
FT   intron          complement(101110..101175)
FT                   /gene="Pc20g00440"
FT                   /locus_tag="PCH_Pc20g00440"
FT                   /number=1
FT   exon            complement(101176..101677)
FT                   /gene="Pc20g00440"
FT                   /locus_tag="PCH_Pc20g00440"
FT                   /number=2
FT   intron          complement(101678..101740)
FT                   /gene="Pc20g00440"
FT                   /locus_tag="PCH_Pc20g00440"
FT                   /number=2
FT   exon            complement(101741..101766)
FT                   /gene="Pc20g00440"
FT                   /locus_tag="PCH_Pc20g00440"
FT                   /number=3
FT   intron          complement(101767..101818)
FT                   /gene="Pc20g00440"
FT                   /locus_tag="PCH_Pc20g00440"
FT                   /number=3
FT   exon            complement(101819..101903)
FT                   /gene="Pc20g00440"
FT                   /locus_tag="PCH_Pc20g00440"
FT                   /number=4
FT   intron          complement(101904..102011)
FT                   /gene="Pc20g00440"
FT                   /locus_tag="PCH_Pc20g00440"
FT                   /number=4
FT   exon            complement(102012..102025)
FT                   /gene="Pc20g00440"
FT                   /locus_tag="PCH_Pc20g00440"
FT                   /number=5
FT   mRNA            join(<102765..102767,102844..102888,102944..103082,
FT                   103148..>103326)
FT                   /gene="Pc20g00450"
FT                   /locus_tag="PCH_Pc20g00450"
FT   CDS_pept        join(102765..102767,102844..102888,102944..103082,
FT                   103148..103326)
FT                   /gene="Pc20g00450"
FT                   /locus_tag="PCH_Pc20g00450"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPAC1B3.02c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85374"
FT                   /db_xref="GOA:B6HFE1"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="InterPro:IPR038567"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE1"
FT                   /inference="similar to AA sequence:PIR:T38020"
FT                   /inference="protein motif:PFAM:PF05129"
FT                   /inference="protein motif:COGS:COG4888"
FT                   /protein_id="CAP85374.1"
FT                   /translation="MGKRKKSSSKPQGPRKREPLATTFSCLFCNHENSVVVKLDKKLGL
FT                   GDLSCKVCGQKFQTGINYLSAPVDVYSDWVDACDAVAKDTANQYDAPNPSQLGQRGISK
FT                   QAIPEETGQDDGYDDDY"
FT   exon            102765..102767
FT                   /gene="Pc20g00450"
FT                   /locus_tag="PCH_Pc20g00450"
FT                   /number=1
FT   intron          102768..102843
FT                   /gene="Pc20g00450"
FT                   /locus_tag="PCH_Pc20g00450"
FT                   /number=1
FT   exon            102844..102888
FT                   /gene="Pc20g00450"
FT                   /locus_tag="PCH_Pc20g00450"
FT                   /number=2
FT   intron          102889..102943
FT                   /gene="Pc20g00450"
FT                   /locus_tag="PCH_Pc20g00450"
FT                   /number=2
FT   exon            102944..103082
FT                   /gene="Pc20g00450"
FT                   /locus_tag="PCH_Pc20g00450"
FT                   /number=3
FT   intron          103083..103147
FT                   /gene="Pc20g00450"
FT                   /locus_tag="PCH_Pc20g00450"
FT                   /number=3
FT   exon            103148..103326
FT                   /gene="Pc20g00450"
FT                   /locus_tag="PCH_Pc20g00450"
FT                   /number=4
FT   mRNA            complement(join(<103668..103719,103774..103945,
FT                   104003..104361,104422..>104579))
FT                   /gene="Pc20g00460"
FT                   /locus_tag="PCH_Pc20g00460"
FT   CDS_pept        complement(join(103668..103719,103774..103945,
FT                   104003..104361,104422..104579))
FT                   /gene="Pc20g00460"
FT                   /locus_tag="PCH_Pc20g00460"
FT                   /note="unknown EC_number=2.4.2.9"
FT                   /note="Title: strong similarity to uracil
FT                   phosphoribosyltransferase Fur1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85375"
FT                   /db_xref="GOA:B6HFE2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE2"
FT                   /inference="similar to AA sequence:PIR:JH0147"
FT                   /inference="protein motif:COGS:COG0035"
FT                   /protein_id="CAP85375.1"
FT                   /translation="MASKPESGPSPAQGVGPLYRPDGEKPTATVSKEVSYDNVHVLPQT
FT                   PQLIALLTMIRDKRTSRADFIFYSNRIIRLLVEEGLNHLPVVEQSITTPVGRSYLGVKF
FT                   EGKICGVSIMRAGEAMEQGLRDCCRSVRIGKILIQRDEESCMPKLFYDKLPSDIADRWV
FT                   LLLDPMFATGGSATLAVETLIERGVPEHRILFLNLIASPSGVAEFAERFPKLRVVTSFI
FT                   DQGLDEKKYIIPGLGDFGDRYYSM"
FT   exon            complement(103668..103719)
FT                   /gene="Pc20g00460"
FT                   /locus_tag="PCH_Pc20g00460"
FT                   /number=1
FT   intron          complement(103720..103773)
FT                   /gene="Pc20g00460"
FT                   /locus_tag="PCH_Pc20g00460"
FT                   /number=1
FT   exon            complement(103774..103945)
FT                   /gene="Pc20g00460"
FT                   /locus_tag="PCH_Pc20g00460"
FT                   /number=2
FT   intron          complement(103946..104002)
FT                   /gene="Pc20g00460"
FT                   /locus_tag="PCH_Pc20g00460"
FT                   /number=2
FT   exon            complement(104003..104361)
FT                   /gene="Pc20g00460"
FT                   /locus_tag="PCH_Pc20g00460"
FT                   /number=3
FT   intron          complement(104362..104421)
FT                   /gene="Pc20g00460"
FT                   /locus_tag="PCH_Pc20g00460"
FT                   /number=3
FT   exon            complement(104422..104579)
FT                   /gene="Pc20g00460"
FT                   /locus_tag="PCH_Pc20g00460"
FT                   /number=4
FT   mRNA            join(<105210..107396,107458..>107736)
FT                   /gene="Pc20g00470"
FT                   /locus_tag="PCH_Pc20g00470"
FT   CDS_pept        join(105210..107396,107458..107736)
FT                   /gene="Pc20g00470"
FT                   /locus_tag="PCH_Pc20g00470"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An17g02360 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85376"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR022771"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE3"
FT                   /protein_id="CAP85376.1"
FT                   /translation="MDNSHPRNRRLVTYGSAAKSQPPSNTEKTVRSSATRTTSKEMPLP
FT                   SSSRPSRPVYTRLQRDKNGDKQLSGPAKTTTARGVTQPKPITEANVYDFPSSDDEQMSM
FT                   IQRKRRRYSPNGNKAVPATKRSAKPSETGNGVHNVSPPMGKRGSDGRRPLAKKLEADER
FT                   TSSVASTSYSRPGRSVRNQTKLPTVENEMGVSTAEGLGDGESIRKSSPDINQGYATKAN
FT                   VTPGRRRLIDSLGITQSPVETSPAVETPLESPADSQPPPDPTTPDRASPSAAVNECPAE
FT                   SHVQDSPASVPSHLRGSRVTYARQRSFLDDLIMSEDLSTHNASSGLRHRSQSVQRQLNY
FT                   EATSSARLIVPNEDTNDDGSVRSIHELRQAGGNARYRGAVESIFEDIEDSQNSLTGRCN
FT                   AFLQLCGKLLDTGLKRRFVECNFDKRLVDCLSMDLQVVPTILAFCAYALGSSDGHMSYV
FT                   LATSAWPKLQEASPALLGMHDDIPVAARAQASGLSRPLQKTIQNTIPQIAAMLFPDTAL
FT                   SKLSPCILALYCLRSTMSTTQTKGENPSLSKSLLKPLVQALVLEGQRCASLGKIHPESS
FT                   EILCMGFSILESSTALAESFTKDHWDILDPLSELHSLLCLESGTAGQIQLLYIRLILNV
FT                   TNSNPSLCDRFATPEMVGGLVRIVSAKFGDLTEDALGQANSSLDSVILALGALINLTEQ
FT                   SEASRSIFLHSADSSKLFLDQLLHLFMTRVDSISTAHSVLEVHHNVAVGYLAVLLLTLS
FT                   LDPATRSKIKSSLAPNGLTTVISTVDEFLQYHQKIEQEISTSPTQGQPASGFLSRLQEL
FT                   ITRIRLAEQ"
FT   exon            105210..107396
FT                   /gene="Pc20g00470"
FT                   /locus_tag="PCH_Pc20g00470"
FT                   /number=1
FT   intron          107397..107457
FT                   /gene="Pc20g00470"
FT                   /locus_tag="PCH_Pc20g00470"
FT                   /number=1
FT   exon            107458..107736
FT                   /gene="Pc20g00470"
FT                   /locus_tag="PCH_Pc20g00470"
FT                   /number=2
FT   mRNA            join(<108359..108413,108485..108624,108677..108805,
FT                   108866..>109105)
FT                   /gene="Pc20g00480"
FT                   /locus_tag="PCH_Pc20g00480"
FT   CDS_pept        join(108359..108413,108485..108624,108677..108805,
FT                   108866..109105)
FT                   /gene="Pc20g00480"
FT                   /locus_tag="PCH_Pc20g00480"
FT                   /note="Title: strong similarity to ras-related GTP-binding
FT                   protein rheb - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85377"
FT                   /db_xref="GOA:B6HFN7"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN7"
FT                   /inference="similar to AA sequence:TREMBL:HSD132.1"
FT                   /inference="protein motif:PFAM:PF00071"
FT                   /inference="protein motif:COGS:COG0532"
FT                   /protein_id="CAP85377.1"
FT                   /translation="MPSAPKQRKIAIVGSRSVGKSSLTVRFVEHHFVESYYPTIENTFS
FT                   RIIKHNGQDYATEIVDTAGQDEYSILNSKHFIGIHGYIIVYSVTSRQSFDMVRVIRDKI
FT                   LNHLGADDVPLVIVGNKSDLKPDHRQVTLDDGRQLAEELNCAFTEASAFLDFNVSKAFD
FT                   LMIGEVEKSQNPSQPTGNNKCALM"
FT   exon            108359..108413
FT                   /gene="Pc20g00480"
FT                   /locus_tag="PCH_Pc20g00480"
FT                   /number=1
FT   intron          108414..108484
FT                   /gene="Pc20g00480"
FT                   /locus_tag="PCH_Pc20g00480"
FT                   /number=1
FT   exon            108485..108624
FT                   /gene="Pc20g00480"
FT                   /locus_tag="PCH_Pc20g00480"
FT                   /number=2
FT   intron          108625..108676
FT                   /gene="Pc20g00480"
FT                   /locus_tag="PCH_Pc20g00480"
FT                   /number=2
FT   exon            108677..108805
FT                   /gene="Pc20g00480"
FT                   /locus_tag="PCH_Pc20g00480"
FT                   /number=3
FT   intron          108806..108865
FT                   /gene="Pc20g00480"
FT                   /locus_tag="PCH_Pc20g00480"
FT                   /number=3
FT   exon            108866..109105
FT                   /gene="Pc20g00480"
FT                   /locus_tag="PCH_Pc20g00480"
FT                   /number=4
FT   mRNA            join(<109708..109840,109891..109961,110016..110177,
FT                   110244..110665,110717..110807,110858..111226,
FT                   111280..>111444)
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT   CDS_pept        join(109708..109840,109891..109961,110016..110177,
FT                   110244..110665,110717..110807,110858..111226,
FT                   111280..111444)
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /note="unknown EC_number=6.1.1.11"
FT                   /note="Title: strong similarity to cytosolic serine--tRNA
FT                   ligase Ses1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85378"
FT                   /db_xref="GOA:B6HFN8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN8"
FT                   /inference="similar to AA sequence:PIR:YSBYC"
FT                   /inference="protein motif:PFAM:PF02403"
FT                   /inference="protein motif:PFAM:PF00587"
FT                   /inference="protein motif:COGS:COG0172"
FT                   /protein_id="CAP85378.1"
FT                   /translation="MLDLADFVTERGGDIKKIKESQQKRFAPEEAVDEVVALYEEARRA
FT                   RYDVTQMGSQINGVQKAIGMKKKNKEDATELLAQKAELETKKKELEEAAVAKEVQRDRK
FT                   IRTIGNYVHESVPVSNDEADNKLIKTWTPEGAEMQKPGCLSHHEVLTRLDGYDPERGVK
FT                   IVGHRGYCLTGYGLFLNLALINYGLEFLFNKGYTPNQPPQFMLKDLMAKTAQLEQFDEE
FT                   LYKVTESEDKSTDKYLIATSEQPLSALHDSEWLQDKDLPIKYAGYSTCYRKEAGSHGKD
FT                   AWGIFRVHQFEKIEQFVLTKPEDSWQAFEDMMNTSEEFYQSLKLPYNIVAIVSGALNNA
FT                   ASKKYDLEAWFPFQQEYKELVSCSNCTDYQARALEIRYGAKKATDLKKTYVHALNSTLC
FT                   ATERTLCCVLENYQKEDGIEVPEVLRKYIPGAPEFLPYTKELPKDTTSSKAKAKANKGT
FT                   DDAAKKMQGLQV"
FT   exon            109708..109840
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /number=1
FT   intron          109841..109890
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /number=1
FT   exon            109891..109961
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /number=2
FT   intron          109962..110015
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /number=2
FT   exon            110016..110177
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /number=3
FT   intron          110178..110243
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /number=3
FT   exon            110244..110665
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /number=4
FT   intron          110666..110716
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /number=4
FT   exon            110717..110807
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /number=5
FT   intron          110808..110857
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /number=5
FT   exon            110858..111226
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /number=6
FT   intron          111227..111279
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /number=6
FT   exon            111280..111444
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /number=7
FT   mRNA            <111963..>112286
FT                   /gene="Pc20g00500"
FT                   /locus_tag="PCH_Pc20g00500"
FT   CDS_pept        <111963..>112286
FT                   /pseudo
FT                   /gene="Pc20g00500"
FT                   /locus_tag="PCH_Pc20g00500"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to retroviral-like transposable
FT                   element like protein An03g03110 - Aspergillus niger
FT                   [truncated ORF][putative pseudogene]"
FT   exon            <111963..>112286
FT                   /gene="Pc20g00500"
FT                   /locus_tag="PCH_Pc20g00500"
FT                   /number=1
FT   mRNA            complement(join(<114095..114554,114651..>114856))
FT                   /gene="Pc20g00510"
FT                   /locus_tag="PCH_Pc20g00510"
FT   CDS_pept        complement(join(114095..114554,114651..114856))
FT                   /gene="Pc20g00510"
FT                   /locus_tag="PCH_Pc20g00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85380"
FT                   /db_xref="GOA:B6HFN9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN9"
FT                   /protein_id="CAP85380.1"
FT                   /translation="MSAATSSASTTHATGSLQDPTKLSSWVTEAQDAKKTPLLFSCIYG
FT                   IYLLGRIVVLLVANALKKRESQAEKDAKCSECPTARSRILELEQRVRIAELSARDANSR
FT                   AERFAVQVRRANELAEEFQRRAMAVEERVGDWRNFEFSANEVGSLHSPQTPSRHSPASS
FT                   AQSQPDSLKTQIKQSRVVSWTRSISRSVRRAVRPRRHKRSETLEAGQQFSKVRNSRSN"
FT   exon            complement(114095..114554)
FT                   /gene="Pc20g00510"
FT                   /locus_tag="PCH_Pc20g00510"
FT                   /number=1
FT   intron          complement(114555..114650)
FT                   /gene="Pc20g00510"
FT                   /locus_tag="PCH_Pc20g00510"
FT                   /number=1
FT   exon            complement(114651..114856)
FT                   /gene="Pc20g00510"
FT                   /locus_tag="PCH_Pc20g00510"
FT                   /number=2
FT   mRNA            <115351..>115918
FT                   /gene="Pc20g00520"
FT                   /locus_tag="PCH_Pc20g00520"
FT   CDS_pept        <115351..>115918
FT                   /gene="Pc20g00520"
FT                   /locus_tag="PCH_Pc20g00520"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An03g03110 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85381"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP0"
FT                   /protein_id="CAP85381.1"
FT                   /translation="MSTPYDFDRQKESDISKIVPKLKGESNFAQWQHRLYMALRGNNKT
FT                   YVHLIQGTVNKPTPPDLYDESVETVRELAQHRATSAVFASGSSDPIAPVSDVVVRELVK
FT                   EQKQKNKELLREYQVLVDKWDLFNIHCCNQIFSTLDTIPASYVHNVENPRDAYKLLRAE
FT                   YGSSPWQGDFKRFEVLINLQHKNNNS"
FT   exon            115351..115918
FT                   /gene="Pc20g00520"
FT                   /locus_tag="PCH_Pc20g00520"
FT                   /number=1
FT   mRNA            join(<117646..117926,117994..118301,118359..118948,
FT                   119002..119044,119097..119155,119215..119296,
FT                   119350..>119378)
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT   CDS_pept        join(117646..117926,117994..118301,118359..118948,
FT                   119002..119044,119097..119155,119215..119296,
FT                   119350..119378)
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /note="unknown EC_number=1.1.1.95"
FT                   /note="Title: strong similarity to phosphoglycerate
FT                   dehydrogenase like protein An17g02330 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85382"
FT                   /db_xref="GOA:B6HFP1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029015"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP1"
FT                   /inference="protein motif:PFAM:PF00389"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /inference="protein motif:COGS:COG0111"
FT                   /protein_id="CAP85382.1"
FT                   /translation="MSNARDIRPRQDDASLLATSPSASFNSPSSHSSAFNRTVPVNAKP
FT                   LKPFATEDIKVLLLENVNQTGREILSQQGYQVEFLKSSLPEDQLIEKIRDVHVIGIRSK
FT                   TKLTARVLKEAKNLIVIGCFCIGTNQVDLQYAADQGIAVFNSPFSNSRSVAELVIGEMV
FT                   MLARQLGDRSSEMHAGTWNKVSNGCWEIRGKTLGIIGYGHIGAQLSVLAEAMGMSVIYY
FT                   DVLNIMSLGTARQVEALDDLLAEADFITCHVPELPETKGMIGQKQFEKMKKGSYLINAS
FT                   RGTVVDIPALIDAMRSGKVAGAALDVYPNEPAGNGDYFNNDLNSWGADLRSLKNLILTP
FT                   HIGGSTEEAQKAIGVEVAQALVRYANEGSTLGAVNLPEVVLRSLTMDEPDHARVIYIHK
FT                   NIPGVLRKVNEIIGDHNVDKQMTDSRGDVAYLMADISNVDAATIKELYTSLESLPSRIM
FT                   TRVLY"
FT   exon            117646..117926
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /number=1
FT   intron          117927..117993
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /number=1
FT   exon            117994..118301
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /number=2
FT   intron          118302..118358
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /number=2
FT   exon            118359..118948
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /number=3
FT   intron          118949..119001
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /number=3
FT   exon            119002..119044
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /number=4
FT   intron          119045..119096
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /number=4
FT   exon            119097..119155
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /number=5
FT   intron          119156..119214
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /number=5
FT   exon            119215..119296
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /number=6
FT   intron          119297..119349
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /number=6
FT   exon            119350..119378
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /number=7
FT   mRNA            complement(join(<119746..120478,120534..120728,
FT                   120781..120994,121048..121075,121130..121381,
FT                   121443..121524,121575..>121684))
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT   CDS_pept        complement(join(119746..120478,120534..120728,
FT                   120781..120994,121048..121075,121130..121381,
FT                   121443..121524,121575..121684))
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /note="unknown EC_number=2.7.1.-"
FT                   /note="Title: strong similarity to protein kinase Sgv1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85383"
FT                   /db_xref="GOA:B6HFP2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP2"
FT                   /inference="similar to AA sequence:PIR:A39526"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP85383.1"
FT                   /translation="MAIKSLEKDENGQARFFGCSNIRDYEFLDKLGEGTFGEVYKARSK
FT                   KDAKIVALKKILMHHEKEGFPITAIREIKLMKALSHPNILQLKEMSIERGKGEGRKKPS
FT                   MYMVFPYMEHDLSGLLENPAVTFTEPQIKCYLMQLLEGLKFMHANRILHRDMKAANLLI
FT                   SNGGILQIADFGLARPYDDAPPQPGKGGGESKREYTALVVTRWYRPPELLLQLRKYTTA
FT                   IDLWGVGCVFGEMFKGKPILAGNSDLNQAELIFNLVGTPNEENMPGWSQLPGCEGVKNF
FT                   GIKRGNLHNFFKDLNPVAISLLGEFLRLDWRKRINAMDALKHPYFTTHPLPARPGEIPQ
FT                   FADSHELDRKKFRSQRVPMPPVPPAASDTSNGAWPSSGSRGPDSRHSRVPGAARGGRPN
FT                   AQGMHGSHGHHAAHGHPQRRAPFPPTQRDTGLPPRPPAPHNPPWDGSQSNRPDNRDDRR
FT                   GQFGQGRPGGRSGNLDSYVPNYSSNDRGSDRGNDRSRDSGEHGSHSNADWRSTSRRDYR
FT                   RDPPPRRRSRSPGYRDGSRG"
FT   exon            complement(119746..120478)
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /number=1
FT   intron          complement(120479..120533)
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /number=1
FT   exon            complement(120534..120728)
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /number=2
FT   intron          complement(120729..120780)
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /number=2
FT   exon            complement(120781..120994)
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /number=3
FT   intron          complement(120995..121047)
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /number=3
FT   exon            complement(121048..121075)
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /number=4
FT   intron          complement(121076..121129)
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /number=4
FT   exon            complement(121130..121381)
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /number=5
FT   intron          complement(121382..121442)
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /number=5
FT   exon            complement(121443..121524)
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /number=6
FT   intron          complement(121525..121574)
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /number=6
FT   exon            complement(121575..121684)
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /number=7
FT   mRNA            complement(join(<122508..122568,122771..122830,
FT                   122902..123098,123134..123213,123274..123422,
FT                   123529..123625,123678..123723,123775..124131,
FT                   124198..124329,124381..124463,124519..124851,
FT                   124924..125077,125126..125432,125485..125592,
FT                   125648..125793,125857..126206,126253..126384,
FT                   126441..126507,126561..126695,126743..127084,
FT                   127137..127679,127738..127777,127837..>127928))
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT   CDS_pept        complement(join(122508..122568,122771..122830,
FT                   122902..123098,123134..123213,123274..123422,
FT                   123529..123625,123678..123723,123775..124131,
FT                   124198..124329,124381..124463,124519..124851,
FT                   124924..125077,125126..125432,125485..125592,
FT                   125648..125793,125857..126206,126253..126384,
FT                   126441..126507,126561..126695,126743..127084,
FT                   127137..127679,127738..127777,127837..127928))
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /EC_number="3.6.3.8"
FT                   /note="Title: strong similarity to Ca2+-transporting ATPase
FT                   like protein An17g02310 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00550"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85384"
FT                   /db_xref="GOA:B6HFP3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP3"
FT                   /inference="protein motif:PFAM:PF00122"
FT                   /inference="protein motif:COGS:COG0474"
FT                   /protein_id="CAP85384.1"
FT                   /translation="MGSRPQSPSGTGPVDLSMPRNRLRRDSMRSSMSVVSDVEMARNEV
FT                   FDGPISESIPSSVVSFAHRRDRAGSTVSFTYFQDEEDFAEWSNEDEDVVDEEGEDDEES
FT                   LHGIRDPDLESARGSFVSKRMSTSRDSVEHPLLSRYLSASSYGRDRRSGSRLNQKVYIA
FT                   SEDLTAVFAGFSTSSGGFAVYIALCILTGGFAWLLFRWLPRWRVKLIGKATPIGKCQWV
FT                   AIEDQWNQFTIHGVDSQIYGRPLSTVFADSPSHGYDEDNDPNIDSLRFIDYRYLKFFYH
FT                   PIEDKFSLINGWKDPSWTNAKVMRSGLDADERDSREQIFGSNAIEIEQKTIPQLLVDEA
FT                   FHPFYIFQIASLVLWSMDEYYYYAVCIFLISFFSIATTVLETKSTMSRLREISLFECDV
FT                   RVLRNGFWRSVSSQELVPGDVYEFSDPSLHQVPCDCILLSGDSIVNESMLTGESVPVSK
FT                   TPLTDDALKYLDLSTPSIHPQVAKHFLFSGTKVIRARRPQNVDEDEAVALAVVMRTGFL
FT                   TTKGALVRSMLFPKPSGFKFYRDSFRYIAVMAIVALLGFVASFINFVRLGLAWHLIIIR
FT                   ALDLITIVVPPALPATLTIGTNFALSRLKKQNIFCISPQKVNVGGKLDIVCFDKTGTLT
FT                   EDGLDVLGARIVTRGKRFSELLSETSDGFLCPSQNVDSECDIEKQRNIMYAMATCHSLR
FT                   VVDDELLGDPLDVKMFQFTNWRFEEGGNHVSDQTNPKYDTIAPSVAKPPQRHIGDEQDV
FT                   NDSLELGVLRSFEFVSNLRRASVIVRKFGDNGASFFVKGAPESIKDICIPGTLPSDYED
FT                   LLNYYTHKGYRVIACASKYERKLSWMKAQKMTRTDAESDLEFLGFIIFENKLKPSTAGV
FT                   ISELNEAGIRNVMCTGDNILTAISVARECNMLGRDELCFIPHFIEEPGISSKISLIWEC
FT                   VDNPDLQLDPRTLLPMNDAEVDLSIPGNVLTEREYSVAVTGDAFRWLVDFGNEDVLKKV
FT                   LVCGKVFARMSPDEKHELVEKLQSIDYCCGFCGDGANDCGALKAADVGISLSDAEASVA
FT                   APFTSRLFEISCVPTVIKEGRAALVTSFSCFKFMSLYSAIQFSSVSFLYTSGSNLGDFQ
FT                   FLFIDLVLIMPIAVFMGWADPAPTLSRKRPTADLVSRKVLTPLLGQILFLPPQLDLEKS
FT                   NIVNSENTALFLFSCFQYIFISIVLSAGPPFRKPMTQNGPYLFTIIVNTMISGYMLFRP
FT                   SNWVSEMLATRASIRYLRSVLDSREEHIPTCGTDAWTRSCPLAAKLPQKAQDVQSAVGG
FT                   IAPMKYAFKAPTLGSASANRATELPFQKIEKKGGPKGASSPTERDHPSWPGT"
FT   exon            complement(122508..122568)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=1
FT   intron          complement(122569..122770)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=1
FT   exon            complement(122771..122830)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=2
FT   intron          complement(122831..122901)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=2
FT   exon            complement(122902..123098)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=3
FT   intron          complement(123099..123133)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=3
FT   exon            complement(123134..123213)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=4
FT   intron          complement(123214..123273)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=4
FT   exon            complement(123274..123422)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=5
FT   intron          complement(123423..123528)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=5
FT   exon            complement(123529..123625)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=6
FT   intron          complement(123626..123677)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=6
FT   exon            complement(123678..123723)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=7
FT   intron          complement(123724..123774)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=7
FT   exon            complement(123775..124131)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=8
FT   intron          complement(124132..124197)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=8
FT   exon            complement(124198..124329)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=9
FT   intron          complement(124330..124380)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=9
FT   exon            complement(124381..124463)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=10
FT   intron          complement(124464..124518)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=10
FT   exon            complement(124519..124851)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=11
FT   intron          complement(124852..124923)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=11
FT   exon            complement(124924..125077)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=12
FT   intron          complement(125078..125125)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=12
FT   exon            complement(125126..125432)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=13
FT   intron          complement(125433..125484)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=13
FT   exon            complement(125485..125592)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=14
FT   intron          complement(125593..125647)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=14
FT   exon            complement(125648..125793)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=15
FT   intron          complement(125794..125856)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=15
FT   exon            complement(125857..126206)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=16
FT   intron          complement(126207..126252)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=16
FT   exon            complement(126253..126384)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=17
FT   intron          complement(126385..126440)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=17
FT   exon            complement(126441..126507)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=18
FT   intron          complement(126508..126560)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=18
FT   exon            complement(126561..126695)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=19
FT   intron          complement(126696..126742)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=19
FT   exon            complement(126743..127084)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=20
FT   intron          complement(127085..127136)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=20
FT   exon            complement(127137..127679)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=21
FT   intron          complement(127680..127737)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=21
FT   exon            complement(127738..127777)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=22
FT   intron          complement(127778..127836)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=22
FT   exon            complement(127837..127928)
FT                   /gene="Pc20g00550"
FT                   /locus_tag="PCH_Pc20g00550"
FT                   /number=23
FT   mRNA            join(<129123..129169,129251..129330,129393..130100,
FT                   130159..130499,130552..>130602)
FT                   /gene="Pc20g00560"
FT                   /locus_tag="PCH_Pc20g00560"
FT   CDS_pept        join(129123..129169,129251..129330,129393..130100,
FT                   130159..130499,130552..130602)
FT                   /gene="Pc20g00560"
FT                   /locus_tag="PCH_Pc20g00560"
FT                   /note="Title: strong similarity to nucleosome assembly
FT                   protein I Nap-i - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00560"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85385"
FT                   /db_xref="GOA:B6HFP4"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="InterPro:IPR037231"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP4"
FT                   /inference="similar to AA sequence:TREMBL:SCNAPI.1"
FT                   /inference="protein motif:PFAM:PF00956"
FT                   /protein_id="CAP85385.1"
FT                   /translation="MSEPIRNKKADFPVAPTPQNTPANNAPISSHAQQPGVSSIEEESL
FT                   DKAAAASLFARNPALVSMIQGKLGQLVGRSSGYIESLPPSVRRRVAGLKGIQKEHSKLE
FT                   AQFQEEVLELEKKYFGKFTPLYQRRSTIINGGVEPTEAEVEAGKEDEESDEEETKEEPK
FT                   KEEAETANGIPEFWLSAMKNQISLAEMITERDEEALKHLTDIRMEYLDRPGFRLIFEFS
FT                   ENEFFTNKTISKTYFYKDESGYGGDFIYDHADGSQIDWKEDKDLTLRLESKKQRNKNTK
FT                   QTRVVKISVPTESFFNFFSPPQPPSEDDESVASDIEERLELDYQLGEDIKEKLIPRAID
FT                   WFTGEALQFEELGEDFDGDEFEDDDDEEEEDDEDEEDLGSDRDVDEEDTDEEDGTSKPK
FT                   KEAAECKQN"
FT   exon            129123..129169
FT                   /gene="Pc20g00560"
FT                   /locus_tag="PCH_Pc20g00560"
FT                   /number=1
FT   intron          129170..129250
FT                   /gene="Pc20g00560"
FT                   /locus_tag="PCH_Pc20g00560"
FT                   /number=1
FT   exon            129251..129330
FT                   /gene="Pc20g00560"
FT                   /locus_tag="PCH_Pc20g00560"
FT                   /number=2
FT   intron          129331..129392
FT                   /gene="Pc20g00560"
FT                   /locus_tag="PCH_Pc20g00560"
FT                   /number=2
FT   exon            129393..130100
FT                   /gene="Pc20g00560"
FT                   /locus_tag="PCH_Pc20g00560"
FT                   /number=3
FT   intron          130101..130158
FT                   /gene="Pc20g00560"
FT                   /locus_tag="PCH_Pc20g00560"
FT                   /number=3
FT   exon            130159..130499
FT                   /gene="Pc20g00560"
FT                   /locus_tag="PCH_Pc20g00560"
FT                   /number=4
FT   intron          130500..130551
FT                   /gene="Pc20g00560"
FT                   /locus_tag="PCH_Pc20g00560"
FT                   /number=4
FT   exon            130552..130602
FT                   /gene="Pc20g00560"
FT                   /locus_tag="PCH_Pc20g00560"
FT                   /number=5
FT   mRNA            join(<131371..131505,131602..131734,131791..131980,
FT                   132039..135891,135944..136017,136075..>136393)
FT                   /gene="Pc20g00570"
FT                   /locus_tag="PCH_Pc20g00570"
FT   CDS_pept        join(131371..131505,131602..131734,131791..131980,
FT                   132039..135891,135944..136017,136075..136393)
FT                   /gene="Pc20g00570"
FT                   /locus_tag="PCH_Pc20g00570"
FT                   /EC_number="3.6.4.1"
FT                   /note="Title: strong similarity to myosin Myo2
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00570"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85386"
FT                   /db_xref="GOA:B6HG04"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036103"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG04"
FT                   /inference="similar to AA sequence:PIR:A38454"
FT                   /inference="protein motif:PFAM:PF00063"
FT                   /inference="protein motif:PFAM:PF00612"
FT                   /inference="protein motif:PFAM:PF01843"
FT                   /inference="protein motif:COGS:COG5022"
FT                   /protein_id="CAP85386.1"
FT                   /translation="MAHIYEVGTRAWQPDPTEGWLASEVKEKLEDGEKVQLIFELENGE
FT                   TKTVETTQSELQVDNNPKLPPLMNPAMLEASEDLTNLSHLNEPAVLQAIKLRYAQKEIY
FT                   TYSGIVLIATNPFARVDSLYVPQMVQVYAGKQRASQAPHLFAIAEEAFADMLRDGKNQT
FT                   IVVSGESGAGKTVSAKYIMRYFATRESSDQPGKYTTSRAEAISETEEQILATNPVMEAF
FT                   GNAKTTRNDNSSRFGKYIEIMFDDRTNIIGAKIRTYLLERSRLVFQPLKERNYHIFYQL
FT                   VAGASDAEKQELGLLATEDFEYLNQGGTPVIDGVDDKAEFEATRKSLAVIGVPKEDQTG
FT                   IFRVLAALLHLGNVKITATRTDSSVSSTEPSLLRACEMLGIDATEFAKWIVKKQLITRG
FT                   EKITSNLTQQQALVVRDSVSKFIYSSLFDWLVDKINRRLATDEVLEQFKCFIGVLDIYG
FT                   FEHFAKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVREEIDWTFIDFSDNQPCIDLI
FT                   EAKLGVLALLDEESRLPMGSDEQFVTKLHHHFAADKQKFYKKPRFGKSAFTVCHYAVDV
FT                   TYESDGFIEKNRDTVPDEHLEVLRNSSNPFIKEILDTAAAVREKDSASMSSKPVAAAPG
FT                   RRIGVAVNRKPTLGGIFKSSLIELMHTINNTEVHYIRCIKPNEAKEAWKFEGPMVLSQL
FT                   RACGVLETVRISTAGYPTRWTYEEFAIRYYMLCHSSQWTSEIRDMCHAILRKALGDEKQ
FT                   DKYQLGLTKIFFRAGMLAFLENLRTSRLNECAIMIQKNLRAKYYRRRYLDARDSILTTQ
FT                   AFIRGFLARQHAHEIRRTKAATTIQRVWRGQKEKKRYTQIRKNFILFESVAKGFLCRRN
FT                   IMDSINGNAAKVIQRAFRSWRQLRAWRQYRRKVITIQNLWRGKEARNAYKRLREDARDL
FT                   KQISYKLENKVVELTQYLQTLKLENKTLVSQLDNYDTQLKSWRTRHNALEARTKELQVE
FT                   ANQAGITAARLEAIEEEMSKLQQGHTEAQATIKRLQEEERISREALQTANEELERLKLL
FT                   DADHEKDKTALRQRISDLEEQLEVAKRSVPLNGMNGDGLPNGGAVQTPTPGLINLVSSK
FT                   KPKPKRRSAGAERIETDRFSGAYNPRPVSMAVTPGSMATRQSAAISPGLESVEVELENL
FT                   LSEEEDLNEEVAMGLIRNLKIPLPTSTPPPTEKEVLFPAYLINLVTSEMWNNGFVKESE
FT                   RFLANVMQSIQQEVMQHDGDDAINPGAFWLSNVHEMLSFVFLAEDWYEAQKTENYEYDR
FT                   LLEIVKHDLESLEFNIYHTWMKVLKKKLYKMIVPAIIESQSLPGFVTSETNRFLGKLLP
FT                   SNNNPAYSMDNLLSLLNGVYKAMKAFYLEDAIILQTVTELLRLVGVTAFNDLLMRRNFL
FT                   SWKRGLQINYNITRIEEWCKSHDMPEGTLKLEHLMQATKLLQLKKATLNDIEIIQDICW
FT                   MLSPNQIQKLLNQYLVADYEQPINGEIMKAVASRVTEKSDVLLLAPVDMEDSGPYEIAE
FT                   PRVITALETYTPSWLQTPRLKRLAEIVSAQAMAQQEKLDWDNGVVEE"
FT   exon            131371..131505
FT                   /gene="Pc20g00570"
FT                   /locus_tag="PCH_Pc20g00570"
FT                   /number=1
FT   intron          131506..131601
FT                   /gene="Pc20g00570"
FT                   /locus_tag="PCH_Pc20g00570"
FT                   /number=1
FT   exon            131602..131734
FT                   /gene="Pc20g00570"
FT                   /locus_tag="PCH_Pc20g00570"
FT                   /number=2
FT   intron          131735..131790
FT                   /gene="Pc20g00570"
FT                   /locus_tag="PCH_Pc20g00570"
FT                   /number=2
FT   exon            131791..131980
FT                   /gene="Pc20g00570"
FT                   /locus_tag="PCH_Pc20g00570"
FT                   /number=3
FT   intron          131981..132038
FT                   /gene="Pc20g00570"
FT                   /locus_tag="PCH_Pc20g00570"
FT                   /number=3
FT   exon            132039..135891
FT                   /gene="Pc20g00570"
FT                   /locus_tag="PCH_Pc20g00570"
FT                   /number=4
FT   intron          135892..135943
FT                   /gene="Pc20g00570"
FT                   /locus_tag="PCH_Pc20g00570"
FT                   /number=4
FT   exon            135944..136017
FT                   /gene="Pc20g00570"
FT                   /locus_tag="PCH_Pc20g00570"
FT                   /number=5
FT   intron          136018..136074
FT                   /gene="Pc20g00570"
FT                   /locus_tag="PCH_Pc20g00570"
FT                   /number=5
FT   exon            136075..136393
FT                   /gene="Pc20g00570"
FT                   /locus_tag="PCH_Pc20g00570"
FT                   /number=6
FT   mRNA            complement(join(<136435..136570,136638..136827,
FT                   136942..>137068))
FT                   /gene="Pc20g00580"
FT                   /locus_tag="PCH_Pc20g00580"
FT   CDS_pept        complement(join(136435..136570,136638..136827,
FT                   136942..137068))
FT                   /gene="Pc20g00580"
FT                   /locus_tag="PCH_Pc20g00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00580"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85387"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG05"
FT                   /protein_id="CAP85387.1"
FT                   /translation="MTPDDLVWEQAEEIFDKWLLQFLQHDVLRPIGAFIITHERGFGGK
FT                   GGDGIDSRSKVDGDGHQGSIYRGIQMSTLTFHEQFESQEKAKVENSLEKRMDSEPTHDE
FT                   TSHLQQFPEQSLLVYKPRRHMQLKQMKIMRITVSQRPWIIQASRNP"
FT   exon            complement(136435..136570)
FT                   /gene="Pc20g00580"
FT                   /locus_tag="PCH_Pc20g00580"
FT                   /number=1
FT   intron          complement(136571..136637)
FT                   /gene="Pc20g00580"
FT                   /locus_tag="PCH_Pc20g00580"
FT                   /number=1
FT   exon            complement(136638..136827)
FT                   /gene="Pc20g00580"
FT                   /locus_tag="PCH_Pc20g00580"
FT                   /number=2
FT   intron          complement(136828..136941)
FT                   /gene="Pc20g00580"
FT                   /locus_tag="PCH_Pc20g00580"
FT                   /number=2
FT   exon            complement(136942..137068)
FT                   /gene="Pc20g00580"
FT                   /locus_tag="PCH_Pc20g00580"
FT                   /number=3
FT   mRNA            join(<137402..137572,137628..137701,137758..137902,
FT                   137956..137992,138054..138118,138171..>138239)
FT                   /gene="Pc20g00590"
FT                   /locus_tag="PCH_Pc20g00590"
FT   CDS_pept        join(137402..137572,137628..137701,137758..137902,
FT                   137956..137992,138054..138118,138171..138239)
FT                   /gene="Pc20g00590"
FT                   /locus_tag="PCH_Pc20g00590"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   ncu01441.1 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00590"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85388"
FT                   /db_xref="GOA:B6HG06"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR027502"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG06"
FT                   /inference="protein motif:PFAM:PF01725"
FT                   /inference="protein motif:COGS:COG0127"
FT                   /protein_id="CAP85388.1"
FT                   /translation="MTLTKLNFITGNKNKLLEVRAILGKVIEVDNQEVDVPEIQGTIEE
FT                   IAKEKARRAAEAINGPALTEDTALEFHALKGLPGPYIKSFMEKLGHEGLNKMLDGFEDR
FT                   TAEAVCTFAFCRGPGEEPIVFQGRTEGAIVRPRGSGNFGWDAIFEYDGKQTYAEMDKEE
FT                   KNKISHRYKALVKLQQWLAEGQQ"
FT   exon            137402..137572
FT                   /gene="Pc20g00590"
FT                   /locus_tag="PCH_Pc20g00590"
FT                   /number=1
FT   intron          137573..137627
FT                   /gene="Pc20g00590"
FT                   /locus_tag="PCH_Pc20g00590"
FT                   /number=1
FT   exon            137628..137701
FT                   /gene="Pc20g00590"
FT                   /locus_tag="PCH_Pc20g00590"
FT                   /number=2
FT   intron          137702..137757
FT                   /gene="Pc20g00590"
FT                   /locus_tag="PCH_Pc20g00590"
FT                   /number=2
FT   exon            137758..137902
FT                   /gene="Pc20g00590"
FT                   /locus_tag="PCH_Pc20g00590"
FT                   /number=3
FT   intron          137903..137955
FT                   /gene="Pc20g00590"
FT                   /locus_tag="PCH_Pc20g00590"
FT                   /number=3
FT   exon            137956..137992
FT                   /gene="Pc20g00590"
FT                   /locus_tag="PCH_Pc20g00590"
FT                   /number=4
FT   intron          137993..138053
FT                   /gene="Pc20g00590"
FT                   /locus_tag="PCH_Pc20g00590"
FT                   /number=4
FT   exon            138054..138118
FT                   /gene="Pc20g00590"
FT                   /locus_tag="PCH_Pc20g00590"
FT                   /number=5
FT   intron          138119..138170
FT                   /gene="Pc20g00590"
FT                   /locus_tag="PCH_Pc20g00590"
FT                   /number=5
FT   exon            138171..138239
FT                   /gene="Pc20g00590"
FT                   /locus_tag="PCH_Pc20g00590"
FT                   /number=6
FT   mRNA            complement(join(<138331..138532,138591..138739,
FT                   138844..>139026))
FT                   /gene="Pc20g00600"
FT                   /locus_tag="PCH_Pc20g00600"
FT   CDS_pept        complement(join(138331..138532,138591..138739,
FT                   138844..139026))
FT                   /gene="Pc20g00600"
FT                   /locus_tag="PCH_Pc20g00600"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1310_scaffold_4.tfa_510wg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00600"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85389"
FT                   /db_xref="GOA:B6HG07"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG07"
FT                   /inference="protein motif:COGS:COG1936"
FT                   /inference="protein motif:COGS:COG0465"
FT                   /inference="protein motif:COGS:COG0464"
FT                   /protein_id="CAP85389.1"
FT                   /translation="MRTSPNVIITGTPGVGKTVHCEQLAQEIGLKHLSINQVAKDRGCF
FT                   DEYDEELKTWVVDEDKLLDALEDEIPNGGYLIDWHACDLFPKSWIDLVVVLRCPTTDVL
FT                   YDRLSSRGYHEKKLEENVDAEIFGVLADEAREAFDEEIVVELNSEQDSDVDSNCQRIAQ
FT                   WVDSWKQSQAENAD"
FT   exon            complement(138331..138532)
FT                   /gene="Pc20g00600"
FT                   /locus_tag="PCH_Pc20g00600"
FT                   /number=1
FT   intron          complement(138533..138590)
FT                   /gene="Pc20g00600"
FT                   /locus_tag="PCH_Pc20g00600"
FT                   /number=1
FT   exon            complement(138591..138739)
FT                   /gene="Pc20g00600"
FT                   /locus_tag="PCH_Pc20g00600"
FT                   /number=2
FT   intron          complement(138740..138843)
FT                   /gene="Pc20g00600"
FT                   /locus_tag="PCH_Pc20g00600"
FT                   /number=2
FT   exon            complement(138844..139026)
FT                   /gene="Pc20g00600"
FT                   /locus_tag="PCH_Pc20g00600"
FT                   /number=3
FT   mRNA            complement(join(<139261..139297,139347..139551,
FT                   139606..139760,139811..139842,139895..>140326))
FT                   /gene="Pc20g00610"
FT                   /locus_tag="PCH_Pc20g00610"
FT   CDS_pept        complement(join(139261..139297,139347..139551,
FT                   139606..139760,139811..139842,139895..140326))
FT                   /gene="Pc20g00610"
FT                   /locus_tag="PCH_Pc20g00610"
FT                   /note="Title: strong similarity to kidney injury associated
FT                   molecule HW034 protein 2 like protein An17g02285
FT                   -Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00610"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85390"
FT                   /db_xref="InterPro:IPR012462"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG08"
FT                   /protein_id="CAP85390.1"
FT                   /translation="MPSWLKKMLGKGGNISKQTQITSDGKLTRRKTVENETDHLIPVLA
FT                   RLCEQDNSVQRAFLCSPKVRHICKMRREGGFCGYRNIQMMVSWVKKSGSFGHEHFPKEG
FT                   PTILELQDMIESAWDMGFNSSGRVETGGIKDTRKFIGTPEAQALFMSLGIPCEARSLPE
FT                   RSDVRACDALYIDVADYFRSACPPEDETKVIQTDLPPIYFQHQGHSMTIVGFEIRDNGS
FT                   ANLLVFDPMFKTSPAMERLIGAFVKPSDPTRLLKAYRRGTPYLQKYKIFELLKLCITSP
FT                   KQDAT"
FT   exon            complement(139261..139297)
FT                   /gene="Pc20g00610"
FT                   /locus_tag="PCH_Pc20g00610"
FT                   /number=1
FT   intron          complement(139298..139346)
FT                   /gene="Pc20g00610"
FT                   /locus_tag="PCH_Pc20g00610"
FT                   /number=1
FT   exon            complement(139347..139551)
FT                   /gene="Pc20g00610"
FT                   /locus_tag="PCH_Pc20g00610"
FT                   /number=2
FT   intron          complement(139552..139605)
FT                   /gene="Pc20g00610"
FT                   /locus_tag="PCH_Pc20g00610"
FT                   /number=2
FT   exon            complement(139606..139760)
FT                   /gene="Pc20g00610"
FT                   /locus_tag="PCH_Pc20g00610"
FT                   /number=3
FT   intron          complement(139761..139810)
FT                   /gene="Pc20g00610"
FT                   /locus_tag="PCH_Pc20g00610"
FT                   /number=3
FT   exon            complement(139811..139842)
FT                   /gene="Pc20g00610"
FT                   /locus_tag="PCH_Pc20g00610"
FT                   /number=4
FT   intron          complement(139843..139894)
FT                   /gene="Pc20g00610"
FT                   /locus_tag="PCH_Pc20g00610"
FT                   /number=4
FT   exon            complement(139895..140326)
FT                   /gene="Pc20g00610"
FT                   /locus_tag="PCH_Pc20g00610"
FT                   /number=5
FT   mRNA            complement(<140374..>140913)
FT                   /gene="Pc20g00620"
FT                   /locus_tag="PCH_Pc20g00620"
FT   CDS_pept        complement(140374..140913)
FT                   /gene="Pc20g00620"
FT                   /locus_tag="PCH_Pc20g00620"
FT                   /note="Title: similarity to hypothetical protein An17g02283
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85391"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG09"
FT                   /protein_id="CAP85391.1"
FT                   /translation="MTDNNTASCPFCPFTDSDAGFVSQHIEFCHPETGVTGFLEETPQE
FT                   FTAQNPAPLPVDEDGADKYVDCPHGCGETIEIAELSSHLDLHVAEDMALDDIGATSARS
FT                   TPDAHGHEYDETFDDEDPLDMLESYKGGKRGMQRDSTRANTAKPPRPHSPPRTINADGI
FT                   KRLGVFVSYLHFKDKY"
FT   exon            complement(140374..140913)
FT                   /gene="Pc20g00620"
FT                   /locus_tag="PCH_Pc20g00620"
FT                   /number=1
FT   mRNA            complement(join(<141272..142169,142234..142638,
FT                   142882..143325,143385..>143935))
FT                   /gene="Pc20g00630"
FT                   /locus_tag="PCH_Pc20g00630"
FT   CDS_pept        complement(join(141272..142169,142234..142638,
FT                   142882..143325,143385..143935))
FT                   /gene="Pc20g00630"
FT                   /locus_tag="PCH_Pc20g00630"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   B11A5.10 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00630"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85392"
FT                   /db_xref="GOA:B6HG10"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG10"
FT                   /inference="similar to AA sequence:TREMBL:NCB11A5.1"
FT                   /protein_id="CAP85392.1"
FT                   /translation="MFHKRQEHDAEETTRKSRSLWIFRSWSWFPNYAKEPEMQQLTVHS
FT                   DPVRKWIKGVVICSWIIGGVLALNIILTVVAAGLAYSGNSGQMFDFASLYMGKCSTSKY
FT                   WTTGLHLLINILSTALLGASNYCMQCLAAPSREQVDEAHSQKTWVRIGVPNIMDLLRYQ
FT                   TGRRRLLGSILLITSLPIHLIYNSAVYFSIGPTEYSIVAAQDKLIQEHGNSTEFEQCFT
FT                   ENVGMDLPSFNAAIRDGRFNTLSKQECIDIFAQDYASGYGTVVLVTKDPMPQNESVALV
FT                   GTGNRHSFEGGFSQFSWLCDEEYPCTKSIAEEDTQDWSVDALTWSRPTIHLTARSYSID
FT                   HCMTLPVEETCQLFFSPLICLVVIGCNLVKLICALLAARENRKDIFLTTGDAIASFLAK
FT                   PDPATEGVCLLSGSLVKKRTQGWRKYKGRERKSLDLLETKQESPLRLPSRKRWFQAASV
FT                   SRWVYTVLLFVCMLVPSVIVLRLGILNYNKASKSKSIWDSGLGEASSGTTLAGLSISAT
FT                   STGIFSMILMANIPQILVSLAYFFYNGLLTCMLGAVEYDNYATKRKPLRVSWPRGAQRS
FT                   TYYLTLPYRYSIPLLIVSAVLHWLVSQSFFFVQVIPFDRHGVPQERYPEVLVTCGYSPV
FT                   AIIFGIIVGGLLPVVAALMGLRRFRSHMPLAGQCSAAISAACHPMTTAVDHALKPVQWG
FT                   EVPGSVLSHSGFLNTITTDIECDARSSVGSDEQRLPLARELDRNDSRAVGFLHCTFTSE
FT                   DVSEPSTSHLYL"
FT   exon            complement(141272..142169)
FT                   /gene="Pc20g00630"
FT                   /locus_tag="PCH_Pc20g00630"
FT                   /number=1
FT   intron          complement(142170..142233)
FT                   /gene="Pc20g00630"
FT                   /locus_tag="PCH_Pc20g00630"
FT                   /number=1
FT   exon            complement(142234..142638)
FT                   /gene="Pc20g00630"
FT                   /locus_tag="PCH_Pc20g00630"
FT                   /number=2
FT   intron          complement(142639..142881)
FT                   /gene="Pc20g00630"
FT                   /locus_tag="PCH_Pc20g00630"
FT                   /number=2
FT   exon            complement(142882..143325)
FT                   /gene="Pc20g00630"
FT                   /locus_tag="PCH_Pc20g00630"
FT                   /number=3
FT   intron          complement(143326..143384)
FT                   /gene="Pc20g00630"
FT                   /locus_tag="PCH_Pc20g00630"
FT                   /number=3
FT   exon            complement(143385..143935)
FT                   /gene="Pc20g00630"
FT                   /locus_tag="PCH_Pc20g00630"
FT                   /number=4
FT   mRNA            join(<146670..146797,146849..146929,147003..148252,
FT                   148352..>148449)
FT                   /gene="Pc20g00640"
FT                   /locus_tag="PCH_Pc20g00640"
FT   CDS_pept        join(146670..146797,146849..146929,147003..148252,
FT                   148352..148449)
FT                   /gene="Pc20g00640"
FT                   /locus_tag="PCH_Pc20g00640"
FT                   /note="unknown EC_number=2.7.2.4"
FT                   /note="Title: strong similarity to aspartate kinase Hom3
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00640"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85393"
FT                   /db_xref="GOA:B6HG11"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041747"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG11"
FT                   /inference="similar to AA sequence:PIR:KIBYD"
FT                   /inference="protein motif:PFAM:PF00696"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /inference="protein motif:COGS:COG0527"
FT                   /protein_id="CAP85393.1"
FT                   /translation="MATTILDSNLPVTAQAHSSWVVQKFGGTSVGKFARNIIEQVVEPS
FT                   LVNNRVAVVCSARSSSTKAEGTTNRLLRAARDAESPRSRQYLTLVEAVRLEHVQVAQEE
FT                   LKSVEIRDQVIADITGECERVLKFLEAAQTLGEISARCVDKVMSTGEKLSCRLMAALLQ
FT                   DRGVDSQYVDLAEIIDFPIGPHGLDQDFYNTLAAAFGSKVEACGHRVPVMTGYFGTIPG
FT                   GLLDQIGRGYTDLCAALVAVGTRAQELQVWKEVDGIFTADPRKVPTAHLLPAITPAEAA
FT                   ELTFYGSEVIHPFTMEQVIRARIPIRIKNVMNPKNEGTIIFPDSVAELERTTPGHDPRL
FT                   FRTRSPSLANTPKRPTAVTIKHNILVINVHSNKRSLSHGFFAGIFSVLDKWRLSIDLIS
FT                   TSEVHVSLALHSEMPLLNGNGRDEYQVIDDDLQGALNDLKRYGTVDIIPEMAILSLVGK
FT                   QMKNMIGVAGRMFTTLGENSVNIEMISQGASEINISCVIEERDADRALNIIHTSMFTFL
FT                   D"
FT   exon            146670..146797
FT                   /gene="Pc20g00640"
FT                   /locus_tag="PCH_Pc20g00640"
FT                   /number=1
FT   intron          146798..146848
FT                   /gene="Pc20g00640"
FT                   /locus_tag="PCH_Pc20g00640"
FT                   /number=1
FT   exon            146849..146929
FT                   /gene="Pc20g00640"
FT                   /locus_tag="PCH_Pc20g00640"
FT                   /number=2
FT   intron          146930..147002
FT                   /gene="Pc20g00640"
FT                   /locus_tag="PCH_Pc20g00640"
FT                   /number=2
FT   exon            147003..148252
FT                   /gene="Pc20g00640"
FT                   /locus_tag="PCH_Pc20g00640"
FT                   /number=3
FT   intron          148253..148351
FT                   /gene="Pc20g00640"
FT                   /locus_tag="PCH_Pc20g00640"
FT                   /number=3
FT   exon            148352..148449
FT                   /gene="Pc20g00640"
FT                   /locus_tag="PCH_Pc20g00640"
FT                   /number=4
FT   mRNA            <150771..>152876
FT                   /gene="Pc20g00650"
FT                   /locus_tag="PCH_Pc20g00650"
FT   CDS_pept        150771..152876
FT                   /gene="Pc20g00650"
FT                   /locus_tag="PCH_Pc20g00650"
FT                   /note="Title: strong similarity to hnf-3/forkhead
FT                   transcription factor sep1p - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00650"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85394"
FT                   /db_xref="GOA:B6HG12"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR030456"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG12"
FT                   /inference="similar to AA sequence:PIR:JC6500"
FT                   /inference="protein motif:PFAM:PF00250"
FT                   /inference="protein motif:COGS:COG5025"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP85394.1"
FT                   /translation="MGSTRSTGAHYSSVLAPSAQEIIRSQPRLQPSPLPLQPIQNPSSH
FT                   PSSGPHRPSPTKGLHPQGSHPRHGKLGFVPISAPTPPMFTTDSPAKKAPFPLYSTTSMP
FT                   HSALFTTFSSINTESSKENHLPEEPSNDNFADFPEPSYESKLPMKRTLMEAAPLKERSN
FT                   KKQKRDDAPVAYLPEPHDMPPVEDDGTKPPYSYATLIGMSILRATNRRLTLAQIYKWIS
FT                   DTFSYYKNSDPGWQNSIRHNLSLNKAFIKQERPKDDPGKGNYWAIEPGMEAQFLKDKQV
FT                   RRATMSSLPLPAAPQRDLIPQSQTASTTTWMVPPQPVYNAPSHHAPTPRPAPNDLSSDA
FT                   TLPASDPALQDDADEVVPVPAPRAAPRSSPPAIRSSPPIAPPRFARQGTPPTPTQSNPT
FT                   PAPRPRKRKSITMNDSGYFSSLESSALRPNKAGHILTSDLDIEPPRIKRGRAEEEIARM
FT                   RSSSHDISPGQPAARKNPNPPIGSSPLRSQYVSMQPPPLTPIIKFKKPARPPPSVSPNT
FT                   NLRNHRRKIQQMVNSPIKHLGLSEDALPWSPAFNLQDEAYTPNDHFHTSFDVFADPGSA
FT                   QISYGSPEKRSVKRPRNDGSNTVLSDITSVNINTRLGVPSLSRSKSAIFPESPSKLPDT
FT                   SRFGDAGQEDFFSFHLFDEGNDSSGEVDGVDLLQGFQKIGGVSKDDTLKPRALHRPQMG
FT                   RTNTTLF"
FT   exon            150771..152876
FT                   /gene="Pc20g00650"
FT                   /locus_tag="PCH_Pc20g00650"
FT                   /number=1
FT   mRNA            complement(join(<153528..153671,153729..153859,
FT                   153929..>154100))
FT                   /gene="Pc20g00660"
FT                   /locus_tag="PCH_Pc20g00660"
FT   CDS_pept        complement(join(153528..153671,153729..153859,
FT                   153929..154100))
FT                   /gene="Pc20g00660"
FT                   /locus_tag="PCH_Pc20g00660"
FT                   /note="Title: strong similarity to protein G10 - Xenopus
FT                   laevis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85395"
FT                   /db_xref="GOA:B6HG13"
FT                   /db_xref="InterPro:IPR001748"
FT                   /db_xref="InterPro:IPR018230"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG13"
FT                   /inference="similar to AA sequence:PIR:S05955"
FT                   /inference="protein motif:PFAM:PF01125"
FT                   /inference="protein motif:COGS:COG5132"
FT                   /protein_id="CAP85395.1"
FT                   /translation="MPPIRTSRNRKPPPAGFDDIEDTLLEFSNKMKDAENASHEGKKKY
FT                   EVLWPIFQISHQRSRYIYDLYYEKEAISKELYDFLLKNKYADANLIAKWKKQGYEKLCC
FT                   LRCVQTKETNFNSTCICRVPKAQLKEDQTIQCVSCGCNGCGSSD"
FT   exon            complement(153528..153671)
FT                   /gene="Pc20g00660"
FT                   /locus_tag="PCH_Pc20g00660"
FT                   /number=1
FT   intron          complement(153672..153728)
FT                   /gene="Pc20g00660"
FT                   /locus_tag="PCH_Pc20g00660"
FT                   /number=1
FT   exon            complement(153729..153859)
FT                   /gene="Pc20g00660"
FT                   /locus_tag="PCH_Pc20g00660"
FT                   /number=2
FT   intron          complement(153860..153928)
FT                   /gene="Pc20g00660"
FT                   /locus_tag="PCH_Pc20g00660"
FT                   /number=2
FT   exon            complement(153929..154100)
FT                   /gene="Pc20g00660"
FT                   /locus_tag="PCH_Pc20g00660"
FT                   /number=3
FT   mRNA            join(<154391..154490,154624..>154799)
FT                   /gene="Pc20g00670"
FT                   /locus_tag="PCH_Pc20g00670"
FT   CDS_pept        join(154391..154490,154624..154799)
FT                   /gene="Pc20g00670"
FT                   /locus_tag="PCH_Pc20g00670"
FT                   /note="Title: similarity to hypothetical protein ncu06225.1
FT                   - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85396"
FT                   /db_xref="GOA:B6HG14"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039238"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG14"
FT                   /inference="protein motif:PFAM:PF02953"
FT                   /protein_id="CAP85396.1"
FT                   /translation="MEQQLDLTKLSESDKKELNQVLTNEAQKSNIQQTVHHLNEVCWEK
FT                   CITSKITSGTLDKSEEACAQNCVDRWMDTSLSILSKLDSMRGGPGH"
FT   exon            154391..154490
FT                   /gene="Pc20g00670"
FT                   /locus_tag="PCH_Pc20g00670"
FT                   /number=1
FT   intron          154491..154623
FT                   /gene="Pc20g00670"
FT                   /locus_tag="PCH_Pc20g00670"
FT                   /number=1
FT   exon            154624..154799
FT                   /gene="Pc20g00670"
FT                   /locus_tag="PCH_Pc20g00670"
FT                   /number=2
FT   mRNA            complement(join(<155566..155653,155712..155998,
FT                   156071..156120,156451..>156475))
FT                   /gene="Pc20g00680"
FT                   /locus_tag="PCH_Pc20g00680"
FT   CDS_pept        complement(join(155566..155653,155712..155998,
FT                   156071..156120,156451..156475))
FT                   /gene="Pc20g00680"
FT                   /locus_tag="PCH_Pc20g00680"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit L23a - Rattus norvegicus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00680"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85397"
FT                   /db_xref="GOA:B6HG15"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG15"
FT                   /inference="similar to AA sequence:PIR:R3RT3A"
FT                   /inference="protein motif:PFAM:PF03939"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /inference="protein motif:COGS:COG0089"
FT                   /protein_id="CAP85397.1"
FT                   /translation="MAPTDNKTGKNKANAAAKAVAKGASLHKSRKVRTSSTFHRPKTLQ
FT                   LSRSPKYPRVSVNHGPALDFNKIVLYPLNTESAMKKIEENNTLVFIVNVKSNKRQIKQA
FT                   LKKLYDVDTVKINTLIRPDGTKKAFARLTPDVDALDIAATKLAIV"
FT   exon            complement(155566..155653)
FT                   /gene="Pc20g00680"
FT                   /locus_tag="PCH_Pc20g00680"
FT                   /number=1
FT   intron          complement(155654..155711)
FT                   /gene="Pc20g00680"
FT                   /locus_tag="PCH_Pc20g00680"
FT                   /number=1
FT   exon            complement(155712..155998)
FT                   /gene="Pc20g00680"
FT                   /locus_tag="PCH_Pc20g00680"
FT                   /number=2
FT   intron          complement(155999..156070)
FT                   /gene="Pc20g00680"
FT                   /locus_tag="PCH_Pc20g00680"
FT                   /number=2
FT   exon            complement(156071..156120)
FT                   /gene="Pc20g00680"
FT                   /locus_tag="PCH_Pc20g00680"
FT                   /number=3
FT   intron          complement(156121..156450)
FT                   /gene="Pc20g00680"
FT                   /locus_tag="PCH_Pc20g00680"
FT                   /number=3
FT   exon            complement(156451..156475)
FT                   /gene="Pc20g00680"
FT                   /locus_tag="PCH_Pc20g00680"
FT                   /number=4
FT   mRNA            <156841..>157692
FT                   /gene="Pc20g00690"
FT                   /locus_tag="PCH_Pc20g00690"
FT   CDS_pept        156841..157692
FT                   /gene="Pc20g00690"
FT                   /locus_tag="PCH_Pc20g00690"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   YBR141c - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00690"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85398"
FT                   /db_xref="GOA:B6HG16"
FT                   /db_xref="InterPro:IPR021867"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG16"
FT                   /inference="similar to AA sequence:PIR:S46010"
FT                   /protein_id="CAP85398.1"
FT                   /translation="MAPQKRSKRPMLLSHSRPRIVKSKDAALSAKATRTLIRTHHRLLK
FT                   VRAQALAAGDEARVSSIDAQIEANGGLESYQIASKLGQSMDRGGDSSKVLIDWIKPQLK
FT                   QWNKAIPKLRVLEVGALSTKNACSTHPALDVTRIDLNSQEPGILKQDFMERPLPSSDDE
FT                   RFNIISLSLVLNYVPDATGRGEMLKHCVKFLTSKCPIELVPSLFMVLPIACVDNSRYLN
FT                   EERLGEILTCLGFRLAQSKRTSKLVFHLWEHTGTYAPKAFKKEELRSGKTRNNFAVILN
FT                   KK"
FT   exon            156841..157692
FT                   /gene="Pc20g00690"
FT                   /locus_tag="PCH_Pc20g00690"
FT                   /number=1
FT   mRNA            complement(join(<157751..158120,158171..158337,
FT                   158388..158485,158538..158666,158717..159687,
FT                   159741..>159892))
FT                   /gene="Pc20g00700"
FT                   /locus_tag="PCH_Pc20g00700"
FT   CDS_pept        complement(join(157751..158120,158171..158337,
FT                   158388..158485,158538..158666,158717..159687,
FT                   159741..159892))
FT                   /gene="Pc20g00700"
FT                   /locus_tag="PCH_Pc20g00700"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   YJR001w - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00700"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85399"
FT                   /db_xref="GOA:B6HG17"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG17"
FT                   /inference="similar to AA sequence:PIR:S55188"
FT                   /inference="protein motif:PFAM:PF01490"
FT                   /inference="protein motif:COGS:COG1113"
FT                   /inference="protein motif:COGS:COG0833"
FT                   /protein_id="CAP85399.1"
FT                   /translation="MSRAERTDEDLDNEPVYGSLRIPAAAPSSYDYGHLNSGSPTAESE
FT                   IGGRQRSSSYSIRVRQAGGPNSIDNFARSWQRAAAFPEILPRRSSFVSAHSDDELAIAT
FT                   GQEYGSRSSPSWGRHSDVERPLLRGDSDSDQDDGDTRAPESSKRALPSTGLLSSSFDRS
FT                   FANSYGTISSRVSESTRRHAIQFHREHHPQVHVDGSGDSDRGPLLIKHVQHEDGTEEDI
FT                   VVGQSTLPQTIFNSVNVLIGIGLLSLPLAMKHAGWVLGLVFLIFSAVATSYTAKILAKC
FT                   LDVDRSVVTYADLAYISFGQHARLITSFLFCLELLGACVALVVLFADSLYALVPGLSIL
FT                   QWKIVCGVVLLPLNFLPLRFLSITSILGIISCTSIVVLICIDGFIKPDAPGSLRQPANT
FT                   FLFPENWATVPLSFGLIMSPWGGHGVFPNIYRDMRHPQKYGKSLWVTYIFTFALDCSMA
FT                   IIGWLMFGDIIRDEVTANILTITDYPQSLSVCIVVFISIIPLTKVPLNARPLVATFEVL
FT                   CGLGGGHVPAENGSKTLQKVSRAMVRVFVVATIVILAIVFPAFDRIMAFLGSFLCFTIC
FT                   IIFPLAFYLKIFGKEIGRGEYILDWVLLIVSSILAAVGTVWAFLPQDMLSAN"
FT   exon            complement(157751..158120)
FT                   /gene="Pc20g00700"
FT                   /locus_tag="PCH_Pc20g00700"
FT                   /number=1
FT   intron          complement(158121..158170)
FT                   /gene="Pc20g00700"
FT                   /locus_tag="PCH_Pc20g00700"
FT                   /number=1
FT   exon            complement(158171..158337)
FT                   /gene="Pc20g00700"
FT                   /locus_tag="PCH_Pc20g00700"
FT                   /number=2
FT   intron          complement(158338..158387)
FT                   /gene="Pc20g00700"
FT                   /locus_tag="PCH_Pc20g00700"
FT                   /number=2
FT   exon            complement(158388..158485)
FT                   /gene="Pc20g00700"
FT                   /locus_tag="PCH_Pc20g00700"
FT                   /number=3
FT   intron          complement(158486..158537)
FT                   /gene="Pc20g00700"
FT                   /locus_tag="PCH_Pc20g00700"
FT                   /number=3
FT   exon            complement(158538..158666)
FT                   /gene="Pc20g00700"
FT                   /locus_tag="PCH_Pc20g00700"
FT                   /number=4
FT   intron          complement(158667..158716)
FT                   /gene="Pc20g00700"
FT                   /locus_tag="PCH_Pc20g00700"
FT                   /number=4
FT   exon            complement(158717..159687)
FT                   /gene="Pc20g00700"
FT                   /locus_tag="PCH_Pc20g00700"
FT                   /number=5
FT   intron          complement(159688..159740)
FT                   /gene="Pc20g00700"
FT                   /locus_tag="PCH_Pc20g00700"
FT                   /number=5
FT   exon            complement(159741..159892)
FT                   /gene="Pc20g00700"
FT                   /locus_tag="PCH_Pc20g00700"
FT                   /number=6
FT   mRNA            join(<160884..161004,161059..161108,161167..161538,
FT                   161593..162349,162423..162572,162630..162661,
FT                   162691..>162696)
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT   CDS_pept        join(160884..161004,161059..161108,161167..161538,
FT                   161593..162349,162423..162572,162630..162661,
FT                   162691..162696)
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /note="Title: strong similarity to peptide chain release
FT                   factor eRF-1 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00710"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85400"
FT                   /db_xref="GOA:B6HG18"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG18"
FT                   /inference="similar to AA sequence:PIR:S50853"
FT                   /inference="protein motif:PFAM:PF03463"
FT                   /inference="protein motif:PFAM:PF03464"
FT                   /inference="protein motif:PFAM:PF03465"
FT                   /inference="protein motif:COGS:COG1503"
FT                   /inference="protein motif:COGS:COG1537"
FT                   /protein_id="CAP85400.1"
FT                   /translation="MSAPPPNEAEKNIEIWKVKKLIKRLESARGNGTSMISLIIPPKDQ
FT                   ISRAAKMLAEEYGTASNIKSRVNRLSVLSAITSTQQRLKLYNKVPPNGLVVYCGEIITS
FT                   EGKERKINIDFEPFKPINTSLYLCDNKFHTEALSELLEADQKFGFIVMDGNGTLFGTLS
FT                   GNTREILQRLTVDLPKKHGRGGQSALRFSRLREEKRHNYVRKIAELAVQNYITNDKPNV
FT                   AGLVLAGSADFKNDLNQSDLFDGRLQSKVIKVVDVSYGGENGFNQAIELAGETLSNVKF
FT                   VQEKKLIGQYFQEISQDTGRVCYGIEDTLKAMELGAAEILIVHENLEITRWVMKNAAGN
FT                   QVIVHTNKVQESQKDLFQDKETGLDMEVVESGSFLEWLAEAYKDFGANLEFVSDRSGEG
FT                   NQFVKGFGGIGAILRYKVNFEQLADLSDDDEFYDESEDERPEAPAASLLTARPVDHASG
FT                   SRDGTKASVKDNQKRPGPRSLKLLRVSSKLQGTHTEV"
FT   exon            160884..161004
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /number=1
FT   intron          161005..161058
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /number=1
FT   exon            161059..161108
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /number=2
FT   intron          161109..161166
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /number=2
FT   exon            161167..161538
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /number=3
FT   intron          161539..161592
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /number=3
FT   exon            161593..162349
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /number=4
FT   intron          162350..162422
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /number=4
FT   exon            162423..162572
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /number=5
FT   intron          162573..162629
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /number=5
FT   exon            162630..162661
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /number=6
FT   intron          162662..162690
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /number=6
FT   exon            162691..162696
FT                   /gene="Pc20g00710"
FT                   /locus_tag="PCH_Pc20g00710"
FT                   /number=7
FT   mRNA            complement(join(<163128..164027,164091..>164144))
FT                   /gene="Pc20g00720"
FT                   /locus_tag="PCH_Pc20g00720"
FT   CDS_pept        complement(join(163128..164027,164091..164144))
FT                   /gene="Pc20g00720"
FT                   /locus_tag="PCH_Pc20g00720"
FT                   /note="unknown EC_number=4.2.1.51"
FT                   /note="Title: strong similarity to hypothetical chorismate
FT                   mutase/prephenate dehydratase pheA - Aquifex aeolicus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00720"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85401"
FT                   /db_xref="GOA:B6HG19"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG19"
FT                   /inference="similar to AA sequence:PIR:B70382"
FT                   /inference="protein motif:PFAM:PF00800"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /inference="protein motif:COGS:COG0077"
FT                   /protein_id="CAP85401.1"
FT                   /translation="MAPFKVAFLGPLGSFSHQAAAESFCKLSADLQPQVSFPDAFAALQ
FT                   KKEVDYAVIPCENSTNGSVMQTLDLLADRDGSYKDVKVCGEYYLTVHHFLMVRKGTYPG
FT                   GWAEYDGSITKLYTHPQAWGQCEAFLTKYFKGIERQDVTSTSKAAEIVSKETTERGAAI
FT                   ANRFAAEQHGTDVLVENIEDRADNTTRFLIFRNVLDERTSEFKFEQPNPPTLEGELALE
FT                   TTHKTLISFTIDHSSPGALANALLIFKAHGLNLTSINTRPSLKKPWQYIFFVECGRTPS
FT                   DENKEAVHKALNDLRQVTETCRDLGTWKDQLSASNA"
FT   exon            complement(163128..164027)
FT                   /gene="Pc20g00720"
FT                   /locus_tag="PCH_Pc20g00720"
FT                   /number=1
FT   mat_peptide     complement(163131..164018)
FT                   /gene="Pc20g00720"
FT                   /locus_tag="PCH_Pc20g00720"
FT   sig_peptide     complement(join(164019..164027,164091..164144))
FT                   /gene="Pc20g00720"
FT                   /locus_tag="PCH_Pc20g00720"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(164028..164090)
FT                   /gene="Pc20g00720"
FT                   /locus_tag="PCH_Pc20g00720"
FT                   /number=1
FT   exon            complement(164091..164144)
FT                   /gene="Pc20g00720"
FT                   /locus_tag="PCH_Pc20g00720"
FT                   /number=2
FT   mRNA            join(<164406..165090,165156..>165532)
FT                   /gene="Pc20g00730"
FT                   /locus_tag="PCH_Pc20g00730"
FT   CDS_pept        join(164406..165090,165156..165532)
FT                   /gene="Pc20g00730"
FT                   /locus_tag="PCH_Pc20g00730"
FT                   /note="Title: similarity to hypothetical protein
FT                   SPBC1105.15c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00730"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85402"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC4"
FT                   /inference="similar to AA sequence:PIR:T39292"
FT                   /inference="protein motif:COGS:COG3777"
FT                   /protein_id="CAP85402.1"
FT                   /translation="MKTNPLRPLISLRGGRHACRTYSSLSERLHYELTTRKLPLTYDYL
FT                   HPQPSHLLNLTLRDLLPQSKNSSGYATLPTLQNPSPLPVGHHLIYFPPQVTLSQLLPDC
FT                   TDTLHTPGEPFNRRLWAGGNLRFPVRSPPLDGSRAVCIESIRNVTVKGREGDEKVTVTI
FT                   ERRIGNVAEQETAEETWERIWKENEDNSGESSVIENRDLIFMRLKTSAQIEADKAQFGK
FT                   PGRTVKPPSGATFRHALIPTKALLFRFSALTFNAHSIHLDKSYTQNQEGYPNLLVHGPL
FT                   TLTLLLSVLQQQLSRLNLCISDIEYKNIAPLFVEQELVICGKPKNDTGAWDVWIEGPDG
FT                   GLAVRGTARTRLE"
FT   exon            164406..165090
FT                   /gene="Pc20g00730"
FT                   /locus_tag="PCH_Pc20g00730"
FT                   /number=1
FT   intron          165091..165155
FT                   /gene="Pc20g00730"
FT                   /locus_tag="PCH_Pc20g00730"
FT                   /number=1
FT   exon            165156..165532
FT                   /gene="Pc20g00730"
FT                   /locus_tag="PCH_Pc20g00730"
FT                   /number=2
FT   mRNA            join(<165868..165902,165957..166135,166194..166279,
FT                   166655..166697,166751..>167178)
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT   CDS_pept        join(165868..165902,165957..166135,166194..166279,
FT                   166655..166697,166751..167178)
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An17g02180 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85403"
FT                   /db_xref="GOA:B6HGC5"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC5"
FT                   /inference="protein motif:PFAM:PF04511"
FT                   /inference="protein motif:COGS:COG5291"
FT                   /protein_id="CAP85403.1"
FT                   /translation="MDVFWAAPPVTRTLTALTLVQSALMYGGLLSFYWAPFLPSLIFSW
FT                   RPQIYRLVTPFLLTGPKLGFFFDLYIMYRYGSAAEKSMAPGEFLIYLLFVAFSIMLTAG
FT                   GYLGAAILLPPLTMAFVYTFSQTNRGTKTRFWFIDIPVVFLPYAMLLVTMVSNGWDAAL
FT                   VESTGILAAHTYDFLTRIYPTFGGGRNFITVPGFLERYFTEHDPNSGYRGYGTASRAPR
FT                   PAGQPSSASASGSTWGSWTSSSSWNGRGAGRRLG"
FT   sig_peptide     join(165868..165902,165957..166053)
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            165868..165902
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT                   /number=1
FT   intron          165903..165956
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT                   /number=1
FT   exon            165957..166135
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT                   /number=2
FT   mat_peptide     join(166054..166135,166194..166279,166655..166697,
FT                   166751..167175)
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT   intron          166136..166193
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT                   /number=2
FT   exon            166194..166279
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT                   /number=3
FT   intron          166280..166654
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT                   /number=3
FT   exon            166655..166697
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT                   /number=4
FT   intron          166698..166750
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT                   /number=4
FT   exon            166751..167178
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT                   /number=5
FT   mRNA            join(<167606..167714,167770..167926,167994..168625,
FT                   168685..168911,168965..>169261)
FT                   /gene="Pc20g00750"
FT                   /locus_tag="PCH_Pc20g00750"
FT   CDS_pept        join(167606..167714,167770..167926,167994..168625,
FT                   168685..168911,168965..169261)
FT                   /gene="Pc20g00750"
FT                   /locus_tag="PCH_Pc20g00750"
FT                   /note="Title: strong similarity to
FT                   centromere/microtubule-binding protein Cbf5 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00750"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85404"
FT                   /db_xref="GOA:B6HGC6"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC6"
FT                   /inference="similar to AA sequence:PIR:S41853"
FT                   /inference="protein motif:PFAM:PF01509"
FT                   /inference="protein motif:PFAM:PF01472"
FT                   /inference="protein motif:COGS:COG0130"
FT                   /protein_id="CAP85404.1"
FT                   /translation="MAVVKTSEMDYAIKPEASVPSVDTSDWPLLLKNYEKLLVRTGHFT
FT                   PIPAGSSPLSRDLKSYISSGVINLDKPSNPSSHEVVAWMKRILRSEKTGHSGTLDPKVT
FT                   GCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKIPGGEAQFVRALETLTGALFQRPPLI
FT                   SAVKRQLRIRTIHESKNYEFDNERHLGVFWVSCEAGTYIRTLCVHLGLLLGVGAHMQEL
FT                   RRVRSGAMGEGEGMVTLHDVMDAQWVYDNNRDESYLRKVISPLESLLTGYKRIVVKDSA
FT                   VNAVCYGAKLMIPGLLRYEAGIECHEEVVLMTTKGEAIAIGIAQMSTVELTTCDHGVVA
FT                   KVKRCIMERDLYPRRWGLGPTALEKKKMKTAGTLDKYGRPNDATPAQWKSEYKDFNLPI
FT                   TGTAAVAPSAETKTETEAPKVESPEPVKEEVEDKKRKRDGETAEEKAERKKKKKEKKEK
FT                   KERRKSKQDDSDDSD"
FT   exon            167606..167714
FT                   /gene="Pc20g00750"
FT                   /locus_tag="PCH_Pc20g00750"
FT                   /number=1
FT   intron          167715..167769
FT                   /gene="Pc20g00750"
FT                   /locus_tag="PCH_Pc20g00750"
FT                   /number=1
FT   exon            167770..167926
FT                   /gene="Pc20g00750"
FT                   /locus_tag="PCH_Pc20g00750"
FT                   /number=2
FT   intron          167927..167993
FT                   /gene="Pc20g00750"
FT                   /locus_tag="PCH_Pc20g00750"
FT                   /number=2
FT   exon            167994..168625
FT                   /gene="Pc20g00750"
FT                   /locus_tag="PCH_Pc20g00750"
FT                   /number=3
FT   intron          168626..168684
FT                   /gene="Pc20g00750"
FT                   /locus_tag="PCH_Pc20g00750"
FT                   /number=3
FT   exon            168685..168911
FT                   /gene="Pc20g00750"
FT                   /locus_tag="PCH_Pc20g00750"
FT                   /number=4
FT   intron          168912..168964
FT                   /gene="Pc20g00750"
FT                   /locus_tag="PCH_Pc20g00750"
FT                   /number=4
FT   exon            168965..169261
FT                   /gene="Pc20g00750"
FT                   /locus_tag="PCH_Pc20g00750"
FT                   /number=5
FT   mRNA            join(<169815..169868,169927..170466,170524..170718,
FT                   170771..>171202)
FT                   /gene="Pc20g00760"
FT                   /locus_tag="PCH_Pc20g00760"
FT   CDS_pept        join(169815..169868,169927..170466,170524..170718,
FT                   170771..171202)
FT                   /gene="Pc20g00760"
FT                   /locus_tag="PCH_Pc20g00760"
FT                   /note="Title: strong similarity to erythroblast macrophage
FT                   protein EMP - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00760"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85405"
FT                   /db_xref="GOA:B6HGC7"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="InterPro:IPR027714"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC7"
FT                   /inference="similar to AA sequence:TREMBLNEW:AK001088.1"
FT                   /inference="protein motif:COGS:COG5109"
FT                   /protein_id="CAP85405.1"
FT                   /translation="MAAELTSTKLNPESHIILDQPLLRLPHELARRNFKTVQRAVEREK
FT                   EYIIPAIKETAAASLSNTQTPDQTLAALDAMISRMQGLKRKMESLQEEEKKIHNQSRKR
FT                   IQHLETLHKIPSLADVKYDQWSRVRLDRLLVDHMLRSGYSESAKQLAQDRGVEELVDLG
FT                   VFTQCQRVVDSLRRGETKEALQWCGENKAALKKSQHNLEFELRLQQYIEMVRTQDKSKK
FT                   IEAIIHAKKYLIPNHQSQNSEIMRAAGLLVFTQDTRAEPYKSLFALDRWRVLAQLFIQT
FT                   HHELLSLPSQPLLHIALSAGLSALKTPLCHSAYTSSSSNSQSTSTSVCPICSTELNELA
FT                   RKMPYAHHSKSYVESDPIVLPNGRVYGKQRLMEISRKMGSVGPGKVKDPTTGEVFHESE
FT                   MKKVYIM"
FT   exon            169815..169868
FT                   /gene="Pc20g00760"
FT                   /locus_tag="PCH_Pc20g00760"
FT                   /number=1
FT   intron          169869..169926
FT                   /gene="Pc20g00760"
FT                   /locus_tag="PCH_Pc20g00760"
FT                   /number=1
FT   exon            169927..170466
FT                   /gene="Pc20g00760"
FT                   /locus_tag="PCH_Pc20g00760"
FT                   /number=2
FT   intron          170467..170523
FT                   /gene="Pc20g00760"
FT                   /locus_tag="PCH_Pc20g00760"
FT                   /number=2
FT   exon            170524..170718
FT                   /gene="Pc20g00760"
FT                   /locus_tag="PCH_Pc20g00760"
FT                   /number=3
FT   intron          170719..170770
FT                   /gene="Pc20g00760"
FT                   /locus_tag="PCH_Pc20g00760"
FT                   /number=3
FT   exon            170771..171202
FT                   /gene="Pc20g00760"
FT                   /locus_tag="PCH_Pc20g00760"
FT                   /number=4
FT   mRNA            complement(join(<171294..172264,172515..>172740))
FT                   /gene="Pc20g00770"
FT                   /locus_tag="PCH_Pc20g00770"
FT   CDS_pept        complement(join(171294..172264,172515..172740))
FT                   /gene="Pc20g00770"
FT                   /locus_tag="PCH_Pc20g00770"
FT                   /note="Title: similarity to hypothetical protein YIL096c
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00770"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85406"
FT                   /db_xref="InterPro:IPR019446"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC8"
FT                   /inference="similar to AA sequence:PIR:S48477"
FT                   /protein_id="CAP85406.1"
FT                   /translation="MPRNNKKVKNAPPPRPRGPSKPAGLSSYPAKGQQHGNGQKQGNSN
FT                   ANVPKKASMQANQRPIVPFLRKDRILLIGEGDFSFGRSLAKQYKCRNLCATCYDSKEAL
FT                   YDKYPQAPQNVSDILSASAKPKPASDETEKQPEENKSEDQDSTNPSQQTPKVVFSVDAR
FT                   KLGAPTGGGKEIRTGFARRERKRPAWYQQNEPAGPPYQPGGPWDVICFNFPHVGGLSTD
FT                   VNRQVRANQELLVAFFKACVPLVSKPPPLMDAEDDEWVYADGEESDEEDEDEDEEGGEG
FT                   EELGKDDDTTGKGFRTGPGQILVTLFEGEPYTLWNIKDLARHAGLVVVTSFRFPWTSYE
FT                   GYSHARTAGHIEGKDGERGGWRGEDREARMYVFEVKQKEPAKKGGKKRSRDDDSSDSE"
FT   exon            complement(171294..172264)
FT                   /gene="Pc20g00770"
FT                   /locus_tag="PCH_Pc20g00770"
FT                   /number=1
FT   intron          complement(172265..172514)
FT                   /gene="Pc20g00770"
FT                   /locus_tag="PCH_Pc20g00770"
FT                   /number=1
FT   exon            complement(172515..172740)
FT                   /gene="Pc20g00770"
FT                   /locus_tag="PCH_Pc20g00770"
FT                   /number=2
FT   mRNA            complement(join(<173058..173254,173521..173725,
FT                   173782..>174306))
FT                   /gene="Pc20g00780"
FT                   /locus_tag="PCH_Pc20g00780"
FT   CDS_pept        complement(join(173058..173254,173521..173725,
FT                   173782..174306))
FT                   /gene="Pc20g00780"
FT                   /locus_tag="PCH_Pc20g00780"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg03030.1 - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00780"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85407"
FT                   /db_xref="GOA:B6HGC9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC9"
FT                   /inference="protein motif:COGS:COG5048"
FT                   /protein_id="CAP85407.1"
FT                   /translation="MFTCTPCNRRYNDQASLDYHLLFSPCHAHKCGSCSKYFTSEADLI
FT                   AHAAEARHHAFECKPCGQIFKSGNLLRVHRESNLHRRMINSPLNTFFRSWPNFPFHVQL
FT                   PPHKSWEQLHMFYGWDDQTPEYRAAWIRYQDALASEVTIWFGDVLELDSWQKLCRAVGI
FT                   APLPGTCADGYMAIRNLYVNLIDLIQWARTGKADGEVQRWKNNVDLFEYSIATKRIFER
FT                   DMTTNDKPNVVLRHLANCMLPRRELILPGAALLLVSWLISTTYVWLSPFLLGYSKGRGI
FT                   LVFFWNALLVVAFSFLPLCLEHQLRPS"
FT   exon            complement(173058..173254)
FT                   /gene="Pc20g00780"
FT                   /locus_tag="PCH_Pc20g00780"
FT                   /number=1
FT   intron          complement(173255..173520)
FT                   /gene="Pc20g00780"
FT                   /locus_tag="PCH_Pc20g00780"
FT                   /number=1
FT   exon            complement(173521..173725)
FT                   /gene="Pc20g00780"
FT                   /locus_tag="PCH_Pc20g00780"
FT                   /number=2
FT   intron          complement(173726..173781)
FT                   /gene="Pc20g00780"
FT                   /locus_tag="PCH_Pc20g00780"
FT                   /number=2
FT   exon            complement(173782..174306)
FT                   /gene="Pc20g00780"
FT                   /locus_tag="PCH_Pc20g00780"
FT                   /number=3
FT   mRNA            complement(join(<175014..175447,175504..175875,
FT                   175935..176022,176076..>176318))
FT                   /gene="Pc20g00790"
FT                   /locus_tag="PCH_Pc20g00790"
FT   CDS_pept        complement(join(175014..175447,175504..175875,
FT                   175935..176022,176076..176318))
FT                   /gene="Pc20g00790"
FT                   /locus_tag="PCH_Pc20g00790"
FT                   /note="Title: strong similarity to vanadate resistance
FT                   protein Van2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00790"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85408"
FT                   /db_xref="GOA:B6HGD0"
FT                   /db_xref="InterPro:IPR038736"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD0"
FT                   /inference="similar to AA sequence:PIR:S50238"
FT                   /inference="protein motif:COGS:COG5070"
FT                   /protein_id="CAP85408.1"
FT                   /translation="MAEDKKSDDYTVDMNKVDQGNKEFEAAPPPTPSPRASSTVSNNPA
FT                   FPVLAYCGSSIMMTVMNKYVLSGLDFNLNFLLLCVQSLVCIAAIQTCKSMGLITFRDFN
FT                   TDEARKWFPITLLLIGMIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTNL
FT                   TLFSFGLMVFSSLIAAWADIKHAVESTGDTSSKVSTLNAGYVWMLINCLCTSSYVLGMR
FT                   KRIKLTNFKDFDTMFYNNLLSIPVLIVLTLLVEDWSSANLARNFPEANRDGIFFAMVLS
FT                   GASSVFISYTSAWCVRTTSSTTYSMVGALNKLPIALSGLIFFDAPVTFPSVSAIAIGFV
FT                   SGIVYAVAKIKQNSKPRTGVLPTPVSASSQSMRDSLRS"
FT   exon            complement(175014..175447)
FT                   /gene="Pc20g00790"
FT                   /locus_tag="PCH_Pc20g00790"
FT                   /number=1
FT   intron          complement(175448..175503)
FT                   /gene="Pc20g00790"
FT                   /locus_tag="PCH_Pc20g00790"
FT                   /number=1
FT   exon            complement(175504..175875)
FT                   /gene="Pc20g00790"
FT                   /locus_tag="PCH_Pc20g00790"
FT                   /number=2
FT   intron          complement(175876..175934)
FT                   /gene="Pc20g00790"
FT                   /locus_tag="PCH_Pc20g00790"
FT                   /number=2
FT   exon            complement(175935..176022)
FT                   /gene="Pc20g00790"
FT                   /locus_tag="PCH_Pc20g00790"
FT                   /number=3
FT   intron          complement(176023..176075)
FT                   /gene="Pc20g00790"
FT                   /locus_tag="PCH_Pc20g00790"
FT                   /number=3
FT   exon            complement(176076..176318)
FT                   /gene="Pc20g00790"
FT                   /locus_tag="PCH_Pc20g00790"
FT                   /number=4
FT   mRNA            <177119..>177811
FT                   /gene="Pc20g00800"
FT                   /locus_tag="PCH_Pc20g00800"
FT   CDS_pept        177119..177811
FT                   /gene="Pc20g00800"
FT                   /locus_tag="PCH_Pc20g00800"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An17g02130 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00800"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85409"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD1"
FT                   /inference="protein motif:COGS:COG0526"
FT                   /inference="protein motif:COGS:COG3118"
FT                   /protein_id="CAP85409.1"
FT                   /translation="MPDSDDDALFAALENEDDTHYRDQRIHQLNAELAATKNNHSARAT
FT                   SGNTGLIQNEVYPTLSTDQSVLDFTTRTSRCLVHFAHPDFLRCAVMDMKLGELANAHYE
FT                   VSFARVDVRNTPFIAQKLGIKVLPCVIGFKDGVGVDRVVGFEGLEARGFDGVEGFDVKV
FT                   LEKRLVFKGILLAVKIGAGDDDDVREEEESDDGAGGRGFGRKKGRRGIRGSNPNVRNRG
FT                   DDDDDDWD"
FT   exon            177119..177811
FT                   /gene="Pc20g00800"
FT                   /locus_tag="PCH_Pc20g00800"
FT                   /number=1
FT   mRNA            complement(join(<178423..180007,180070..>180080))
FT                   /gene="Pc20g00810"
FT                   /locus_tag="PCH_Pc20g00810"
FT   CDS_pept        complement(join(178423..180007,180070..180080))
FT                   /gene="Pc20g00810"
FT                   /locus_tag="PCH_Pc20g00810"
FT                   /note="unknown EC_number=2.4.1.34"
FT                   /note="Title: strong similarity to 1,3-beta-glucan synthase
FT                   gs-1 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00810"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85410"
FT                   /db_xref="GOA:B6HGD2"
FT                   /db_xref="InterPro:IPR009203"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD2"
FT                   /inference="similar to AA sequence:PIR:T46649"
FT                   /inference="protein motif:COGS:COG4282"
FT                   /protein_id="CAP85410.1"
FT                   /translation="MANMLTSTWRSFWHTMTSYDRHASHDSPYRTGRHVPLSQSRHEPL
FT                   TSVATSAIESRPDLSNPYDDEPTKGSASAQASEWNGSPDGLGSPTQPYSPGMRSVASQK
FT                   RRSNDQGEGAPEIQMQSFHDGAPPPPPVAHSWRKIERWLEHNYEELHDQLGEGCTQNDI
FT                   NELEHELDCSLPLEVRESLMVHDGQERGGLPTGVIFSAMLLDCEEIVQEWRNWKKVNDE
FT                   YLSNATVMQNPPASSSAASSSAAGPSQQASTLWQSDLLDRQDSQPPGAVQKSYAHPAWI
FT                   PLARDWGGNNLAIDLAPGPAGKWGQVIIFGRDYDCKYVVARSWAGFLATLADDLCSGHV
FT                   IVDEETNELKLKQFKAQNVEPPYLEILRWRADQKYGRRVPRRKGPVPNGLGVNAAGNRS
FT                   SSRESPYGSPTRAEERGRSPHRFSKGGNAQSPKTPFGVSSPLARVTEETTSPVVTAGPT
FT                   ISEDAKENGKEPQTEDLMEVVTPQISNKENEGFSKPNELKESDKAEKSEKTDSVESSTA
FT                   IESEVLGEMKNVAI"
FT   exon            complement(178423..180007)
FT                   /gene="Pc20g00810"
FT                   /locus_tag="PCH_Pc20g00810"
FT                   /number=1
FT   intron          complement(180008..180069)
FT                   /gene="Pc20g00810"
FT                   /locus_tag="PCH_Pc20g00810"
FT                   /number=1
FT   exon            complement(180070..180080)
FT                   /gene="Pc20g00810"
FT                   /locus_tag="PCH_Pc20g00810"
FT                   /number=2
FT   mRNA            complement(join(<182088..182902,182958..>183035))
FT                   /gene="Pc20g00820"
FT                   /locus_tag="PCH_Pc20g00820"
FT   CDS_pept        complement(join(182088..182902,182958..183035))
FT                   /pseudo
FT                   /gene="Pc20g00820"
FT                   /locus_tag="PCH_Pc20g00820"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to conserved hypothetical
FT                   protein - Neurospora crassa [putative pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:NC103E1.4"
FT   exon            complement(182088..182902)
FT                   /gene="Pc20g00820"
FT                   /locus_tag="PCH_Pc20g00820"
FT                   /number=1
FT   intron          complement(182903..182957)
FT                   /gene="Pc20g00820"
FT                   /locus_tag="PCH_Pc20g00820"
FT                   /number=1
FT   exon            complement(182958..183035)
FT                   /gene="Pc20g00820"
FT                   /locus_tag="PCH_Pc20g00820"
FT                   /number=2
FT   mRNA            <183895..>184422
FT                   /gene="Pc20g00830"
FT                   /locus_tag="PCH_Pc20g00830"
FT   CDS_pept        183895..184422
FT                   /gene="Pc20g00830"
FT                   /locus_tag="PCH_Pc20g00830"
FT                   /note="Title: similarity to hypothetical protein An12g06250
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00830"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85412"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD3"
FT                   /protein_id="CAP85412.1"
FT                   /translation="MNLNGLSWPTKHLHASTRNGSTWGYVIYRTTYTPHSNAAFLRIIE
FT                   LLNSYMKQGLYSECVSSENNTSMDTDLTTYHEIWAQHRPIVMNHPRFDGASIDSIRAHF
FT                   RCWVGQQEDQGYCTQYRMCMVIDEESLQTLLDAPPPQESSDEKIIDPMRHVKVVTLLPD
FT                   SDDDEFDSFLGG"
FT   exon            183895..184422
FT                   /gene="Pc20g00830"
FT                   /locus_tag="PCH_Pc20g00830"
FT                   /number=1
FT   mRNA            complement(<186091..>187497)
FT                   /gene="Pc20g00840"
FT                   /locus_tag="PCH_Pc20g00840"
FT   CDS_pept        complement(186091..187497)
FT                   /gene="Pc20g00840"
FT                   /locus_tag="PCH_Pc20g00840"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An17g02110 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00840"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85413"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD4"
FT                   /protein_id="CAP85413.1"
FT                   /translation="MSTQSPHSPTPKGSRNNRRPQKKNTTPHAQKPALLSTPPSSPPRN
FT                   MSSGAIQVDPSNNFNSSKKKPMRSGKKSRDNKASPAPHSGYHSNGYNSGPRHTPSRPAV
FT                   TSPQTKPSPAYAGPTFHASPAPSALPIPSFFSKSAPDANLVPPMETDSDDADVDPELEM
FT                   TPSKPRNRNNQSKGEEPKPSPLDFLFKAAVQARDQKSTSSPEVNKVLQSPQTEPRVVRP
FT                   NADGMFTFEMGNSDYNRNSNIGPSFAPSYQDRMNALRPSSTPQSPDMTEEERRTKTEEL
FT                   KHLLLNPPPQKPPSSAYASPEYAGPFGSRPSNVPPYATPMRTSSGPQLTASHGSFSSPQ
FT                   LQQQQISQNNGRRHYQYPTHSHSPLRREVDMVPPPSMPPYRGPVSNNTSNGGSPAPYGN
FT                   PYMTMSQQQQQQQQSGYASPHPDYAPSSFQIPVNSPSPSRVVDTAQIENDIRRVLKLDA
FT                   SGPPVTQSSA"
FT   exon            complement(186091..187497)
FT                   /gene="Pc20g00840"
FT                   /locus_tag="PCH_Pc20g00840"
FT                   /number=1
FT   mRNA            join(<188262..188366,188422..188500,188562..188632,
FT                   188698..>188796)
FT                   /gene="Pc20g00850"
FT                   /locus_tag="PCH_Pc20g00850"
FT   CDS_pept        join(188262..188366,188422..188500,188562..188632,
FT                   188698..188796)
FT                   /gene="Pc20g00850"
FT                   /locus_tag="PCH_Pc20g00850"
FT                   /note="Title: strong similarity to ring-box protein 1 RBX1
FT                   - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00850"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85414"
FT                   /db_xref="GOA:B6HGD5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024766"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD5"
FT                   /inference="similar to AA sequence:TREMBL:BC017370.1"
FT                   /inference="protein motif:COGS:COG5194"
FT                   /inference="protein motif:COGS:COG5540"
FT                   /inference="protein motif:COGS:COG5183"
FT                   /inference="protein motif:COGS:COG5243"
FT                   /inference="protein motif:COGS:COG5219"
FT                   /inference="protein motif:COGS:COG0553"
FT                   /inference="protein motif:COGS:COG5574"
FT                   /inference="protein motif:COGS:COG5432"
FT                   /protein_id="CAP85414.1"
FT                   /translation="MTDVEMKEAATGSSKGKAVAKGSDNADKKKFEVKKWNAVALWAWD
FT                   IVVDNCAICRNHIMDLCIECQANQGSSTTEECTVAWGICNHAFHFHCISRWLKTRQVCP
FT                   LDNRDWEFQKYGR"
FT   exon            188262..188366
FT                   /gene="Pc20g00850"
FT                   /locus_tag="PCH_Pc20g00850"
FT                   /number=1
FT   intron          188367..188421
FT                   /gene="Pc20g00850"
FT                   /locus_tag="PCH_Pc20g00850"
FT                   /number=1
FT   exon            188422..188500
FT                   /gene="Pc20g00850"
FT                   /locus_tag="PCH_Pc20g00850"
FT                   /number=2
FT   intron          188501..188561
FT                   /gene="Pc20g00850"
FT                   /locus_tag="PCH_Pc20g00850"
FT                   /number=2
FT   exon            188562..188632
FT                   /gene="Pc20g00850"
FT                   /locus_tag="PCH_Pc20g00850"
FT                   /number=3
FT   intron          188633..188697
FT                   /gene="Pc20g00850"
FT                   /locus_tag="PCH_Pc20g00850"
FT                   /number=3
FT   exon            188698..188796
FT                   /gene="Pc20g00850"
FT                   /locus_tag="PCH_Pc20g00850"
FT                   /number=4
FT   mRNA            complement(join(<189072..189269,189331..189390,
FT                   189470..>189517))
FT                   /gene="Pc20g00860"
FT                   /locus_tag="PCH_Pc20g00860"
FT   CDS_pept        complement(join(189072..189269,189331..189390,
FT                   189470..189517))
FT                   /gene="Pc20g00860"
FT                   /locus_tag="PCH_Pc20g00860"
FT                   /note="Title: similarity to signal peptidase subunit like
FT                   protein An17g02095 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00860"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85415"
FT                   /db_xref="GOA:B6HGD6"
FT                   /db_xref="InterPro:IPR009542"
FT                   /db_xref="InterPro:IPR037713"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD6"
FT                   /protein_id="CAP85415.1"
FT                   /translation="MDELLAPIQDVIEGQIDFHGQRLAELLSTVLLVISGAASFVIGYI
FT                   YQDIHLTLWTGLAGTLFTAFVVVPPWPVYNRNPEKWLGSTSANAAPGITVDGVKVQ"
FT   exon            complement(189072..189269)
FT                   /gene="Pc20g00860"
FT                   /locus_tag="PCH_Pc20g00860"
FT                   /number=1
FT   intron          complement(189270..189330)
FT                   /gene="Pc20g00860"
FT                   /locus_tag="PCH_Pc20g00860"
FT                   /number=1
FT   exon            complement(189331..189390)
FT                   /gene="Pc20g00860"
FT                   /locus_tag="PCH_Pc20g00860"
FT                   /number=2
FT   intron          complement(189391..189469)
FT                   /gene="Pc20g00860"
FT                   /locus_tag="PCH_Pc20g00860"
FT                   /number=2
FT   exon            complement(189470..189517)
FT                   /gene="Pc20g00860"
FT                   /locus_tag="PCH_Pc20g00860"
FT                   /number=3
FT   mRNA            complement(join(<190187..190531,190588..190886,
FT                   190997..>191414))
FT                   /gene="Pc20g00870"
FT                   /locus_tag="PCH_Pc20g00870"
FT   CDS_pept        complement(join(190187..190531,190588..190886,
FT                   190997..191414))
FT                   /gene="Pc20g00870"
FT                   /locus_tag="PCH_Pc20g00870"
FT                   /note="unknown EC_number=2.7.1.39"
FT                   /note="Title: strong similarity to homoserine kinase Thr1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00870"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85416"
FT                   /db_xref="GOA:B6HGD7"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD7"
FT                   /inference="similar to AA sequence:TREMBL:SCTHR1.1"
FT                   /inference="protein motif:PFAM:PF00288"
FT                   /inference="protein motif:COGS:COG0083"
FT                   /inference="protein motif:COGS:COG0153"
FT                   /protein_id="CAP85416.1"
FT                   /translation="MSSFVIKIPCSSANIGPGFDVIGLALSLHLDLHVTIEAKPSSQEP
FT                   FNCAITYEDQSKSVEQISLDPEVNLITRVALYVLRCHDQRAFPVETKVHIVNPIPLGRG
FT                   LGSSGTAVVAGVMLGNEVGKLGLSKERLLDYCLMIERHPDNVAASLFGGFVGTYLNELK
FT                   PEDVARKEIPLSEVLPAPAGGVDTGIRPPEPPMAIGHYRKFNWAPEIKAIAIIPDFVVP
FT                   TANARNVLPQSYSREDVVFNLQRAALLPAALGSSPPDPDMIFLAMQDKVHQPYRKTLIP
FT                   GLTEILQFMTPATQPGLLGICLSGAGPTILALATERFTEIADRIIAQFASNGISCQWKL
FT                   LEPAHDGATVAYN"
FT   exon            complement(190187..190531)
FT                   /gene="Pc20g00870"
FT                   /locus_tag="PCH_Pc20g00870"
FT                   /number=1
FT   intron          complement(190532..190587)
FT                   /gene="Pc20g00870"
FT                   /locus_tag="PCH_Pc20g00870"
FT                   /number=1
FT   exon            complement(190588..190886)
FT                   /gene="Pc20g00870"
FT                   /locus_tag="PCH_Pc20g00870"
FT                   /number=2
FT   intron          complement(190887..190996)
FT                   /gene="Pc20g00870"
FT                   /locus_tag="PCH_Pc20g00870"
FT                   /number=2
FT   exon            complement(190997..191414)
FT                   /gene="Pc20g00870"
FT                   /locus_tag="PCH_Pc20g00870"
FT                   /number=3
FT   mRNA            <192852..>194792
FT                   /gene="Pc20g00880"
FT                   /locus_tag="PCH_Pc20g00880"
FT   CDS_pept        192852..194792
FT                   /gene="Pc20g00880"
FT                   /locus_tag="PCH_Pc20g00880"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPBC27B12.12c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00880"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85417"
FT                   /db_xref="GOA:B6HGD8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD8"
FT                   /inference="similar to AA sequence:PIR:T40036"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /inference="protein motif:COGS:COG0598"
FT                   /protein_id="CAP85417.1"
FT                   /translation="MSESPRSERYMYLTRYSTPVPELDDHRLQMQTPPRIEVPVERSYS
FT                   PHDTTQGPEILDRPDLLSAQDARRDGPIPRDFEKVDDNRSLNELNGLGRRFSVDHNATY
FT                   QTPRRISIVNPDLANASAASSVSARSSSPPNSVEAFADPRRRERANTLDSHAPPDLEAI
FT                   LQRTVSGGTHNRRPTFSNASAIHPQLGDVPFDTAEEACFEEPGRIPVIDYEELEEFVAL
FT                   NPSIKVADADRRKYSMSSQSKRPRIFYDLRPGAESPEIGAIKKNGSSDTLSEDEKKNAA
FT                   VTDEKERFKTRQNVNQRSRFGFFSSESQSTVHAADLGDLVLPGETFRDLFELGPEGGVW
FT                   WLDVANPTDEELGAISRAFSIHPLTTEDIQTQEAREKVELFKQYYFVCFRTFFQTDKTS
FT                   EEFLEPVNFYMVVFRDGVLTFSFEDNPHAANVRKRIGKLRDYVALSSDWICYAMIDDIV
FT                   DSFGPVIRDVELESEAIEDHVFIARVDDFESFLPRIGGLRKKVMSLMRLLGGKADVIRG
FT                   FSKRCNEQYSVTPRGDIGLYLGDIQDHVVTMMSNLAHFEKMLSRSHTNYLAQLNVTNLV
FT                   LGNHVNKVLSKVTLIATILVPMNLITGLFGMNVEVPGQHTDGLNWWFGILGVIAGIVVV
FT                   SFGLARWQKLV"
FT   exon            192852..194792
FT                   /gene="Pc20g00880"
FT                   /locus_tag="PCH_Pc20g00880"
FT                   /number=1
FT   mRNA            join(<195772..196993,197047..>197711)
FT                   /gene="Pc20g00890"
FT                   /locus_tag="PCH_Pc20g00890"
FT   CDS_pept        join(195772..196993,197047..197711)
FT                   /gene="Pc20g00890"
FT                   /locus_tag="PCH_Pc20g00890"
FT                   /note="Title: strong similarity to stretch-activated
FT                   Ca2+-permeable channel protein homolog yam8p
FT                   -Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00890"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85418"
FT                   /db_xref="GOA:B6HGD9"
FT                   /db_xref="InterPro:IPR024338"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD9"
FT                   /inference="similar to AA sequence:PIR:JC7212"
FT                   /protein_id="CAP85418.1"
FT                   /translation="MRRHYNALQCYITATISAIFLLFALTCDSVAYAYSDAPNGPDTES
FT                   TLNLRGVVTSDGAGLPFALDSFNGLELRESVEEDGESNGLELVRRNPNAAKALGNNQFE
FT                   APDLEIGAVHWFYLPKTVVNGKHDPKGAGLPAYMNATEGDNDANDSASELRKRDEDFSK
FT                   RALTTVYLSLTTCKKPHTNKTDSQGGFPQLQVYVSNSEKLQQPGPGKDDSQQDIHTAVG
FT                   GYVGITIDTDSDVFIGVAAPNSTDYTGSYTYQIAASIDDFFHNIVDNDPNLFFVDADVS
FT                   AALLVTNNLTQSAENSTNYQQWMNIVPPYTMFAHNINDTALQGLEKSFCALDTLSQVGR
FT                   ISNSTEVGMTNRGLGNKPKEQFYVTGLNRSSSYSGLLAMVGNSTASGNGIVGGGGKVWQ
FT                   PMNFTTKADDNCAVLFNLTFCSEVAYAVPSNPKISVDKLRTIYDDHAAAFYQNFTYSLQ
FT                   QVQCKTNEESMFSLAVNCSDCERSYKQWLCSVTIPRCADYSSNATYLAVRNAGQPFING
FT                   SSLPDDSPYRQSVASNTSRNSIIDEKIKPGPYKEVLPCQDICHTLVKDCPSALGFGCPE
FT                   GAWMNASYGYRNLDGIITCSYLGAVYYLSLGTRLGAWHWVFSLVVMGVMYLL"
FT   exon            195772..196993
FT                   /gene="Pc20g00890"
FT                   /locus_tag="PCH_Pc20g00890"
FT                   /number=1
FT   intron          196994..197046
FT                   /gene="Pc20g00890"
FT                   /locus_tag="PCH_Pc20g00890"
FT                   /number=1
FT   exon            197047..197711
FT                   /gene="Pc20g00890"
FT                   /locus_tag="PCH_Pc20g00890"
FT                   /number=2
FT   mRNA            complement(<197868..>198476)
FT                   /gene="Pc20g00900"
FT                   /locus_tag="PCH_Pc20g00900"
FT   CDS_pept        complement(197868..198476)
FT                   /gene="Pc20g00900"
FT                   /locus_tag="PCH_Pc20g00900"
FT                   /note="Title: strong similarity to pyruvate water dikinase
FT                   like protein An04g08210 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00900"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85419"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE0"
FT                   /protein_id="CAP85419.1"
FT                   /translation="MSIETSESETASLATPIKTPAAEEEEEKEKDTCRPSIYSPANLLS
FT                   SLLSPFSFSSTSPESTTTTSPNNDKDKEKEKTKSPSKISIETPTSASTQSTPEPYYTPE
FT                   ETPLFKTLYKTRLTKTRTKQLLRAGERGYDDPPPPPGLGDCCGSSCDPCVRDLWKQEIG
FT                   IWRERWGDRGVEDGVGVSTDEKKSEKKEEKLAKRKDLEW"
FT   exon            complement(197868..198476)
FT                   /gene="Pc20g00900"
FT                   /locus_tag="PCH_Pc20g00900"
FT                   /number=1
FT   mRNA            complement(<199003..>200487)
FT                   /gene="Pc20g00910"
FT                   /locus_tag="PCH_Pc20g00910"
FT   CDS_pept        complement(199003..200487)
FT                   /gene="Pc20g00910"
FT                   /locus_tag="PCH_Pc20g00910"
FT                   /note="Title: similarity to hypothetical protein ES2 - Mus
FT                   musculus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00910"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85420"
FT                   /db_xref="InterPro:IPR019148"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE1"
FT                   /inference="similar to AA sequence:TREMBL:AF037256.1"
FT                   /protein_id="CAP85420.1"
FT                   /translation="MASSSSQELVKQSAGQLMPPPPPPKRIKRPATVLDEDVYTNTLSH
FT                   IIARDFFPGLLETQIKQEYLEALESKDKSWIASSKKKLADVMRTPTPGSNARRKSDYAS
FT                   VPSTPQHFPAGRAGDTPHGWGGDTPMSVISTSTSATETQDRNIPDVSNMGLVAFQAKYT
FT                   SEDNESFNKVLDKQNEKRREKYPWLWSGNKVPSARQIAHHQQEIKRITAQGGKPEMGLI
FT                   KRDEHVQSAIKTDLDARPAKPNSWKSRPDNTLMFLPSSVEDTHETLAQKAEITSRAGPK
FT                   RTLYQNTRLLDPHAAAAADAANAVPPSPSLSAIQDAIAGRPHLSESEAASAFAGSETPR
FT                   VNGYAFVDEDEPEPEFTYGSSSKTDDDMEADWRLLGPTSEKPNPFQLGETRKREALHHR
FT                   MVDRVARNKRAEKAARVTKTPVSLTPRFASSPRLDFGSASTPGAGSSRGSVYAGGHQGK
FT                   MLTPAAQKLLQQVGTPRPRERKSGLGNAWTPTPKRK"
FT   exon            complement(199003..200487)
FT                   /gene="Pc20g00910"
FT                   /locus_tag="PCH_Pc20g00910"
FT                   /number=1
FT   mRNA            <201091..>202338
FT                   /gene="Pc20g00920"
FT                   /locus_tag="PCH_Pc20g00920"
FT   CDS_pept        201091..202338
FT                   /gene="Pc20g00920"
FT                   /locus_tag="PCH_Pc20g00920"
FT                   /note="Title: similarity to hypothetical protein An08g09910
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00920"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85421"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE2"
FT                   /protein_id="CAP85421.1"
FT                   /translation="MLVSMKRNPPSIRQAPKAIPIKSSSWVGDIHQYLKSTFVTYPILK
FT                   ALGLDLLDAFPVELVLSIADFLPLEDIYCLSLCNSRLLAIFRSWKKREYLDRKARLSFL
FT                   HRLERDHPRYLTCDDCLILHDLDSISEPLELSYSTKTYPPRIDCPALRPGYSTCGRSWI
FT                   NLHNDSSVQHTYALHFSHLQLAMRRFYSDSQYGISTDALSFTEVTNEFVEGDRVLKPTT
FT                   LFSVEAQICPEAPSLYLRIQDVVSMKDMRLLGDDKYYEEVEKEYFAALPICKHQQKTMG
FT                   IQSIPRDVLTHECSNCSDCNTDWEIELFENRPSGHVTMVMTRYIDLGPGLSLDDPRWSV
FT                   HAWTEWEESVCKLDSKYMISSPRHTFEALTDTSLEDLTSRNLSYLENERYQTVMVPGPR
FT                   SWSHSWVLWNGAAVHS"
FT   exon            201091..202338
FT                   /gene="Pc20g00920"
FT                   /locus_tag="PCH_Pc20g00920"
FT                   /number=1
FT   mRNA            complement(join(<203251..205028,205095..>205557))
FT                   /gene="Pc20g00930"
FT                   /locus_tag="PCH_Pc20g00930"
FT   CDS_pept        complement(join(203251..205028,205095..205557))
FT                   /gene="Pc20g00930"
FT                   /locus_tag="PCH_Pc20g00930"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An17g02060 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00930"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85422"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE3"
FT                   /protein_id="CAP85422.1"
FT                   /translation="MSTFPPPMAKPWDNDDGSDRPSTNSSNEHPEHAAHIRSRSTAHAH
FT                   SPKRLSVFSGRSRSNTTTSTSSRRSPGSSMTSTDSSIASDERAGSSLGLRSDKQDKPSR
FT                   SFLARGSRILRRQGSKINIVATLDEEDEADREKARPEREMFGRRARHADHSERLKSIIS
FT                   DPFDFHHLTHTNPSQFQSLDQTRENDLVTEFSAIRASQRPQTDLKGIRAEDIHFRNFSS
FT                   DDLGSLGTATTVDVPSISPPASPKTRQYPAHHARRESRVNENFSRPVSRYPRSCPTTPP
FT                   PPAVPETPPPETDEPAPRAIDEILGLSTAMTYPDLQSVQPTRFFSPEPADNSARTSSMS
FT                   SHYDLEDVPEEEEGTRYWESPESSMGCPHSRTTSQASQPPANAQSPSTSERKAPMSIYV
FT                   AEELSRKFSEAMGSPTLPQPPHDKDTPRAQVEVTPPEPIASLHQFSYEDELYDSWDADI
FT                   DYCYEHAAESTSNFDWSRTSLDEARPQIGVACSDGPWLAPKTRQLQPSPLSTSALATPD
FT                   LDPSPAQSMPSQLAPTPSTTDYEQDFIARGADYFHPVSSSILPSMGKQISHEPLYEEYM
FT                   TTDGESDRHFPFAQGMMGPISPRSSFSPISKCNSQESLMLSRAASIVRKHRSSVSTTNS
FT                   VPELVHSLSSSRELMPTDRMTAVEALTRPASSSHHRQTKSLAEAHFRQSGSSTSLEGPD
FT                   LTVSVHDRAKSISEVESQPTKFEAPLPPVPVRNPNRRKARSPSYSLFPTTAH"
FT   exon            complement(203251..205028)
FT                   /gene="Pc20g00930"
FT                   /locus_tag="PCH_Pc20g00930"
FT                   /number=1
FT   intron          complement(205029..205094)
FT                   /gene="Pc20g00930"
FT                   /locus_tag="PCH_Pc20g00930"
FT                   /number=1
FT   exon            complement(205095..205557)
FT                   /gene="Pc20g00930"
FT                   /locus_tag="PCH_Pc20g00930"
FT                   /number=2
FT   mRNA            complement(join(<208344..208647,208904..209040,
FT                   209539..>209880))
FT                   /gene="Pc20g00940"
FT                   /locus_tag="PCH_Pc20g00940"
FT   CDS_pept        complement(join(208344..208647,208904..209040,
FT                   209539..209880))
FT                   /gene="Pc20g00940"
FT                   /locus_tag="PCH_Pc20g00940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00940"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85423"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGQ8"
FT                   /protein_id="CAP85423.1"
FT                   /translation="MRYALIAPVLLAATALAVPVPNQGDVSVANRDVGDGIDAAADANV
FT                   SGDASVNVKRDGGDGIDADAELSGDVSADVKRDGGNDIDADAELSGDVSADVKRDGGDG
FT                   IDADVDADADYTKEERELTISNSLPFVCLLFGSFRRAQTRKSHVSQICLQNERSPLLIH
FT                   SPQDSSNGRIHMYFTQIGDRWIVAQAKRIARYATLNYNLRSPSSGRDTVAIDFEGTEYG
FT                   VARNITTGVGDQLLVSGELDLSILGKHEEERVRDRRTM"
FT   exon            complement(208344..208647)
FT                   /gene="Pc20g00940"
FT                   /locus_tag="PCH_Pc20g00940"
FT                   /number=1
FT   mat_peptide     complement(join(208347..208647,208904..209040,
FT                   209539..209829))
FT                   /gene="Pc20g00940"
FT                   /locus_tag="PCH_Pc20g00940"
FT   intron          complement(208648..208903)
FT                   /gene="Pc20g00940"
FT                   /locus_tag="PCH_Pc20g00940"
FT                   /number=1
FT   exon            complement(208904..209040)
FT                   /gene="Pc20g00940"
FT                   /locus_tag="PCH_Pc20g00940"
FT                   /number=2
FT   intron          complement(209041..209538)
FT                   /gene="Pc20g00940"
FT                   /locus_tag="PCH_Pc20g00940"
FT                   /number=2
FT   exon            complement(209539..209880)
FT                   /gene="Pc20g00940"
FT                   /locus_tag="PCH_Pc20g00940"
FT                   /number=3
FT   sig_peptide     complement(209830..209880)
FT                   /gene="Pc20g00940"
FT                   /locus_tag="PCH_Pc20g00940"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            <210768..>211541
FT                   /gene="Pc20g00950"
FT                   /locus_tag="PCH_Pc20g00950"
FT   CDS_pept        210768..211541
FT                   /gene="Pc20g00950"
FT                   /locus_tag="PCH_Pc20g00950"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   15_scaffold_1.tfa_30wg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00950"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85424"
FT                   /db_xref="GOA:B6HGQ9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGQ9"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP85424.1"
FT                   /translation="MEICEKAEAFVDQDDDIVFDHTRLILRRDNEYFYARTDWRILDLH
FT                   PSAADISQLELNKIPMENVWPPMDPRFTPAPDPLPPNCYVKQPSLLYYSDTPASLEPAR
FT                   QVLAEVEACEVLQQHPHPNIAQYFGCVTMDGKITGLCFHKYPITLSQKLKEATPFDKAF
FT                   CLEGIESGVRHMHSLGLIHNDLNPRNIMMDGERPVIIDFDSCKREGDELGLKAGTSGWE
FT                   LEGIIYAKPENDYFGLSKIREIMIGGEDGKPEEQS"
FT   exon            210768..211541
FT                   /gene="Pc20g00950"
FT                   /locus_tag="PCH_Pc20g00950"
FT                   /number=1
FT   mRNA            complement(join(<212858..215596,215671..>216525))
FT                   /gene="Pc20g00960"
FT                   /locus_tag="PCH_Pc20g00960"
FT   CDS_pept        complement(join(212858..215596,215671..216525))
FT                   /gene="Pc20g00960"
FT                   /locus_tag="PCH_Pc20g00960"
FT                   /note="Title: strong similarity to protein required for
FT                   normal CLN1 and CLN2 G1 cyclin expression Ctr9
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00960"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85425"
FT                   /db_xref="GOA:B6HGR0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR031101"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR0"
FT                   /inference="similar to AA sequence:SWISSPROT:CTR9_YEAST"
FT                   /inference="protein motif:COGS:COG0457"
FT                   /protein_id="CAP85425.1"
FT                   /translation="MAPLENGQTNGLNGDAVPPASPLNNLRFSDIPDAIDIPASSFDSE
FT                   VEVSLLELPDDPTELCTLLENEKAAKNFWVIIALAYAKRKQIDHAIDILTKGLASVAHG
FT                   ATKEKLGLLGWICWMLLLKSRHAPRVAPEGELYSEAKTKDHYLQLATSTLNEASRLNPA
FT                   YPPLFLARGVLCLLRASLYPPRAVRPGAVDTSERVESLRQALKCFDESSKAFGGRNIMA
FT                   ILGRARAHYMLGRYADALEGYQKALIKMPNLTDPDPRIGLGCCLWQLGFKDQAKVAWER
FT                   SLSLNPESKVANVLLAVYYLHDSSRRATTDPMFGSMYKLAMTQYTQKAFKLDKEYPMTC
FT                   SMFASYFLLRKQYPTVETLARKAIEHTDVMSIASDGWYLLGRKSHYEGDNARAAEFYNR
FT                   SDQARGGVDKGYLPAKFGAVQMQITNKDFDGAKFRLEKIVQQSKNPEAMTLLAAIHAEE
FT                   VFAAQKSGSKEDKSTETKRAITLLESVRSMWKDEKQNISPDESVLVYLSRLYEGTAPDK
FT                   SMQCLTQLEQIQIAEIPEDARPDIEDQEKMNAALRESLPPQLLNNMGCFLYQNDKIALA
FT                   RGLFQSALNACVQSKEKEDGTDTDALVTTISYNLGRTYEAADMWDEAKKVYEGLLERHS
FT                   DYTEANARLTYIALRQSPTDEGPKKIGKLYEAESTNLEVRSLYGWYLSKAKKRVANLAE
FT                   DSEQRHFKHTLQYYDKHDRYALTGMGNVHLLAARDMRRDTDQEKEKRRKIYQRAVEFFD
FT                   KALQLDPKNAYAAQGIAIALVDDKKDHSSAVQILSKIRDTIKDPSVYLNLGHVFAELRQ
FT                   FSRSIEHYETALSKDRQRDVQILACLGRVWWLRGKQEANLAAMKTALDYATRARDIAPD
FT                   QLHLQFNVAFVQNQIASLAYGLQPTQKTLQDVQEAAEGLKEAIETFERLSKEKNPPYPS
FT                   AALEQRANMGRTISKQLDRAMQSQKEYEEKNAAKLQQAREAREAAARVREEELRKAQEV
FT                   EMERKKRIAEERAQMVEEVQRHALQRAEEERAREEAELTHDSETGDRVKRKKKPASKRK
FT                   KKGGDDFIADEGEGEAAHSAAESEGEAPKKRRRLGRRSGGKAQVDKPEKPGKYKSSEMV
FT                   VDSDDEEAARSAGEDKDDMFGDDEEPAEEAAPRRRGKASRRIADEDEDEDEDEEVQQEV
FT                   QAEKSVHEDDKDDDLFGEEPSKTTEDTEMQE"
FT   exon            complement(212858..215596)
FT                   /gene="Pc20g00960"
FT                   /locus_tag="PCH_Pc20g00960"
FT                   /number=1
FT   intron          complement(215597..215670)
FT                   /gene="Pc20g00960"
FT                   /locus_tag="PCH_Pc20g00960"
FT                   /number=1
FT   exon            complement(215671..216525)
FT                   /gene="Pc20g00960"
FT                   /locus_tag="PCH_Pc20g00960"
FT                   /number=2
FT   mRNA            complement(join(<216925..217312,217379..>218238))
FT                   /gene="Pc20g00970"
FT                   /locus_tag="PCH_Pc20g00970"
FT   CDS_pept        complement(join(216925..217312,217379..218238))
FT                   /gene="Pc20g00970"
FT                   /locus_tag="PCH_Pc20g00970"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig5_part_ii.tfa_3290wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00970"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85426"
FT                   /db_xref="GOA:B6HGR1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR032098"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR1"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /inference="protein motif:COGS:COG0204"
FT                   /protein_id="CAP85426.1"
FT                   /translation="MEPTEVRQRKPPTTKDAGELQKLSTKPPSEPRLKHGIPMQILRSL
FT                   LLITWADCCIMAICVTQLIGCPLYLINRYYYYSYMAYTKQCFGLVLGSVTQWSSPTLFR
FT                   VSGDASVRGQIHLSKDGLLETRFPERLVMISNHQVYTDWVYLWWVAYTNQMHGRIFIIL
FT                   KESLKYIPIVGTGMMFYGFIFMARKWMSDKPRLQHRLDKLKTAYTGSNSARPQYDPMWL
FT                   LIFPEGTNLSINTKRRSDIWGEKQGLPSFKHVILPRSTGLFFCLQQLRGTVDWVYDCTM
FT                   AYEGPPKGSYPDKYFTLRSTYLQGRPPTSVNMHWRRFQVSKIPLDDQKEFEEWMTARWA
FT                   EKDQLMDQYFETGRFPTELAGSIKADHAVDGQQAAALAGYVESYGSLHHWSELGLIFVV
FT                   LVSVAVLCKFVTSWMQ"
FT   exon            complement(216925..217312)
FT                   /gene="Pc20g00970"
FT                   /locus_tag="PCH_Pc20g00970"
FT                   /number=1
FT   intron          complement(217313..217378)
FT                   /gene="Pc20g00970"
FT                   /locus_tag="PCH_Pc20g00970"
FT                   /number=1
FT   exon            complement(217379..218238)
FT                   /gene="Pc20g00970"
FT                   /locus_tag="PCH_Pc20g00970"
FT                   /number=2
FT   mRNA            join(<218842..218968,219037..219151,219209..>220259)
FT                   /gene="Pc20g00980"
FT                   /locus_tag="PCH_Pc20g00980"
FT   CDS_pept        join(218842..218968,219037..219151,219209..220259)
FT                   /gene="Pc20g00980"
FT                   /locus_tag="PCH_Pc20g00980"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   associated with ferric reductase activity Utr1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00980"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85427"
FT                   /db_xref="GOA:B6HGR2"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR2"
FT                   /inference="similar to AA sequence:PIR:S46589"
FT                   /inference="protein motif:PFAM:PF01513"
FT                   /inference="protein motif:COGS:COG0061"
FT                   /protein_id="CAP85427.1"
FT                   /translation="MLRAILRRSPRLALRQHFSTSRPRHEIKDIGSLSQRLIPKYQESC
FT                   DGELLCLQWPAPPRNIFLVRKDCAPAVTDSLIEFVNHVSSAYPSIAVILESKTAAEVHS
FT                   SLSFPVYSVSLDEKTTALHDKVDLTVTLGGDGTILHAASVFATCSNVPPVLSFSMGTLG
FT                   FLSEWKFSEFKRAFREVYMSGAGAGDRTHVLEGVPGAGLTEQESEMGPTGWSSVRGKSM
FT                   GSTRGARILMRNRLKVGLFAADGTETTPIRTKTDQGQGVYVMNELLIHRGKEPHLAVVD
FT                   VFVGGRFLTEAVADGIIISTPTGSTAYSLSSGGSIVHPLVPSILLTPICARSLSFRPLV
FT                   LPSSTPITLRLSEKNRGRELEVSLDGVHLGQGMAVGMEVRVWNEEMRHGKNEWQGGVPS
FT                   VMRRSVGCEAHEGWVGGLNGLLKFNHPFGEL"
FT   exon            218842..218968
FT                   /gene="Pc20g00980"
FT                   /locus_tag="PCH_Pc20g00980"
FT                   /number=1
FT   intron          218969..219036
FT                   /gene="Pc20g00980"
FT                   /locus_tag="PCH_Pc20g00980"
FT                   /number=1
FT   exon            219037..219151
FT                   /gene="Pc20g00980"
FT                   /locus_tag="PCH_Pc20g00980"
FT                   /number=2
FT   intron          219152..219208
FT                   /gene="Pc20g00980"
FT                   /locus_tag="PCH_Pc20g00980"
FT                   /number=2
FT   exon            219209..220259
FT                   /gene="Pc20g00980"
FT                   /locus_tag="PCH_Pc20g00980"
FT                   /number=3
FT   mRNA            join(<220869..220885,220946..222959,223018..>223527)
FT                   /gene="Pc20g00990"
FT                   /locus_tag="PCH_Pc20g00990"
FT   CDS_pept        join(220869..220885,220946..222959,223018..223527)
FT                   /gene="Pc20g00990"
FT                   /locus_tag="PCH_Pc20g00990"
FT                   /note="unknown EC_number=2.7.1.-"
FT                   /note="Title: strong similarity to serine/threonine protein
FT                   kinase like protein An17g02010 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00990"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85428"
FT                   /db_xref="GOA:B6HGR3"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR033923"
FT                   /db_xref="InterPro:IPR036936"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR3"
FT                   /inference="protein motif:PFAM:PF00169"
FT                   /inference="protein motif:PFAM:PF00786"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP85428.1"
FT                   /translation="MTSYGNNMYSSEQFMNPGPAPRPPTDRPPKLTLPTNNTATSFGQM
FT                   SLDSPSTPAPSTANLSLFPNTSSPSLAMTRSNTGQNGISIIKEGTVRCKEDKFLATWNT
FT                   RYLILREYKLEFLKSDSGKVVITFPLSSVTAVARSEDSKMAFEVTRLANPKDANSKASL
FT                   LARDLPTKTITCEVKSDDEIYEWIDKIYERCPGMGGVSNPTNFSHRVHVGFDPNTGAFV
FT                   GLPPEWEKLLTSSAITKEDYKNNPQAVIEVLEFYSDIKMREQNPQYYAGINSPSNGQPK
FT                   AYGSSVGSSIAPPRPPPPGPMQRLDSSQSKSDGSMRSASSSVGQSDRAADHQQQVERMK
FT                   EMADQERRRVEEERRNKEEQDAYNASIPKSRPNMAQQELGGYGGDEASQNSRYQPSRPA
FT                   PQAPGSAARQQDPRQLTAQRPAPAPPSQSPYGQNAPRAPGAPRTDDRQGSPSSRYPPSD
FT                   PRAPGSASRHQQNGSKGQAGPPPTRLPAPVQAVKPLNIANKQNGNKQNVPDGVRQAEAA
FT                   LTKKADQPRQKEVRMSAMSENEVMERLRSVVSKDNPNESYSKQRKIGQGASGSVYVARV
FT                   KESAPSSVAHELYRTYGPRCQVAIKQMDLRSQPRKELIVNEIIVMKDSQHPNIVNFLDS
FT                   FLQESSNELWVVMEFMEGGALTDVIDNNQVITEGQIATICAETCKGLAHLHNQSIIHRD
FT                   IKSDNVLLDRVGHVKITDFGFCAKLTETKNKRATMVGTPYWMAPEVVKQKEYGPKVDCW
FT                   SLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPEKLSKELKSFLSVCLCVNVQ
FT                   SRASADELLAHEFLQTGCSLASLAELLRWKKATG"
FT   exon            220869..220885
FT                   /gene="Pc20g00990"
FT                   /locus_tag="PCH_Pc20g00990"
FT                   /number=1
FT   intron          220886..220945
FT                   /gene="Pc20g00990"
FT                   /locus_tag="PCH_Pc20g00990"
FT                   /number=1
FT   exon            220946..222959
FT                   /gene="Pc20g00990"
FT                   /locus_tag="PCH_Pc20g00990"
FT                   /number=2
FT   intron          222960..223017
FT                   /gene="Pc20g00990"
FT                   /locus_tag="PCH_Pc20g00990"
FT                   /number=2
FT   exon            223018..223527
FT                   /gene="Pc20g00990"
FT                   /locus_tag="PCH_Pc20g00990"
FT                   /number=3
FT   mRNA            join(<224159..224229,224374..>224644)
FT                   /gene="Pc20g01000"
FT                   /locus_tag="PCH_Pc20g01000"
FT   CDS_pept        join(224159..224229,224374..224644)
FT                   /gene="Pc20g01000"
FT                   /locus_tag="PCH_Pc20g01000"
FT                   /note="Title: weak similarity to poly(ADP-ribose)
FT                   glycohydrolase - Bos taurus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01000"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85429"
FT                   /db_xref="GOA:B6HGR4"
FT                   /db_xref="InterPro:IPR007724"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR4"
FT                   /inference="similar to AA sequence:TREMBL:BTU78975.1"
FT                   /protein_id="CAP85429.1"
FT                   /translation="MADGPPWTKYCMTDQGQRLTGATGNTRKPYSFVTTGLWGCGAFGG
FT                   NRQVKAIIQWYAASLANVLELRYVLGGEEQKVFRDVFDVLVRLGTDLQNGKAAVPKPDE
FT                   IFEYVLQSL"
FT   exon            224159..224229
FT                   /gene="Pc20g01000"
FT                   /locus_tag="PCH_Pc20g01000"
FT                   /number=1
FT   intron          224230..224373
FT                   /gene="Pc20g01000"
FT                   /locus_tag="PCH_Pc20g01000"
FT                   /number=1
FT   exon            224374..224644
FT                   /gene="Pc20g01000"
FT                   /locus_tag="PCH_Pc20g01000"
FT                   /number=2
FT   mRNA            complement(join(<225175..227052,227166..227346,
FT                   227526..227884,227954..>229540))
FT                   /gene="Pc20g01010"
FT                   /locus_tag="PCH_Pc20g01010"
FT   CDS_pept        complement(join(225175..227052,227166..227346,
FT                   227526..227884,227954..229540))
FT                   /gene="Pc20g01010"
FT                   /locus_tag="PCH_Pc20g01010"
FT                   /note="unknown EC_number=6.1.1.14"
FT                   /note="Title: strong similarity to glycine-tRNA ligase Grs1
FT                   - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85430"
FT                   /db_xref="GOA:B6HGR5"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR5"
FT                   /inference="similar to AA sequence:PIR:S48285"
FT                   /inference="protein motif:PFAM:PF00587"
FT                   /inference="protein motif:PFAM:PF03129"
FT                   /inference="protein motif:COGS:COG0423"
FT                   /inference="protein motif:COGS:COG0442"
FT                   /protein_id="CAP85430.1"
FT                   /translation="MATVNTKTGQAVDRTVLDSMLRRRMFYTPSFEIYGGVSGLYDYGP
FT                   PGTALIANMTDLWRKHFVLEEDMLEVDTTMLTPHEILKTSGHVDKFADWMCKDPKTGEI
FT                   FRADHLVEEVLEARLKGDKQARGEKIEVDEEKEAKKKRKAKSTEAKKLDDALVKEYEET
FT                   LAQIDNYGGPELEQLIKKHDIRNPVTGGEVLPPVSFNLMFQTSIGPSSNMPGYLRPETA
FT                   QGQFLNFAKLLEFNQQSMPFASASIGKSFRNEISPRAGLLRVREFLMAEIEHYVDPEGG
FT                   KKHSRFDEVKDTELSLLDRNVQLSGSTNLTKMTVGKAVETGLVDNETLGYFLARIQSFL
FT                   LKLGVDPAKLRFRQHMANEMAHYATDCWDAELQTSYGWIECVGCADRSAYDLTVHKDKT
FT                   GAPLVVRQTRAEPLRIEEYQIDLEKKKFGPRFKKDAKTVEAAIEALSQDLREKLSLDLE
FT                   KDGKIEVDVEGVGSGKVEIEKDLIKIEKRTRVENVREYTPNVIEPSFGIGRILYSVIEH
FT                   SYWYRAGDETRGVLSFPPAIAPTKVLLVPLSTHASFKPLTQRLTSKLRKAGVSNRVDDS
FT                   SASIGKRYSRNDELGTPFGVTVDFQSVQDNTFTLRDRDTTKQVRASEDEILQAVKSLVE
FT                   GDETWEDIRKRLPEIRGTSVIDLSSFHSPLSTTMAPTVHSAKLTLSCPLFAADFDPRNN
FT                   GRLLVGGGGGEGRSGITEAVELNLSRDEDSVTSLAAAPLAGDEAGSLVALAGINSSVEQ
FT                   QKKNNNQHLRAFRFEAPRKTTEDRKQDEKAKKDAKSEEEVIPGRAIALSQASLFRTKNG
FT                   PGSSDTYQRVTRLSPWPKGKDGTEKHTRIGAVATGLAQSGEIVFFRATETPSEKDIIGR
FT                   IQLSSNEEAEDMDFVSLEHDLEKTDDGHGRFLVAYTNGTDVMVGEISCSSSSNSSPDVR
FT                   SVYNIPLPASGARTARPKFRALRFLSPRTLLLLQNAPNRGGSELVLLQLPSAKSSKSKV
FT                   LQRRKLPRTVKIGLGLDICQLGTNPQGQQQTVIAASGSDNSIPLFTLEYGPNRGYSNFR
FT                   PYTTLRDVHPFSMTKLTFSTFIAPPHPVTPDVGPQNIKLASVSMGNTVVVHTFPLSPFP
FT                   TSSRTPRYVLVTPGPAEIWELIYSIIVLLFSISAICVAMLAFAEIRGGTPPVLGATEWL
FT                   PESIRGAIAREYVIPPRDKLTYFDTLLAPRGSGGDTDTPVATIVPTESQIESLREILDR
FT                   VHRAGAAPADLETVAPQSLSVIVRCGAGQNAEQSVIVETAVSASGEAEQSEEEKLQAWK
FT                   DLSASEQSVWKQRLADAGRWTASEGESVLLGVLFGEACGGLGRAVRDELP"
FT   exon            complement(225175..227052)
FT                   /gene="Pc20g01010"
FT                   /locus_tag="PCH_Pc20g01010"
FT                   /number=1
FT   intron          complement(227053..227165)
FT                   /gene="Pc20g01010"
FT                   /locus_tag="PCH_Pc20g01010"
FT                   /number=1
FT   exon            complement(227166..227346)
FT                   /gene="Pc20g01010"
FT                   /locus_tag="PCH_Pc20g01010"
FT                   /number=2
FT   intron          complement(227347..227525)
FT                   /gene="Pc20g01010"
FT                   /locus_tag="PCH_Pc20g01010"
FT                   /number=2
FT   exon            complement(227526..227884)
FT                   /gene="Pc20g01010"
FT                   /locus_tag="PCH_Pc20g01010"
FT                   /number=3
FT   intron          complement(227885..227953)
FT                   /gene="Pc20g01010"
FT                   /locus_tag="PCH_Pc20g01010"
FT                   /number=3
FT   exon            complement(227954..229540)
FT                   /gene="Pc20g01010"
FT                   /locus_tag="PCH_Pc20g01010"
FT                   /number=4
FT   mRNA            <229921..>231216
FT                   /gene="Pc20g01020"
FT                   /locus_tag="PCH_Pc20g01020"
FT   CDS_pept        229921..231216
FT                   /gene="Pc20g01020"
FT                   /locus_tag="PCH_Pc20g01020"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig5_part_ii.tfa_3260cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85431"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR6"
FT                   /inference="protein motif:PFAM:PF04427"
FT                   /inference="protein motif:COGS:COG2136"
FT                   /inference="protein motif:COGS:COG5154"
FT                   /inference="protein motif:COGS:COG1196"
FT                   /inference="protein motif:COGS:COG3468"
FT                   /protein_id="CAP85431.1"
FT                   /translation="MGVPGRSGPPPGVMGDIKTGNKLRRKMNHVKRKRAKDAARREERY
FT                   AFKKEEAKNPKLKEERLRRNIPLTLERKRVWNEADNDTEETGLGLSVDVERIKRAKKEE
FT                   EDELNRPLEEGEDDSEVPESDNESVDSMLESDNSEDEDEGEEKNEDQDASRGRKKTSLR
FT                   TATERATSPTQSTRSTNLSLAPEALAAKFPTLFTEGPPPTPKILITTGLNSTLHVQAET
FT                   LTDVFPNSVYIRRNAHRYSHKFSIREISKFASNRNFTAVVVLNEDQKRPSGLTIVHLPV
FT                   GPTFHFSISNWIDGKRLPGHGRATDHWPELILNNFRTPLGLLTAHLFRTLFPPQPEFEG
FT                   RQVVTLHNQRDYIFVRRHRYVFREKRETEKAVVGADGKEMAGAEGIRTGLQELGPRFTL
FT                   KLRRVDKGIQRASGQEWEWKGGMEKTRTLFQL"
FT   exon            229921..231216
FT                   /gene="Pc20g01020"
FT                   /locus_tag="PCH_Pc20g01020"
FT                   /number=1
FT   mRNA            complement(<231386..>231958)
FT                   /gene="Pc20g01030"
FT                   /locus_tag="PCH_Pc20g01030"
FT   CDS_pept        complement(231386..231958)
FT                   /gene="Pc20g01030"
FT                   /locus_tag="PCH_Pc20g01030"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   cipA - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85432"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR7"
FT                   /inference="similar to AA sequence:TREMBL:ENI344256.1"
FT                   /protein_id="CAP85432.1"
FT                   /translation="MRTGPTRKTIADLGKSSFWYEWSLAIPSAFGIDFAKRTVTLFDEG
FT                   EAMISTSTWPQVGRTVAGLLSMPIKAERGNGACLENLKNQVVYADPFTVSQKNMFESAF
FT                   RVTGTTEKDWTITKESAKERYENGVKEMNQGDRIEFVKILDTRIFFEDGAGNFESKGTL
FT                   NGLLGLPKEDIDEVTRAAIERSKSTTW"
FT   exon            complement(231386..231958)
FT                   /gene="Pc20g01030"
FT                   /locus_tag="PCH_Pc20g01030"
FT                   /number=1
FT   mRNA            <232049..>232843
FT                   /gene="Pc20g01040"
FT                   /locus_tag="PCH_Pc20g01040"
FT   CDS_pept        232049..232843
FT                   /gene="Pc20g01040"
FT                   /locus_tag="PCH_Pc20g01040"
FT                   /note="Title: strong similarity to rhoGAP homolog like
FT                   protein An17g01955 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85433"
FT                   /db_xref="GOA:B6HGR8"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR8"
FT                   /inference="protein motif:COGS:COG0193"
FT                   /protein_id="CAP85433.1"
FT                   /translation="MTLREKKNTTYNSQYPLEYTPNLSPLLPTNMEVLPRRLLFIASIG
FT                   NPAPYYNTRHSAGHLLLDALKPLLETTLPNTGLYHETWQSPTQMNITGPKLVRRLEQWA
FT                   TERASRLERIANVAATRASTSSSSSQPPNLPAQTTYPTTLIILHDELSIAQGKVRVVRG
FT                   GPESLSLRGHRGLISICDTLRKKGLYPRSSGASKGVTGPLADLSILRVGLGIGRPSSHE
FT                   TAAVSDYVLKTVTDKELKAYHAAAAPVVETIRDELFRPAGKV"
FT   exon            232049..232843
FT                   /gene="Pc20g01040"
FT                   /locus_tag="PCH_Pc20g01040"
FT                   /number=1
FT   mRNA            complement(join(<233199..233652,233711..233858,
FT                   233922..233995,234069..234114,234256..234306,
FT                   234385..>234397))
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT   CDS_pept        complement(join(233199..233652,233711..233858,
FT                   233922..233995,234069..234114,234256..234306,
FT                   234385..234397))
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /note="Title: strong similarity to protein Rvs161
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85434"
FT                   /db_xref="GOA:B6HGR9"
FT                   /db_xref="InterPro:IPR003005"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR037429"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR9"
FT                   /inference="similar to AA sequence:PIR:S19516"
FT                   /inference="protein motif:PFAM:PF03114"
FT                   /protein_id="CAP85434.1"
FT                   /translation="MSWAGFKKNVNRATTQVMMKTGHVERTNDRDYEIEERRYRTMETA
FT                   ATRLQKESKGYLDSLRAMTASQMRIAETIDAFYGDAGTKDGVSRSYKQAVEDLDAETIK
FT                   ALDGPYRTTVLDPISRFCAYFPDVNECIKKRNHKLLDYDAMRAKVKKLAEKPDKDVTKL
FT                   PRTEREAEMAKQAYEQLNEQLFNELPQLIDLRVPYLDPSFEALVKIQLRFCAEAYSRMA
FT                   QVQQYLDAETRDQYAKGDLDNRVEEVLQEIRDLSIAGTV"
FT   exon            complement(233199..233652)
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /number=1
FT   intron          complement(233653..233710)
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /number=1
FT   exon            complement(233711..233858)
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /number=2
FT   intron          complement(233859..233921)
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /number=2
FT   exon            complement(233922..233995)
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /number=3
FT   intron          complement(233996..234068)
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /number=3
FT   exon            complement(234069..234114)
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /number=4
FT   intron          complement(234115..234255)
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /number=4
FT   exon            complement(234256..234306)
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /number=5
FT   intron          complement(234307..234384)
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /number=5
FT   exon            complement(234385..234397)
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /number=6
FT   mRNA            complement(join(<236568..236699,236757..>238220))
FT                   /gene="Pc20g01060"
FT                   /locus_tag="PCH_Pc20g01060"
FT   CDS_pept        complement(join(236568..236699,236757..238220))
FT                   /gene="Pc20g01060"
FT                   /locus_tag="PCH_Pc20g01060"
FT                   /note="unknown EC_number=2.7.1.-"
FT                   /note="Title: strong similarity to
FT                   serine/threonine-specific protein kinase Hal4
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85435"
FT                   /db_xref="GOA:B6HGS0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS0"
FT                   /inference="similar to AA sequence:PIR:OKBY8W"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP85435.1"
FT                   /translation="MTPPSPSPVPSAVSSAAASQHSHDPRDGDASVTRAIAGMNLAAHA
FT                   NGEALPPPASPAAKPTRSTMAARLTRMFSSTGKNTPPRENNEVPRDLSDSSLESIQPLN
FT                   GRTSKPSSRPASRPPSRPPSRGENSRTPSRNPSLKSEPLEKYDKKKMDDKKKDGASVHK
FT                   RFEVLTEALGNHSHNLRSARRQEKLTDLLRDMMGGRKKDDQVDEQQLSLMSTWIDQFKT
FT                   ERDKLAADKKGGPNATASLVDKYGKCQEIVGRGAFGIVRISHKVDPQDSKCEQLYAVKE
FT                   FRRRPQETTKKYQKRLTSEFCISSSLRHPNVIHTLDLLQDAKGDYCEVMEYCAGGDLYT
FT                   LVLAAGKLEVAEADCFFKQLMRGVEYMHEMGVAHRDLKPENLLLTTHGALKITDFGNGE
FT                   CFRMAWEKEAHMTAGLCGSAPYIAPEEYVEREFDPRAVDLWATGVIYMAMRTGRHLWRV
FT                   ARKDEDEFYQRYLDGRKHEDGYAPIETLHRARCRNVIYSILDPNPSRRINASQVLKSEW
FT                   VRQIKLCKAGEEGF"
FT   exon            complement(236568..236699)
FT                   /gene="Pc20g01060"
FT                   /locus_tag="PCH_Pc20g01060"
FT                   /number=1
FT   intron          complement(236700..236756)
FT                   /gene="Pc20g01060"
FT                   /locus_tag="PCH_Pc20g01060"
FT                   /number=1
FT   exon            complement(236757..238220)
FT                   /gene="Pc20g01060"
FT                   /locus_tag="PCH_Pc20g01060"
FT                   /number=2
FT   mRNA            complement(join(<243175..243278,243345..243490,
FT                   243572..243770,243833..>243869))
FT                   /gene="Pc20g01070"
FT                   /locus_tag="PCH_Pc20g01070"
FT   CDS_pept        complement(join(243175..243278,243345..243490,
FT                   243572..243770,243833..243869))
FT                   /gene="Pc20g01070"
FT                   /locus_tag="PCH_Pc20g01070"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   B7F18.180 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85436"
FT                   /db_xref="GOA:B6HGS1"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS1"
FT                   /inference="similar to AA sequence:PIR:T50999"
FT                   /inference="protein motif:PFAM:PF04099"
FT                   /inference="protein motif:COGS:COG5122"
FT                   /protein_id="CAP85436.1"
FT                   /translation="MVVYSFYIFDRHAECIYKRRWLPRPTSTVGKSRSDTVSGAAPTGL
FT                   GQTVRSTDDDSKLVFGTVFSLRNMVRKLGGEDDNFVSFTTSQYKLHYYETPTNTKFVML
FT                   TDLKSPSMRIALQQIYINLFVEYVVKNPLSPTEHPGGVGVNNELFEESLEQFVVRAL"
FT   exon            complement(243175..243278)
FT                   /gene="Pc20g01070"
FT                   /locus_tag="PCH_Pc20g01070"
FT                   /number=1
FT   intron          complement(243279..243344)
FT                   /gene="Pc20g01070"
FT                   /locus_tag="PCH_Pc20g01070"
FT                   /number=1
FT   exon            complement(243345..243490)
FT                   /gene="Pc20g01070"
FT                   /locus_tag="PCH_Pc20g01070"
FT                   /number=2
FT   intron          complement(243491..243571)
FT                   /gene="Pc20g01070"
FT                   /locus_tag="PCH_Pc20g01070"
FT                   /number=2
FT   exon            complement(243572..243770)
FT                   /gene="Pc20g01070"
FT                   /locus_tag="PCH_Pc20g01070"
FT                   /number=3
FT   intron          complement(243771..243832)
FT                   /gene="Pc20g01070"
FT                   /locus_tag="PCH_Pc20g01070"
FT                   /number=3
FT   exon            complement(243833..243869)
FT                   /gene="Pc20g01070"
FT                   /locus_tag="PCH_Pc20g01070"
FT                   /number=4
FT   mRNA            join(<244217..244296,244364..244448,244505..244654,
FT                   244733..245527,245578..245715,245767..>246966)
FT                   /gene="Pc20g01080"
FT                   /locus_tag="PCH_Pc20g01080"
FT   CDS_pept        join(244217..244296,244364..244448,244505..244654,
FT                   244733..245527,245578..245715,245767..246966)
FT                   /gene="Pc20g01080"
FT                   /locus_tag="PCH_Pc20g01080"
FT                   /EC_number="2.7.11.17"
FT                   /note="Title: strong similarity to calcium/calmodulin
FT                   dependent protein kinase cmkC - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85437"
FT                   /db_xref="GOA:B6HGS2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS2"
FT                   /inference="similar to AA sequence:TREMBL:AF156028.1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP85437.1"
FT                   /translation="MSDISAEPSTSSLEGMSDARPQASRFPQSPPRSTASHDSYARHRR
FT                   RNPRSRRPVKETLNARSSYYTSQDDGTAEHRINQYIIKQEIGRGSFGAVHLAADQYGNE
FT                   YAVKEFSKSRLRKRAQSHMLRRPRGPIRGGTDFNSPLHRHPSGDDTETAKNPLYLIKEE
FT                   IAIMKKLNHNNLVSLIEVLDDPTEDSLYMVMEMCKKGVVMKVGLEEKADPYDDEQCRCW
FT                   FRDLILGIEYLHSQGIVHRDIKPDNCLVTNDDILKVVDFGVSEMFEKDSNMFTGKSAGS
FT                   PAFLPPELCVAKHGDVSGRATDIWSMGVTLYCLRYGRLPFEKQSIFELYDSIRGDTLVY
FT                   EDESDEVFKDLIGRILEKDPEKRIDMFALREHPWVTKNGTDPLLSFEENTSQIIEPPTE
FT                   EEMNSAITRKMGHLVTVMKAVQRFKRLTDPMKPQSPIQSTFGSILGGDHDAFLVEPPME
FT                   MDPDEPFPTVGAALQTHDSNGPDVRKNFPRRPFAGFRENAGCIGSTDSASFSSQPEHSP
FT                   SNSKIPSGVTEPERRDSGSIRSWGSTAQPDVGHEAQPHSQSASPHIPLSRASSSRTKRS
FT                   MEGTRGHARDPLEEEFPYLFIGPSTYNGSSQQDTVPGDEPASILQEPGHSMDPSDQMED
FT                   EEPVQFVSESPGAADFNIYETAYRKELDRIKNNLKDRDTGRKVYLTRFVEENSAEVLKL
FT                   SKEKELDLQMGDDFTPSPLSRTPSGFGTAVSALRSQILQKRQAEEPEEQGGDARKDKDY
FT                   SQNREPHPHPPKRLSVPSQSIPEPESSSLEATGVSSTEGNGDSKAQLRRILDRVRGKSD
FT                   GAE"
FT   exon            244217..244296
FT                   /gene="Pc20g01080"
FT                   /locus_tag="PCH_Pc20g01080"
FT                   /number=1
FT   intron          244297..244363
FT                   /gene="Pc20g01080"
FT                   /locus_tag="PCH_Pc20g01080"
FT                   /number=1
FT   exon            244364..244448
FT                   /gene="Pc20g01080"
FT                   /locus_tag="PCH_Pc20g01080"
FT                   /number=2
FT   intron          244449..244504
FT                   /gene="Pc20g01080"
FT                   /locus_tag="PCH_Pc20g01080"
FT                   /number=2
FT   exon            244505..244654
FT                   /gene="Pc20g01080"
FT                   /locus_tag="PCH_Pc20g01080"
FT                   /number=3
FT   intron          244655..244732
FT                   /gene="Pc20g01080"
FT                   /locus_tag="PCH_Pc20g01080"
FT                   /number=3
FT   exon            244733..245527
FT                   /gene="Pc20g01080"
FT                   /locus_tag="PCH_Pc20g01080"
FT                   /number=4
FT   intron          245528..245577
FT                   /gene="Pc20g01080"
FT                   /locus_tag="PCH_Pc20g01080"
FT                   /number=4
FT   exon            245578..245715
FT                   /gene="Pc20g01080"
FT                   /locus_tag="PCH_Pc20g01080"
FT                   /number=5
FT   intron          245716..245766
FT                   /gene="Pc20g01080"
FT                   /locus_tag="PCH_Pc20g01080"
FT                   /number=5
FT   exon            245767..246966
FT                   /gene="Pc20g01080"
FT                   /locus_tag="PCH_Pc20g01080"
FT                   /number=6
FT   mRNA            complement(join(<248711..249558,249658..249772,
FT                   249825..>249866))
FT                   /gene="Pc20g01090"
FT                   /locus_tag="PCH_Pc20g01090"
FT   CDS_pept        complement(join(248711..249558,249658..249772,
FT                   249825..249866))
FT                   /gene="Pc20g01090"
FT                   /locus_tag="PCH_Pc20g01090"
FT                   /note="Title: similarity to hypothetical protein An17g01855
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85438"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS3"
FT                   /protein_id="CAP85438.1"
FT                   /translation="MSNPSDRPWTEEDKYTLLTEILKKAGFPSSYLVRMIKEYGITPSW
FT                   EHIPLPQGRSLSSCKTAYLNMVQQPVHPPHPVAPFPPRSDITGPPASMDPSTMRKRPLY
FT                   PSDKPIPRAIQPRPPASTASYSSESGASAQLSPRLDTGPGEPPRKRGRPSKAETERRKL
FT                   LAEARGETYPAPRRSGSGRLKVPPSPTSPAAGPSSTPFPPAPQAFHGPKPGPVPMLYDT
FT                   SAMRSAIPPGPGPASNDERRDMPARGMGTNMRELPRPTEMGHPLPSPHALQLGPPDAFP
FT                   RLSNPVERPYSFSADRFSPPDSGRRDSVTSRSDQPGPYSEGRMSTTPAEQAPR"
FT   exon            complement(248711..249558)
FT                   /gene="Pc20g01090"
FT                   /locus_tag="PCH_Pc20g01090"
FT                   /number=1
FT   intron          complement(249559..249657)
FT                   /gene="Pc20g01090"
FT                   /locus_tag="PCH_Pc20g01090"
FT                   /number=1
FT   exon            complement(249658..249772)
FT                   /gene="Pc20g01090"
FT                   /locus_tag="PCH_Pc20g01090"
FT                   /number=2
FT   intron          complement(249773..249824)
FT                   /gene="Pc20g01090"
FT                   /locus_tag="PCH_Pc20g01090"
FT                   /number=2
FT   exon            complement(249825..249866)
FT                   /gene="Pc20g01090"
FT                   /locus_tag="PCH_Pc20g01090"
FT                   /number=3
FT   mRNA            join(<252120..252516,252636..254252,254305..>254357)
FT                   /gene="Pc20g01100"
FT                   /locus_tag="PCH_Pc20g01100"
FT   CDS_pept        join(252120..252516,252636..254252,254305..254357)
FT                   /gene="Pc20g01100"
FT                   /locus_tag="PCH_Pc20g01100"
FT                   /note="Title: strong similarity to huntingtin interacting
FT                   protein 1 HIF-1 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01100"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85439"
FT                   /db_xref="GOA:B6HGS4"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR006560"
FT                   /db_xref="InterPro:IPR025788"
FT                   /db_xref="InterPro:IPR035441"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS4"
FT                   /inference="similar to AA sequence:TREMBL:HSA238403.1"
FT                   /inference="protein motif:PFAM:PF00856"
FT                   /inference="protein motif:PFAM:PF00397"
FT                   /inference="protein motif:COGS:COG2940"
FT                   /protein_id="CAP85439.1"
FT                   /translation="MSAHDYADSEEPAKMERDSPVNGNHLKNGDSRTSSRSPLPPKKES
FT                   SPNSDAPDPMKENIGEIVLKQEPGQPPKLSRSSSQKVASRPPPLYTHLPDSTQDALATF
FT                   EQIPGCIYANKYMGYTEHAMECDCAEEWDPKIGRNIACGEDSDCINRATKIECAGECGC
FT                   GPDCQNQRFQKRQFAPVSVIKTEKKGFGLRAEKNLDPGELIYEYVGEVVGEQQFRKRMR
FT                   QYDEEGIKHFYFMSLNKGEFVDATKRGNLGRFCNHSCNPNCYVDKWVVGEKLRMGIFAE
FT                   RAVQAGEELVFNYNVDRYGADPQPCYCGEPMCTGFIGGRTQTERATKLSNATIEALGID
FT                   EADGWDTVVAKRPKKKKMEEDDEEYVDSVQPKSLDEDGVTKVMAALVQCQEKWIAVKLL
FT                   GRIQRCDDERVRNRVVRMHGYQILNSQLAQWKEDQNVVLQILNILDGFPRLTRNKIQDS
FT                   KIETNIRPLTTCDDERVPKKAVALLESWAGLEVAYRIPRMKRGKDAKQAINQFERRETG
FT                   QEQRQRSLTRSPSPVYDAPRGPAQQRRDRGPQRSRQPNRRGPRPLPEGWYTAEAEGRVY
FT                   YYSASGKTTWERPTLPATPATPAPGQPAKNQQNLALQSIIDGIMNTQEDTPSENRTATP
FT                   VTPQPSADQPERRHKDGEKWRKLPLEKQKRIYENTVTFPAYQARGGSVQTQDP"
FT   exon            252120..252516
FT                   /gene="Pc20g01100"
FT                   /locus_tag="PCH_Pc20g01100"
FT                   /number=1
FT   intron          252517..252635
FT                   /gene="Pc20g01100"
FT                   /locus_tag="PCH_Pc20g01100"
FT                   /number=1
FT   exon            252636..254252
FT                   /gene="Pc20g01100"
FT                   /locus_tag="PCH_Pc20g01100"
FT                   /number=2
FT   intron          254253..254304
FT                   /gene="Pc20g01100"
FT                   /locus_tag="PCH_Pc20g01100"
FT                   /number=2
FT   exon            254305..254357
FT                   /gene="Pc20g01100"
FT                   /locus_tag="PCH_Pc20g01100"
FT                   /number=3
FT   mRNA            join(<254424..254430,254587..>255023)
FT                   /gene="Pc20g01110"
FT                   /locus_tag="PCH_Pc20g01110"
FT   CDS_pept        join(254424..254430,254587..255023)
FT                   /gene="Pc20g01110"
FT                   /locus_tag="PCH_Pc20g01110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85440"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS5"
FT                   /protein_id="CAP85440.1"
FT                   /translation="MKSKYVDRGKHEAEKSQDATPNPGSEVHSTGDDEAVAGASASSPL
FT                   EDDDAASLKRKRNGTLNVDGAEDGASSPSKRQKSTPPPPPPPPPPADLPQDDADGDTSM
FT                   GNTGNDSSHPKDDSGAGVDVNMEIEAENNPQTERPQISVEGQV"
FT   exon            254424..254430
FT                   /gene="Pc20g01110"
FT                   /locus_tag="PCH_Pc20g01110"
FT                   /number=1
FT   intron          254431..254586
FT                   /gene="Pc20g01110"
FT                   /locus_tag="PCH_Pc20g01110"
FT                   /number=1
FT   exon            254587..255023
FT                   /gene="Pc20g01110"
FT                   /locus_tag="PCH_Pc20g01110"
FT                   /number=2
FT   mRNA            complement(join(<255666..256026,256134..256322,
FT                   256416..256502,256675..256746,256807..>256841))
FT                   /gene="Pc20g01120"
FT                   /locus_tag="PCH_Pc20g01120"
FT   CDS_pept        complement(join(255666..256026,256134..256322,
FT                   256416..256502,256675..256746,256807..256841))
FT                   /gene="Pc20g01120"
FT                   /locus_tag="PCH_Pc20g01120"
FT                   /note="Title: strong similarity to translation initiation
FT                   factor like protein An17g01815 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85441"
FT                   /db_xref="GOA:B6HH38"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH38"
FT                   /inference="protein motif:PFAM:PF01912"
FT                   /inference="protein motif:COGS:COG1976"
FT                   /protein_id="CAP85441.1"
FT                   /translation="MAVRAQFENSNEVGVFSCLTNAYAIVAVGASENFYSVFESELQDV
FT                   IPICHATIAGTRIVGRLIVGNRKGLLVPTTTTDQELQHLRNTLPAEVKIQRIEERLSAL
FT                   GNVICCNDHVAIVHPDLERETEEIIADVLGVEVFRQTVADNVLTGSYMALSNQGGIVHP
FT                   KTSIRDQDELSSLLQVPLVAGSVNRGSPVVGAGMVVNDWLAITGLDTTATELSVVESVF
FT                   RLGEMAPGGAGGAAVNKDSIVESFY"
FT   exon            complement(255666..256026)
FT                   /gene="Pc20g01120"
FT                   /locus_tag="PCH_Pc20g01120"
FT                   /number=1
FT   intron          complement(256027..256133)
FT                   /gene="Pc20g01120"
FT                   /locus_tag="PCH_Pc20g01120"
FT                   /number=1
FT   exon            complement(256134..256322)
FT                   /gene="Pc20g01120"
FT                   /locus_tag="PCH_Pc20g01120"
FT                   /number=2
FT   intron          complement(256323..256415)
FT                   /gene="Pc20g01120"
FT                   /locus_tag="PCH_Pc20g01120"
FT                   /number=2
FT   exon            complement(256416..256502)
FT                   /gene="Pc20g01120"
FT                   /locus_tag="PCH_Pc20g01120"
FT                   /number=3
FT   intron          complement(256503..256674)
FT                   /gene="Pc20g01120"
FT                   /locus_tag="PCH_Pc20g01120"
FT                   /number=3
FT   exon            complement(256675..256746)
FT                   /gene="Pc20g01120"
FT                   /locus_tag="PCH_Pc20g01120"
FT                   /number=4
FT   intron          complement(256747..256806)
FT                   /gene="Pc20g01120"
FT                   /locus_tag="PCH_Pc20g01120"
FT                   /number=4
FT   exon            complement(256807..256841)
FT                   /gene="Pc20g01120"
FT                   /locus_tag="PCH_Pc20g01120"
FT                   /number=5
FT   mRNA            complement(join(<259228..260013,260064..260172,
FT                   260225..261528,261579..>261666))
FT                   /gene="Pc20g01130"
FT                   /locus_tag="PCH_Pc20g01130"
FT   CDS_pept        complement(join(259228..260013,260064..260172,
FT                   260225..261528,261579..261666))
FT                   /pseudo
FT                   /gene="Pc20g01130"
FT                   /locus_tag="PCH_Pc20g01130"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   contig_1_162_scaffold_13.tfa_30wg - Aspergillus nidulans"
FT   exon            complement(259228..260013)
FT                   /gene="Pc20g01130"
FT                   /locus_tag="PCH_Pc20g01130"
FT                   /number=1
FT   intron          complement(260014..260063)
FT                   /gene="Pc20g01130"
FT                   /locus_tag="PCH_Pc20g01130"
FT                   /number=1
FT   exon            complement(260064..260172)
FT                   /gene="Pc20g01130"
FT                   /locus_tag="PCH_Pc20g01130"
FT                   /number=2
FT   intron          complement(260173..260224)
FT                   /gene="Pc20g01130"
FT                   /locus_tag="PCH_Pc20g01130"
FT                   /number=2
FT   exon            complement(260225..261528)
FT                   /gene="Pc20g01130"
FT                   /locus_tag="PCH_Pc20g01130"
FT                   /number=3
FT   intron          complement(261529..261578)
FT                   /gene="Pc20g01130"
FT                   /locus_tag="PCH_Pc20g01130"
FT                   /number=3
FT   exon            complement(261579..261666)
FT                   /gene="Pc20g01130"
FT                   /locus_tag="PCH_Pc20g01130"
FT                   /number=4
FT   mRNA            complement(<263597..>264763)
FT                   /gene="Pc20g01140"
FT                   /locus_tag="PCH_Pc20g01140"
FT   CDS_pept        complement(263597..264763)
FT                   /gene="Pc20g01140"
FT                   /locus_tag="PCH_Pc20g01140"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_38_scaffold_2.tfa_240wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85443"
FT                   /db_xref="GOA:B6HH39"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH39"
FT                   /protein_id="CAP85443.1"
FT                   /translation="MPHLSYSLAAASLLATFIVTILSGICYATSKASPDVASTILSAVS
FT                   CMALIALGLLHHQNIQTGRRLWICFAGGYLLIAAAASAGAMARSPQASVFVVRSVFWAL
FT                   SVFAQGLYCGFLAMTLAQEKSNPQWPRAYSQEVHSQELKDIPQSPNFLPSPPRVCDLSE
FT                   LFEPKRSSLRKFPRRSSRYSDTTLCPTSTKEEKNASIDNSSSTHTSPSPSPTRDRMPDT
FT                   LPDRDTRPLLRGTHSIRSMPSLRRNPPTALPLDSRVHPSMPSPTASTIRIDSPTQSSSN
FT                   NSTWEYNPFSENNIHPLFRSTSPCPSPTFSPGTMVKASPSAGQTITAGTITRMRSARSL
FT                   HDHAMRAPSPLPGSESEETIRTRPNPTLGFAHSQSVKRYDLNESPYEK"
FT   exon            complement(263597..264763)
FT                   /gene="Pc20g01140"
FT                   /locus_tag="PCH_Pc20g01140"
FT                   /number=1
FT   mat_peptide     complement(263600..264679)
FT                   /gene="Pc20g01140"
FT                   /locus_tag="PCH_Pc20g01140"
FT   sig_peptide     complement(264680..264763)
FT                   /gene="Pc20g01140"
FT                   /locus_tag="PCH_Pc20g01140"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<266302..266319,266382..266429,266493..266568,
FT                   266647..266726,266794..267126,267179..267649,
FT                   267704..>267820)
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT   CDS_pept        join(266302..266319,266382..266429,266493..266568,
FT                   266647..266726,266794..267126,267179..267649,
FT                   267704..267820)
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1275_scaffold_4.tfa_160wg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85444"
FT                   /db_xref="GOA:B6HH40"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR004806"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015360"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036353"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH40"
FT                   /inference="protein motif:PFAM:PF00240"
FT                   /inference="protein motif:PFAM:PF00627"
FT                   /inference="protein motif:COGS:COG5272"
FT                   /protein_id="CAP85444.1"
FT                   /translation="MKLTFKDLKQEKFVIDVEPSETVREVKVKIAQEKGEYEAERMKVI
FT                   YSGKILQDDKTVESYNIQEKDFLVCLPSKQPKAAASTASSQVPSTPAARAPVSTPAAPP
FT                   APHAAAAPPPSVAPATPSPAGAAPAPSSGPAFGDPSALTMGPAAEGAVVQMEAMGFART
FT                   DIDRAMRAAFYNPDRAIEYLLTGIPDNIQEQQQQQQQASETAPTGAAPAAPAAPSGGDE
FT                   PHLNLFEAAAQAGGEGGRPRGAAGAGAGAAGGEALGSLEFLRSNPHFQQLRQLVQQQPH
FT                   MLEPILQQVAAGNPQIASIIGQNSDQFLQLLGEELEDEEGALPPGAQAISVTEEERDAI
FT                   ERLCRLGFPRDSVIQAYFACDKNEELAANFLFDQPDEDEQ"
FT   exon            266302..266319
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /number=1
FT   intron          266320..266381
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /number=1
FT   exon            266382..266429
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /number=2
FT   intron          266430..266492
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /number=2
FT   exon            266493..266568
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /number=3
FT   intron          266569..266646
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /number=3
FT   exon            266647..266726
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /number=4
FT   intron          266727..266793
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /number=4
FT   exon            266794..267126
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /number=5
FT   intron          267127..267178
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /number=5
FT   exon            267179..267649
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /number=6
FT   intron          267650..267703
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /number=6
FT   exon            267704..267820
FT                   /gene="Pc20g01150"
FT                   /locus_tag="PCH_Pc20g01150"
FT                   /number=7
FT   mRNA            complement(join(<268849..269705,269869..270447,
FT                   270614..>270722))
FT                   /gene="Pc20g01160"
FT                   /locus_tag="PCH_Pc20g01160"
FT   CDS_pept        complement(join(268849..269705,269869..270447,
FT                   270614..270722))
FT                   /gene="Pc20g01160"
FT                   /locus_tag="PCH_Pc20g01160"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg04979.1 - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01160"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85445"
FT                   /db_xref="GOA:B6HH41"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH41"
FT                   /inference="protein motif:PFAM:PF03901"
FT                   /protein_id="CAP85445.1"
FT                   /translation="MWRRTYLLLLVIRVYFALSPSYLHPDENFQGPELFADHQNAGRIF
FT                   SFPSKLPWEFTVEHPIRSIFPLWATYELPMSLLKWFYTEIGSGSPPPHLVYYALRGGMF
FT                   LLSFVLEDWAIYELVPSPRHRRAIVVLVASSYVTWTYQTHTFSNSLETLLVAWGLVLIR
FT                   RIVENKVRRDKASKYTIHADLTPSDTRPSSPTPCSPSSPWWASSTASPSRLSFYSRVCN
FT                   CCLSSSATSLLSALRDPIITPLNNLLYNTDTSNLAQHGLHPRHQHFTANLLQLLGPVYI
FT                   TMLVSLFSWPLVPYWMRNVRALSALSATMLLSLFPHQEPRFLLPAVPLLLSCVPMRRSR
FT                   LLLAVWVIFNAAMGFLMGVYHQGGVVPTQLAMRDIVSSSTTHHIPSATVFWWKTYSPPL
FT                   WLLGGDNQTTEIQTLDLMGMSGAEMMLQLEKVVPACSTPSPVFLVAPTSAAFLDPYAVS
FT                   ARQSRDQNLQLHPLWSYRKHLNLDDMDFGEDGILPTLKRVVGRRGLGVWSVRRSCK"
FT   exon            complement(268849..269705)
FT                   /gene="Pc20g01160"
FT                   /locus_tag="PCH_Pc20g01160"
FT                   /number=1
FT   mat_peptide     complement(join(268852..269705,269869..270447,
FT                   270614..270653))
FT                   /gene="Pc20g01160"
FT                   /locus_tag="PCH_Pc20g01160"
FT   intron          complement(269706..269868)
FT                   /gene="Pc20g01160"
FT                   /locus_tag="PCH_Pc20g01160"
FT                   /number=1
FT   exon            complement(269869..270447)
FT                   /gene="Pc20g01160"
FT                   /locus_tag="PCH_Pc20g01160"
FT                   /number=2
FT   intron          complement(270448..270613)
FT                   /gene="Pc20g01160"
FT                   /locus_tag="PCH_Pc20g01160"
FT                   /number=2
FT   exon            complement(270614..270722)
FT                   /gene="Pc20g01160"
FT                   /locus_tag="PCH_Pc20g01160"
FT                   /number=3
FT   sig_peptide     complement(270654..270722)
FT                   /gene="Pc20g01160"
FT                   /locus_tag="PCH_Pc20g01160"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<271717..271795,271824..271909,271970..272137,
FT                   272189..>272362)
FT                   /gene="Pc20g01170"
FT                   /locus_tag="PCH_Pc20g01170"
FT   CDS_pept        join(271717..271795,271824..271909,271970..272137,
FT                   272189..272362)
FT                   /exception="reasons given in citation"
FT                   /gene="Pc20g01170"
FT                   /locus_tag="PCH_Pc20g01170"
FT                   /note="putative sequencing error"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig5_part_ii.tfa_3150cg - Aspergillus fumigatus
FT                   [putative sequencing error]"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR041577"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH42"
FT                   /inference="protein motif:PFAM:PF03931"
FT                   /inference="protein motif:PFAM:PF01466"
FT                   /inference="protein motif:COGS:COG5201"
FT                   /protein_id="CAP85446.1"
FT                   /translation="YKDLFRAELPTALPLEYNIAYKIDIGTYIPININVYRLSFKKLDE
FT                   XARXVKDLIKKGLIRESNSVXGFLVVFAXKPNRKXRIYIDYRALNNIIVKNGYPLPRIX
FT                   ELLDIIGNVRILSKIDLIAGYXXIRIGEGSIEKIVFNTIXGKYEXLAIPFRLYNAPTTF
FT                   XSIINKTLXPLFSYNIVVYLDDILIFLATLDKYRKYIEEVLALLXKXXLYVLPTKCTFA
FT                   TXELEFYSYIVRNRTIRPLPAKVEAIXAXPRLKTIYNVYXFLGLATYYYRFVYNFLKVY
FT                   ILLYKLLKESDSTLYKXRFRPITXIEAYKSAFRKVKDLLTSALVLKXLDRNRLYVIEID
FT                   TSEXALSIVLIXEDDNRKLHLVIYNRRKLYSAELNYPIYKKELLAIKEAIYIXDRYIDR
FT                   DRFETVIITDNTSLXYLNTIREYSKRLARXIAEFXXYRLSIRYRKGSENVIADTISRRL
FT                   DLIGTT"
FT   exon            271717..271795
FT                   /gene="Pc20g01170"
FT                   /locus_tag="PCH_Pc20g01170"
FT                   /number=1
FT   intron          271796..271823
FT                   /gene="Pc20g01170"
FT                   /locus_tag="PCH_Pc20g01170"
FT                   /number=1
FT   exon            271824..271909
FT                   /gene="Pc20g01170"
FT                   /locus_tag="PCH_Pc20g01170"
FT                   /number=2
FT   intron          271910..271969
FT                   /gene="Pc20g01170"
FT                   /locus_tag="PCH_Pc20g01170"
FT                   /number=2
FT   exon            271970..272137
FT                   /gene="Pc20g01170"
FT                   /locus_tag="PCH_Pc20g01170"
FT                   /number=3
FT   intron          272138..272188
FT                   /gene="Pc20g01170"
FT                   /locus_tag="PCH_Pc20g01170"
FT                   /number=3
FT   exon            272189..272362
FT                   /gene="Pc20g01170"
FT                   /locus_tag="PCH_Pc20g01170"
FT                   /number=4
FT   mRNA            join(<273241..273294,273385..>273792)
FT                   /gene="Pc20g01180"
FT                   /locus_tag="PCH_Pc20g01180"
FT   CDS_pept        join(273241..273294,273385..273792)
FT                   /gene="Pc20g01180"
FT                   /locus_tag="PCH_Pc20g01180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85447"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH43"
FT                   /protein_id="CAP85447.1"
FT                   /translation="MAKACCSKFGCGRHIMKRNGRAEGANTEGPLRPSGSTYASGGAWR
FT                   CICFSSVSAIRSIQCNSRISFSPLLGSCGRRVDGYVRFPFLSRVSVSLFPQMANSDIKM
FT                   DFGSRKQRCDLPDGVVGAQTDPLGDGAVLTLSFGKLLLGAEGLVALCGK"
FT   exon            273241..273294
FT                   /gene="Pc20g01180"
FT                   /locus_tag="PCH_Pc20g01180"
FT                   /number=1
FT   intron          273295..273384
FT                   /gene="Pc20g01180"
FT                   /locus_tag="PCH_Pc20g01180"
FT                   /number=1
FT   exon            273385..273792
FT                   /gene="Pc20g01180"
FT                   /locus_tag="PCH_Pc20g01180"
FT                   /number=2
FT   mRNA            join(<273853..274014,274059..274124,274236..>274358)
FT                   /gene="Pc20g01190"
FT                   /locus_tag="PCH_Pc20g01190"
FT   CDS_pept        join(273853..274014,274059..274124,274236..274358)
FT                   /gene="Pc20g01190"
FT                   /locus_tag="PCH_Pc20g01190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85448"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH44"
FT                   /protein_id="CAP85448.1"
FT                   /translation="MANVFFENGGNRSLTYRHLEGLIATASLLDGRMKLSTFECGWFVC
FT                   GRAWLRFGWAETISAKWVNFYECSVYAHTAQDRWKQSSYNAICVLQCQAVLYCRISKLA
FT                   LEALIRNLVSRE"
FT   exon            273853..274014
FT                   /gene="Pc20g01190"
FT                   /locus_tag="PCH_Pc20g01190"
FT                   /number=1
FT   intron          274015..274058
FT                   /gene="Pc20g01190"
FT                   /locus_tag="PCH_Pc20g01190"
FT                   /number=1
FT   exon            274059..274124
FT                   /gene="Pc20g01190"
FT                   /locus_tag="PCH_Pc20g01190"
FT                   /number=2
FT   intron          274125..274235
FT                   /gene="Pc20g01190"
FT                   /locus_tag="PCH_Pc20g01190"
FT                   /number=2
FT   exon            274236..274358
FT                   /gene="Pc20g01190"
FT                   /locus_tag="PCH_Pc20g01190"
FT                   /number=3
FT   mRNA            complement(join(<274462..275301,275355..>275438))
FT                   /gene="Pc20g01200"
FT                   /locus_tag="PCH_Pc20g01200"
FT   CDS_pept        complement(join(274462..275301,275355..275438))
FT                   /gene="Pc20g01200"
FT                   /locus_tag="PCH_Pc20g01200"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An03g04950 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01200"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85449"
FT                   /db_xref="GOA:B6HH45"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH45"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP85449.1"
FT                   /translation="MEIQQSLPLSNPSIYKIDPMAWMRPLSDPHSRDLEGDFPLDGKDF
FT                   DSVTDKTLAILLESAPVLHEFGAIKVVRLSRDLVMKGGGTVLPCEAKTLNLVASRTGIR
FT                   APRVHRSFQVEDDTQYFGTKGYIVMDFIPGQPLDKCWADLTSDNQRQIAIQIAEMIKEM
FT                   QSVVISQPGPPGGGPFRGRFFTDYSAGPFKDSAEFQGWFNHKLDICKHVKQCPKDIPPF
FT                   QFTTFVLTHQDISPRNLILDQNGEVWLVDWAFAGAYPPAFESAALLAQQFFTGFNEAVL
FT                   SLIPRFPEEERQLDSIAYGLTTAALA"
FT   exon            complement(274462..275301)
FT                   /gene="Pc20g01200"
FT                   /locus_tag="PCH_Pc20g01200"
FT                   /number=1
FT   intron          complement(275302..275354)
FT                   /gene="Pc20g01200"
FT                   /locus_tag="PCH_Pc20g01200"
FT                   /number=1
FT   exon            complement(275355..275438)
FT                   /gene="Pc20g01200"
FT                   /locus_tag="PCH_Pc20g01200"
FT                   /number=2
FT   mRNA            <276081..>276425
FT                   /gene="Pc20g01210"
FT                   /locus_tag="PCH_Pc20g01210"
FT   CDS_pept        <276081..>276425
FT                   /pseudo
FT                   /gene="Pc20g01210"
FT                   /locus_tag="PCH_Pc20g01210"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical protein An15g06870
FT                   - Aspergillus niger [truncated ORF][putative pseudogene]"
FT   exon            <276081..>276425
FT                   /gene="Pc20g01210"
FT                   /locus_tag="PCH_Pc20g01210"
FT                   /number=1
FT   mRNA            <278175..>282176
FT                   /gene="Pc20g01220"
FT                   /locus_tag="PCH_Pc20g01220"
FT   CDS_pept        278175..282176
FT                   /gene="Pc20g01220"
FT                   /locus_tag="PCH_Pc20g01220"
FT                   /note="Title: strong similarity to multidrug resistance
FT                   protein mdr1 - Aspergillus flavus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85451"
FT                   /db_xref="GOA:B6HH46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH46"
FT                   /inference="similar to AA sequence:PIR:T30882"
FT                   /inference="protein motif:PFAM:PF00664"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /inference="protein motif:COGS:COG1132"
FT                   /protein_id="CAP85451.1"
FT                   /translation="MQQPQEGVTAVEKVADGPQLNEKPVDKRDSDSASTSTAKEHESKT
FT                   PVASDEDALYAHLPEHEKDILKQQLDAPPVNISYFGLYRYASRIDILIIVISTLCAIAA
FT                   GAALPLFTILFGSLATAFQKIMLRTIPYDEFYDQLTTNVLYFIYLGIGEFVTVYVSTVG
FT                   FIYTGEHVTQKIREHYLEAILRQNIAYFDKLGAGEVTTRITADTNLIQDGVSEKVGLTL
FT                   TAVATFVTAFIVAYIKYAPLAGICTSTMVALVLIMGGGSQLIIKFGKLSLESAGAGGTV
FT                   AEEVISSIRNATAFGTQDKLAKQYESHLLRAERWGMRLQMSLAVMVGIMFGLMFMNYGL
FT                   GFWMGSQFLVDGKVDVGQVLTILMAILIGSFSLGNVSPNASAFTNAVAAATKIFATIDR
FT                   DSPLDPTSDEGIILDHVEGHIEFRNVKHIYPSRPEVTVMNDVSLGIPAGNTTALVGPSG
FT                   SGKSTVVGLVERFYLPVGGQVFLDGHDIQTLNLRWLRQQISLVSQEPVLFGTTIYQNIR
FT                   HGLIGTRFEHESEEKIKELIENAAKMANAHEFITALPEGYETNVGQRGFLLSGGQKQRI
FT                   AIARAMVSDPKILLLDEATSALDTKSEGVVQAALDRAAEGRTTIVIAHRLSTIKSAHNI
FT                   VVFVQGSIVEQGTHSQLTEHDGPYFKLVEAQRINEEKDADALDADEDEDGLEEMTKSHI
FT                   ARVKSIASGSTCVKDEAETFQDAMHRQESRKSVSSVILSQKTAEGGRKHSLLTLIKFIG
FT                   SFNKEERWFMAIGLCFSILAGCGQPTQAFLYAKAISALSLPKTQYDKLRSDANFWSLMF
FT                   FIVGIVQIITFSVHGIAFAFSSERLIRKARGNAFRVMLRQDINFFDREENSTGALTSFL
FT                   STETKHLAGISGQTLGTILMTSTTLIASIVIALAFGWKLALVCMSVIPILLGCGFYRFY
FT                   MLAAFQARSKAAYEGSASYACEATSAIRTVASLTRETDVWSFYHGQLERQGRTSLISVF
FT                   KSSLLYAASQALVFFCVALGFWYGGTLLGHHEYDVFRFFVCFSEILFGAQSAGTVFSFS
FT                   PDMGKAKNAAAEFLRLFERRPTIDTWSEEGENLDHCEGTIEFKDVHFRYPTRPEQPVLR
FT                   GLNLTVKPGQYIALVGPSGCGKSTTIALLERFYDALSGGVYIDDKNIADLNVNSYRSHL
FT                   ALVSQEPTLYQGTIKENILLGSPNQDPTEEELVQVCKDANIYDFIMSLPEGFNTVVGSK
FT                   GGMLSGGQKQRVAIARALLRNPKVLLLDEATSALDSESEKVVQAALDAAARGRTTIAVA
FT                   HRLSTIQKADIIYVFDQGKIVESGTHTELLRNKGRYFELVNLQSLGRAG"
FT   exon            278175..282176
FT                   /gene="Pc20g01220"
FT                   /locus_tag="PCH_Pc20g01220"
FT                   /number=1
FT   mRNA            complement(join(<282536..282695,282785..282870,
FT                   282940..>282987))
FT                   /gene="Pc20g01230"
FT                   /locus_tag="PCH_Pc20g01230"
FT   CDS_pept        complement(join(282536..282695,282785..282870,
FT                   282940..282987))
FT                   /gene="Pc20g01230"
FT                   /locus_tag="PCH_Pc20g01230"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   SPBC409.03 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85452"
FT                   /db_xref="InterPro:IPR010760"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH47"
FT                   /inference="similar to AA sequence:PIR:T40431"
FT                   /protein_id="CAP85452.1"
FT                   /translation="MDQAKETRSFRDQERVDNLRASIASLEAKYARLEADLASVTAQLK
FT                   DDYNTTCVRYTQLLHEYNDIRDVGQGLMELIADARGVRQVEVVREFGFSEED"
FT   exon            complement(282536..282695)
FT                   /gene="Pc20g01230"
FT                   /locus_tag="PCH_Pc20g01230"
FT                   /number=1
FT   intron          complement(282696..282784)
FT                   /gene="Pc20g01230"
FT                   /locus_tag="PCH_Pc20g01230"
FT                   /number=1
FT   exon            complement(282785..282870)
FT                   /gene="Pc20g01230"
FT                   /locus_tag="PCH_Pc20g01230"
FT                   /number=2
FT   intron          complement(282871..282939)
FT                   /gene="Pc20g01230"
FT                   /locus_tag="PCH_Pc20g01230"
FT                   /number=2
FT   exon            complement(282940..282987)
FT                   /gene="Pc20g01230"
FT                   /locus_tag="PCH_Pc20g01230"
FT                   /number=3
FT   mRNA            join(<283390..283503,283554..283631,283702..284532,
FT                   284598..>285041)
FT                   /gene="Pc20g01240"
FT                   /locus_tag="PCH_Pc20g01240"
FT   CDS_pept        join(283390..283503,283554..283631,283702..284532,
FT                   284598..285041)
FT                   /gene="Pc20g01240"
FT                   /locus_tag="PCH_Pc20g01240"
FT                   /note="Title: strong similarity to hypothetical membrane
FT                   protein Ytp1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85453"
FT                   /db_xref="GOA:B6HH48"
FT                   /db_xref="InterPro:IPR018825"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH48"
FT                   /inference="similar to AA sequence:PIR:S59812"
FT                   /protein_id="CAP85453.1"
FT                   /translation="MAYLRQSLWTLSVLVASALAHGGHEAVPEGESISQDPIDSTLWTH
FT                   MILMGLAFGIIFPTGMVLGIIRSRWHVPVQVVGTVIAVLAYFLGHAHKGRQFDKNVHAS
FT                   VANWLMLLLVAQVVLGFYLKLHLEKAGQARIRWIFVLAHGIVGKVMPVLSWAQMLFGGI
FT                   ASLGFCRDDHLGQCLAHFIMGSAFIGYGICLTILLLVGQYWLRRTGRSQEFFDSLIIAA
FT                   WGCVNTFTEHRWGSPWAHNDLQHTTMGIIWWCAGLLGMWLSRTRSGRPKRNLIPAIVIL
FT                   ITGYAMSAHPQSLMISTMIHSIFGYTLMAAGLTRIIEISFVLKDKPALSEPNSFQYLTP
FT                   FLLYASGFLFMGATEEQMLLLHNAGVTHVSYVLILYSIAFIVFLCKLIPYPPLIFSGTP
FT                   THSSLPVVNILLHIYAVHAWPNSESTNQDGPMYSTLNGNANGRARSNSQQIQDAEAFEL
FT                   HGLISDDEEGPSMGPRKNSDEELGKEETRH"
FT   sig_peptide     283390..283449
FT                   /gene="Pc20g01240"
FT                   /locus_tag="PCH_Pc20g01240"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            283390..283503
FT                   /gene="Pc20g01240"
FT                   /locus_tag="PCH_Pc20g01240"
FT                   /number=1
FT   mat_peptide     join(283450..283503,283554..283631,283702..284532,
FT                   284598..285038)
FT                   /gene="Pc20g01240"
FT                   /locus_tag="PCH_Pc20g01240"
FT   intron          283504..283553
FT                   /gene="Pc20g01240"
FT                   /locus_tag="PCH_Pc20g01240"
FT                   /number=1
FT   exon            283554..283631
FT                   /gene="Pc20g01240"
FT                   /locus_tag="PCH_Pc20g01240"
FT                   /number=2
FT   intron          283632..283701
FT                   /gene="Pc20g01240"
FT                   /locus_tag="PCH_Pc20g01240"
FT                   /number=2
FT   exon            283702..284532
FT                   /gene="Pc20g01240"
FT                   /locus_tag="PCH_Pc20g01240"
FT                   /number=3
FT   intron          284533..284597
FT                   /gene="Pc20g01240"
FT                   /locus_tag="PCH_Pc20g01240"
FT                   /number=3
FT   exon            284598..285041
FT                   /gene="Pc20g01240"
FT                   /locus_tag="PCH_Pc20g01240"
FT                   /number=4
FT   mRNA            complement(join(<285377..286270,286322..286508,
FT                   286557..286614,286663..>286702))
FT                   /gene="Pc20g01250"
FT                   /locus_tag="PCH_Pc20g01250"
FT   CDS_pept        complement(join(285377..286270,286322..286508,
FT                   286557..286614,286663..286702))
FT                   /gene="Pc20g01250"
FT                   /locus_tag="PCH_Pc20g01250"
FT                   /note="Title: strong similarity to Smt3p activating enzyme
FT                   Aos1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85454"
FT                   /db_xref="GOA:B6HH49"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH49"
FT                   /inference="similar to AA sequence:PIR:S59837"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /inference="protein motif:COGS:COG0476"
FT                   /protein_id="CAP85454.1"
FT                   /translation="MAEQQDNAQSISADEIALYDRQIRLWGVHAQEKIRSANILLITVK
FT                   ALANEVAKNLVLAGIGSLTIIDHQDVTEEDLGAQFFIAEAQSEKDVIGKNRAQVAGPQI
FT                   HKMNPRVKLNIDTSDVKTKQPDFFAQFDITIATELDFLTNTTVNAACRLANRPFYAAGL
FT                   HGLYGYVFADLISHDFVIERNKSNMPPATQETPTRSIIDITTKKEQNEANKEESKIIEL
FT                   VTKREVYSPLILANTSPLPEEYTRLPRRRKQVTPLLSCLRALWEFEKLRGHRPTFTHED
FT                   LELFTKLSRDRHQELKLEPLTLDSVFLRTFLQNLGSELSPVAAFLGGALAQDVINVLSA
FT                   REQPLQNMLLFDGEKSVGPIYSLHPFFPDDGADMAAVPPVRNPVTVPVAGDS"
FT   exon            complement(285377..286270)
FT                   /gene="Pc20g01250"
FT                   /locus_tag="PCH_Pc20g01250"
FT                   /number=1
FT   intron          complement(286271..286321)
FT                   /gene="Pc20g01250"
FT                   /locus_tag="PCH_Pc20g01250"
FT                   /number=1
FT   exon            complement(286322..286508)
FT                   /gene="Pc20g01250"
FT                   /locus_tag="PCH_Pc20g01250"
FT                   /number=2
FT   intron          complement(286509..286556)
FT                   /gene="Pc20g01250"
FT                   /locus_tag="PCH_Pc20g01250"
FT                   /number=2
FT   exon            complement(286557..286614)
FT                   /gene="Pc20g01250"
FT                   /locus_tag="PCH_Pc20g01250"
FT                   /number=3
FT   intron          complement(286615..286662)
FT                   /gene="Pc20g01250"
FT                   /locus_tag="PCH_Pc20g01250"
FT                   /number=3
FT   exon            complement(286663..286702)
FT                   /gene="Pc20g01250"
FT                   /locus_tag="PCH_Pc20g01250"
FT                   /number=4
FT   mRNA            join(<287846..287848,287904..288694,288756..289361,
FT                   289412..289518,289586..289645,289710..289777,
FT                   289869..>290102)
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT   CDS_pept        join(287846..287848,287904..288694,288756..289361,
FT                   289412..289518,289586..289645,289710..289777,
FT                   289869..290102)
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /note="Title: similarity to hypothetical protein AAK58053.1
FT                   - Ophiostoma novo-ulmi"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85455"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH50"
FT                   /inference="similar to AA sequence:TREMBL:AF378550.1"
FT                   /protein_id="CAP85455.1"
FT                   /translation="MSGNYDYPRASSSSSRRISRTIRPDERPEILRLQHLRNFVSERNR
FT                   SGAHNAYNATLALETLNREVAEHSLDRARDRTNFEQARADIDRQIQQLHSETAGPAERI
FT                   RSIWLDQIRSERARTSLSPESHSLRHRLPWQTLRPPSPDGSLSRSPPLMPPSGQSGRDG
FT                   QGRMKRRKLDTDDNREEFRGFNYGQYGQVVPGMLQMEIASCDGGSYDPDSGCSRPENVL
FT                   DNNTSVYSTKEARCNLVLCHRGEAPFCLKKIVIKAPQCGFDAPIQEGMVFVAMTSDELL
FT                   ARTAQYQIQYSSGRYRRRGRRSGMQPSQEYLTGFRPPLQNLERTVLMSPHSAAVPQTAE
FT                   DPQAQFHITTEYDENNEDSDDDEDWRSALLERTQAEQTEDPLSDTDESPSDEEDPSSRH
FT                   QRRRQIESERLSTLSRVSEQRLRHGPSLVYPNPPAEPAHPAAEVLKPHARFFIEREKSM
FT                   VTIKFDPPPSGRFILIKLWSPRAHGNIDIESIIAHGYAGPRFFPTFHFLFVYSISAATF
FT                   LLASTIDHTNYVVCGIVRYLVTSKAWQVRANNLNDTYNALLHPWMLPPSSTFAIPNLGT
FT                   YIGNLSGMTTAMTYSLYIQHSGDDREREPINPHGLDHIIARRHLAL"
FT   exon            287846..287848
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /number=1
FT   intron          287849..287903
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /number=1
FT   exon            287904..288694
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /number=2
FT   intron          288695..288755
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /number=2
FT   exon            288756..289361
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /number=3
FT   intron          289362..289411
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /number=3
FT   exon            289412..289518
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /number=4
FT   intron          289519..289585
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /number=4
FT   exon            289586..289645
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /number=5
FT   intron          289646..289709
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /number=5
FT   exon            289710..289777
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /number=6
FT   intron          289778..289868
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /number=6
FT   exon            289869..290102
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /number=7
FT   mRNA            join(<291774..292383,292460..>293166)
FT                   /gene="Pc20g01270"
FT                   /locus_tag="PCH_Pc20g01270"
FT   CDS_pept        join(291774..292383,292460..293166)
FT                   /gene="Pc20g01270"
FT                   /locus_tag="PCH_Pc20g01270"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_112_scaffold_8.tfa_450cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85456"
FT                   /db_xref="GOA:B6HH51"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019103"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH51"
FT                   /inference="protein motif:PFAM:PF00240"
FT                   /protein_id="CAP85456.1"
FT                   /translation="MRITVSVIRPEQADSDIINLEVGGDMSIELLKAIVESETSIPPEA
FT                   QQLVYNNQLLQNPSQTLDQAGITEGDMLGVHVTLRAPQPAPRPAASSSVAPRQNAQPRP
FT                   GMPDPETIRLHILGDPRVREAVRRQNPELSEAADNAQRFREVLLRQQQGEAQREAEKEA
FT                   RIAMLNADPFNHDNQKEIEEIIRQNAVTENLHNAMEHHPESFGRVTMLYIPVEVNGHRL
FT                   NAFVDSGAQVTIMSPECATSCNIMRLVDRRYGGIAKGVGTAPILGRVHSAQIKIGEMFL
FT                   PCSFTVMEGKQIDLLLGLDMLRRHQACIDLQRGALVIQDQAVPFLGESDIPKHFTEEFE
FT                   AEPTVKGADGAEVGARTGAVTHKAENNPNANATPNIASASGSGASGSQPRINIRPAPTS
FT                   RWPQDSIARITELGFSREEAVRALDMAHGDLEGAIGFLI"
FT   exon            291774..292383
FT                   /gene="Pc20g01270"
FT                   /locus_tag="PCH_Pc20g01270"
FT                   /number=1
FT   intron          292384..292459
FT                   /gene="Pc20g01270"
FT                   /locus_tag="PCH_Pc20g01270"
FT                   /number=1
FT   exon            292460..293166
FT                   /gene="Pc20g01270"
FT                   /locus_tag="PCH_Pc20g01270"
FT                   /number=2
FT   mRNA            complement(join(<293362..293432,293524..293676,
FT                   293958..294149,294226..>294298))
FT                   /gene="Pc20g01280"
FT                   /locus_tag="PCH_Pc20g01280"
FT   CDS_pept        complement(join(293362..293432,293524..293676,
FT                   293958..294149,294226..294298))
FT                   /gene="Pc20g01280"
FT                   /locus_tag="PCH_Pc20g01280"
FT                   /note="Title: similarity to hypothetical v-snare binding
FT                   protein SPAC56F8.07 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85457"
FT                   /db_xref="GOA:B6HH52"
FT                   /db_xref="InterPro:IPR016964"
FT                   /db_xref="InterPro:IPR033118"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH52"
FT                   /inference="similar to AA sequence:PIR:T38917"
FT                   /protein_id="CAP85457.1"
FT                   /translation="MSICTRKRDLAYLLFFVTHVPIILLIDTVPLLPSFLQTNLSHQLR
FT                   EFYITTYRDKFFEDPPTWFTVFIWMELLYHLPVSIWAARGLLKDHPLVPVHLLVFGIQA
FT                   FITTLTSLVVVWSWTDRSVAEKQQLTTLYAPYMALGGFMALDMVFRLRDKLMPKTKRE"
FT   exon            complement(293362..293432)
FT                   /gene="Pc20g01280"
FT                   /locus_tag="PCH_Pc20g01280"
FT                   /number=1
FT   intron          complement(293433..293523)
FT                   /gene="Pc20g01280"
FT                   /locus_tag="PCH_Pc20g01280"
FT                   /number=1
FT   exon            complement(293524..293676)
FT                   /gene="Pc20g01280"
FT                   /locus_tag="PCH_Pc20g01280"
FT                   /number=2
FT   intron          complement(293677..293957)
FT                   /gene="Pc20g01280"
FT                   /locus_tag="PCH_Pc20g01280"
FT                   /number=2
FT   exon            complement(293958..294149)
FT                   /gene="Pc20g01280"
FT                   /locus_tag="PCH_Pc20g01280"
FT                   /number=3
FT   intron          complement(294150..294225)
FT                   /gene="Pc20g01280"
FT                   /locus_tag="PCH_Pc20g01280"
FT                   /number=3
FT   exon            complement(294226..294298)
FT                   /gene="Pc20g01280"
FT                   /locus_tag="PCH_Pc20g01280"
FT                   /number=4
FT   mRNA            join(<295520..296516,296590..>296720)
FT                   /gene="Pc20g01290"
FT                   /locus_tag="PCH_Pc20g01290"
FT   CDS_pept        join(295520..296516,296590..296720)
FT                   /gene="Pc20g01290"
FT                   /locus_tag="PCH_Pc20g01290"
FT                   /note="unknown EC_number=1.-.-.-"
FT                   /note="Title: strong similarity to Fe(II)-dependent
FT                   sulfonate/alpha-ketoglutarate dioxygenase YLL057c
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01290"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85458"
FT                   /db_xref="GOA:B6HD66"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD66"
FT                   /inference="similar to AA sequence:PIR:S50963"
FT                   /inference="protein motif:PFAM:PF02668"
FT                   /inference="protein motif:COGS:COG2175"
FT                   /protein_id="CAP85458.1"
FT                   /translation="MPSSAPRRPKQPKKQEPISYDINIPYVDVDKQSKISTKYPQYLPS
FT                   WDPIWFEPLQPFEYEDPALRVRNKSKPNLLPPTAKVSHIQPSLGTIVENVQLSDLSAAG
FT                   RDELALLISERKVVAFPDQDLIDAGPDAQESFMRHFGKPNYQPVSGSMTDHPAFHIIHR
FT                   DGNRDEIARFLQQRTTTTLWHQDVSYEIQPPGYVMLGLLQGPEVGGDTVFAATDLAYKR
FT                   LSPAVTAFLDGLKVTHSSAKMIAHARMTGGLVRKDPVDTVHPLIRVHPVTGEKCMFLNG
FT                   EFITRIDGLKDSETKWVLDFLMNHLVTGHDFQVRVRWQPRTIVMFDNRSTIHSAIVDYL
FT                   DDDYGAKARHIFRLIALGEKPIPVYEEEEEDEEFE"
FT   exon            295520..296516
FT                   /gene="Pc20g01290"
FT                   /locus_tag="PCH_Pc20g01290"
FT                   /number=1
FT   intron          296517..296589
FT                   /gene="Pc20g01290"
FT                   /locus_tag="PCH_Pc20g01290"
FT                   /number=1
FT   exon            296590..296720
FT                   /gene="Pc20g01290"
FT                   /locus_tag="PCH_Pc20g01290"
FT                   /number=2
FT   mRNA            complement(join(<297054..297665,297722..298351,
FT                   298412..298500,298566..301025,301075..>301351))
FT                   /gene="Pc20g01300"
FT                   /locus_tag="PCH_Pc20g01300"
FT   CDS_pept        complement(join(297054..297665,297722..298351,
FT                   298412..298500,298566..301025,301075..301351))
FT                   /gene="Pc20g01300"
FT                   /locus_tag="PCH_Pc20g01300"
FT                   /note="Title: strong similarity to nucleoporin Nup170
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01300"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85459"
FT                   /db_xref="GOA:B6HD67"
FT                   /db_xref="InterPro:IPR004870"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="InterPro:IPR042533"
FT                   /db_xref="InterPro:IPR042537"
FT                   /db_xref="InterPro:IPR042538"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD67"
FT                   /inference="similar to AA sequence:PIR:S45429"
FT                   /inference="protein motif:PFAM:PF03177"
FT                   /inference="protein motif:COGS:COG5308"
FT                   /protein_id="CAP85459.1"
FT                   /translation="MSYPTLPTNLPPATPQKPLPGAYFQTPAPATARPLPPKSPLQTQP
FT                   QTPMPKLPPAASKTKNQTVSTEERGARTINSSLQSESRYPDLDSYLSQGSSSEYNIPVS
FT                   QSWAPFQKVKMYDIPDQIFDQYNRAQVSTSMGLFAELNHAWVAIDNALYIWDFTHPNPQ
FT                   LVGFEEQPNSINAVKLTKPRSGVFLPAITHLLVIATTADIILLGMGYENTPSGGRQVSL
FT                   YHTGMSVAVRGLDINVFAASPSTGRIFFGGSSDTDVHEVTYQQEERWFQGRCGRVNHTS
FT                   SRLSAFRPSMSLTNLAQSAAEHVVQMALDDSRNLLYTLSSSSTIRVFHMGPENTLTLAI
FT                   TKRALDIYSNIGHIITSNETLNPGIKIVSISPVPATEASRYHLVATTATGYRIYLSATG
FT                   SNSWAPASTNTSPPTSMQALHVKTPPVDTSPGVSGVAPSISLASPLGAVSPSAGQITTL
FT                   SPTRLAERYSPGYFFCFTTKDAQQKIDTLFISTPDSGRVAQYQESSVSGKAAESAIILD
FT                   LGGKAEDIGLVSAPSPVTNELAVQFDHPAAEIAILTNGGVHIIRRRRLVDIFAALLRSS
FT                   GNPHEGLTGEIQNFLRTYGRSEMLATALAVACGQGMEISPDQRLTRITDPDVLAAARQA
FT                   FITQGGRAHLNENAIADGSTSALDAVQPSPRHTGIALYIARLLRSIWKEKIAKVGNGPN
FT                   GAQSVSASVSSSKLQAVQHDLSSLAEFFKVNKTFIDGLNGPDALARVNSKQEEVALQAE
FT                   HRALHSLVQLVSHTIEGISFILVLFDERVDEIVATLPAESKAKFLSLTFEELFSSSKGH
FT                   DIAKELVKGIVNRNIAKGSNVETVADALRRRCGSFCSTEDVVIFKAQEMLKRATEAGAN
FT                   TELGRNLLNESLHLFQQVAECLPMDYLVSAVDNFIADQFFAGAIQLALNVAARSDKSNL
FT                   AYSWIMDQRPEQDPRREYFYFRKQCYDLIFKVVLAVDKLAASDPGLIDGQLTTIAKRQN
FT                   EAYGVISDSTDEVFLTSLYDWYLEQGWNDRLLQTQSPFVVTYLQRKSNDDLGHADLLWR
FT                   FYAQSQRFFETAQVQFHLANSAFVLPLSRRIEYLGQARANASIFTPDVGRQSRQRLLQE
FT                   ISNLIDVANIQDDLLQRLKDDERILPERKPEILREVDGPVLDISTLFNKYADSASYHDI
FT                   CLQIFYQADHRNAADVKSTWQHLIQGVHDATVQRGSPQPYEAVIDKVRSLGSRLRMSET
FT                   IFPIRELVPMLERYALEFQRNVGPATWVVDLFLDLGVAHESLYAVLETMYYTDEAPFHG
FT                   SNRRVIAHDLLYLLNGWFHETVRLGGIVFGSDIVAERVSEMLLLLQQSGVISGEQLEIA
FT                   HDLRSRIDDILR"
FT   exon            complement(297054..297665)
FT                   /gene="Pc20g01300"
FT                   /locus_tag="PCH_Pc20g01300"
FT                   /number=1
FT   intron          complement(297666..297721)
FT                   /gene="Pc20g01300"
FT                   /locus_tag="PCH_Pc20g01300"
FT                   /number=1
FT   exon            complement(297722..298351)
FT                   /gene="Pc20g01300"
FT                   /locus_tag="PCH_Pc20g01300"
FT                   /number=2
FT   intron          complement(298352..298411)
FT                   /gene="Pc20g01300"
FT                   /locus_tag="PCH_Pc20g01300"
FT                   /number=2
FT   exon            complement(298412..298500)
FT                   /gene="Pc20g01300"
FT                   /locus_tag="PCH_Pc20g01300"
FT                   /number=3
FT   intron          complement(298501..298565)
FT                   /gene="Pc20g01300"
FT                   /locus_tag="PCH_Pc20g01300"
FT                   /number=3
FT   exon            complement(298566..301025)
FT                   /gene="Pc20g01300"
FT                   /locus_tag="PCH_Pc20g01300"
FT                   /number=4
FT   intron          complement(301026..301074)
FT                   /gene="Pc20g01300"
FT                   /locus_tag="PCH_Pc20g01300"
FT                   /number=4
FT   exon            complement(301075..301351)
FT                   /gene="Pc20g01300"
FT                   /locus_tag="PCH_Pc20g01300"
FT                   /number=5
FT   mRNA            join(<301664..301803,301856..>302255)
FT                   /gene="Pc20g01310"
FT                   /locus_tag="PCH_Pc20g01310"
FT   CDS_pept        join(301664..301803,301856..302255)
FT                   /gene="Pc20g01310"
FT                   /locus_tag="PCH_Pc20g01310"
FT                   /note="Title: similarity to hypothetical conserved protein
FT                   VC0519 - Vibrio cholerae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01310"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85460"
FT                   /db_xref="GOA:B6HD68"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD68"
FT                   /inference="similar to AA sequence:PIR:G82312"
FT                   /inference="protein motif:COGS:COG1610"
FT                   /protein_id="CAP85460.1"
FT                   /translation="MFQSIRFSSRLPARLVRWNSTGPALPPLMATLRTDLKTAMRAKDT
FT                   TRLNVLRALISETNNAAKTASPIQTDIQLLSLIRKRLNASKDAAKEFAAAERPDLKEKE
FT                   DAQVVVLEEYASQVKTLPIAEIKEVVINEIAAMVNANTKPNQGTVLKALFAPGGPLDGK
FT                   PVDRKEVATEVKNALS"
FT   exon            301664..301803
FT                   /gene="Pc20g01310"
FT                   /locus_tag="PCH_Pc20g01310"
FT                   /number=1
FT   intron          301804..301855
FT                   /gene="Pc20g01310"
FT                   /locus_tag="PCH_Pc20g01310"
FT                   /number=1
FT   exon            301856..302255
FT                   /gene="Pc20g01310"
FT                   /locus_tag="PCH_Pc20g01310"
FT                   /number=2
FT   mRNA            complement(join(<302378..302665,302712..302890,
FT                   302942..303056,303117..>303218))
FT                   /gene="Pc20g01320"
FT                   /locus_tag="PCH_Pc20g01320"
FT   CDS_pept        complement(join(302378..302665,302712..302890,
FT                   302942..303056,303117..303218))
FT                   /gene="Pc20g01320"
FT                   /locus_tag="PCH_Pc20g01320"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   YMR200w - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01320"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85461"
FT                   /db_xref="GOA:B6HD69"
FT                   /db_xref="InterPro:IPR019623"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD69"
FT                   /inference="similar to AA sequence:PIR:S59441"
FT                   /protein_id="CAP85461.1"
FT                   /translation="MFLIWGLLVTAALANANDLVGTWTTKSRDVLTGPGFYDPLNDKLL
FT                   EPNLTGISYSFDDDGNYESAYYRAISNPVDPSCPGGIMQWQHGSYTVFGNGTLILTPIA
FT                   VDGRQLLSDPCRQQSGQYTRYNTTEEFKEFSVYIDKFNRIKRLDLTKFDGSLVHPMFLA
FT                   YQPPKMLPTTTLNPMPTGHKQKRELSSKESGVYLVAREQLVNPDRWWWLGVLMTSLGGV
FT                   AFFCS"
FT   exon            complement(302378..302665)
FT                   /gene="Pc20g01320"
FT                   /locus_tag="PCH_Pc20g01320"
FT                   /number=1
FT   mat_peptide     complement(join(302381..302665,302712..302890,
FT                   302942..303056,303117..303170))
FT                   /gene="Pc20g01320"
FT                   /locus_tag="PCH_Pc20g01320"
FT   intron          complement(302666..302711)
FT                   /gene="Pc20g01320"
FT                   /locus_tag="PCH_Pc20g01320"
FT                   /number=1
FT   exon            complement(302712..302890)
FT                   /gene="Pc20g01320"
FT                   /locus_tag="PCH_Pc20g01320"
FT                   /number=2
FT   intron          complement(302891..302941)
FT                   /gene="Pc20g01320"
FT                   /locus_tag="PCH_Pc20g01320"
FT                   /number=2
FT   exon            complement(302942..303056)
FT                   /gene="Pc20g01320"
FT                   /locus_tag="PCH_Pc20g01320"
FT                   /number=3
FT   intron          complement(303057..303116)
FT                   /gene="Pc20g01320"
FT                   /locus_tag="PCH_Pc20g01320"
FT                   /number=3
FT   exon            complement(303117..303218)
FT                   /gene="Pc20g01320"
FT                   /locus_tag="PCH_Pc20g01320"
FT                   /number=4
FT   sig_peptide     complement(303171..303218)
FT                   /gene="Pc20g01320"
FT                   /locus_tag="PCH_Pc20g01320"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<303541..303628,303678..304103,304155..>304270)
FT                   /gene="Pc20g01330"
FT                   /locus_tag="PCH_Pc20g01330"
FT   CDS_pept        join(303541..303628,303678..304103,304155..304270)
FT                   /gene="Pc20g01330"
FT                   /locus_tag="PCH_Pc20g01330"
FT                   /note="unknown EC_number=6.3.3.2"
FT                   /note="Title: strong similarity to 5-formyltetrahydrofolate
FT                   cyclo-ligase MTHFS - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01330"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85462"
FT                   /db_xref="GOA:B6HD70"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD70"
FT                   /inference="similar to AA sequence:SWISSPROT:FTHC_HUMAN"
FT                   /inference="protein motif:PFAM:PF01812"
FT                   /inference="protein motif:COGS:COG0212"
FT                   /protein_id="CAP85462.1"
FT                   /translation="MAFQAAKRDLRKRMRSTLQGLSATSISQQSSAATTTFLSLPEYQT
FT                   AKSIAVYLSMPSGELSTTGIVKDALQRGKNVYIPYIHTQGKTSIMDMFALGSVSEFESL
FT                   QRDKWGIPSLLSTQIEGRPNGLAQGLDLIVMPGMAFDHGFRRLGHGKGYYDHFLTRYST
FT                   STHKMPFLVALSLQEQLLAEDIPVVEHDWLVDAIVVGDGQFLNRRA"
FT   sig_peptide     join(303541..303628,303678..303685)
FT                   /gene="Pc20g01330"
FT                   /locus_tag="PCH_Pc20g01330"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            303541..303628
FT                   /gene="Pc20g01330"
FT                   /locus_tag="PCH_Pc20g01330"
FT                   /number=1
FT   intron          303629..303677
FT                   /gene="Pc20g01330"
FT                   /locus_tag="PCH_Pc20g01330"
FT                   /number=1
FT   exon            303678..304103
FT                   /gene="Pc20g01330"
FT                   /locus_tag="PCH_Pc20g01330"
FT                   /number=2
FT   mat_peptide     join(303686..304103,304155..304267)
FT                   /gene="Pc20g01330"
FT                   /locus_tag="PCH_Pc20g01330"
FT   intron          304104..304154
FT                   /gene="Pc20g01330"
FT                   /locus_tag="PCH_Pc20g01330"
FT                   /number=2
FT   exon            304155..304270
FT                   /gene="Pc20g01330"
FT                   /locus_tag="PCH_Pc20g01330"
FT                   /number=3
FT   mRNA            complement(join(<304304..304353,304408..304498,
FT                   304556..304671,304818..>304863))
FT                   /gene="Pc20g01340"
FT                   /locus_tag="PCH_Pc20g01340"
FT   CDS_pept        complement(join(304304..304353,304408..304498,
FT                   304556..304671,304818..304863))
FT                   /gene="Pc20g01340"
FT                   /locus_tag="PCH_Pc20g01340"
FT                   /note="Title: similarity to small nuclear ribonucleoprotein
FT                   E - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85463"
FT                   /db_xref="GOA:B6HD71"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027078"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD71"
FT                   /inference="similar to AA sequence:PIR:A32127"
FT                   /inference="protein motif:PFAM:PF01423"
FT                   /inference="protein motif:COGS:COG1958"
FT                   /protein_id="CAP85463.1"
FT                   /translation="MYQHLTAETGSKRGSSRKTLLAPIHFIFSLLQKRSTVSIWLYEQL
FT                   AFRIEGKIRGFDEFMNLVIDDAVEVRLATKTEEEKRRPLGQILLKGDNVSLIQAV"
FT   exon            complement(304304..304353)
FT                   /gene="Pc20g01340"
FT                   /locus_tag="PCH_Pc20g01340"
FT                   /number=1
FT   intron          complement(304354..304407)
FT                   /gene="Pc20g01340"
FT                   /locus_tag="PCH_Pc20g01340"
FT                   /number=1
FT   exon            complement(304408..304498)
FT                   /gene="Pc20g01340"
FT                   /locus_tag="PCH_Pc20g01340"
FT                   /number=2
FT   intron          complement(304499..304555)
FT                   /gene="Pc20g01340"
FT                   /locus_tag="PCH_Pc20g01340"
FT                   /number=2
FT   exon            complement(304556..304671)
FT                   /gene="Pc20g01340"
FT                   /locus_tag="PCH_Pc20g01340"
FT                   /number=3
FT   intron          complement(304672..304817)
FT                   /gene="Pc20g01340"
FT                   /locus_tag="PCH_Pc20g01340"
FT                   /number=3
FT   exon            complement(304818..304863)
FT                   /gene="Pc20g01340"
FT                   /locus_tag="PCH_Pc20g01340"
FT                   /number=4
FT   mRNA            join(<304907..305032,305093..305185,305233..305505,
FT                   305557..305647,305713..307953,308005..>308093)
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT   CDS_pept        join(304907..305032,305093..305185,305233..305505,
FT                   305557..305647,305713..307953,308005..308093)
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /note="Title: strong similarity to nuclear import protein
FT                   Mtr10 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85464"
FT                   /db_xref="GOA:B6HD72"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD72"
FT                   /inference="similar to AA sequence:PIR:S67048"
FT                   /inference="protein motif:COGS:COG5101"
FT                   /inference="protein motif:COGS:COG5657"
FT                   /inference="protein motif:COGS:COG5656"
FT                   /protein_id="CAP85464.1"
FT                   /translation="MASKEAGQAFAPVLAAVATMQGNVSRTEKTQAHEFLEKFQKSIEA
FT                   WTTTHALLQSPDVPVEAKLFAATTLKGKIIFDLDQLPPDSVLALRDSVLNLLVAFAPGP
FT                   RPIQTQLCVCLASLAIQMVTWKDVLATVGAALGGSAGDCVLEFLKILPEEVTEGRKINL
FT                   SEDELVDRTKELLEDNAEQVMQLMIQYAQSSPAAATNPRLLDCITSWLREIPAAKVVES
FT                   PLMDVIFKALDNDASFDAGVDCVCTLYRDTKDVDESLPVIQALYPRLMALRPKIAETAE
FT                   AEDLEAFKGITRMFAEAGEAWVVLVARLPGEFQGLVEALLECCARDWERDAVSLTFIFW
FT                   YELKQYITLDRYTDARVAFQPVFAQLVDIMVKHLEFPTPEEGEGEDLFSGDREQEEKFR
FT                   QFRHAMGDVLKDCCAVVGVNDCLAKIYQLIQEWVAKYASQASNEHVPHWQELEAPLFGL
FT                   RAMGRMVDPEESTILGQLIPLIVQIPDQEKVRFQAIMALARYTEWTALHPETLEAQLNY
FT                   VISGFHHSSQEVVQASALAFKFLGTDCQKLLGGHIAQLHTFFESVLDKLKPTSQEEVTE
FT                   GVAAVVSVQPHEKIYDSYKMFCDPIMARIMNLANNAQTEEDQRAVADHLQLITIFVQVV
FT                   TPILAPGEENPAVKYCGEVLPIMTTIVMNFTSSTPILERVCRCWRYMIISYRTGMIPLL
FT                   PTLAQSIANGFQASREGCFLWATDAVVREFSDGAEYVDQATSDAVFQFYEQQAIAFLRI
FT                   LNDLPPQNLPDVIEDFFRLSSNAVRYYPKKYITSSLAVPIFSAALSALTLQQLDPLIAT
FT                   LHYYRDLFSFAFDKPMVSQFTSPEGQPYVTPPEVREAVKTLIISQGQPLAQRVLTGMMF
FT                   TFPGDCFPDASGVLMTMFELLPQETGAWLQTTLQMLPSGTMKHGEAERLLKNVSDKVQS
FT                   GETRKIRVLLQDFTNSYRRRNVAPRDGLGRLEAARFRFSG"
FT   sig_peptide     304907..304987
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            304907..305032
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /number=1
FT   mat_peptide     join(304988..305032,305093..305185,305233..305505,
FT                   305557..305647,305713..307953,308005..308090)
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT   intron          305033..305092
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /number=1
FT   exon            305093..305185
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /number=2
FT   intron          305186..305232
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /number=2
FT   exon            305233..305505
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /number=3
FT   intron          305506..305556
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /number=3
FT   exon            305557..305647
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /number=4
FT   intron          305648..305712
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /number=4
FT   exon            305713..307953
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /number=5
FT   intron          307954..308004
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /number=5
FT   exon            308005..308093
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /number=6
FT   mRNA            <308776..>311103
FT                   /gene="Pc20g01360"
FT                   /locus_tag="PCH_Pc20g01360"
FT   CDS_pept        308776..311103
FT                   /gene="Pc20g01360"
FT                   /locus_tag="PCH_Pc20g01360"
FT                   /note="Title: strong similarity to hypothetical C2H2 zinc
FT                   finger protein - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01360"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85465"
FT                   /db_xref="GOA:B6HD73"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD73"
FT                   /inference="similar to AA sequence:PIR:T50055"
FT                   /inference="protein motif:PFAM:PF00096"
FT                   /inference="protein motif:COGS:COG5048"
FT                   /protein_id="CAP85465.1"
FT                   /translation="MEIDGQPSKRRRRSRKVQSDRKFECTFEGCGKSYSRAEHLSRHAL
FT                   NHTPKQIYRCDFPNCYRSFVRQDLCTRHRERHTTSGSQLQKRDHFTENGTKHSPPSSPA
FT                   ITAPEYFVGSEEPKPPVTTYPLTTGVDSNEIQVDQFSDFPAVLDQPDNLIDLDSMSYPI
FT                   FGGETYNRSPFAMADDFAAWLFSEPVAPLGYGMVPLVQNQFYMNEPAYSNHNFCSVIPQ
FT                   HPMSVTSILDSGAPPAVISEAKRQELLHLMSTRFNESAYAAGAKRKDALMDGDLNDDRH
FT                   ALSLRMMQTYIGSYWYHFHAQLPILHQPTFSADRIPNLLLLAIMAIGAATLDKIHGQSA
FT                   TEAAAELASFIAWHLRWEIFMDADFRPPAKLWVFQSLLLLEVYEKLFSTRALHERAHIH
FT                   HDTTLTLMRRGSSLIGSSSFATPESKEEDESWSTWIKTEATRRVAFAAFVLDSTHATMF
FT                   GHSAKMVAHELRLPLPCDEALWAATSAAEVARVQSSLQSHGVRPIMFLDGLKRTLNGQP
FT                   VRTNAFGRIIIMSGLLSVCWHLNQRDLQISSLGVGQTLGGRDKWRTALLRAFDNWRRDF
FT                   DEALGPSTTSESRNVLHGLAHMGSHVDIADLQIFAGAGRLMGRSITARDYSAAREKTEK
FT                   WATKASARDATFYALKFLSTCFLDSATQPGEYAARDDYLLNRPWVMYFAALVVWTYGFA
FT                   LDGPLRPPPILLTVADRERDMQGFLHRVGEIQEPNELEAMNGRNGCLGLLMILRDSFAK
FT                   PRWELLGEAARLLDSCIAKLQS"
FT   exon            308776..311103
FT                   /gene="Pc20g01360"
FT                   /locus_tag="PCH_Pc20g01360"
FT                   /number=1
FT   mRNA            join(<311500..311671,311771..311911,311982..312074,
FT                   312140..>312168)
FT                   /gene="Pc20g01370"
FT                   /locus_tag="PCH_Pc20g01370"
FT   CDS_pept        join(311500..311671,311771..311911,311982..312074,
FT                   312140..312168)
FT                   /gene="Pc20g01370"
FT                   /locus_tag="PCH_Pc20g01370"
FT                   /note="Title: strong similarity to calmodulin 6 CaM6
FT                   -Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85466"
FT                   /db_xref="GOA:B6HD74"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD74"
FT                   /inference="similar to AA sequence:PIR:S35187"
FT                   /inference="protein motif:COGS:COG5126"
FT                   /protein_id="CAP85466.1"
FT                   /translation="MANNDQASTNYKEAFSLFDRRGTGRVAGDLLGDLLRACGQNPTLA
FT                   EISDLEKSVGGDFDFDSFLKVLNRPGGFREPGEPEEYCRGFQVFDKDMTGFIGVGQLRY
FT                   ILTNLGEKMSDDEVDELLKAVDTSSGEINYTDLVRTILAN"
FT   exon            311500..311671
FT                   /gene="Pc20g01370"
FT                   /locus_tag="PCH_Pc20g01370"
FT                   /number=1
FT   intron          311672..311770
FT                   /gene="Pc20g01370"
FT                   /locus_tag="PCH_Pc20g01370"
FT                   /number=1
FT   exon            311771..311911
FT                   /gene="Pc20g01370"
FT                   /locus_tag="PCH_Pc20g01370"
FT                   /number=2
FT   intron          311912..311981
FT                   /gene="Pc20g01370"
FT                   /locus_tag="PCH_Pc20g01370"
FT                   /number=2
FT   exon            311982..312074
FT                   /gene="Pc20g01370"
FT                   /locus_tag="PCH_Pc20g01370"
FT                   /number=3
FT   intron          312075..312139
FT                   /gene="Pc20g01370"
FT                   /locus_tag="PCH_Pc20g01370"
FT                   /number=3
FT   exon            312140..312168
FT                   /gene="Pc20g01370"
FT                   /locus_tag="PCH_Pc20g01370"
FT                   /number=4
FT   mRNA            complement(<312375..>312908)
FT                   /gene="Pc20g01380"
FT                   /locus_tag="PCH_Pc20g01380"
FT   CDS_pept        complement(312375..312908)
FT                   /gene="Pc20g01380"
FT                   /locus_tag="PCH_Pc20g01380"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An07g01650 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85467"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD75"
FT                   /protein_id="CAP85467.1"
FT                   /translation="MTDQRLPIQTQHCRFCNHLLLATTRNINTLPRRGGESKDKALILP
FT                   LERKSSADGEVEVDLEEEARATETPSRKARHASNHTTLLLATTIPDRRATMIRREDGIE
FT                   KRILLRCGRCKVVVGYYLDRVHWAAGDRGAVRDGEEEDEERPPAVYLLPGAVVETEKLG
FT                   GEGVGEREWREWAV"
FT   exon            complement(312375..312908)
FT                   /gene="Pc20g01380"
FT                   /locus_tag="PCH_Pc20g01380"
FT                   /number=1
FT   mRNA            complement(join(<313469..313661,313732..>315686))
FT                   /gene="Pc20g01390"
FT                   /locus_tag="PCH_Pc20g01390"
FT   CDS_pept        complement(join(313469..313661,313732..315686))
FT                   /gene="Pc20g01390"
FT                   /locus_tag="PCH_Pc20g01390"
FT                   /note="Title: strong similarity to cytoplasmic
FT                   metalloproteinase mepB - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01390"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85468"
FT                   /db_xref="GOA:B6HD76"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR024080"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD76"
FT                   /inference="similar to AA sequence:TREMBL:AFU85769.1"
FT                   /inference="protein motif:PFAM:PF01432"
FT                   /inference="protein motif:COGS:COG0339"
FT                   /protein_id="CAP85468.1"
FT                   /translation="MAPAHLRAPPQAPPIFTATPQSVVADAERLIKNSRAIQDKVVAEI
FT                   KPDDATFANVVRPLAQDDNQMGLESHILGFYQAVSTDSKLRDASSKAEELMDEFFIEAV
FT                   MREDVFGLVDAVLRRNESLDPESRRLLEKEHKDFVRNGLGLPAGPQRLRFKEIKKRLSQ
FT                   LSIEFQKNLNEENGGIWFTPEQLAGVPKDVLDGLKKGEGENAGKLWLSFKYPDLFPTMK
FT                   YASDPETRRQVMIANENKCNQNVPLFRESIILRDEAARLIGYPNHAAFRIEDKMAKTPE
FT                   IVNKFLGDLRDRLTDGGKKEIQKLLELKNATDPKADGRYYLWDHRFYDRLMLEKDYSLD
FT                   QQLIAEWFPLQTTIDGMLKIFEELFGLEFVEIIGEDRAAIAPTGKGNDIVWHDDVQVFS
FT                   VWNDEGEGSGFVGYLYLDLFPREGKYGHAANFNLQPGFVDKDGNRRFPATALVCNFTKP
FT                   QPKKPSLLKHDEVVTLFHELGHGIHDLVSRTIYSRFHGTSTVRDFVEAPSQMLENWCWE
FT                   PSQLRSLSRHYSTLSPEYLATWQEAQEGKTATSQPSERIPDDVIENLIRTKHVNDSLFN
FT                   LRQLHFGIFDMTVHEPKTHADIEALPLSATYNRLRQEITQLDGPEVQGAGSEWGHGEAT
FT                   FGHLIGGYDAGYYGYLSSQVYSTDMFYTVFKDDPMNKAAGRRYRYQVLEKGGSQDEMKT
FT                   LTEFLGREPQTDAFYKDLGLA"
FT   exon            complement(313469..313661)
FT                   /gene="Pc20g01390"
FT                   /locus_tag="PCH_Pc20g01390"
FT                   /number=1
FT   intron          complement(313662..313731)
FT                   /gene="Pc20g01390"
FT                   /locus_tag="PCH_Pc20g01390"
FT                   /number=1
FT   exon            complement(313732..315686)
FT                   /gene="Pc20g01390"
FT                   /locus_tag="PCH_Pc20g01390"
FT                   /number=2
FT   mRNA            complement(join(<316506..317635,317693..>317930))
FT                   /gene="Pc20g01400"
FT                   /locus_tag="PCH_Pc20g01400"
FT   CDS_pept        complement(join(316506..317635,317693..317930))
FT                   /gene="Pc20g01400"
FT                   /locus_tag="PCH_Pc20g01400"
FT                   /EC_number="1.14.19.1"
FT                   /note="Title: strong similarity to stearoyl-CoA desaturase
FT                   ole1 - Ajellomyces capsulatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85469"
FT                   /db_xref="GOA:B6HD77"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001522"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD77"
FT                   /inference="similar to AA sequence:PIR:S52746"
FT                   /inference="protein motif:PFAM:PF00487"
FT                   /inference="protein motif:PFAM:PF00173"
FT                   /inference="protein motif:COGS:COG1398"
FT                   /inference="protein motif:COGS:COG5274"
FT                   /protein_id="CAP85469.1"
FT                   /translation="MSSKPDATRPRAADTKKVHIADTQMTRQNWYKHVNWLNVTFIIGV
FT                   PISGCIQAFFVPLQLKTAIWAVIYYFFTGLGITAGYHRLWAHCSYSATLPMRIWLALVG
FT                   GGAVEGSIRWWARDHRAHHRYTDTDKDPYSVRKGLLYSHLGWMVMKQNPKRIGRTDITD
FT                   LNEDPVVVWQHRNYIKVVITMGLIVPMLVAGLGWGDWYGGFVYAGILRIFFVQQATFCV
FT                   NSLAHWLGDQPFDDRNSPRDHIITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWT
FT                   IWTCKQLGLAYDLKQFRSNEIEKGRVQQLQKKIDQKRAKLDWGTPLDQLPVMEWDDYVE
FT                   QAKNGRGLISIAGVVHDVTDFIKDHPGGKAMIKSGLGKDATAMFNGGVYYHSNGAHNLL
FT                   STMRVGVIRGGGEVEIWKRAQKENSEYVRDETGQRIIRAGQQVTKMPEPIPTADAA"
FT   exon            complement(316506..317635)
FT                   /gene="Pc20g01400"
FT                   /locus_tag="PCH_Pc20g01400"
FT                   /number=1
FT   intron          complement(317636..317692)
FT                   /gene="Pc20g01400"
FT                   /locus_tag="PCH_Pc20g01400"
FT                   /number=1
FT   exon            complement(317693..317930)
FT                   /gene="Pc20g01400"
FT                   /locus_tag="PCH_Pc20g01400"
FT                   /number=2
FT   mRNA            complement(join(<318142..318248,318458..>318653))
FT                   /gene="Pc20g01410"
FT                   /locus_tag="PCH_Pc20g01410"
FT   CDS_pept        complement(join(318142..318248,318458..318653))
FT                   /gene="Pc20g01410"
FT                   /locus_tag="PCH_Pc20g01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85470"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD78"
FT                   /protein_id="CAP85470.1"
FT                   /translation="MRDMTILLQDGKFGQFASAQVLVPHNPLYSVPHTQAMTSFVWRFS
FT                   RPFGEGGRDFQGWMLISGVASTKALGLAGPNIRQKAMRHATPEQRAAQISLSACL"
FT   exon            complement(318142..318248)
FT                   /gene="Pc20g01410"
FT                   /locus_tag="PCH_Pc20g01410"
FT                   /number=1
FT   intron          complement(318249..318457)
FT                   /gene="Pc20g01410"
FT                   /locus_tag="PCH_Pc20g01410"
FT                   /number=1
FT   exon            complement(318458..318653)
FT                   /gene="Pc20g01410"
FT                   /locus_tag="PCH_Pc20g01410"
FT                   /number=2
FT   mRNA            join(<319847..319938,319990..320156,320206..320385,
FT                   320447..>321741)
FT                   /gene="Pc20g01420"
FT                   /locus_tag="PCH_Pc20g01420"
FT   CDS_pept        join(319847..319938,319990..320156,320206..320385,
FT                   320447..321741)
FT                   /gene="Pc20g01420"
FT                   /locus_tag="PCH_Pc20g01420"
FT                   /note="Title: strong similarity to purine permease with
FT                   broad specificity uapC - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85471"
FT                   /db_xref="GOA:B6HD79"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD79"
FT                   /inference="similar to AA sequence:TREMBL:ANUAPA.1"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /inference="protein motif:COGS:COG2233"
FT                   /inference="protein motif:COGS:COG2252"
FT                   /protein_id="CAP85471.1"
FT                   /translation="MDGPDQIGPDHTPKRTISDKVRYAVRTFTTREGLLGDYDYGYLFI
FT                   PRLPFAKRARKSAPFFGLDDRVPVVLALILGLQHALAMLAGVISPPILLGGSGGANFGD
FT                   DLYQYLVSTSLIVSGLLSVVQMFRFHIKGTKYYIGTGLLSVVGTSFSTITVAQGAFSQM
FT                   YKSGYCPTLEDGTKLPCPKGYGALLGTSCLCSLLEIGMSFMSSKILARVFPPLVTGPTV
FT                   LLIGASLIKSAMQDWAGGASCGADPSARAMCPSANAPHPLPWGSPEFIGLGFLVFVTII
FT                   VCERWGPPILKSCSVIVGLLVGSIVAAACNYFDSSGIAAAPVASFAWVHTFPLSVYPPL
FT                   ILPLLALYIVIMMESIGDITATCDVSRLQVEGDTFDSRIQGGVLGNGITCLLAGLMTIS
FT                   PMSVFAQNNGVIALTKCANRTAGYCCCFFLVIMGIFSKFAAALVAIPSSVLGGMTAFLF
FT                   SSVAVSGLRIIGSVPPTRRNRFILTASFSIGMGVTLLPEWFSYFFTYKGDNHALEGLIN
FT                   AVDLVMENGFAISAILGIFLNLFIPDEPDDVPAIFESTNSNDAPVQTDIPEQSSTTTKI
FT                   A"
FT   exon            319847..319938
FT                   /gene="Pc20g01420"
FT                   /locus_tag="PCH_Pc20g01420"
FT                   /number=1
FT   intron          319939..319989
FT                   /gene="Pc20g01420"
FT                   /locus_tag="PCH_Pc20g01420"
FT                   /number=1
FT   exon            319990..320156
FT                   /gene="Pc20g01420"
FT                   /locus_tag="PCH_Pc20g01420"
FT                   /number=2
FT   intron          320157..320205
FT                   /gene="Pc20g01420"
FT                   /locus_tag="PCH_Pc20g01420"
FT                   /number=2
FT   exon            320206..320385
FT                   /gene="Pc20g01420"
FT                   /locus_tag="PCH_Pc20g01420"
FT                   /number=3
FT   intron          320386..320446
FT                   /gene="Pc20g01420"
FT                   /locus_tag="PCH_Pc20g01420"
FT                   /number=3
FT   exon            320447..321741
FT                   /gene="Pc20g01420"
FT                   /locus_tag="PCH_Pc20g01420"
FT                   /number=4
FT   mRNA            complement(<321911..>322465)
FT                   /gene="Pc20g01430"
FT                   /locus_tag="PCH_Pc20g01430"
FT   CDS_pept        complement(321911..322465)
FT                   /gene="Pc20g01430"
FT                   /locus_tag="PCH_Pc20g01430"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An12g06840 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85472"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD80"
FT                   /protein_id="CAP85472.1"
FT                   /translation="MSEPISRTEARQKSADIKKKQAETLAGLPPGSLHISLYIRSDPPL
FT                   PNDFHWAFYLHNGTSSTPGGTKYHARGVGGGWIAGHEATAGIFTENFLCVVIQIATIPP
FT                   SAHERVDEIMRSYDGSLNSIPGITCRVWILTILRILVDEGFVHCDIGELEKDCFEFGNE
FT                   HSATASANQQPRPVVKSRVSS"
FT   exon            complement(321911..322465)
FT                   /gene="Pc20g01430"
FT                   /locus_tag="PCH_Pc20g01430"
FT                   /number=1
FT   mRNA            complement(<322753..>324036)
FT                   /gene="Pc20g01440"
FT                   /locus_tag="PCH_Pc20g01440"
FT   CDS_pept        complement(322753..324036)
FT                   /gene="Pc20g01440"
FT                   /locus_tag="PCH_Pc20g01440"
FT                   /note="Title: similarity to hypothetical protein PA3022
FT                   -Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85473"
FT                   /db_xref="GOA:B6HD81"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD81"
FT                   /inference="similar to AA sequence:PIR:C83268"
FT                   /inference="protein motif:PFAM:PF03476"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /inference="protein motif:COGS:COG3217"
FT                   /protein_id="CAP85473.1"
FT                   /translation="MSNVDISHGGILPNLIIIFLLSALFLVLKTLTTLKTSNNPKGCRR
FT                   LGLPPGQSNLDDEFDPKYSQGVPSDQDDHGRPSWRVKALFSYPLKSCGAVELQVSNVVP
FT                   TGLEFDRQFVFAEYNNDEWNIRTLRNAGFNRLALIHPEIWVPDPSAPDYDADLPEIKSQ
FT                   GVMLISYPRMLPAGWSSLPIKVGMALKFLKSQQTFQVPLLPPADSKFPLVPVKIWKDKV
FT                   LAHDYGRLLPASLHAYLGSDTSKNTLTLLRASAPHSRQIFRNAPRKEDLGFQPNTAFAD
FT                   AYPIHLLSISSHRDVAARCAYAIPRLSIRRFRANVIVQGPSAFEEDHWKRLAIGGTEIH
FT                   ASCRTVRCRLPNVDPLSGDRHKAEPDRTLKSYRRIDDGDRTNACLGMQLVPAKEKFVLR
FT                   VGDSVEVLETGEHQYIKMLAPGEKVEGV"
FT   exon            complement(322753..324036)
FT                   /gene="Pc20g01440"
FT                   /locus_tag="PCH_Pc20g01440"
FT                   /number=1
FT   mRNA            join(<324255..324306,324363..324555,324608..324657,
FT                   324708..325261,325315..>325638)
FT                   /gene="Pc20g01450"
FT                   /locus_tag="PCH_Pc20g01450"
FT   CDS_pept        join(324255..324306,324363..324555,324608..324657,
FT                   324708..325261,325315..325638)
FT                   /gene="Pc20g01450"
FT                   /locus_tag="PCH_Pc20g01450"
FT                   /note="Title: weak similarity to DNA repair protein rhp55p
FT                   - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85474"
FT                   /db_xref="GOA:B6HD82"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD82"
FT                   /inference="similar to AA sequence:PIR:T43680"
FT                   /inference="protein motif:COGS:COG1066"
FT                   /protein_id="CAP85474.1"
FT                   /translation="MDLLGLDGLEGFDDGDTPPVVSISASQSLNASAATRHPIATGLAR
FT                   LDEVLNDLPDQPDQGGILRGHVTEIFGPPGAGKTSLALNIACNALRDGKVVWIDTGCPL
FT                   PTPRLEEMSINLDDFIYFRAHTLAHLIALLARPPKGFPPSGTSLLVVDSVSNLFSAYFP
FT                   SAQELKDQLAEGKITDKAHLQWLINRRWNIASELGTHLARVAARNIAVVAINQSHTKVK
FT                   GQSHAVLQPLLSGGAWEASVQTRIAVYRDLPDERLAEVEKRAGKPLPEQAGELLVAFRI
FT                   EPDGLYEMERKDSVPSEPLTPLPKSPDFEYYDPPTPTPSPISSVLSSAPPSPKLESPKP
FT                   PSPKPTSPEKPVQIPNKKRKVEEVADSQDEDSEEEDVPWTNEITLNTNRS"
FT   exon            324255..324306
FT                   /gene="Pc20g01450"
FT                   /locus_tag="PCH_Pc20g01450"
FT                   /number=1
FT   intron          324307..324362
FT                   /gene="Pc20g01450"
FT                   /locus_tag="PCH_Pc20g01450"
FT                   /number=1
FT   exon            324363..324555
FT                   /gene="Pc20g01450"
FT                   /locus_tag="PCH_Pc20g01450"
FT                   /number=2
FT   intron          324556..324607
FT                   /gene="Pc20g01450"
FT                   /locus_tag="PCH_Pc20g01450"
FT                   /number=2
FT   exon            324608..324657
FT                   /gene="Pc20g01450"
FT                   /locus_tag="PCH_Pc20g01450"
FT                   /number=3
FT   intron          324658..324707
FT                   /gene="Pc20g01450"
FT                   /locus_tag="PCH_Pc20g01450"
FT                   /number=3
FT   exon            324708..325261
FT                   /gene="Pc20g01450"
FT                   /locus_tag="PCH_Pc20g01450"
FT                   /number=4
FT   intron          325262..325314
FT                   /gene="Pc20g01450"
FT                   /locus_tag="PCH_Pc20g01450"
FT                   /number=4
FT   exon            325315..325638
FT                   /gene="Pc20g01450"
FT                   /locus_tag="PCH_Pc20g01450"
FT                   /number=5
FT   mRNA            <326357..>327337
FT                   /gene="Pc20g01460"
FT                   /locus_tag="PCH_Pc20g01460"
FT   CDS_pept        326357..327337
FT                   /gene="Pc20g01460"
FT                   /locus_tag="PCH_Pc20g01460"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An07g02000 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85475"
FT                   /db_xref="GOA:B6HD83"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD83"
FT                   /protein_id="CAP85475.1"
FT                   /translation="MSNVPQDLLDGISGALAKEGNTLQMILIAFIGLSCYNVAELVVLV
FT                   PATFRRWRGLYFWSLLISGVLGVVPYSIGFLMKFFTQTDSVLSVTVLTIGWWTMVTGQS
FT                   VVLYSRLHLVLRDERMLRHVLKLIIANVLLLHVPTTILTYGANIVHSGEVAWVNGYNIM
FT                   EKIQLTGFTFQESLLSTLYVIETVKLLRLGADVSSRPDARSIMYQLIGINCAIIAMDLL
FT                   LLSLEYADFYAVQITLKGFVYSLKLKLEFAVLGRLVDLIQGSRHPVSLAIADTLPLCSM
FT                   QRPPETPDRSEDAPYEQAEPKDFLVPPGGGRLVQRRMFMESGRAA"
FT   exon            326357..327337
FT                   /gene="Pc20g01460"
FT                   /locus_tag="PCH_Pc20g01460"
FT                   /number=1
FT   mRNA            complement(join(<327687..327805,327895..328491,
FT                   328548..328598,328650..328669,328726..>328769))
FT                   /gene="Pc20g01470"
FT                   /locus_tag="PCH_Pc20g01470"
FT   CDS_pept        complement(join(327687..327805,327895..328491,
FT                   328548..328598,328650..328669,328726..328769))
FT                   /gene="Pc20g01470"
FT                   /locus_tag="PCH_Pc20g01470"
FT                   /note="deleted EC_number 3.4.99.46"
FT                   /note="Title: strong similarity to proteasome 20S subunit
FT                   Pre8 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85476"
FT                   /db_xref="GOA:B6HD84"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR034644"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD84"
FT                   /inference="similar to AA sequence:PIR:SNBYY7"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /inference="protein motif:COGS:COG0638"
FT                   /protein_id="CAP85476.1"
FT                   /translation="MADRYSFSLTTFSPSGKLVQIEYALNAVNQGVTALGIKATNGIVL
FT                   ATEKKSSSPLIDPPSLSKISLITPDIGMVYAGMGPDYRVLVDKARKVSHTGYKRIYNEY
FT                   PPTRILVQDVARVVQEATQSGGVRPYGVSLLVAGWDEGVEPESEEAKKDDPEEKISSKT
FT                   GGIKKGGPSLYQVDPSGSYYPWKATAIGKHATSAKTFLEKRYTEGLELEDAIHIALLTL
FT                   KETIEGEMNGDTIEIGIVGPPADHLLGYEGVEGAQGPRFRKLTKEQIEDYLTNL"
FT   exon            complement(327687..327805)
FT                   /gene="Pc20g01470"
FT                   /locus_tag="PCH_Pc20g01470"
FT                   /number=1
FT   intron          complement(327806..327894)
FT                   /gene="Pc20g01470"
FT                   /locus_tag="PCH_Pc20g01470"
FT                   /number=1
FT   exon            complement(327895..328491)
FT                   /gene="Pc20g01470"
FT                   /locus_tag="PCH_Pc20g01470"
FT                   /number=2
FT   intron          complement(328492..328547)
FT                   /gene="Pc20g01470"
FT                   /locus_tag="PCH_Pc20g01470"
FT                   /number=2
FT   exon            complement(328548..328598)
FT                   /gene="Pc20g01470"
FT                   /locus_tag="PCH_Pc20g01470"
FT                   /number=3
FT   intron          complement(328599..328649)
FT                   /gene="Pc20g01470"
FT                   /locus_tag="PCH_Pc20g01470"
FT                   /number=3
FT   exon            complement(328650..328669)
FT                   /gene="Pc20g01470"
FT                   /locus_tag="PCH_Pc20g01470"
FT                   /number=4
FT   intron          complement(328670..328725)
FT                   /gene="Pc20g01470"
FT                   /locus_tag="PCH_Pc20g01470"
FT                   /number=4
FT   exon            complement(328726..328769)
FT                   /gene="Pc20g01470"
FT                   /locus_tag="PCH_Pc20g01470"
FT                   /number=5
FT   mRNA            join(<328803..328985,329059..329673,329724..>329864)
FT                   /gene="Pc20g01480"
FT                   /locus_tag="PCH_Pc20g01480"
FT   CDS_pept        join(328803..328985,329059..329673,329724..329864)
FT                   /gene="Pc20g01480"
FT                   /locus_tag="PCH_Pc20g01480"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   CAB91761.2 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85477"
FT                   /db_xref="GOA:B6HD85"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD85"
FT                   /inference="similar to AA sequence:TREMBL:NCB14D6.52"
FT                   /inference="protein motif:PFAM:PF00097"
FT                   /inference="protein motif:COGS:COG5183"
FT                   /protein_id="CAP85477.1"
FT                   /translation="MERSKEGELCCRQRWVTFGAVELTKGGDQIGISRGVWDTFGFSAF
FT                   LLLVVLFFFNPSKKETHYPPRVCRICLESVLPTFQPSEFLQKPRVVYESSDPECGRLLS
FT                   PCQCKGSSRYVHEGCLQSWRHADPKYGTRNFWQCPTCGFQYRLERLTWARWISSATTQL
FT                   ILTLGILFLTVFLLGFIADPIIDFYLGPVDVYAELVEEDVSWLGHFLKGLASLGLLSFL
FT                   KAIFALSPFPWNLRSVASGRNSGRNRAAQLNWLVVMVGIGTFLWAVYKGVRSWSRRTLE
FT                   KAGERVMDVPLPDDESDTDVPIPDDAGMKEE"
FT   exon            328803..328985
FT                   /gene="Pc20g01480"
FT                   /locus_tag="PCH_Pc20g01480"
FT                   /number=1
FT   intron          328986..329058
FT                   /gene="Pc20g01480"
FT                   /locus_tag="PCH_Pc20g01480"
FT                   /number=1
FT   exon            329059..329673
FT                   /gene="Pc20g01480"
FT                   /locus_tag="PCH_Pc20g01480"
FT                   /number=2
FT   intron          329674..329723
FT                   /gene="Pc20g01480"
FT                   /locus_tag="PCH_Pc20g01480"
FT                   /number=2
FT   exon            329724..329864
FT                   /gene="Pc20g01480"
FT                   /locus_tag="PCH_Pc20g01480"
FT                   /number=3
FT   mRNA            join(<330355..330986,331053..>331428)
FT                   /gene="Pc20g01490"
FT                   /locus_tag="PCH_Pc20g01490"
FT   CDS_pept        join(330355..330986,331053..331428)
FT                   /gene="Pc20g01490"
FT                   /locus_tag="PCH_Pc20g01490"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An07g02040 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85478"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF6"
FT                   /protein_id="CAP85478.1"
FT                   /translation="MDDLPPGSRLAHVRSELAMDSESEESESATPTNADTAKTETEPFP
FT                   EYDESECEMLASSIAADKRREEAWIHALGKATQRENRMLHVDPNIIPYFQSDPSHRSQV
FT                   VLEQLRDLLADPQMRPKIRDQFITMINATLQFNLVIFHQSSEFLAPKEIEDAELHLESV
FT                   LNLVEWMEEDLRDQLETAEQVSYAIEGASLQPTSAYERLCKMASLFANAMKKPRYLERR
FT                   LLSLYMDMYEEWVHTPFLLLRNRQLVNEQDPSPERTKLSRRVIMIWDLMNSCIESYGTL
FT                   TWFTLEIKHQYFAPVMGYLCDSPEIWQYCWDQYQALEKDRAQASEKDLSQCATI"
FT   exon            330355..330986
FT                   /gene="Pc20g01490"
FT                   /locus_tag="PCH_Pc20g01490"
FT                   /number=1
FT   intron          330987..331052
FT                   /gene="Pc20g01490"
FT                   /locus_tag="PCH_Pc20g01490"
FT                   /number=1
FT   exon            331053..331428
FT                   /gene="Pc20g01490"
FT                   /locus_tag="PCH_Pc20g01490"
FT                   /number=2
FT   mRNA            complement(join(<331607..332321,332390..>332691))
FT                   /gene="Pc20g01500"
FT                   /locus_tag="PCH_Pc20g01500"
FT   CDS_pept        complement(join(331607..332321,332390..332691))
FT                   /gene="Pc20g01500"
FT                   /locus_tag="PCH_Pc20g01500"
FT                   /note="unknown EC_number=4.1.1.46"
FT                   /note="Title: strong similarity to 2,3-dihydroxybenzoic
FT                   acid decarboxylase dhbD - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85479"
FT                   /db_xref="GOA:B6HDF7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF7"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /inference="protein motif:COGS:COG2159"
FT                   /inference="protein motif:COGS:COG3618"
FT                   /protein_id="CAP85479.1"
FT                   /translation="MLGKIALEEAFALPRFREKTKWWAGMFATDTEKHTAEINDVGPIR
FT                   LDFAERHGVGLQILSYTAPGVQDIWDAKDAQALAVEINDYIAEKVKAHPDRFAAFATLS
FT                   MHDPQEAAAELRRCVTQHGFLGALVNDTQRAGADGDDMIFYDNEKWDVFWATCTELDVP
FT                   LYLHPRNPTGTIYDKLWADRKWLIGPPLSFAQGVSLHVLGMVTNGVFDRNPKLQVILGH
FT                   LGEHIPFDMWRINHWFEDRKKMLGLGETCKRTIREYFAENLWITTSGHFSTTTLNFCMA
FT                   EVGADRILFSIDYPFETFADACDWFDSAEMSNTDRLKIGRENAKKLFKLGAYKDSTA"
FT   exon            complement(331607..332321)
FT                   /gene="Pc20g01500"
FT                   /locus_tag="PCH_Pc20g01500"
FT                   /number=1
FT   intron          complement(332322..332389)
FT                   /gene="Pc20g01500"
FT                   /locus_tag="PCH_Pc20g01500"
FT                   /number=1
FT   exon            complement(332390..332691)
FT                   /gene="Pc20g01500"
FT                   /locus_tag="PCH_Pc20g01500"
FT                   /number=2
FT   mRNA            complement(join(<332980..333138,333212..>333559))
FT                   /gene="Pc20g01510"
FT                   /locus_tag="PCH_Pc20g01510"
FT   CDS_pept        complement(join(332980..333138,333212..333559))
FT                   /gene="Pc20g01510"
FT                   /locus_tag="PCH_Pc20g01510"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g05278 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85480"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF8"
FT                   /protein_id="CAP85480.1"
FT                   /translation="MATRTIYLISARNTSFQRAHFSIFVPSATNPDRGTKIHAVGAPMA
FT                   GYVLEFKRNYNPSLEPHDQTFPIGQVHSSDVVDSPDAAPSIDSTPRGKIELAATQVPTP
FT                   GINQNFMAPVNDTTNKRCQEWTMEYVRHLVAKGLVDKEAIEIVQSKRDPPTHGIGLRSV
FT                   TRPGT"
FT   exon            complement(332980..333138)
FT                   /gene="Pc20g01510"
FT                   /locus_tag="PCH_Pc20g01510"
FT                   /number=1
FT   intron          complement(333139..333211)
FT                   /gene="Pc20g01510"
FT                   /locus_tag="PCH_Pc20g01510"
FT                   /number=1
FT   exon            complement(333212..333559)
FT                   /gene="Pc20g01510"
FT                   /locus_tag="PCH_Pc20g01510"
FT                   /number=2
FT   mRNA            complement(join(<333826..334424,334482..334530,
FT                   334589..334879,334943..335031,335084..335168,
FT                   335222..>335599))
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT   CDS_pept        complement(join(333826..334424,334482..334530,
FT                   334589..334879,334943..335031,335084..335168,
FT                   335222..335599))
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg07210.1 - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85481"
FT                   /db_xref="GOA:B6HDF9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF9"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /inference="protein motif:COGS:COG2124"
FT                   /protein_id="CAP85481.1"
FT                   /translation="MLQSTLTLALASCNDFPTLRDVGSLTSVILLLLALLYKVLYVPVA
FT                   SPPRKDSPPCLRLPSWKVTQLFFEKRFDFIKDGFKATSSSIYQTSLFRHNAIVLSGDEG
FT                   RQLFFKEKGLCLYDTFSIMMGSGAAKFDPHQVGGVVRRMASIQRPDNLQKLIPLILLES
FT                   QQKMNAWGRERILDPCSSLHEVAFQLVMRIASFDIANDPVLSARLKSLVDTVDSITNPY
FT                   STWLPWLPGPALFHKFFASVQIYRIVQAAINARKRSGIKRDDMLQQMIDEGDGTIQIFG
FT                   CMLGLSLAGARATGTIVTWLIMQITSDPVWSSNVQEEVKTFVSTHTLSPSLSGDALIQA
FT                   LSEIPLTAWESQTPNLDLCIRETLRTSQPYTAVRKNIGPDVTIGPYVIPSGSLVVYPFS
FT                   DTALNPNYYPDATRWDPSRGIDKETPFIGWGGGKHACKGQRLATLSMKLMVVYALMRFD
FT                   ITMVDGQGKKINRLPLPDWNDSATCRPKERCGIKFVEK"
FT   exon            complement(333826..334424)
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT                   /number=1
FT   intron          complement(334425..334481)
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT                   /number=1
FT   exon            complement(334482..334530)
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT                   /number=2
FT   intron          complement(334531..334588)
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT                   /number=2
FT   exon            complement(334589..334879)
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT                   /number=3
FT   intron          complement(334880..334942)
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT                   /number=3
FT   exon            complement(334943..335031)
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT                   /number=4
FT   intron          complement(335032..335083)
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT                   /number=4
FT   exon            complement(335084..335168)
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT                   /number=5
FT   intron          complement(335169..335221)
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT                   /number=5
FT   exon            complement(335222..335599)
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT                   /number=6
FT   mRNA            complement(join(<337282..337944,338003..338053,
FT                   338114..338868,338923..>339298))
FT                   /gene="Pc20g01530"
FT                   /locus_tag="PCH_Pc20g01530"
FT   CDS_pept        complement(join(337282..337944,338003..338053,
FT                   338114..338868,338923..339298))
FT                   /gene="Pc20g01530"
FT                   /locus_tag="PCH_Pc20g01530"
FT                   /note="Title: strong similarity to fructose symporter Fsy1
FT                   - Saccharomyces pastorianus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85482"
FT                   /db_xref="GOA:B6HDG0"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG0"
FT                   /inference="similar to AA sequence:TREMBL:SPA250992.1"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP85482.1"
FT                   /translation="MTKREKIDTLSEKVVPQQPFGTAERARRDLNAKLSNPLAGFSHTE
FT                   LRDQGRTFAELHEMGDESDIRAFELGAVLAQSPERYDNVAGLTNKEKAVLRREVTHRWS
FT                   QPWKMYVVITLCSLSATVQGMDQTVVNGAQIFYKHQFGIGDGSSRSAWLVGLVNSAPYL
FT                   CCAFISSWLTVPFNHWFGRRGTIFIACCLSAITCLWQGFVSTWWAMFVARFMLGFGIGP
FT                   KSATVPIYAAETAPPSIRGALVMQWHVWTAFGIMVGYASDLIFYNVESSAIVGLNWRCM
FT                   MASAMFPALVVCCFVFACPESPHWYIRQKQYYRAYRSICTLRNHKIQAARDLYYMHTLL
FT                   EAENSIKLGRNKLLELIKVPRNRRAMLASQIVMFMQQFCGVNVISYYSSEIFLEANFSP
FT                   PAALAASLGWGLINWLLSIPAIYTIDTFGRRNLLLLTFPLMSMAMLFTGFSFWIPESSH
FT                   HARLACIALGTYLFGVVYSPGEGPVPFTYTAEVYPLYVRSYGMALGTATMWFCNFLLGV
FT                   TWPSLRAAFTTQGAFAWHASWCFVGWWMILLFMPETKGKTLEELDQVFSVPTRLHARYG
FT                   LRQIGYFFKRYLLRRDIRPEALYEREELVKAQDVGFNA"
FT   exon            complement(337282..337944)
FT                   /gene="Pc20g01530"
FT                   /locus_tag="PCH_Pc20g01530"
FT                   /number=1
FT   intron          complement(337945..338002)
FT                   /gene="Pc20g01530"
FT                   /locus_tag="PCH_Pc20g01530"
FT                   /number=1
FT   exon            complement(338003..338053)
FT                   /gene="Pc20g01530"
FT                   /locus_tag="PCH_Pc20g01530"
FT                   /number=2
FT   intron          complement(338054..338113)
FT                   /gene="Pc20g01530"
FT                   /locus_tag="PCH_Pc20g01530"
FT                   /number=2
FT   exon            complement(338114..338868)
FT                   /gene="Pc20g01530"
FT                   /locus_tag="PCH_Pc20g01530"
FT                   /number=3
FT   intron          complement(338869..338922)
FT                   /gene="Pc20g01530"
FT                   /locus_tag="PCH_Pc20g01530"
FT                   /number=3
FT   exon            complement(338923..339298)
FT                   /gene="Pc20g01530"
FT                   /locus_tag="PCH_Pc20g01530"
FT                   /number=4
FT   mRNA            join(<340636..340675,340738..341011,341080..341427,
FT                   341485..>341674)
FT                   /gene="Pc20g01540"
FT                   /locus_tag="PCH_Pc20g01540"
FT   CDS_pept        join(340636..340675,340738..341011,341080..341427,
FT                   341485..341674)
FT                   /gene="Pc20g01540"
FT                   /locus_tag="PCH_Pc20g01540"
FT                   /note="Title: weak similarity to hypothetical chloroplast
FT                   RNA-binding protein At2g35410 - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85483"
FT                   /db_xref="GOA:B6HDG1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG1"
FT                   /inference="protein motif:PFAM:PF00076"
FT                   /inference="protein motif:COGS:COG0724"
FT                   /protein_id="CAP85483.1"
FT                   /translation="MDDAESPRLEEQQTPTKSPFTNVRTDGRAFNSPNWRMKAESPATP
FT                   SRTNASPSANPNTSRAAFSRPGAHVPQAINDGRRLYVGNMPYTAKMEDVEALFIAAEFP
FT                   IERIDIAIDPFTGRNPSYCFVDLQNKEHAERAMTELDGRDMLGRPVKIKPGVAKSQERI
FT                   QNPPEPFRIDCWRQQERPSFAKVNSDSSSRVYVGGLPRLTDHGAVQTNIEMFFKGFKVE
FT                   HVSKLFTPHPAKRFEPGEHYYLFVDVGSPEQALKAMDTLNGREGPWGGPLRVQFARGTK
FT                   DT"
FT   exon            340636..340675
FT                   /gene="Pc20g01540"
FT                   /locus_tag="PCH_Pc20g01540"
FT                   /number=1
FT   intron          340676..340737
FT                   /gene="Pc20g01540"
FT                   /locus_tag="PCH_Pc20g01540"
FT                   /number=1
FT   exon            340738..341011
FT                   /gene="Pc20g01540"
FT                   /locus_tag="PCH_Pc20g01540"
FT                   /number=2
FT   intron          341012..341079
FT                   /gene="Pc20g01540"
FT                   /locus_tag="PCH_Pc20g01540"
FT                   /number=2
FT   exon            341080..341427
FT                   /gene="Pc20g01540"
FT                   /locus_tag="PCH_Pc20g01540"
FT                   /number=3
FT   intron          341428..341484
FT                   /gene="Pc20g01540"
FT                   /locus_tag="PCH_Pc20g01540"
FT                   /number=3
FT   exon            341485..341674
FT                   /gene="Pc20g01540"
FT                   /locus_tag="PCH_Pc20g01540"
FT                   /number=4
FT   mRNA            join(<343174..343273,343325..343911,343967..>344632)
FT                   /gene="Pc20g01550"
FT                   /locus_tag="PCH_Pc20g01550"
FT   CDS_pept        join(343174..343273,343325..343911,343967..344632)
FT                   /gene="Pc20g01550"
FT                   /locus_tag="PCH_Pc20g01550"
FT                   /note="unknown EC_number=2.7.1.105"
FT                   /note="unknown EC_number=3.1.3.46"
FT                   /note="Title: strong similarity to
FT                   fructose-2,6-bisphosphate 2-phosphatase Fbp26
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01550"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85484"
FT                   /db_xref="GOA:B6HDG2"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG2"
FT                   /inference="similar to AA sequence:TREMBL:S42124.1"
FT                   /inference="protein motif:PFAM:PF01591"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /inference="protein motif:COGS:COG0588"
FT                   /inference="protein motif:COGS:COG0406"
FT                   /protein_id="CAP85484.1"
FT                   /translation="MPIANFGTQSDDSKICVVMVGLPARGKSLIAGKAMRYLGWVGIPA
FT                   RVFNVGSYRRFSTPQPQAGFFDPHNEEGERMRRAAAEAAMSDMLQWFNTGKGVVAILDA
FT                   TNSTKDRRRWIYEKCTEAGIEALFVESICDDEDLIMTNIKEVKTTSPDYKGQDPEVAAL
FT                   DFRNRIRNYEKVYETIDDDEKSYTYVKLINVGSTVIINQIKDYLSSRLVYYIQNIHIKP
FT                   RSIWLSRHGESEFNLTGRIGGDSNISERGEAYARALPELMRKSGIPDNTKIVIWTSTLR
FT                   RTIQSARHLKAETGYETLEWKALDELDSGVCDGLTYEQIAEKYPEDFAARDEDKYNYRY
FT                   RGGESYRDVVIRLEPIIMELERSENVIIVTHQAVLRCIYAYFMNVPQEQSPWMEVPLHT
FT                   LIKLTPRAYGTEEQRFKADIPAVSTWRGKGTSAKHQEFPAEGKKEDTETKN"
FT   exon            343174..343273
FT                   /gene="Pc20g01550"
FT                   /locus_tag="PCH_Pc20g01550"
FT                   /number=1
FT   intron          343274..343324
FT                   /gene="Pc20g01550"
FT                   /locus_tag="PCH_Pc20g01550"
FT                   /number=1
FT   exon            343325..343911
FT                   /gene="Pc20g01550"
FT                   /locus_tag="PCH_Pc20g01550"
FT                   /number=2
FT   intron          343912..343966
FT                   /gene="Pc20g01550"
FT                   /locus_tag="PCH_Pc20g01550"
FT                   /number=2
FT   exon            343967..344632
FT                   /gene="Pc20g01550"
FT                   /locus_tag="PCH_Pc20g01550"
FT                   /number=3
FT   mRNA            join(<345120..346551,346599..347414,347465..347573,
FT                   347625..348059,348118..>348175)
FT                   /gene="Pc20g01560"
FT                   /locus_tag="PCH_Pc20g01560"
FT   CDS_pept        join(345120..346551,346599..347414,347465..347573,
FT                   347625..348059,348118..348175)
FT                   /gene="Pc20g01560"
FT                   /locus_tag="PCH_Pc20g01560"
FT                   /note="unknown EC_number=3.4.16.-"
FT                   /note="Title: strong similarity to vacuolar
FT                   carboxypeptidase like protein An07g02110 - Aspergillus
FT                   niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01560"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85485"
FT                   /db_xref="GOA:B6HDG3"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR019452"
FT                   /db_xref="InterPro:IPR019453"
FT                   /db_xref="InterPro:IPR032914"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG3"
FT                   /inference="protein motif:PFAM:PF00780"
FT                   /protein_id="CAP85485.1"
FT                   /translation="MLSAFTARPLVELKPRDKSRIDSVLAYGDRLLAGLNNGNLRIYRV
FT                   TDDGKTELLRELEKFSRYKIEQLALIKEANVLVSLSGGYVSLHDAQSYELVEQLAQTKG
FT                   ASVFAITSNVVNDVDTNVPAIVSRLAVAVKRKILMWAWRDMELERDTAELSLVSGVKTL
FT                   TWVAATRLVVGLNSSFVMVNIESGQFTDLAGPGSIEESGRFTGVGAASMSYIGMGGMVP
FT                   RPLVTRLREGEILLAKDVNTNFIDVDGQPLGRKQVPWSHAPVELGYSYPFLLALHDSSK
FT                   GVLEVRNPETLSLLQSVPLPSASILHIPQPNISLAHAGKGFLVASDRTIWRMEALSYDT
FT                   QIDALVEGGYLDEAISLLGVLEDALLRDKPGRLRATRLEKAQSLFALNKYRESLDLFTE
FT                   VSAPPESVIRLYPRLIAGDLSTVPEPEVANGKANGSQSDGSSDDVAAGQASTHAASIIS
FT                   SVRKPDEGSEASSIRGDDKGLRIAVRELQGYLADVRRRFQRFLNPDGSLKAPVPVEATD
FT                   EASDSVLKLLDFPSPDEFATQICAKARLVDTTLFRAHMFATPSLAGSLFRIANFCDPEV
FT                   VMERLEETGRYNDLIDFLYGKKLHRQALELLQRFGQTDNGPLSGPTRTVAYLQNLPPDQ
FT                   IDLVLEFGEWPLRANHELGMEIFQTDTENAETLPRPRVLGFLEGIDTTLAIQYLEHVIH
FT                   EWNDMTPDIHQRLLILYLDQLTSNEQGEWKEKFLTMLKESEQYSPAKMLDRLDREDPNY
FT                   YEARAILFSKMGQHRQALEIYVFKLADHEKAEEYCNQVHLAEKAEEENSIYLTLLSLYL
FT                   SPPHGYEPQNDPAIDLLAKHGSRLPADAALKLIPDKQAVQKLEFYFKGRMRAANSVFNE
FT                   ARIVANLRKARDMQIQAQLALGEGIRGGGTRARHVTVTEERICGVCHKRLGGSVINVFP
FT                   DDTVVHLGCVNRKPSVRAG"
FT   exon            345120..346551
FT                   /gene="Pc20g01560"
FT                   /locus_tag="PCH_Pc20g01560"
FT                   /number=1
FT   intron          346552..346598
FT                   /gene="Pc20g01560"
FT                   /locus_tag="PCH_Pc20g01560"
FT                   /number=1
FT   exon            346599..347414
FT                   /gene="Pc20g01560"
FT                   /locus_tag="PCH_Pc20g01560"
FT                   /number=2
FT   intron          347415..347464
FT                   /gene="Pc20g01560"
FT                   /locus_tag="PCH_Pc20g01560"
FT                   /number=2
FT   exon            347465..347573
FT                   /gene="Pc20g01560"
FT                   /locus_tag="PCH_Pc20g01560"
FT                   /number=3
FT   intron          347574..347624
FT                   /gene="Pc20g01560"
FT                   /locus_tag="PCH_Pc20g01560"
FT                   /number=3
FT   exon            347625..348059
FT                   /gene="Pc20g01560"
FT                   /locus_tag="PCH_Pc20g01560"
FT                   /number=4
FT   intron          348060..348117
FT                   /gene="Pc20g01560"
FT                   /locus_tag="PCH_Pc20g01560"
FT                   /number=4
FT   exon            348118..348175
FT                   /gene="Pc20g01560"
FT                   /locus_tag="PCH_Pc20g01560"
FT                   /number=5
FT   mRNA            complement(<348362..>348637)
FT                   /gene="Pc20g01570"
FT                   /locus_tag="PCH_Pc20g01570"
FT   CDS_pept        complement(348362..348637)
FT                   /gene="Pc20g01570"
FT                   /locus_tag="PCH_Pc20g01570"
FT                   /note="Title: similarity to hypothetical protein An07g02120
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01570"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85486"
FT                   /db_xref="InterPro:IPR014849"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG4"
FT                   /protein_id="CAP85486.1"
FT                   /translation="MASNTSLSAVYTAPQVTETFEHVISTTTGTLAAKQAHLSALQSLV
FT                   PKLQDQINVFLTERMEEDKKVQGQLSAQEAKEEENYGEEVVEDMIA"
FT   exon            complement(348362..348637)
FT                   /gene="Pc20g01570"
FT                   /locus_tag="PCH_Pc20g01570"
FT                   /number=1
FT   mRNA            <349265..>351778
FT                   /gene="Pc20g01580"
FT                   /locus_tag="PCH_Pc20g01580"
FT   CDS_pept        349265..351778
FT                   /gene="Pc20g01580"
FT                   /locus_tag="PCH_Pc20g01580"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   CAD21228.1 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01580"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85487"
FT                   /db_xref="InterPro:IPR013745"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG5"
FT                   /inference="similar to AA sequence:TREMBL:NCB24G3.12"
FT                   /inference="protein motif:COGS:COG3468"
FT                   /inference="protein motif:COGS:COG0739"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /inference="protein motif:COGS:COG1674"
FT                   /inference="protein motif:COGS:COG5210"
FT                   /inference="protein motif:COGS:COG5411"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /inference="protein motif:COGS:COG0552"
FT                   /inference="protein motif:COGS:COG0455"
FT                   /protein_id="CAP85487.1"
FT                   /translation="MNPTFRSPNSPGRQAPAPRYPRPPSDDEEEDDSDEDELVRPGSSG
FT                   SDASSNVTTVSAAPVTPINTQQPGGYFPPQPRSATSPHHPMPNPSGRRPSGRGPSVELP
FT                   RHRSRHHSQGFFEPSLPTASSDQVPTVSASRIAAQAAMQQTKKQQNVTTPVEDGSRPRR
FT                   SGSSSPPLMPAPLRVNQPSPQPPPPSGNVATTAANVVFPRAGAAPAEQQPEKQKKKKLF
FT                   SKPKHIGISSHKDLGKDRGLPSPSKISGLSRMVSGSTTNLADLSSNNSSMYNLSNASVS
FT                   TVVPADRPPIQEKEKEKDKDKHKHHFLSRQKLKLKDRVEDHFNLPLSSASSNSRPADPN
FT                   APQSLYSFTPASPAPGATFGKSVSGLDLLHGGRALREKKKEEKALAESEQMEWLANNAG
FT                   GPTTPGGFPGPSSVGSSGTLPESMLRETLQGFGLNNMTPEDAWDFLKAKLLVIFDGEDV
FT                   RIAIEDLNKLVLVHLQRCVLKRAPTSIVVDLQELLETGFATLNHSSLIGLPDEKLVPHL
FT                   VQVWLLVFGTILPFIQAVFLPLDLEFKGCGSLMTSREAGEFWGALPVGGTLDVRSLVLI
FT                   AFRDCMILNRYDALKATFSRLSLDSINSGFPTLSVTAKSTGTGGRPGTAASLDAGFGSY
FT                   TSQSSTLLSTVTDSYSSDGISALANHPRPTSSDSRSRATSNTSSNADPLFFQSITSPPT
FT                   SNKRPTVIHRGNTSADSSHVITETVGRMLQCISVLASVQTDDASQERIEILSKALKHNW
FT                   LGRGRTGRDRRGFVGAKIRPVMVGGPPVIDDGDSLTTAGISIGASTSTGGSRGRGDSSS
FT                   SEWSSNVPGPGMSMRSGGRRELSVL"
FT   exon            349265..351778
FT                   /gene="Pc20g01580"
FT                   /locus_tag="PCH_Pc20g01580"
FT                   /number=1
FT   mRNA            complement(join(<352207..352395,352500..354208,
FT                   354275..354620,354726..>354911))
FT                   /gene="Pc20g01590"
FT                   /locus_tag="PCH_Pc20g01590"
FT   CDS_pept        complement(join(352207..352395,352500..354208,
FT                   354275..354620,354726..354911))
FT                   /gene="Pc20g01590"
FT                   /locus_tag="PCH_Pc20g01590"
FT                   /note="Title: weak similarity to protein CG33196-PB
FT                   -Drosophila melanogaster"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01590"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85488"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG6"
FT                   /protein_id="CAP85488.1"
FT                   /translation="MASDRTIRDLFPALVVGLERETSATPSVHDSDASFHPSQSPTPVN
FT                   KQTLPAQDSIEVKAPTPTADLLLLDPHEFSLLQLKRILRTTYLQLVTLCLTIPVGAFIP
FT                   ALDPQTTNTNSNTEGRPKDASHILTPRIRVVMRKGPREPTPDSDTVSESSKKQHPKDVT
FT                   PITPRRRIVITKKSRAEGRPNEATPTSTPRVRIVVRKRSREITEDSDTVSDPTSAKGTK
FT                   DVTPIPSHSSQDSIHSTAPSDPRNPSSYLESNLLNSAEEPPVDSNMDSPKPTAVSTSHE
FT                   SSSDYDETSISVNPTSELPATSMSPNSRSSSEEAPSRDAGHLSPTLDFVPSTPPHPSSD
FT                   SSMGPPTDPSMDPNMVSHRQPLDSAVIPGNPSFEDPDVLPSTFMYPEETFDQSNRAIDP
FT                   MGVYTPEEYARILASEQEVLREMADPHTDIATHLYSQTEDPYYTTINDLNRHTDTSTHL
FT                   YSQTEEPHHTAIDDLDRHTDISTHPYSQTEEPHYTTIDDMDRIFAEMEAATAGMDFLQP
FT                   EFWAAIGRDLSSPSQPGALESDQHAQAPTTSGTLQSVEGTDLGSVPKRARHSSPKTKSP
FT                   SPDLSSTLSVKTSVSMPSRSASSKAKSTTPPAMSASNRRRSKDQSVTPAPTASSSRRRS
FT                   KASTKTETATPEPRATVTVSPRRLRSSDVMPRPSTNTKKNPQGNATPDSWDTAPTADKM
FT                   MSQMKETESMSWFDITAAWNQNRSDLDDEMTWRALSKRWGRIKDRIGPWPGFDEALLDA
FT                   FSQFNSKPDDESFAQIAEDISIQLGWDVSGAACQGRYDVLEEAGKIDLKGKGRARK"
FT   exon            complement(352207..352395)
FT                   /gene="Pc20g01590"
FT                   /locus_tag="PCH_Pc20g01590"
FT                   /number=1
FT   intron          complement(352396..352499)
FT                   /gene="Pc20g01590"
FT                   /locus_tag="PCH_Pc20g01590"
FT                   /number=1
FT   exon            complement(352500..354208)
FT                   /gene="Pc20g01590"
FT                   /locus_tag="PCH_Pc20g01590"
FT                   /number=2
FT   intron          complement(354209..354274)
FT                   /gene="Pc20g01590"
FT                   /locus_tag="PCH_Pc20g01590"
FT                   /number=2
FT   exon            complement(354275..354620)
FT                   /gene="Pc20g01590"
FT                   /locus_tag="PCH_Pc20g01590"
FT                   /number=3
FT   intron          complement(354621..354725)
FT                   /gene="Pc20g01590"
FT                   /locus_tag="PCH_Pc20g01590"
FT                   /number=3
FT   exon            complement(354726..354911)
FT                   /gene="Pc20g01590"
FT                   /locus_tag="PCH_Pc20g01590"
FT                   /number=4
FT   mRNA            join(<356424..357081,357152..359073,359137..>359295)
FT                   /gene="Pc20g01600"
FT                   /locus_tag="PCH_Pc20g01600"
FT   CDS_pept        join(356424..357081,357152..359073,359137..359295)
FT                   /gene="Pc20g01600"
FT                   /locus_tag="PCH_Pc20g01600"
FT                   /note="Title: similarity to hypothetical AAA-ATPase
FT                   AAR34299.1 - Geobacter sulfurreducens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01600"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85489"
FT                   /db_xref="GOA:B6HDG7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG7"
FT                   /inference="similar to AA sequence:TREMBLNEW:AE017210.117"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /inference="protein motif:COGS:COG0464"
FT                   /protein_id="CAP85489.1"
FT                   /translation="MDHTSTPTEAKDEVVPSENLNGSAQPAEVKDVREVKDAATAPAPE
FT                   TTPASAPKLCKKHKKKNKKKDESDSSSDSSSSSSSSDSDADSEDASDSTESDSDTEKRK
FT                   RHRLRKARARRALRDKKRRKKRKQRSRKAETSDSESDSEEESDSVSSTDSDDDIDDKAL
FT                   RKLVTKLKLSKKRAKKLRELAADDLAASDSLGETRREKRSKKKKPASKVAYKRVDQLWD
FT                   TTIHKYKLTETVDDPDADEWDQYIFNIRRKFNWENKYLETVVDIKSKPLRDALSKIMDG
FT                   VKGVSLVQEPAVVDPNMLFLYLEETRQYMKDLKKQSRSEKKRKVRKAAAVKAAHLKVLI
FT                   KYLDTDYADIKKTLYPLLEANTITFDLLWALYKPNTIAYTPTYGSTDEPRAFKIEYAIK
FT                   ESSFMKGQWYSVDGRYLEYDGKDYGFGTMSAEVDSFKGARKITSLACYPLKYHRDAEAL
FT                   RARLVERGKRFVALRGMNYRFHKGMAFYKKKRSLIIKVNINGRVMIDPAIHRRINPNYP
FT                   ISTVRPKDPDLIDPEDLGISGDEGEDSDGCCCGGSDSDSEHGGASDTPRTMYKVVEDTE
FT                   GCPRVVEVEVDENGTEIHKEKMDRIEGAASGSKDREFTEEELLIASPVVLGFAFSEKLW
FT                   LEFTISGISDIEWDKEAFGSLVLPSNQKSIVKALVESHTFHAAQNIDDVIQGKGKGLVA
FT                   VLHGPPGTGKTLTAEGIAELLRRPLYMVSAGELGTDSRTLEAELNKILDIAHSWGAVLL
FT                   LDEADVFLEKRTIHDIHRNALVSIFLRLLEYFQGILFLTTNRVETFDDAFQSRIHVALR
FT                   YGDLTSKAKRSIWKMFLERVRAIEGVNIASFSEEDYDMLSRHTLNGRQIKNSVRTAQAL
FT                   AVNEKAPLSMDHIKRVLEVAETFDQDLRGGTGYLDAMRSYT"
FT   exon            356424..357081
FT                   /gene="Pc20g01600"
FT                   /locus_tag="PCH_Pc20g01600"
FT                   /number=1
FT   intron          357082..357151
FT                   /gene="Pc20g01600"
FT                   /locus_tag="PCH_Pc20g01600"
FT                   /number=1
FT   exon            357152..359073
FT                   /gene="Pc20g01600"
FT                   /locus_tag="PCH_Pc20g01600"
FT                   /number=2
FT   intron          359074..359136
FT                   /gene="Pc20g01600"
FT                   /locus_tag="PCH_Pc20g01600"
FT                   /number=2
FT   exon            359137..359295
FT                   /gene="Pc20g01600"
FT                   /locus_tag="PCH_Pc20g01600"
FT                   /number=3
FT   mRNA            complement(join(<359670..360263,360323..360567,
FT                   360624..360741,360795..>360860))
FT                   /gene="Pc20g01610"
FT                   /locus_tag="PCH_Pc20g01610"
FT   CDS_pept        complement(join(359670..360263,360323..360567,
FT                   360624..360741,360795..360860))
FT                   /gene="Pc20g01610"
FT                   /locus_tag="PCH_Pc20g01610"
FT                   /note="unknown EC_number=1.1.1.37"
FT                   /note="Title: strong similarity to mitochondrial malate
FT                   dehydrogenase Mdh1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01610"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85490"
FT                   /db_xref="GOA:B6HDG8"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG8"
FT                   /inference="similar to AA sequence:PIR:DEBYMM"
FT                   /inference="protein motif:PFAM:PF00056"
FT                   /inference="protein motif:PFAM:PF02866"
FT                   /inference="protein motif:COGS:COG0039"
FT                   /protein_id="CAP85490.1"
FT                   /translation="MFAARRTVNLFQKRAFSASAINASKVSVLGAAGGIGQPLSLLLKL
FT                   NPRVSELALYDIRGGPGVAADLSHINTNSTVTGYNPDASGLRDCLEGSEIILIPAGVPR
FT                   KPGMTRDDLFNTNASIVRDLAKAAAEAAPKAHVLVIANPVNSTVPIVAEVYKARNVYDP
FT                   KRLFGVTTLDVVRASRFISQVQNTNPAGEAVPVVGGHSGVTIVPLLSQSNHSSIAGQAR
FT                   DALVNRIQFGGDEVVKAKDGAGSATLSMAMAGARFAESLLRAAQGEKGVIEPTFVDSPL
FT                   YKDQGIDFFASRVELGPNGVEKINSVGEVNEYEQGLLDACLTDLKKNIQKGVDFVKANP
FT                   "
FT   exon            complement(359670..360263)
FT                   /gene="Pc20g01610"
FT                   /locus_tag="PCH_Pc20g01610"
FT                   /number=1
FT   intron          complement(360264..360322)
FT                   /gene="Pc20g01610"
FT                   /locus_tag="PCH_Pc20g01610"
FT                   /number=1
FT   exon            complement(360323..360567)
FT                   /gene="Pc20g01610"
FT                   /locus_tag="PCH_Pc20g01610"
FT                   /number=2
FT   intron          complement(360568..360623)
FT                   /gene="Pc20g01610"
FT                   /locus_tag="PCH_Pc20g01610"
FT                   /number=2
FT   exon            complement(360624..360741)
FT                   /gene="Pc20g01610"
FT                   /locus_tag="PCH_Pc20g01610"
FT                   /number=3
FT   intron          complement(360742..360794)
FT                   /gene="Pc20g01610"
FT                   /locus_tag="PCH_Pc20g01610"
FT                   /number=3
FT   exon            complement(360795..360860)
FT                   /gene="Pc20g01610"
FT                   /locus_tag="PCH_Pc20g01610"
FT                   /number=4
FT   mRNA            complement(join(<361720..362163,362219..362400,
FT                   362457..362556,362604..>362606))
FT                   /gene="Pc20g01620"
FT                   /locus_tag="PCH_Pc20g01620"
FT   CDS_pept        complement(join(361720..362163,362219..362400,
FT                   362457..362556,362604..362606))
FT                   /gene="Pc20g01620"
FT                   /locus_tag="PCH_Pc20g01620"
FT                   /note="Title: similarity to transport protein Bos1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85491"
FT                   /db_xref="GOA:B6HDG9"
FT                   /db_xref="InterPro:IPR027027"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG9"
FT                   /inference="similar to AA sequence:PIR:A39206"
FT                   /inference="protein motif:PFAM:PF05008"
FT                   /protein_id="CAP85491.1"
FT                   /translation="MNSLFNSALKQSSSIRRDLDTFSQSPTTSSPALQGQLAASLASLS
FT                   RTVDDYSALSKKELIPEKQQKAFDRVKNFRNELMDYRTQFDRLRKEREDAQSVTNHNEL
FT                   LGRRPHHTATPENPYAQSSLPQSTSAFTPSSSDLGFGASPADYNRETNALREQSFFSNT
FT                   HNQLDDFLDRGRAVLADLGQQREVLKGTQRRLYSVANTLGVSGDTIRMVERRARQDKWI
FT                   FWGGVVIFFLFCWAVLHFLR"
FT   exon            complement(361720..362163)
FT                   /gene="Pc20g01620"
FT                   /locus_tag="PCH_Pc20g01620"
FT                   /number=1
FT   intron          complement(362164..362218)
FT                   /gene="Pc20g01620"
FT                   /locus_tag="PCH_Pc20g01620"
FT                   /number=1
FT   exon            complement(362219..362400)
FT                   /gene="Pc20g01620"
FT                   /locus_tag="PCH_Pc20g01620"
FT                   /number=2
FT   intron          complement(362401..362456)
FT                   /gene="Pc20g01620"
FT                   /locus_tag="PCH_Pc20g01620"
FT                   /number=2
FT   exon            complement(362457..362556)
FT                   /gene="Pc20g01620"
FT                   /locus_tag="PCH_Pc20g01620"
FT                   /number=3
FT   intron          complement(362557..362603)
FT                   /gene="Pc20g01620"
FT                   /locus_tag="PCH_Pc20g01620"
FT                   /number=3
FT   exon            complement(362604..362606)
FT                   /gene="Pc20g01620"
FT                   /locus_tag="PCH_Pc20g01620"
FT                   /number=4
FT   mRNA            complement(join(<363252..363663,363737..363859,
FT                   364396..365462,365524..365747,365808..365857,
FT                   365916..>366025))
FT                   /gene="Pc20g01630"
FT                   /locus_tag="PCH_Pc20g01630"
FT   CDS_pept        complement(join(363252..363663,363737..363859,
FT                   364396..365462,365524..365747,365808..365857,
FT                   365916..366025))
FT                   /gene="Pc20g01630"
FT                   /locus_tag="PCH_Pc20g01630"
FT                   /note="unknown EC_number=2.3.1.12"
FT                   /note="Title: strong similarity to dihydrolipoamide
FT                   acetyltransferase Lat1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01630"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85492"
FT                   /db_xref="GOA:B6HDH0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="InterPro:IPR039453"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH0"
FT                   /inference="similar to AA sequence:PIR:A30198"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /inference="protein motif:PFAM:PF02817"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /inference="protein motif:COGS:COG0508"
FT                   /protein_id="CAP85492.1"
FT                   /translation="MVASAIRMRTPSAMFMSRGAAAMRRPQVSSKLQEVIQTQVPALSA
FT                   LSRFYASKSFPPHTLISMPALSPTMTAGNIGVWQKKAGDALQPGDVLVEIETDKAQMDF
FT                   EFQDEGVLAKVLKESGEKDVSVGSPIAVLVEEGSDVSAFESFTLADAGGDKPAPTEQKE
FT                   EPKSAEPSTPAPAEEAPAAQEPETSGEKLQPSLDREPSISPAAKVLALEKGVSIKGLKG
FT                   TGRGGVITKEDVEKAKPATTAVSGEATFEEIPVSSMRKTIANRLKQSMTENPHYFVSTT
FT                   LSVTKLLKLRQALNASADGQYKLSVNDFLVKACAVALLKVPQVNSSWREENGQAVIRQH
FT                   KTADISVAVSTPTGLITPVVKNVQGLGLSSISKQVKDLGKRARENKLKPEEYQGGTFTI
FT                   SNMGMNAAVERFTAVINPPQAGILAVGTTRKVAIPVETEEGTVTEWDDQIIVTGSFDHK
FT                   VVDGAVGGEWIKELKKVVENPLELLLISPDYVLIPSRTNMSYADAAAKGPKQSPEDVRI
FT                   QTRIFTLRRAPPVGGIYRDESESTASLIDVDGPHVQTVESDFLKHDVQTTTQAERIDRE
FT                   AEEKEKREDEEKKKARSQKAKSSGICGNTSNPVFIANAAIATVVGAGLGFGVYKQHARG
FT                   NLSWELVGLSAGAVGIFGAVDYFVSK"
FT   exon            complement(363252..363663)
FT                   /gene="Pc20g01630"
FT                   /locus_tag="PCH_Pc20g01630"
FT                   /number=1
FT   intron          complement(363664..363736)
FT                   /gene="Pc20g01630"
FT                   /locus_tag="PCH_Pc20g01630"
FT                   /number=1
FT   exon            complement(363737..363859)
FT                   /gene="Pc20g01630"
FT                   /locus_tag="PCH_Pc20g01630"
FT                   /number=2
FT   intron          complement(363860..364395)
FT                   /gene="Pc20g01630"
FT                   /locus_tag="PCH_Pc20g01630"
FT                   /number=2
FT   exon            complement(364396..365462)
FT                   /gene="Pc20g01630"
FT                   /locus_tag="PCH_Pc20g01630"
FT                   /number=3
FT   intron          complement(365463..365523)
FT                   /gene="Pc20g01630"
FT                   /locus_tag="PCH_Pc20g01630"
FT                   /number=3
FT   exon            complement(365524..365747)
FT                   /gene="Pc20g01630"
FT                   /locus_tag="PCH_Pc20g01630"
FT                   /number=4
FT   intron          complement(365748..365807)
FT                   /gene="Pc20g01630"
FT                   /locus_tag="PCH_Pc20g01630"
FT                   /number=4
FT   exon            complement(365808..365857)
FT                   /gene="Pc20g01630"
FT                   /locus_tag="PCH_Pc20g01630"
FT                   /number=5
FT   intron          complement(365858..365915)
FT                   /gene="Pc20g01630"
FT                   /locus_tag="PCH_Pc20g01630"
FT                   /number=5
FT   exon            complement(365916..366025)
FT                   /gene="Pc20g01630"
FT                   /locus_tag="PCH_Pc20g01630"
FT                   /number=6
FT   mRNA            join(<366479..366631,366747..368536,368588..370863,
FT                   370914..372300,372364..>372700)
FT                   /gene="Pc20g01640"
FT                   /locus_tag="PCH_Pc20g01640"
FT   CDS_pept        join(366479..366631,366747..368536,368588..370863,
FT                   370914..372300,372364..372700)
FT                   /gene="Pc20g01640"
FT                   /locus_tag="PCH_Pc20g01640"
FT                   /note="Title: strong similarity to protein Sec7
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01640"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85493"
FT                   /db_xref="GOA:B6HDP9"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR015403"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="InterPro:IPR032629"
FT                   /db_xref="InterPro:IPR032691"
FT                   /db_xref="InterPro:IPR035999"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDP9"
FT                   /inference="similar to AA sequence:TREMBL:SC9489.5"
FT                   /inference="protein motif:PFAM:PF01369"
FT                   /inference="protein motif:COGS:COG5307"
FT                   /inference="protein motif:COGS:COG5271"
FT                   /inference="protein motif:COGS:COG4547"
FT                   /protein_id="CAP85493.1"
FT                   /translation="MDMYITLNVHALLYVCLQNQTMSILPGKRGAVRTLESPTPAGTRG
FT                   SIILAEITPPGVSLTMADTELGSEPTQSIEMPKKPVETPDISPTVPNSDEPALPEQTEP
FT                   QEPVQKGDEEVPKGQDDEEKPEVPPKDEPEQTEQEPQTDGPPTIQEPPQDDNDATESRL
FT                   RSDSRSTTATFMTQRSSPVSSTVFIVTALDNIAASRDARRDKKLEDATQVALANIRQPD
FT                   GQAIDPELIFRPLHLASKALSIPLQVTALDCIGKLITYSYFAFPSAETENNATREQPPL
FT                   IERAIDAICDCFENEATAVEIQQQIIKSLLAAVLNDKIVVHGAGLLKAVRQIYNIFIYS
FT                   KSSQNQQIAQGSLTQMVSTVFDRVRTRMDLKELRVRELEKPSSTLDASASDVGQTSETA
FT                   SMPVADQPVTKEPTTEKLTLQSFESPKEVTGVNDNAPTTVTRAKRSATRSMSGIPEEKD
FT                   DDSSAEDDVDEIYVKDAFLVFRALCKLSHKVLTHEQQQDVKSQNMRSKLLSLHLIHYLI
FT                   NNHTATFISPLAAIKNSSSSADGMNLLLAVRPHLCLSLSRNGSSAVPHIFKVCCEIFWL
FT                   MLKDMRVMMKKELEVFLKEIYLAILEKRGAPAFQKQYFMEILERLGGDPRALVEIYLNY
FT                   DCDRTALENIFQNIIEQLSRYSSVPVVTTPSQQHQYQEQHTKMSAIGSEWHHRGTLPPS
FT                   LTSAHIVPTPPPSMPHIPSEYGLKQQALECLVEILRSLDNWATHRIDEQPEAAMPSKSM
FT                   DNSRESLDTSVLVSPHPETLEGGTGRSTPMPEDDPNQIEKVKQRKIALTNAIQQFNFKP
FT                   KRGIKALLKEGFIQSESPEDIASFMLRTDRIDKAVLGEYLGEGDPENIAIMHAFVDLME
FT                   FTKRRFVESLRSFLQHFRLPGEAQKIDRFMLKFAERYTTQNPNAFANADTAYVLAYSVI
FT                   LLNTDQHSSKMKGRRMTKEDFIKNNRGINDNQDLPTDYLGAIYEDIGSNEIVLYTEQEH
FT                   AANLNPQPAAPTGLATRAGQVFATVGRDIQGEKYAQASEEMANKTEQLYRSLIRAQRKT
FT                   AVKDALSHFIPATSERHVGSMFNVTWMSFLSGLSAPMQDTSNLETIRLCMEGLKLSIRI
FT                   SCAFDLETPRVAFVTALAKFTNLGNVREMMAKNVEALKALLDVAFTEGNHLQGSWRDVL
FT                   TCVSQLDRLQLLSDGVDEGSLPDVSRAPSSADTSRRSMQSTRRARPRSVNGPTAFRPEI
FT                   AMESRSADMIRGVDRIFTNTANLSHEAIIDFVRALSEVSWQEIQSSGHTDSPRTYSLQK
FT                   LVEISYYNMTRVRIEWSKIWDVLGQHFNQVGCHSNTMVVFFALDSLRQLSMRFMEIEEL
FT                   PGFKFQKDFLKPFEHVMANSTTAAVKDMILRCLIQMIQARGDNIRSGWKTMFGVFTVAA
FT                   REPYEGIVNMAFDHVTQVYNTRFGVVITQGAFADLIVCLTEFSKNSKFQKKSLQAIETL
FT                   RSTVTKMLRTPECPLSHRGASAATFQDNGTNLAKQLTRQSQEEQFWYPILIAFQDVLMT
FT                   GDDLEVRSRALTYLFDTLIRHGGDFPRDFWDVLWRQLLYPIFVVLQSKSEMSKVPNHED
FT                   LSVWLSTTMIQALRNMITLFTHYFDALEYMLSRFLELLTLCICQENDTIARIGSNCLQQ
FT                   LILQNVAKFKQEHWSQIVGAFVELFSKTTAYELFTAAVSMSKPAEAVNGDLTQSPDAAV
FT                   ATSDLPDALQPNGSQSTSSIHDGGDPPVQSEARAELEDYRPQSDQQQPAAVTAARRRYF
FT                   NRIITNCVLQLLMIETVHELFSNENVYAQIPSGELLRLMGLLKKSYQFAKKFNEDKDLR
FT                   MQLWRQGFMKQPPNLLKQESGSASTYVRILFRMYHDEREERQSSRAETEAALIPLCADI
FT                   IRSFVRLEEDTQHRNIVAWRPVVVDVIDGYTNFPQDDFNNHIETFYPLGVELLSRDLNP
FT                   EIRVALQSLLRRIGEVRLGIAPPNPLDVPISPRSSVSQKVPRRDSQV"
FT   exon            366479..366631
FT                   /gene="Pc20g01640"
FT                   /locus_tag="PCH_Pc20g01640"
FT                   /number=1
FT   intron          366632..366746
FT                   /gene="Pc20g01640"
FT                   /locus_tag="PCH_Pc20g01640"
FT                   /number=1
FT   exon            366747..368536
FT                   /gene="Pc20g01640"
FT                   /locus_tag="PCH_Pc20g01640"
FT                   /number=2
FT   intron          368537..368587
FT                   /gene="Pc20g01640"
FT                   /locus_tag="PCH_Pc20g01640"
FT                   /number=2
FT   exon            368588..370863
FT                   /gene="Pc20g01640"
FT                   /locus_tag="PCH_Pc20g01640"
FT                   /number=3
FT   intron          370864..370913
FT                   /gene="Pc20g01640"
FT                   /locus_tag="PCH_Pc20g01640"
FT                   /number=3
FT   exon            370914..372300
FT                   /gene="Pc20g01640"
FT                   /locus_tag="PCH_Pc20g01640"
FT                   /number=4
FT   intron          372301..372363
FT                   /gene="Pc20g01640"
FT                   /locus_tag="PCH_Pc20g01640"
FT                   /number=4
FT   exon            372364..372700
FT                   /gene="Pc20g01640"
FT                   /locus_tag="PCH_Pc20g01640"
FT                   /number=5
FT   mRNA            complement(join(<372863..372992,373047..373528,
FT                   373601..>373693))
FT                   /gene="Pc20g01650"
FT                   /locus_tag="PCH_Pc20g01650"
FT   CDS_pept        complement(join(372863..372992,373047..373528,
FT                   373601..373693))
FT                   /gene="Pc20g01650"
FT                   /locus_tag="PCH_Pc20g01650"
FT                   /note="Title: similarity to siroheme synthase cysG
FT                   -Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01650"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85494"
FT                   /db_xref="GOA:B6HDQ0"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR028162"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ0"
FT                   /inference="similar to AA sequence:TREMBL:ECNIRBC.4"
FT                   /inference="protein motif:COGS:COG1648"
FT                   /protein_id="CAP85494.1"
FT                   /translation="MSKFPEVQGGGSLIIAWQIRDKHVLVVGGGEVAAGRILHALNADA
FT                   RVTVVCPAAGLNEEVNFRVTEKQVTHIDRNFEPSDLDNVDMVLCAIDDPEASTQVWKLC
FT                   KERRIIANIADVPPECDFYFGSVHRDGPLQVMVSTNGNGPKLASIVRKKISETLPTNMG
FT                   AAIENVGKLRKKLREVAPNPDQGPKRMKWMSGVCETWSLDELVQMTEEDMDSVLSFYES
FT                   GKIPALEEVRNK"
FT   exon            complement(372863..372992)
FT                   /gene="Pc20g01650"
FT                   /locus_tag="PCH_Pc20g01650"
FT                   /number=1
FT   intron          complement(372993..373046)
FT                   /gene="Pc20g01650"
FT                   /locus_tag="PCH_Pc20g01650"
FT                   /number=1
FT   exon            complement(373047..373528)
FT                   /gene="Pc20g01650"
FT                   /locus_tag="PCH_Pc20g01650"
FT                   /number=2
FT   intron          complement(373529..373600)
FT                   /gene="Pc20g01650"
FT                   /locus_tag="PCH_Pc20g01650"
FT                   /number=2
FT   exon            complement(373601..373693)
FT                   /gene="Pc20g01650"
FT                   /locus_tag="PCH_Pc20g01650"
FT                   /number=3
FT   mRNA            join(<373867..374132,374249..374369,374424..>375506)
FT                   /gene="Pc20g01660"
FT                   /locus_tag="PCH_Pc20g01660"
FT   CDS_pept        join(373867..374132,374249..374369,374424..375506)
FT                   /gene="Pc20g01660"
FT                   /locus_tag="PCH_Pc20g01660"
FT                   /note="unknown EC_number=2.7.6.1"
FT                   /note="Title: strong similarity to ribose-phosphate
FT                   pyrophosphokinase Prps1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85495"
FT                   /db_xref="GOA:B6HDQ1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ1"
FT                   /inference="similar to AA sequence:PIR:S30558"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /inference="protein motif:COGS:COG0462"
FT                   /protein_id="CAP85495.1"
FT                   /translation="MRGVQIFSGNSHPGLADTICERLGTVPAKANLGKFANGETSVNIG
FT                   TSVRNQDVYIIQSGSEKINDSVMELLIMISACKGGSAKSITGMLYFPYSRQSKKKSHRG
FT                   AITARMLANLLTIAGVDHVITMDLHASQMQGFFGKPVDNLFAEPFIARWIRMNVPGWKD
FT                   AVVVSKNAGGTKRVTSLADTLKLNFGIVTTDRRRPKVPVATMTDSTVFFDAVDEDPIPT
FT                   EDAQPFELRMQGYNRTTATPPIPEEQEPITPPPARYLLRPETPPAARRPSELEAAYEYT
FT                   DVRVRDVITGRLVQGQLVDDDYRANEDSQSGGTTPGAGSSSHDNTETIPDAMVNSIVSN
FT                   ASSQPDHALGGSFDAVESDDEASVCAGQVDERTITLVGEVRDRSVFLVDDMIDKSGSWI
FT                   AAAETVVKRGGASKVYCIATHGLFGENSLDQMEACPSIDHIVVTNTFPISPSMLRRSKK
FT                   LIVIDVSSLLAESMRRHHYGERFVFTDPGVV"
FT   exon            373867..374132
FT                   /gene="Pc20g01660"
FT                   /locus_tag="PCH_Pc20g01660"
FT                   /number=1
FT   intron          374133..374248
FT                   /gene="Pc20g01660"
FT                   /locus_tag="PCH_Pc20g01660"
FT                   /number=1
FT   exon            374249..374369
FT                   /gene="Pc20g01660"
FT                   /locus_tag="PCH_Pc20g01660"
FT                   /number=2
FT   intron          374370..374423
FT                   /gene="Pc20g01660"
FT                   /locus_tag="PCH_Pc20g01660"
FT                   /number=2
FT   exon            374424..375506
FT                   /gene="Pc20g01660"
FT                   /locus_tag="PCH_Pc20g01660"
FT                   /number=3
FT   mRNA            join(<378412..378544,378687..>378976)
FT                   /gene="Pc20g01670"
FT                   /locus_tag="PCH_Pc20g01670"
FT   CDS_pept        join(378412..378544,378687..378976)
FT                   /gene="Pc20g01670"
FT                   /locus_tag="PCH_Pc20g01670"
FT                   /note="Title: similarity to hypothetical protein An07g02230
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85496"
FT                   /db_xref="GOA:B6HDQ2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ2"
FT                   /protein_id="CAP85496.1"
FT                   /translation="MANQCSGHVFAIVQATNGNILTWRCSDCNSGPFVAIWRCKICGHY
FT                   ICICFLSISSTDLLLCMNPVQGYFPLGAGLPAHFVAFVWRVFVHLMCSKSPQKFLMHLH
FT                   LASGGVIDRFPPPLSHSSYSLFYYGYVFYILDLDFP"
FT   exon            378412..378544
FT                   /gene="Pc20g01670"
FT                   /locus_tag="PCH_Pc20g01670"
FT                   /number=1
FT   intron          378545..378686
FT                   /gene="Pc20g01670"
FT                   /locus_tag="PCH_Pc20g01670"
FT                   /number=1
FT   exon            378687..378976
FT                   /gene="Pc20g01670"
FT                   /locus_tag="PCH_Pc20g01670"
FT                   /number=2
FT   mRNA            complement(join(<379634..379648,379701..380249,
FT                   380328..380788,380849..381109,381156..381777,
FT                   381837..381989,382046..382446,382509..>382569))
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT   CDS_pept        complement(join(379634..379648,379701..380249,
FT                   380328..380788,380849..381109,381156..381777,
FT                   381837..381989,382046..382446,382509..382569))
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /note="unknown EC_number=3.1.4.4"
FT                   /note="Title: similarity to phospholipase Pld1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01680"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85497"
FT                   /db_xref="GOA:B6HDQ3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR016555"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ3"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /inference="protein motif:COGS:COG1502"
FT                   /protein_id="CAP85497.1"
FT                   /translation="MHKFREKFEQGIDHLEESFKDAHIHDVKAEATHLKAKVGKFFNII
FT                   NPNHRHDEEHEQETDRKRSEIADSHRFKSFAPVHDGNRVKWYVDGKDYMWAVSEALEKA
FT                   TETIYIADWWLSPELFLRRPPVENQQWRLDQVLKRRAEAGVKIYIIVYKEVNQALTCNS
FT                   AHTKHALRNLCPEGTPGYGNIRVMRHPDHNIFENAADMTLYWAHHEKFIVIDYNVGFIG
FT                   GIDLCFGRWDANQHPLADVHPRGLRDDIFPGQDFNNNRIMDFQSVEDWQSNEVSKIDFG
FT                   RMPWHDVAMGLQGDCVYDIAEHFVLRWNFIKRDKYKRSHDVDWLLMEGRTGEEEDIIAV
FT                   QRPKYPCGDYVQHPLTPLSSKPRGNVGTVRAQIVRSSDDWSSGILNEHSIQNAYCETIR
FT                   NAQHYVYIENQFFITATGDQQRPIFNTIGRAIVDACVRAGKEGRKFRVIIVIPAIPGFA
FT                   GDLRDNAALGTRAIMDYQYKSICRGEHSIFGQIEKEGIDPREHVFVFALRAYDRINKTP
FT                   VLEDLEKQADVTYQDIQRGIAETIMSESVHPAVGKDGDDNEKDYAADQSAKEETLRKLQ
FT                   KFQEKVDQRKAGDGFNSKDSVAHCTMLNGGKVSEESWEGDAEAEKANFVQEELYVHGKV
FT                   CIVDDRTIICGSANINDRSQLGSHDSELAIVMEDQDLIDSKMNGQPYRASRLAATLRRQ
FT                   LWREHLGLLRAQDYDASGDPNAQPPDVSLNKIDEGPENEFVMDPLSDGVWNTWTSQATG
FT                   NTETYRMLFRADPDDHIKTFEDYDNFRPRGTRKEGHLFDPYMPAKDVREKLDLIKGHLV
FT                   WLPLDFLRDAEMAEPGLAVNQITESIYT"
FT   exon            complement(379634..379648)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=1
FT   intron          complement(379649..379700)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=1
FT   exon            complement(379701..380249)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=2
FT   intron          complement(380250..380327)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=2
FT   exon            complement(380328..380788)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=3
FT   intron          complement(380789..380848)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=3
FT   exon            complement(380849..381109)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=4
FT   intron          complement(381110..381155)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=4
FT   exon            complement(381156..381777)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=5
FT   intron          complement(381778..381836)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=5
FT   exon            complement(381837..381989)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=6
FT   intron          complement(381990..382045)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=6
FT   exon            complement(382046..382446)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=7
FT   intron          complement(382447..382508)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=7
FT   exon            complement(382509..382569)
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /number=8
FT   mRNA            join(<383870..383885,383933..383961,384011..384669,
FT                   384724..385041,385094..>386651)
FT                   /gene="RFX"
FT                   /locus_tag="PCH_Pc20g01690"
FT   CDS_pept        join(383870..383885,383933..383961,384011..384669,
FT                   384724..385041,385094..386651)
FT                   /gene="RFX"
FT                   /locus_tag="PCH_Pc20g01690"
FT                   /product="transcription factor like protein RFX-Penicillium
FT                   chrysogenum"
FT                   /note="Gene-ID: RFX"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01690"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85498"
FT                   /db_xref="GOA:B6HDQ4"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039779"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ4"
FT                   /inference="similar to AA sequence:TREMBL:PCH243296.1"
FT                   /inference="protein motif:PFAM:PF02257"
FT                   /protein_id="CAP85498.1"
FT                   /translation="MPPELGYLVPGANVLIAPQSRPGTADPVRARSEALSRASRRPRSR
FT                   GSTASIHSSTTQQTQDQHLDGFPQFMPSQVGTGQHMFNNPEDMLMRFGHQLSHHNGAPL
FT                   DQSMQDTHAGMSRTEDFPNHPMQGHPLSHHPIQPEIASGLSGVSVPQYQPMYDSGVENH
FT                   LPDHIVEDQEVSEPGTKKKRGASSTVANDNELRKLLRQYEGWSLKQMAAEVMKNEGGGG
FT                   KAEKVKQVFAMIWLRENCRKSSGSVRRDRVYCCYAENCGTERVSVLNPASFGKLVRIIF
FT                   PNVQTRRLGVRGESKYHYVDLSVIEEKQQKLAPLNPQIAHHSTGPASMPSRAASAMRSR
FT                   SASVQQPTADTAVFPSPTTSFPPRFPNNASPADCNCQSHTPSGPEATITRENVAQQAGK
FT                   MIHQMLQFPTDENPLVDNDTLQLPDIRAYLPSNTDLKVAAALAALYRSHCISVIDSFRY
FT                   CKERNLMKYFSAFHGTLTVPVQKLLTHPNLAPWIKECDWMMYQKMIAFVAPLTTQVVPK
FT                   PVLDAFNSISQRLCGHIAETFKTQPTHVSIARLIPAHIFCNLLKHMLDVNQAANAAAAW
FT                   LCHPDNRNQMWTDFKTMVNPRDMMTKANIPTCAELATEQILKHDIRALLTPLSDADPSA
FT                   SLLFFTQPDTPDSVEAHKFPVESAPGDEYNFPDKWVQFILNIPAAFANHRTQCVIEKVD
FT                   ALWDSVLHRLTLAGAPSFSAWWMTKVFFHEMMVWQAEKGGFMRNTPGSLQSATFGPESL
FT                   GHFQMKQASVPETSPFEASNDSQAKSNPSPPVAHNGHQSHPPSQHPEFKHPPTEKRLSL
FT                   QDPGFQGHNNDDSAIDLEDDTMLLAVGKYGDMMVSDPADAEGDVVVI"
FT   exon            383870..383885
FT                   /gene="RFX"
FT                   /locus_tag="PCH_Pc20g01690"
FT                   /number=1
FT   intron          383886..383932
FT                   /gene="RFX"
FT                   /locus_tag="PCH_Pc20g01690"
FT                   /number=1
FT   exon            383933..383961
FT                   /gene="RFX"
FT                   /locus_tag="PCH_Pc20g01690"
FT                   /number=2
FT   intron          383962..384010
FT                   /gene="RFX"
FT                   /locus_tag="PCH_Pc20g01690"
FT                   /number=2
FT   exon            384011..384669
FT                   /gene="RFX"
FT                   /locus_tag="PCH_Pc20g01690"
FT                   /number=3
FT   intron          384670..384723
FT                   /gene="RFX"
FT                   /locus_tag="PCH_Pc20g01690"
FT                   /number=3
FT   exon            384724..385041
FT                   /gene="RFX"
FT                   /locus_tag="PCH_Pc20g01690"
FT                   /number=4
FT   intron          385042..385093
FT                   /gene="RFX"
FT                   /locus_tag="PCH_Pc20g01690"
FT                   /number=4
FT   exon            385094..386651
FT                   /gene="RFX"
FT                   /locus_tag="PCH_Pc20g01690"
FT                   /number=5
FT   mRNA            complement(join(<387469..387705,388295..388416,
FT                   388460..>388559))
FT                   /gene="Pc20g01700"
FT                   /locus_tag="PCH_Pc20g01700"
FT   CDS_pept        complement(join(387469..387705,388295..388416,
FT                   388460..388559))
FT                   /gene="Pc20g01700"
FT                   /locus_tag="PCH_Pc20g01700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01700"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85499"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ5"
FT                   /protein_id="CAP85499.1"
FT                   /translation="MPHLPSLCLGWALWVGDNAAMTGSASIGGPEHGALCGSFGPMSIS
FT                   RTRHRVSQDVNPRPDMSGMSSGVEAILLHDLLQLYILRWSAAMKLKLTWLEPSKCLGIA
FT                   PEEEREKEWKLASTALLPSELMTYCEAAKFCLPDLRCLYFPALALLSA"
FT   exon            complement(387469..387705)
FT                   /gene="Pc20g01700"
FT                   /locus_tag="PCH_Pc20g01700"
FT                   /number=1
FT   mat_peptide     complement(join(387472..387705,388295..388416,
FT                   388460..388502))
FT                   /gene="Pc20g01700"
FT                   /locus_tag="PCH_Pc20g01700"
FT   intron          complement(387706..388294)
FT                   /gene="Pc20g01700"
FT                   /locus_tag="PCH_Pc20g01700"
FT                   /number=1
FT   exon            complement(388295..388416)
FT                   /gene="Pc20g01700"
FT                   /locus_tag="PCH_Pc20g01700"
FT                   /number=2
FT   intron          complement(388417..388459)
FT                   /gene="Pc20g01700"
FT                   /locus_tag="PCH_Pc20g01700"
FT                   /number=2
FT   exon            complement(388460..388559)
FT                   /gene="Pc20g01700"
FT                   /locus_tag="PCH_Pc20g01700"
FT                   /number=3
FT   sig_peptide     complement(388503..388559)
FT                   /gene="Pc20g01700"
FT                   /locus_tag="PCH_Pc20g01700"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<388623..390954,391090..>391409))
FT                   /gene="Pc20g01710"
FT                   /locus_tag="PCH_Pc20g01710"
FT   CDS_pept        complement(join(388623..390954,391090..391409))
FT                   /gene="Pc20g01710"
FT                   /locus_tag="PCH_Pc20g01710"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig31_part_ii.tfa_3670wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01710"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85500"
FT                   /db_xref="GOA:B6HDQ6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ6"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /inference="protein motif:COGS:COG3119"
FT                   /inference="protein motif:COGS:COG1368"
FT                   /protein_id="CAP85500.1"
FT                   /translation="MKVVHAVHAYLSHGIRRVRLSPGETLDAIWDFSRRYFFTLAFLSL
FT                   FSAKILHLYAHIYSLPLPRLFLWGLTFFFQDVMILLLFRILAQKVAWRPGAALLAILVI
FT                   PSSLLVSFMAAANTSFYVFTGAEIHWRQAKSFNGDAAAIHTLLTGLTGFLIVEGILLTL
FT                   SLFAAHSIHAITGGILHVWAWPVRWLFARVRPHVEPLVRRFWPSKSPDLPDPRIYEQID
FT                   MEDNDSDNEEGDHLLNTGAQLPNRLPESKRVTDGVPQRALILGLFSLFLFLRFMRPWDQ
FT                   VYMYMSTTLPLTTVIEGAERHSPVVTTGTPGLFEYLDGVTALGPAPRWSWMSKEPIAGF
FT                   DDWDQSDPLALHYNPHEDPLHISNLNKPVLEEIHNALASGDVKIKHVVFLKLESARADI
FT                   FPLQKDSFMYKRIAETWKDKTIPPEVVDRLANLTRTAEYLTNFPNGFEHDDARFNGRKA
FT                   YGGISAKNAITSATYTLKSLTGSFCGVTPLVADFNREFDHHIYQPCLPHVFDMLSQQSD
FT                   ITNDTDDFTKWPWHSTFMMSVTEMYDNQDKLTPQLGFRDKQTKETIIKPEAKHYPVTSP
FT                   EVNYYGYPESELREYIRDAIDDAERDHQRLFLSHLTSTTHHPWGVPNDAYEDLMGSKSG
FT                   ANNDMNRYLNSVGYVDDWLSDLIDILEEKGVANETLFVMAGDHGLSLPNDGGITPYDNP
FT                   HIGSFKVPIVIAHPQLPPVQIDTPVINTQIVPTIIDLLIESASLSKDSTTAARDIRSLY
FT                   EGQSLIRPQVVQQDGRESWHFTVMNTGGSWLSVRSAARPEFRLVIPLVNDVEWRFSDVS
FT                   KDPNELNPIERFSLADLAAAVNKEYDDEEILNWLYNAAYVTNWWVTENWDRWRFSPKAT
FT                   EEAKEEVKEDKT"
FT   exon            complement(388623..390954)
FT                   /gene="Pc20g01710"
FT                   /locus_tag="PCH_Pc20g01710"
FT                   /number=1
FT   intron          complement(390955..391089)
FT                   /gene="Pc20g01710"
FT                   /locus_tag="PCH_Pc20g01710"
FT                   /number=1
FT   exon            complement(391090..391409)
FT                   /gene="Pc20g01710"
FT                   /locus_tag="PCH_Pc20g01710"
FT                   /number=2
FT   mRNA            <391965..>393164
FT                   /gene="Pc20g01720"
FT                   /locus_tag="PCH_Pc20g01720"
FT   CDS_pept        391965..393164
FT                   /gene="Pc20g01720"
FT                   /locus_tag="PCH_Pc20g01720"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1492_0.tfa_2510cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01720"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85501"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ7"
FT                   /protein_id="CAP85501.1"
FT                   /translation="MLGSLFGWVSLLFEPLAFQVPLIEPQPRLKSENGIAIPVQGPWQD
FT                   IITGHYAVPPVLKIHDRNSVVKWSWQREDVTQPLPPLIRSGLYSGYNDATDMKWMRGGR
FT                   SVAAVYSALVVVINHTPDQPSTDKKITFAINRANDVLHNAHTIEPLPGDRLAVGTTGQR
FT                   PWDGILVYNMSEALPLMDEPPVLQRIEGLRAIHALIWDEQGQMLWATGTDAAADGSDPV
FT                   PAYGVIQGYPFDAETGLLSIDEAYRFKFPEYFDIDAEWGHGYSWWAGPHDLVPVPNERV
FT                   LLVSNDIGLHAFDINEMNFTAEYDEVVEKYMPGFEVTTNDRHGINRQGEYVELPQSDLK
FT                   GFSLAPDGSFLYTQSLWRLFRGNYTSLVVDGVRHQIMKGNEIYRSRWFGDIDGWPKPKT
FT                   "
FT   sig_peptide     391965..392021
FT                   /gene="Pc20g01720"
FT                   /locus_tag="PCH_Pc20g01720"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            391965..393164
FT                   /gene="Pc20g01720"
FT                   /locus_tag="PCH_Pc20g01720"
FT                   /number=1
FT   mat_peptide     392022..393161
FT                   /gene="Pc20g01720"
FT                   /locus_tag="PCH_Pc20g01720"
FT   mRNA            join(<394968..395480,395537..395915,395972..396160,
FT                   396333..396394,396460..>396651)
FT                   /gene="Pc20g01730"
FT                   /locus_tag="PCH_Pc20g01730"
FT   CDS_pept        join(394968..395480,395537..395915,395972..396160,
FT                   396333..396394,396460..396651)
FT                   /gene="Pc20g01730"
FT                   /locus_tag="PCH_Pc20g01730"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An04g09660 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01730"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85502"
FT                   /db_xref="GOA:B6HDQ8"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ8"
FT                   /protein_id="CAP85502.1"
FT                   /translation="MASSSAPSLANLAFDEICRQLEVFVAGKKASASFVCGGLVPIDAH
FT                   TAASSIPSKTTVSPPVRICWRTDADNILRELTLPLDSQADSKAESGLRQLVVDCEPASF
FT                   GKGQQDVLDPKYRKAGKLEPRSFLTSFHPSDLGILQNVEQILLPNFNTDLENRLPFRKM
FT                   HAELYKLNVYSGPSGLFRKHVDTPRSETQIGSLVVCLPSHFKGGNLVVQHEGKRVEFDW
FT                   SHQSASAIQWAAFYSDCEHEIKTITEGERITLTYNLYVTEPVGGSIPPSLIVDPKSMSL
FT                   YSFLEELLVEPGFMTDGGALGFFCSHAYPHASDEAPMLLPRALKGSDLVLYSVFKSLGI
FT                   QIDVLPVAFDDHYDQCKEKHVLVGDQLHPYFATDEIEEDESMTELCFPGEYRPEITWIG
FT                   SPTHRQEAVSYIAYGNQPSLGAVYSYAALIANIPPFLERQGLVLA"
FT   exon            394968..395480
FT                   /gene="Pc20g01730"
FT                   /locus_tag="PCH_Pc20g01730"
FT                   /number=1
FT   intron          395481..395536
FT                   /gene="Pc20g01730"
FT                   /locus_tag="PCH_Pc20g01730"
FT                   /number=1
FT   exon            395537..395915
FT                   /gene="Pc20g01730"
FT                   /locus_tag="PCH_Pc20g01730"
FT                   /number=2
FT   intron          395916..395971
FT                   /gene="Pc20g01730"
FT                   /locus_tag="PCH_Pc20g01730"
FT                   /number=2
FT   exon            395972..396160
FT                   /gene="Pc20g01730"
FT                   /locus_tag="PCH_Pc20g01730"
FT                   /number=3
FT   intron          396161..396332
FT                   /gene="Pc20g01730"
FT                   /locus_tag="PCH_Pc20g01730"
FT                   /number=3
FT   exon            396333..396394
FT                   /gene="Pc20g01730"
FT                   /locus_tag="PCH_Pc20g01730"
FT                   /number=4
FT   intron          396395..396459
FT                   /gene="Pc20g01730"
FT                   /locus_tag="PCH_Pc20g01730"
FT                   /number=4
FT   exon            396460..396651
FT                   /gene="Pc20g01730"
FT                   /locus_tag="PCH_Pc20g01730"
FT                   /number=5
FT   mRNA            complement(join(<397195..397798,397968..>398002))
FT                   /gene="Pc20g01740"
FT                   /locus_tag="PCH_Pc20g01740"
FT   CDS_pept        complement(join(397195..397798,397968..398002))
FT                   /gene="Pc20g01740"
FT                   /locus_tag="PCH_Pc20g01740"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig_1_65_scaffold_4.tfa_350cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85503"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ9"
FT                   /protein_id="CAP85503.1"
FT                   /translation="MPDWEVEDSHRCAPCKMNRTAFFSSSIINNGSSNRQSCISFSLRP
FT                   APWDSAKILVHPSGYPIEAPPMYSIISKDSPPNVVLLRGWGEGPWVIVGDARLPTLSSK
FT                   IHLTFYGQPIIMRLNQLSGNYALESPAVGQLKWRPDMFTGRDMQLQDATGRKLAKLRPG
FT                   KSGEKLLEILVSHDSSFSEIVLLSGWTARAMTKSVTEATGEILSSVVGA"
FT   exon            complement(397195..397798)
FT                   /gene="Pc20g01740"
FT                   /locus_tag="PCH_Pc20g01740"
FT                   /number=1
FT   intron          complement(397799..397967)
FT                   /gene="Pc20g01740"
FT                   /locus_tag="PCH_Pc20g01740"
FT                   /number=1
FT   exon            complement(397968..398002)
FT                   /gene="Pc20g01740"
FT                   /locus_tag="PCH_Pc20g01740"
FT                   /number=2
FT   mRNA            join(<398358..398414,398469..398987,399067..399201,
FT                   399283..>400032)
FT                   /gene="Pc20g01750"
FT                   /locus_tag="PCH_Pc20g01750"
FT   CDS_pept        join(398358..398414,398469..398987,399067..399201,
FT                   399283..400032)
FT                   /gene="Pc20g01750"
FT                   /locus_tag="PCH_Pc20g01750"
FT                   /note="Title: similarity to transcription activator of
FT                   lysine pathway Lys14 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01750"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85504"
FT                   /db_xref="GOA:B6HDR0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR0"
FT                   /inference="similar to AA sequence:PIR:S61587"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /protein_id="CAP85504.1"
FT                   /translation="MPGVPSSRGCDACRKVKKKCDQLKPTCSRCARLKMTCVGGGQQRY
FT                   MFKNQSVKAMQTQSGAESQSQLQQSFPSTGNRAVWIGKPTRVPSTDTSKMAAAFVAAFQ
FT                   VTDIRYAMAYYGPFLRDIPRRLGNSTVLDSAVRALSTAYSLLHAGSYPPKALVLYGQSL
FT                   RALRECLNDPVEARTPNTLCAVYLITICQSWLGKHDDSLTSHSEAIAHLLRAAALHEWK
FT                   STFEMELVITLCVPIILEGIINPRIKMDSEFWQLASSFRRRLSASRDNNQPQSATELQH
FT                   LAMFPKFVQNPESHLAEIAKTYMQLRLDAQRVKQHLDQCAETVLVSFSSSEVARHCRIQ
FT                   AAYAMLSTLAVLLNSLLRVFDPWNASLVSEAVFLCDEIATQAELASCYRPVGAGYIPLC
FT                   LVVAWAASDNLVQLARIEAILSEYQSDFAEVPWMSRAIWLASTLDSHRIRVMSGKQSPE
FT                   SSLEADSGDSHGAGTKKASVRPESCCIL"
FT   exon            398358..398414
FT                   /gene="Pc20g01750"
FT                   /locus_tag="PCH_Pc20g01750"
FT                   /number=1
FT   intron          398415..398468
FT                   /gene="Pc20g01750"
FT                   /locus_tag="PCH_Pc20g01750"
FT                   /number=1
FT   exon            398469..398987
FT                   /gene="Pc20g01750"
FT                   /locus_tag="PCH_Pc20g01750"
FT                   /number=2
FT   intron          398988..399066
FT                   /gene="Pc20g01750"
FT                   /locus_tag="PCH_Pc20g01750"
FT                   /number=2
FT   exon            399067..399201
FT                   /gene="Pc20g01750"
FT                   /locus_tag="PCH_Pc20g01750"
FT                   /number=3
FT   intron          399202..399282
FT                   /gene="Pc20g01750"
FT                   /locus_tag="PCH_Pc20g01750"
FT                   /number=3
FT   exon            399283..400032
FT                   /gene="Pc20g01750"
FT                   /locus_tag="PCH_Pc20g01750"
FT                   /number=4
FT   mRNA            complement(join(<400892..401551,401601..402027,
FT                   402077..402456,402519..402691,402758..>402821))
FT                   /gene="Pc20g01760"
FT                   /locus_tag="PCH_Pc20g01760"
FT   CDS_pept        complement(join(400892..401551,401601..402027,
FT                   402077..402456,402519..402691,402758..402821))
FT                   /gene="Pc20g01760"
FT                   /locus_tag="PCH_Pc20g01760"
FT                   /note="Title: strong similarity to cercosporin transporter
FT                   CFP - Cercospora kikuchii"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01760"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85505"
FT                   /db_xref="GOA:B6HDR1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR1"
FT                   /inference="similar to AA sequence:TREMBL:AF091042.1"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP85505.1"
FT                   /translation="MWFLPSCFKHPSHFSTDGPTKGCSSMRDFEDQAYTNRDDIPLKET
FT                   GESDDDEEKQVYPPSSKLAPILIGLCFQSFCIALDNTILSTAVPKITEEFNSLSDISWY
FT                   ASAYLLTTCAVTLPFGKIYTYYSTKWTYMIALGLFELGSLICAVTPTSKGLIFGRAIAG
FT                   VGSGGLSPGALLILANSVPLHRRALYFGIIGSTSGIATITGPLLGGLLTDHATWRWCFW
FT                   INLPFGVLTGLVILLFFKDSTSPKPKISRLGQLKRMDPLGILAFIPAIVSLLLCLQWGG
FT                   TKYSWNNARIIALFVLFGVFGFAWCLIQVWKQDDATVPPRLLKDRNVLGAVIHATFLGG
FT                   SFFVFGYYLPIWFQAVKEDSASESGINNLPMVVAMIVFSALGGLMVNIVGYYTPLMFVG
FT                   SAFLTIGSGLCTTFKVDSGRPQWIGYQVILGIGAGLGFQQCINALQTVLPLHDIPVGIA
FT                   IITFAQSLSGAMFISIAQTVFQNRLVASITTYAPNISPNALTKAGAANLSHLVPKNMLP
FT                   SVLHAYNIAVVQTFYVSVAAALLSFIGAGLVQWKSMKRRQKYDGASRSSQ"
FT   exon            complement(400892..401551)
FT                   /gene="Pc20g01760"
FT                   /locus_tag="PCH_Pc20g01760"
FT                   /number=1
FT   intron          complement(401552..401600)
FT                   /gene="Pc20g01760"
FT                   /locus_tag="PCH_Pc20g01760"
FT                   /number=1
FT   exon            complement(401601..402027)
FT                   /gene="Pc20g01760"
FT                   /locus_tag="PCH_Pc20g01760"
FT                   /number=2
FT   intron          complement(402028..402076)
FT                   /gene="Pc20g01760"
FT                   /locus_tag="PCH_Pc20g01760"
FT                   /number=2
FT   exon            complement(402077..402456)
FT                   /gene="Pc20g01760"
FT                   /locus_tag="PCH_Pc20g01760"
FT                   /number=3
FT   intron          complement(402457..402518)
FT                   /gene="Pc20g01760"
FT                   /locus_tag="PCH_Pc20g01760"
FT                   /number=3
FT   exon            complement(402519..402691)
FT                   /gene="Pc20g01760"
FT                   /locus_tag="PCH_Pc20g01760"
FT                   /number=4
FT   intron          complement(402692..402757)
FT                   /gene="Pc20g01760"
FT                   /locus_tag="PCH_Pc20g01760"
FT                   /number=4
FT   exon            complement(402758..402821)
FT                   /gene="Pc20g01760"
FT                   /locus_tag="PCH_Pc20g01760"
FT                   /number=5
FT   mRNA            join(<403481..403584,403671..403734,403964..404036,
FT                   404134..>404312)
FT                   /gene="Pc20g01770"
FT                   /locus_tag="PCH_Pc20g01770"
FT   CDS_pept        join(403481..403584,403671..403734,403964..404036,
FT                   404134..404312)
FT                   /gene="Pc20g01770"
FT                   /locus_tag="PCH_Pc20g01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01770"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85506"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR2"
FT                   /protein_id="CAP85506.1"
FT                   /translation="MATGPPHNYPCQSTLVYLGSRTGGLISSSRLERYWDREKGASEQH
FT                   PADLLGILIHHAFICDDKDRRRSNELYDGGSRSVCVSWLIVAEDCRLEGINLHRDLTVY
FT                   HEEPQAVGDLRLGARYFVGGYLAMIEQLGNEFWGS"
FT   exon            403481..403584
FT                   /gene="Pc20g01770"
FT                   /locus_tag="PCH_Pc20g01770"
FT                   /number=1
FT   intron          403585..403670
FT                   /gene="Pc20g01770"
FT                   /locus_tag="PCH_Pc20g01770"
FT                   /number=1
FT   exon            403671..403734
FT                   /gene="Pc20g01770"
FT                   /locus_tag="PCH_Pc20g01770"
FT                   /number=2
FT   intron          403735..403963
FT                   /gene="Pc20g01770"
FT                   /locus_tag="PCH_Pc20g01770"
FT                   /number=2
FT   exon            403964..404036
FT                   /gene="Pc20g01770"
FT                   /locus_tag="PCH_Pc20g01770"
FT                   /number=3
FT   intron          404037..404133
FT                   /gene="Pc20g01770"
FT                   /locus_tag="PCH_Pc20g01770"
FT                   /number=3
FT   exon            404134..404312
FT                   /gene="Pc20g01770"
FT                   /locus_tag="PCH_Pc20g01770"
FT                   /number=4
FT   mRNA            join(<405825..406236,406289..406330,406462..407124,
FT                   407155..407383,407440..>407737)
FT                   /gene="Pc20g01780"
FT                   /locus_tag="PCH_Pc20g01780"
FT   CDS_pept        join(405825..406236,406289..406330,406462..407124,
FT                   407155..407383,407440..407737)
FT                   /gene="Pc20g01780"
FT                   /locus_tag="PCH_Pc20g01780"
FT                   /note="Title: strong similarity to high-affinity glucose
FT                   transporter HGT1 - Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01780"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85507"
FT                   /db_xref="GOA:B6HDR3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR3"
FT                   /inference="similar to AA sequence:SWISSPROT:HGT1_KLULA"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP85507.1"
FT                   /translation="MQTRRFLGLSGTKVQIAIGFLAGMDFLLFGYDQGVTGGLLTLDSF
FT                   VKYFPEINTLDSYTEHWSPSAKSNQSTRQGITVAAYNLGCFAGSIPTIWIGNILGRRKA
FT                   IFLGSFIMCVGAILQCTSYGLAQLVIGRLITGFGNGINTSTVPTWQSECCKSHRRGQMV
FT                   MIEGAMITCGITISYWINFGLMFADPNEVAWRFPLAFQIFFAAIILAFVMFLPESPRWL
FT                   ILKGREEEAKEVLACLMGDETDELFIDTEFTAIKATVLEMATGSFRDMFTMGEDRHFHR
FT                   TMLAYVNQMFQQISGINLITYYIPTLLEQQVGLDATISRLISACNGTEYFIASWIAVFT
FT                   VERFGRRTLMLFGAVGMSISMVVLAISDSISSTGVAQTVFLFVFNTFFAIGWLGMTWLY
FT                   PAEIVPLKIRAPANALSTSSNWIWNFMVVMITPVAFENIGYKTYIIFAVINAAIVPVVY
FT                   FFFPETTMRSLEEMDRIFRKTTSVFNVVSLANTEPHMYGPNGELLRTLDDVEDDAVRRA
FT                   SFLNKESKAQQQSHTQHAEKCSDEPTSEER"
FT   exon            405825..406236
FT                   /gene="Pc20g01780"
FT                   /locus_tag="PCH_Pc20g01780"
FT                   /number=1
FT   intron          406237..406288
FT                   /gene="Pc20g01780"
FT                   /locus_tag="PCH_Pc20g01780"
FT                   /number=1
FT   exon            406289..406330
FT                   /gene="Pc20g01780"
FT                   /locus_tag="PCH_Pc20g01780"
FT                   /number=2
FT   intron          406331..406461
FT                   /gene="Pc20g01780"
FT                   /locus_tag="PCH_Pc20g01780"
FT                   /number=2
FT   exon            406462..407124
FT                   /gene="Pc20g01780"
FT                   /locus_tag="PCH_Pc20g01780"
FT                   /number=3
FT   intron          407125..407154
FT                   /gene="Pc20g01780"
FT                   /locus_tag="PCH_Pc20g01780"
FT                   /number=3
FT   exon            407155..407383
FT                   /gene="Pc20g01780"
FT                   /locus_tag="PCH_Pc20g01780"
FT                   /number=4
FT   intron          407384..407439
FT                   /gene="Pc20g01780"
FT                   /locus_tag="PCH_Pc20g01780"
FT                   /number=4
FT   exon            407440..407737
FT                   /gene="Pc20g01780"
FT                   /locus_tag="PCH_Pc20g01780"
FT                   /number=5
FT   mRNA            complement(join(<408172..408549,408598..408888,
FT                   408965..409678,409732..409807,409858..409909,
FT                   409960..>409984))
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT   CDS_pept        complement(join(408172..408549,408598..408888,
FT                   408965..409678,409732..409807,409858..409909,
FT                   409960..409984))
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT                   /note="Title: strong similarity to high affinity glucose
FT                   transporter HGT1 - Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01790"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85508"
FT                   /db_xref="GOA:B6HE12"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE12"
FT                   /inference="similar to AA sequence:SWISSPROT:HGT1_KLULA"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP85508.1"
FT                   /translation="MYTITNIYVLAAFGTIGGALFGFDVSSMSAWIGVDTYTDYFDSPD
FT                   SNLQGGITASMSAGSFAGSIAAGWLADILGRRYALMIASLVWIVGAVVQCSAQNVTHLV
FT                   AGRVVSGLAVGVTSSQTCVYLSELAPARIRGRIVGIQQWAIEWGILIMYLIAYGCVVGV
FT                   SGPAAFRICWGVQAVPGLILFIALFFFPESPRWLASQERWEEALDTLAIIHANGDRHDP
FT                   VVQVEFEEVQEAVRVAHESRDVSFMALFGPRVWKRTMCGMSVQMWQQLLGGNVAMYYVV
FT                   YIFEMAGMTGNTTLWSSAIQYVIFLVTTGCMLPFIDRVGRRNLLLIGSVTCMVVHYIIA
FT                   AVMASKGKPVPDVNGNANLTWEIKGSAGMTVIAFSYIFTGIYGLTWAPTAWIYAAEVFP
FT                   LKFRAKGVGLSAATNWIFNFALAYFVAPAFHNIQWKTYIIFGVFCTVMTFHVFFMYPET
FT                   VGRSLEEIDLVFETDVKPWRTHKIGDIFGEEIERRKELGAKTETGGATHEEVV"
FT   exon            complement(408172..408549)
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT                   /number=1
FT   mat_peptide     complement(join(408175..408549,408598..408888,
FT                   408965..409678,409732..409807,409858..409868))
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT   intron          complement(408550..408597)
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT                   /number=1
FT   exon            complement(408598..408888)
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT                   /number=2
FT   intron          complement(408889..408964)
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT                   /number=2
FT   exon            complement(408965..409678)
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT                   /number=3
FT   intron          complement(409679..409731)
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT                   /number=3
FT   exon            complement(409732..409807)
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT                   /number=4
FT   intron          complement(409808..409857)
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT                   /number=4
FT   exon            complement(409858..409909)
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT                   /number=5
FT   sig_peptide     complement(join(409869..409909,409960..409984))
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(409910..409959)
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT                   /number=5
FT   exon            complement(409960..409984)
FT                   /gene="Pc20g01790"
FT                   /locus_tag="PCH_Pc20g01790"
FT                   /number=6
FT   mRNA            complement(join(<412030..412710,412766..413432,
FT                   413484..413857,413918..>414283))
FT                   /gene="Pc20g01800"
FT                   /locus_tag="PCH_Pc20g01800"
FT   CDS_pept        complement(join(412030..412710,412766..413432,
FT                   413484..413857,413918..414283))
FT                   /gene="Pc20g01800"
FT                   /locus_tag="PCH_Pc20g01800"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig42.tfa_690wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01800"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85509"
FT                   /db_xref="GOA:B6HE13"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR029320"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE13"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /inference="protein motif:PFAM:PF01756"
FT                   /inference="protein motif:COGS:COG1960"
FT                   /protein_id="CAP85509.1"
FT                   /translation="MPSPPPDWVKALKPSGPQGSELLHQERAQSNVDVERLSELLHTKE
FT                   TLERRASLLALLQPEKVFDKSQNHSLGRVERLQRSLAKAKRLQQLAEEHKWSMQELHAA
FT                   NDLIGEPTPYGLHASMFLVTLREQGTPEQHKLFLERAEKYEIIGCYAQTELGHGSNVRG
FT                   LETTATWNSNDKTFTINSPTLTASKWWIGSLGRTANHAVVMAQLFIDGKNYGPHPFVVQ
FT                   VRDLETHQPLDNVYVGDIGPKFGYNTMDNGFLLFNNVKIPHVNMLARFCQVDKETNQYA
FT                   KPAMPSLVFGTMTWVRANIVLDAGGVLARGVTIATRYCAVRRQFQDRDADPHAGETQVL
FT                   NYKMVQVRLLPLLASMYALHFTGRGMMRLYEENQSRMKAASSPDQESRGAGPEQLRAGA
FT                   NLLADLHATSCGLKALASTTAGEGLEICRRACGGHGYSSYSGIGPAYADYLPTLTWEGD
FT                   NYMLTQQVARYLLKSARAVLAGKPARNDTSQILQAYLDRRDKGASFDVLDEDKDIVAAF
FT                   GWRTAHLTFEALKHRDAEQRSWNSLLVDFWRLSTAHSQYLMVKNFYEAVSSPELSGALD
FT                   PETKGLMHQLFRLFSLHTLEREAAEFFSSGAVTVRQITLTRTTAVLKLLDDIRPHAVRL
FT                   VDAWAIPDWQLDSSLGRYDGKVYEDLFRRASEENPVNELVFDPYPWNSALLKNEPAKSK
FT                   L"
FT   exon            complement(412030..412710)
FT                   /gene="Pc20g01800"
FT                   /locus_tag="PCH_Pc20g01800"
FT                   /number=1
FT   intron          complement(412711..412765)
FT                   /gene="Pc20g01800"
FT                   /locus_tag="PCH_Pc20g01800"
FT                   /number=1
FT   exon            complement(412766..413432)
FT                   /gene="Pc20g01800"
FT                   /locus_tag="PCH_Pc20g01800"
FT                   /number=2
FT   intron          complement(413433..413483)
FT                   /gene="Pc20g01800"
FT                   /locus_tag="PCH_Pc20g01800"
FT                   /number=2
FT   exon            complement(413484..413857)
FT                   /gene="Pc20g01800"
FT                   /locus_tag="PCH_Pc20g01800"
FT                   /number=3
FT   intron          complement(413858..413917)
FT                   /gene="Pc20g01800"
FT                   /locus_tag="PCH_Pc20g01800"
FT                   /number=3
FT   exon            complement(413918..414283)
FT                   /gene="Pc20g01800"
FT                   /locus_tag="PCH_Pc20g01800"
FT                   /number=4
FT   mRNA            complement(join(<415010..415357,415405..415761,
FT                   415812..416213,416266..416280,416353..>416565))
FT                   /gene="Pc20g01810"
FT                   /locus_tag="PCH_Pc20g01810"
FT   CDS_pept        complement(join(415010..415357,415405..415761,
FT                   415812..416213,416266..416280,416353..416565))
FT                   /gene="Pc20g01810"
FT                   /locus_tag="PCH_Pc20g01810"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   B15I20.50 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01810"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85510"
FT                   /db_xref="GOA:B6HE14"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE14"
FT                   /inference="similar to AA sequence:PIR:T51035"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /inference="protein motif:COGS:COG2271"
FT                   /protein_id="CAP85510.1"
FT                   /translation="MATTCEIQSSRDTSFIALETLPHGQSDTDSRLGPESFPLLEKWNQ
FT                   PRINIHRTFATFWSFLVMGANDAAYGALIPYLESYYHLSYTIVSLVFLSPLVGYTVAAF
FT                   LNHRIHYTLGQRGVAIIGPACHLIAYVINCIHPPYPVLVVAFIFAGLGNGLEDAAWNAW
FT                   LGNMANANELLGVLHGIYGAGAVISPLVATSMIAKGGLPWYYFYYVMTGCAAIELVVSG
FT                   ACFWKSTAADFRASNVSSADNKKGGLRNALFKRPAARVTWLCALFLLGYVGVEVALGGW
FT                   IVTFMIRVRQGGAFASGMTATGFWLGITVGRVILGFVTPRVGEKVAISVYIVCSMAFAL
FT                   VLWLVPQFYVSAVAVSLQGFFLGPLFPGVVVMVTKLLPRHLHVTSIGFVAAFGGSGAAI
FT                   LPFAVGVLAQAKGVQVLQPFIVALSGAILLTWLGLPRVSKVRHNE"
FT   exon            complement(415010..415357)
FT                   /gene="Pc20g01810"
FT                   /locus_tag="PCH_Pc20g01810"
FT                   /number=1
FT   intron          complement(415358..415404)
FT                   /gene="Pc20g01810"
FT                   /locus_tag="PCH_Pc20g01810"
FT                   /number=1
FT   exon            complement(415405..415761)
FT                   /gene="Pc20g01810"
FT                   /locus_tag="PCH_Pc20g01810"
FT                   /number=2
FT   intron          complement(415762..415811)
FT                   /gene="Pc20g01810"
FT                   /locus_tag="PCH_Pc20g01810"
FT                   /number=2
FT   exon            complement(415812..416213)
FT                   /gene="Pc20g01810"
FT                   /locus_tag="PCH_Pc20g01810"
FT                   /number=3
FT   intron          complement(416214..416265)
FT                   /gene="Pc20g01810"
FT                   /locus_tag="PCH_Pc20g01810"
FT                   /number=3
FT   exon            complement(416266..416280)
FT                   /gene="Pc20g01810"
FT                   /locus_tag="PCH_Pc20g01810"
FT                   /number=4
FT   intron          complement(416281..416352)
FT                   /gene="Pc20g01810"
FT                   /locus_tag="PCH_Pc20g01810"
FT                   /number=4
FT   exon            complement(416353..416565)
FT                   /gene="Pc20g01810"
FT                   /locus_tag="PCH_Pc20g01810"
FT                   /number=5
FT   mRNA            join(<417257..417658,417723..418179,418228..418401,
FT                   418451..>418983)
FT                   /gene="Pc20g01820"
FT                   /locus_tag="PCH_Pc20g01820"
FT   CDS_pept        join(417257..417658,417723..418179,418228..418401,
FT                   418451..418983)
FT                   /gene="Pc20g01820"
FT                   /locus_tag="PCH_Pc20g01820"
FT                   /note="unknown EC_number=3.2.1.37"
FT                   /note="Title: strong similarity to xylan
FT                   1,4-beta-xylosidase xynB - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01820"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85511"
FT                   /db_xref="GOA:B6HE15"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE15"
FT                   /inference="similar to AA sequence:PIR:G69735"
FT                   /inference="protein motif:PFAM:PF04616"
FT                   /inference="protein motif:COGS:COG3507"
FT                   /inference="protein motif:COGS:COG3940"
FT                   /protein_id="CAP85511.1"
FT                   /translation="MSYVNPIIPGFNPDPSIVRVDRDFFLVTSSFEYFPGVPIYHSQDL
FT                   IQWKLIGHALTRPSQLQIHTPEPGGGVWATTIRYHGGAYYVIAASFQRYRPQQDDRVWP
FT                   QGFYVKTTDIWNEKTWSDPVYFDQVGFDQDLFWDDDGTVYLSSTYRKIQPTTGAKLKDF
FT                   AIHICTVDLATGHSTSVPKLIRESSSGVAEGSHIFKRGRYWYLFTAEGGTESGHCEWVN
FT                   RSEVSPLGPWELGPNNPLWRNGVDDEVQNTGHADLVEDTKGQWWAVVLGVRPSRRGDTW
FT                   EDSVLGRETFLVPLEWKDDWPVINGGQKISLNSHGPGLYEFHTPVSWRDEFLDSQMQVG
FT                   WYRKNTPFVTDYSLTERPNYLRLHGGPYNLSVPASPTMFLRKQTHHFCRWETRLSFEPT
FT                   AAETEAGTVVWLNYFTYSSIGIRKDGKGRFIRFRPSKGDTVERRLDTKTAVTLTVDCGT
FT                   EYRFGYREDTHSDVHWIGSVSNNAATAAPPVGANFTGMMLGLYAFGERQRCLAPADFAY
FT                   AEFR"
FT   exon            417257..417658
FT                   /gene="Pc20g01820"
FT                   /locus_tag="PCH_Pc20g01820"
FT                   /number=1
FT   intron          417659..417722
FT                   /gene="Pc20g01820"
FT                   /locus_tag="PCH_Pc20g01820"
FT                   /number=1
FT   exon            417723..418179
FT                   /gene="Pc20g01820"
FT                   /locus_tag="PCH_Pc20g01820"
FT                   /number=2
FT   intron          418180..418227
FT                   /gene="Pc20g01820"
FT                   /locus_tag="PCH_Pc20g01820"
FT                   /number=2
FT   exon            418228..418401
FT                   /gene="Pc20g01820"
FT                   /locus_tag="PCH_Pc20g01820"
FT                   /number=3
FT   intron          418402..418450
FT                   /gene="Pc20g01820"
FT                   /locus_tag="PCH_Pc20g01820"
FT                   /number=3
FT   exon            418451..418983
FT                   /gene="Pc20g01820"
FT                   /locus_tag="PCH_Pc20g01820"
FT                   /number=4
FT   mRNA            join(<419250..419385,419436..>420148)
FT                   /gene="Pc20g01830"
FT                   /locus_tag="PCH_Pc20g01830"
FT   CDS_pept        join(419250..419385,419436..420148)
FT                   /gene="Pc20g01830"
FT                   /locus_tag="PCH_Pc20g01830"
FT                   /note="Title: weak similarity to putative transcription
FT                   factor CAF32051.1 - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01830"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85512"
FT                   /db_xref="InterPro:IPR021833"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE16"
FT                   /inference="similar to AA sequence:TREMBLNEW:BX649606.79"
FT                   /protein_id="CAP85512.1"
FT                   /translation="MTENLKIDHLTPISDDAEQVTDDWSGLSDPTERRRRQNRINQRAY
FT                   RKRKRMSSNKDVHPKSLVPRPRSTSTVQSQDRSSQDNPEVSFCRNPELLQDILVRFAES
FT                   AYESYARGDPTADHLMTLTKVNVFRAFAQNLRLIGWLEFWMDDDAISLFNTVLPQRPPR
FT                   QDDNSLIPANLQPTRIQKSIRHHPWLDFFPFPKMRDNLIEAGDDWDDEQLCHDIMGFWG
FT                   ESTMDTGMLVWGEPWNAQNWEVTEPFLKKWQWVVRGCPELMDATNSWRARRGERLIFRY
FT                   I"
FT   exon            419250..419385
FT                   /gene="Pc20g01830"
FT                   /locus_tag="PCH_Pc20g01830"
FT                   /number=1
FT   intron          419386..419435
FT                   /gene="Pc20g01830"
FT                   /locus_tag="PCH_Pc20g01830"
FT                   /number=1
FT   exon            419436..420148
FT                   /gene="Pc20g01830"
FT                   /locus_tag="PCH_Pc20g01830"
FT                   /number=2
FT   mRNA            complement(join(<420597..420915,420974..421326,
FT                   421396..>421734))
FT                   /gene="Pc20g01840"
FT                   /locus_tag="PCH_Pc20g01840"
FT   CDS_pept        complement(join(420597..420915,420974..421326,
FT                   421396..421734))
FT                   /gene="Pc20g01840"
FT                   /locus_tag="PCH_Pc20g01840"
FT                   /note="unknown EC_number=2.5.1.1"
FT                   /note="unknown EC_number=2.5.1.10"
FT                   /note="unknown EC_number=2.5.1.29"
FT                   /note="Title: similarity to geranylgeranyl pyrophosphate
FT                   synthase GGPPS - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01840"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85513"
FT                   /db_xref="GOA:B6HE17"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE17"
FT                   /inference="similar to AA sequence:TREMBL:AB016043.1"
FT                   /inference="protein motif:COGS:COG0142"
FT                   /protein_id="CAP85513.1"
FT                   /translation="MSLFGSVFGFFLRGASPILGMVAVSSFLYLIVDHIHIPRWWDKKT
FT                   HLIGRKSPERITRHECPYDYLREIYGKHHWKAFVHKLSPALHNDDPAKYSMVLEIMDAI
FT                   HLCLMLVDDISDGSDYRKGRPAAHSIYGPSETGNRAYYRVTQILNKTTKDFPNLAPWLM
FT                   QDLQDILEGQDISLIWRRDGLSAFPIATAERLAAYRRMASLKTGSLFRLLGHIVLENDS
FT                   MDETLTTVAWHSQLQNDCKNVYSSEYAKLKGSVAEDLHNREMTYPIVLALDAPDGHLVT
FT                   GALEYPSPRNIRNAMRVIRGDYVRSICTNELRKSGASVKEWLELWGRKEKLDLKA"
FT   exon            complement(420597..420915)
FT                   /gene="Pc20g01840"
FT                   /locus_tag="PCH_Pc20g01840"
FT                   /number=1
FT   mat_peptide     complement(join(420600..420915,420974..421326,
FT                   421396..421674))
FT                   /gene="Pc20g01840"
FT                   /locus_tag="PCH_Pc20g01840"
FT   intron          complement(420916..420973)
FT                   /gene="Pc20g01840"
FT                   /locus_tag="PCH_Pc20g01840"
FT                   /number=1
FT   exon            complement(420974..421326)
FT                   /gene="Pc20g01840"
FT                   /locus_tag="PCH_Pc20g01840"
FT                   /number=2
FT   intron          complement(421327..421395)
FT                   /gene="Pc20g01840"
FT                   /locus_tag="PCH_Pc20g01840"
FT                   /number=2
FT   exon            complement(421396..421734)
FT                   /gene="Pc20g01840"
FT                   /locus_tag="PCH_Pc20g01840"
FT                   /number=3
FT   sig_peptide     complement(421675..421734)
FT                   /gene="Pc20g01840"
FT                   /locus_tag="PCH_Pc20g01840"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<422801..423102,423169..423370,423453..>424328)
FT                   /gene="Pc20g01850"
FT                   /locus_tag="PCH_Pc20g01850"
FT   CDS_pept        join(422801..423102,423169..423370,423453..424328)
FT                   /gene="Pc20g01850"
FT                   /locus_tag="PCH_Pc20g01850"
FT                   /note="unknown EC_number=1.-.-.-"
FT                   /note="Title: strong similarity to hypothetical
FT                   monooxygenase paxM - Penicillium paxilli"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01850"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85514"
FT                   /db_xref="GOA:B6HE18"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE18"
FT                   /inference="similar to AA sequence:TREMBL:AF279808.5"
FT                   /inference="protein motif:PFAM:PF01360"
FT                   /inference="protein motif:COGS:COG0654"
FT                   /inference="protein motif:COGS:COG0644"
FT                   /protein_id="CAP85514.1"
FT                   /translation="MTKMSKSEFQVIIVGGSIGGLTLAHCLQRAGIDHIVLEKASNPAP
FT                   QIGASVGIAPNGARVLDQLRLYDLVEEQIEPLNTATIHYPDGYSFETKFTKVIHERFGY
FT                   PIAFLDRQKLLEILYQGYPDHRKISLGERVIKVEKSGDVAIVSTAKGSVYRGHLVVGAD
FT                   GVHSKHSLVRMGTEHYAGLKAEFRCLFGISSAIKALIIGDQVNAFFDGFTIITIHGKGG
FT                   RVYWFVIQKLDKEYTYPHCPRYTAGDIETAAEELRTIVFYKDINFGQLWENRETVSMTV
FT                   LEEHTFDIWHHDRLVLLGDSAHKMTPNIGQGANMAIEDAASLANLLQRLRKGLDIWPPT
FT                   NGQVKILLEQYRSIRYGRVNSVYKSSRILARLHARDGLLKTLIGRYYVPYAGDLPAYVG
FT                   SKSIADGVMCDFLPPPKRSGDGWERYRTEDSNSGWVLQAIFCVLVFAMLFTYIDWEWVG
FT                   L"
FT   sig_peptide     422801..422872
FT                   /gene="Pc20g01850"
FT                   /locus_tag="PCH_Pc20g01850"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            422801..423102
FT                   /gene="Pc20g01850"
FT                   /locus_tag="PCH_Pc20g01850"
FT                   /number=1
FT   mat_peptide     join(422873..423102,423169..423370,423453..424325)
FT                   /gene="Pc20g01850"
FT                   /locus_tag="PCH_Pc20g01850"
FT   intron          423103..423168
FT                   /gene="Pc20g01850"
FT                   /locus_tag="PCH_Pc20g01850"
FT                   /number=1
FT   exon            423169..423370
FT                   /gene="Pc20g01850"
FT                   /locus_tag="PCH_Pc20g01850"
FT                   /number=2
FT   intron          423371..423452
FT                   /gene="Pc20g01850"
FT                   /locus_tag="PCH_Pc20g01850"
FT                   /number=2
FT   exon            423453..424328
FT                   /gene="Pc20g01850"
FT                   /locus_tag="PCH_Pc20g01850"
FT                   /number=3
FT   mRNA            join(<426313..426540,426597..426751,426801..427127,
FT                   427188..>427596)
FT                   /gene="Pc20g01860"
FT                   /locus_tag="PCH_Pc20g01860"
FT   CDS_pept        join(426313..426540,426597..426751,426801..427127,
FT                   427188..427596)
FT                   /gene="Pc20g01860"
FT                   /locus_tag="PCH_Pc20g01860"
FT                   /note="Title: strong similarity to geranylgeranyl
FT                   pyrophosphate synthase al-3 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01860"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85515"
FT                   /db_xref="GOA:B6HE19"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE19"
FT                   /inference="similar to AA sequence:PIR:S15662"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /inference="protein motif:COGS:COG0142"
FT                   /protein_id="CAP85515.1"
FT                   /translation="MLGLTAAKVFAFISQYIPRITIFTNNKPAASTYYHRRKDLKGFQI
FT                   LQAHTNHTQQNLTLSDGTDSGDCQITEPYEKIVSAPLEYLLCIPGKDIRGKLISAFNEW
FT                   LHLPDDKLAIVKEVIDRLHTASLLIDDIQDASRLRRGHPVAHDVFGVAQTINAANYAYF
FT                   LQQKRLNEINDPRAFHIFTQALLDLHIGQGMDLYWRDALVCPTEAEYTRMVMYKTGGLF
FT                   RLAVELMQIQSTTTTDLSRLVGLLGIIFQIRDDYMNLQSGIYAEKKGLMEDLTEGKFSY
FT                   PVIHSIRADPDNTQLINILKQRSEDRAVKVRAVQYMESTGSFQYCREVLSGLMEQARGH
FT                   VDELETLLGPNQEIHRILDLLQVDPPNVNPRP"
FT   exon            426313..426540
FT                   /gene="Pc20g01860"
FT                   /locus_tag="PCH_Pc20g01860"
FT                   /number=1
FT   intron          426541..426596
FT                   /gene="Pc20g01860"
FT                   /locus_tag="PCH_Pc20g01860"
FT                   /number=1
FT   exon            426597..426751
FT                   /gene="Pc20g01860"
FT                   /locus_tag="PCH_Pc20g01860"
FT                   /number=2
FT   intron          426752..426800
FT                   /gene="Pc20g01860"
FT                   /locus_tag="PCH_Pc20g01860"
FT                   /number=2
FT   exon            426801..427127
FT                   /gene="Pc20g01860"
FT                   /locus_tag="PCH_Pc20g01860"
FT                   /number=3
FT   intron          427128..427187
FT                   /gene="Pc20g01860"
FT                   /locus_tag="PCH_Pc20g01860"
FT                   /number=3
FT   exon            427188..427596
FT                   /gene="Pc20g01860"
FT                   /locus_tag="PCH_Pc20g01860"
FT                   /number=4
FT   mRNA            complement(<428385..>428834)
FT                   /gene="Pc20g01870"
FT                   /locus_tag="PCH_Pc20g01870"
FT   CDS_pept        complement(428385..428834)
FT                   /gene="Pc20g01870"
FT                   /locus_tag="PCH_Pc20g01870"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1490_3.tfa_160wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01870"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85516"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE20"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /inference="protein motif:COGS:COG0251"
FT                   /protein_id="CAP85516.1"
FT                   /translation="MGSGPAKTCFATSSPYEEKIGYYRAVRHGNQIFVSGTTSVDPYSP
FT                   TNAPHVLHPEDARQQTRVALEESIRAIQGLGGKGAEDIVRVKMFVSRHEDCEAVGRGFS
FT                   EILGKHNRGGSGMIGAAATMIVVNGGFINKEMLVEIEVDAVVEYI"
FT   exon            complement(428385..428834)
FT                   /gene="Pc20g01870"
FT                   /locus_tag="PCH_Pc20g01870"
FT                   /number=1
FT   mRNA            complement(<429477..>431018)
FT                   /gene="Pc20g01880"
FT                   /locus_tag="PCH_Pc20g01880"
FT   CDS_pept        complement(429477..431018)
FT                   /gene="Pc20g01880"
FT                   /locus_tag="PCH_Pc20g01880"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SC9B2.03 - Streptomyces coelicolor"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01880"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85517"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE21"
FT                   /inference="similar to AA sequence:PIR:T35899"
FT                   /inference="protein motif:COGS:COG5476"
FT                   /protein_id="CAP85517.1"
FT                   /translation="MSQRPVIAIAGLACETSTFSPARTLGRAFHPRRGPEIIEKYAFLH
FT                   NSTPLADVADWKGALIGHALPGGIVVRADFEQLSREILERLAAIVASNPIDGLWYDIHG
FT                   AMCVDGMEDVEAELLRRIRSVIGPNVLVSASMDLHGNVSRELAHQTDLITCYRMAPHED
FT                   ALETKERACRNLIDVLTSRTDTGCRRPLKAWVPIPILLPGEQTSTRDEPAKSLYSLVPE
FT                   IEAMENVLDAAIWVGYAWADEPRNHAVVMVTGWDKSAVTTGAKRLASLFWRVHKDFHFA
FT                   APTGSFSECIDNALASSNRPFFISDSGDNPTAGGSGDVTFGLNELLKRAEFAKETTRSV
FT                   IYASIPGPQAIDVITKAGVGTTVTVTAGAQVDNLHAGPVTMTGRIHSIRYGDPDAEIEA
FT                   VLQVGSVFTILTKFRKPYHHESDFVGLDLSPRVTNIVIVKIGYLEPELFNMAADWMIAL
FT                   TPGSVDQYLQRLGHHRILRPMWPFDKTFYRAPDLTPRLIPFSNEDLGAPQGLSLE"
FT   exon            complement(429477..431018)
FT                   /gene="Pc20g01880"
FT                   /locus_tag="PCH_Pc20g01880"
FT                   /number=1
FT   mat_peptide     complement(429480..430940)
FT                   /gene="Pc20g01880"
FT                   /locus_tag="PCH_Pc20g01880"
FT   sig_peptide     complement(430941..431018)
FT                   /gene="Pc20g01880"
FT                   /locus_tag="PCH_Pc20g01880"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<431397..431497,431619..>432312)
FT                   /gene="Pc20g01890"
FT                   /locus_tag="PCH_Pc20g01890"
FT   CDS_pept        join(431397..431497,431619..432312)
FT                   /gene="Pc20g01890"
FT                   /locus_tag="PCH_Pc20g01890"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   -Photorhabdus luminescens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01890"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85518"
FT                   /db_xref="GOA:B6HE22"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE22"
FT                   /inference="similar to AA sequence:GENPEPT:BX571866.42"
FT                   /inference="protein motif:PFAM:PF03932"
FT                   /inference="protein motif:COGS:COG3142"
FT                   /inference="protein motif:COGS:COG0157"
FT                   /protein_id="CAP85518.1"
FT                   /translation="MSQTAITQIPILEIACFNQESAVVAARAGADRIELCKDYHLGGLS
FT                   ADIEILQELKSQLTTPIYTMVRPHAEGFCYGESDFESMKRTLNSLKSCGADGFVFGILN
FT                   RSPQMSCDPNLPWVDVSRNKQLVQLAGGRPCTFHRAFDLIPESHWENALADIMECGFAS
FT                   ILTNGGPSGTKATESMDKLQTLVRYKTQLQREQKIRGNRVPEIIVGGGVRASNIGLLQS
FT                   ITGASAFHSAALVASKAVTSAKEVSDMKGGIAQAWEADKKAQ"
FT   exon            431397..431497
FT                   /gene="Pc20g01890"
FT                   /locus_tag="PCH_Pc20g01890"
FT                   /number=1
FT   intron          431498..431618
FT                   /gene="Pc20g01890"
FT                   /locus_tag="PCH_Pc20g01890"
FT                   /number=1
FT   exon            431619..432312
FT                   /gene="Pc20g01890"
FT                   /locus_tag="PCH_Pc20g01890"
FT                   /number=2
FT   mRNA            join(<433686..433794,433902..433972,434066..434302,
FT                   434357..434369,434425..435149,435198..>435641)
FT                   /gene="Pc20g01900"
FT                   /locus_tag="PCH_Pc20g01900"
FT   CDS_pept        join(433686..433794,433902..433972,434066..434302,
FT                   434357..434369,434425..435149,435198..435641)
FT                   /gene="Pc20g01900"
FT                   /locus_tag="PCH_Pc20g01900"
FT                   /note="Title: strong similarity to uracil transport protein
FT                   fur4p - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01900"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85519"
FT                   /db_xref="GOA:B6HE23"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE23"
FT                   /inference="similar to AA sequence:PIR:T43295"
FT                   /inference="protein motif:PFAM:PF02133"
FT                   /inference="protein motif:COGS:COG1953"
FT                   /protein_id="CAP85519.1"
FT                   /translation="MTLGGKLKFWLKKIQVPSEPGLSTAQLMLTNDDLRPVEPERRQWG
FT                   WLNFVAFWIADSLNVNTWMISSSMIVDGLSWWQSWLCVWIGYTVAAIFVYVLGRIATIY
FT                   RIPFAVANRASFGIWGSFWPIINRAAMAVIWYGVQSYLGGECVTLMIAAIWPSYNNLPN
FT                   TIPSSSGVTTKQFVSFFIFWLLSLPALWFPIYKVRHVFTAKAYFSPACAIAFFGWAIAR
FT                   AHGLGPIIDQPNKAQGSALAWAFVKSIMNCIANFAALVINNPDFTRYARDPKDALWPQL
FT                   ITIPVGFAVTSFIGIIVSSSSSVIFGEAVWNPLTLLGMFLKDASSAERFGIFVIGAGFA
FT                   LAQLGTNIAANSVSAGTNLTALLPRFCTIRRGGYLCAAIGLAMCPWTLVASSSKFTLYL
FT                   SAYSVFLSAIAGVMVSDYYLVRKGFLDIQALYSAERDGIYYGTFGVSWHGYAAYISGIL
FT                   VNIVGFAGAIGVNVPIGAMYIYNVNYFSGFIVSGAVYWALAWLVPIPGTSDTWNEIPYE
FT                   PHHMSDSDEKKVGDV"
FT   exon            433686..433794
FT                   /gene="Pc20g01900"
FT                   /locus_tag="PCH_Pc20g01900"
FT                   /number=1
FT   intron          433795..433901
FT                   /gene="Pc20g01900"
FT                   /locus_tag="PCH_Pc20g01900"
FT                   /number=1
FT   exon            433902..433972
FT                   /gene="Pc20g01900"
FT                   /locus_tag="PCH_Pc20g01900"
FT                   /number=2
FT   intron          433973..434065
FT                   /gene="Pc20g01900"
FT                   /locus_tag="PCH_Pc20g01900"
FT                   /number=2
FT   exon            434066..434302
FT                   /gene="Pc20g01900"
FT                   /locus_tag="PCH_Pc20g01900"
FT                   /number=3
FT   intron          434303..434356
FT                   /gene="Pc20g01900"
FT                   /locus_tag="PCH_Pc20g01900"
FT                   /number=3
FT   exon            434357..434369
FT                   /gene="Pc20g01900"
FT                   /locus_tag="PCH_Pc20g01900"
FT                   /number=4
FT   intron          434370..434424
FT                   /gene="Pc20g01900"
FT                   /locus_tag="PCH_Pc20g01900"
FT                   /number=4
FT   exon            434425..435149
FT                   /gene="Pc20g01900"
FT                   /locus_tag="PCH_Pc20g01900"
FT                   /number=5
FT   intron          435150..435197
FT                   /gene="Pc20g01900"
FT                   /locus_tag="PCH_Pc20g01900"
FT                   /number=5
FT   exon            435198..435641
FT                   /gene="Pc20g01900"
FT                   /locus_tag="PCH_Pc20g01900"
FT                   /number=6
FT   mRNA            complement(<436899..>437900)
FT                   /gene="Pc20g01910"
FT                   /locus_tag="PCH_Pc20g01910"
FT   CDS_pept        complement(436899..437900)
FT                   /gene="Pc20g01910"
FT                   /locus_tag="PCH_Pc20g01910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01910"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85520"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE24"
FT                   /protein_id="CAP85520.1"
FT                   /translation="MAESRGGPSNPKFSDLVPLLKGESNWEIWKQYMEIALNGIDPSYW
FT                   PLLIGQDKRPTNLPGMEDSEVDFEDAVTEIDDDTPAHPTAAFATQPTQPTTTKAAIAKR
FT                   KKAQQAWDQKNAIVLSYVASSLDATMLLYFRGGHTAALVYEELRSLYEGKIFFSIRNKV
FT                   TKWATWKYKAGTKPEEFVTEWRHLFTEMQVALPIEQRVSSLYAIYVFLHAVSNNTACQH
FT                   WLNTVSIHDDWSYDEILHNIFGVFIASEGRRIRNDGQLQKQQASANIASADNNKKKKKK
FT                   DNPKGEKEEDKQTKKQYCPFHKRETIHKPKDCFLNPKKKDKSESASMENLWC"
FT   exon            complement(436899..437900)
FT                   /gene="Pc20g01910"
FT                   /locus_tag="PCH_Pc20g01910"
FT                   /number=1
FT   mRNA            complement(join(<438866..439215,439304..439481,
FT                   439542..439861,439917..440457,440511..440870,
FT                   440924..441106,441158..>441277))
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT   CDS_pept        complement(join(438866..439215,439304..439481,
FT                   439542..439861,439917..440457,440511..440870,
FT                   440924..441106,441158..441277))
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /note="unknown EC_number=4.2.1.33"
FT                   /note="Title: strong similarity to 3-isopropylmalate
FT                   dehydratase leu1 - Rhizopus niveus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01920"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85521"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE25"
FT                   /inference="similar to AA sequence:SWISSPROT:LEU2_RHINI"
FT                   /inference="protein motif:PFAM:PF00330"
FT                   /inference="protein motif:PFAM:PF00694"
FT                   /inference="protein motif:COGS:COG1048"
FT                   /protein_id="CAP85521.1"
FT                   /translation="MTISEKIFAMHDLNHKGFVAPGDIIRVHVDWILASEVSWAGMETT
FT                   YNHLGKPGIFRNDRFWLCGDHVVDPRVNELPQVQALISGSERAKKTFKMTEYQGMNYTI
FT                   LHTEFYRERAQPGMLVVGSDSHTCSSGAVGCLAIGLGAADVALPLVTGETWFQVPETIN
FT                   IRLVGAPKPGIGGKDVILYILQVLKRNTIASDRIVEFTGPALRHLSPDTRFAVSNMTTE
FT                   LGGITGIFMPDDTTHNFINRRKLARHKCHTTYFRPDADAEYAAVHQIDLTHVGSFIARY
FT                   PNPDDVVPVTEEEGMELNGCFIGACTTTEEDLILGALVMEQAMKRGSKPTAKGKRKVVP
FT                   GSMPILYRLRKLRLCDIYEDAGFEIGIPGCSYCVGMSADQAAPGEVWISSQNRNFENRM
FT                   GKGSIGHLASAATVAASSFEMKLVDPSDLLAAIDLSRWRQLTTASTHSDATSPKSDLIY
FT                   VEPCGCDYHRAGAQTQKQIEKPRLDIHGRGQTKSLQGKVQRLGDFVNTDALAPAEFLIG
FT                   MKNNMDAGLRCLVHTHPKFRERAQQGFNIVVGGKGFGCGSSREQAVMALLGCGVQCVIA
FT                   KSFSFIFQRNMPSLGLLGITMEDESFFQVADDGVSISIDLNSRIIDVAGKTFGFKLSQM
FT                   ETEIFQFGGIASAFGVFGNKLLEAITPAKSPSGYKQEESEQPDKLLQW"
FT   exon            complement(438866..439215)
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /number=1
FT   intron          complement(439216..439303)
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /number=1
FT   exon            complement(439304..439481)
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /number=2
FT   intron          complement(439482..439541)
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /number=2
FT   exon            complement(439542..439861)
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /number=3
FT   intron          complement(439862..439916)
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /number=3
FT   exon            complement(439917..440457)
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /number=4
FT   intron          complement(440458..440510)
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /number=4
FT   exon            complement(440511..440870)
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /number=5
FT   intron          complement(440871..440923)
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /number=5
FT   exon            complement(440924..441106)
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /number=6
FT   intron          complement(441107..441157)
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /number=6
FT   exon            complement(441158..441277)
FT                   /gene="Pc20g01920"
FT                   /locus_tag="PCH_Pc20g01920"
FT                   /number=7
FT   mRNA            complement(join(<441622..441896,442017..442061,
FT                   442139..>442151))
FT                   /gene="Pc20g01930"
FT                   /locus_tag="PCH_Pc20g01930"
FT   CDS_pept        complement(join(441622..441896,442017..442061,
FT                   442139..442151))
FT                   /gene="Pc20g01930"
FT                   /locus_tag="PCH_Pc20g01930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01930"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85522"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE26"
FT                   /protein_id="CAP85522.1"
FT                   /translation="MSTPASTYIVIPEASGAQIGHVPSVLRYPLPRGGADRVSSASQQF
FT                   TVQPLYNLPGFIFKTCWPSSLLEQILEKYRPGTMAEGNPSTLNQLVQILAQTRGIHMDV
FT                   PNGKYV"
FT   exon            complement(441622..441896)
FT                   /gene="Pc20g01930"
FT                   /locus_tag="PCH_Pc20g01930"
FT                   /number=1
FT   intron          complement(441897..442016)
FT                   /gene="Pc20g01930"
FT                   /locus_tag="PCH_Pc20g01930"
FT                   /number=1
FT   exon            complement(442017..442061)
FT                   /gene="Pc20g01930"
FT                   /locus_tag="PCH_Pc20g01930"
FT                   /number=2
FT   intron          complement(442062..442138)
FT                   /gene="Pc20g01930"
FT                   /locus_tag="PCH_Pc20g01930"
FT                   /number=2
FT   exon            complement(442139..442151)
FT                   /gene="Pc20g01930"
FT                   /locus_tag="PCH_Pc20g01930"
FT                   /number=3
FT   mRNA            complement(join(<442505..443241,443288..443385,
FT                   443444..443508,443557..443768,443824..>443920))
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT   CDS_pept        complement(join(442505..443241,443288..443385,
FT                   443444..443508,443557..443768,443824..443920))
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT                   /note="Title: strong similarity to endo-beta-1,4-glucanase
FT                   A eglA - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01940"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85523"
FT                   /db_xref="GOA:B6HE68"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR035971"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE68"
FT                   /inference="similar to AA sequence:TREMBL:AB009402.1"
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /inference="protein motif:PFAM:PF00734"
FT                   /inference="protein motif:COGS:COG2730"
FT                   /inference="protein motif:COGS:COG2723"
FT                   /protein_id="CAP85523.1"
FT                   /translation="MRFISLLSIAGVTGLVLAAPGPSLSKRAGSFVWFGANEAGAEFGS
FT                   GNIPGELGTDYIWPSTSTIQTLRDAGMNLFRIPFAMERLVPGTLTSSMDATYLASLKST
FT                   VNYVTSSGGYAVIDPHNFGRYYGNIITSTSDFAAFWTALASEFASNDKVIFDTNNEFHS
FT                   QDQTLVLNLNQAAINAIRAAGAKSQYIFVEGNSWSGAWTWTTVNDNMKALTDPQDLIIY
FT                   EMHQYLDSDGSGTSETCVSSTIGRERVVAATQWLKDNGKRAFLGEFAGGANPVCQSAVT
FT                   GMLDYLQANSDVWVGASWWSAGPWWGNYMYSLELPSGVGYTYYMSLLRNYFPGSTGSGG
FT                   TTTAAPTSTPTVATATKTTTTGSSTTGAAHYAQCGGKSWTGATTCASPYACQKQSDYYS
FT                   QCL"
FT   exon            complement(442505..443241)
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT                   /number=1
FT   mat_peptide     complement(join(442508..443241,443288..443385,
FT                   443444..443508,443557..443768,443824..443866))
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT   intron          complement(443242..443287)
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT                   /number=1
FT   exon            complement(443288..443385)
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT                   /number=2
FT   intron          complement(443386..443443)
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT                   /number=2
FT   exon            complement(443444..443508)
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT                   /number=3
FT   intron          complement(443509..443556)
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT                   /number=3
FT   exon            complement(443557..443768)
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT                   /number=4
FT   intron          complement(443769..443823)
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT                   /number=4
FT   exon            complement(443824..443920)
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT                   /number=5
FT   sig_peptide     complement(443867..443920)
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<444481..444726,444801..444927,
FT                   445024..>445634))
FT                   /gene="Pc20g01950"
FT                   /locus_tag="PCH_Pc20g01950"
FT   CDS_pept        complement(join(444481..444726,444801..444927,
FT                   445024..445634))
FT                   /gene="Pc20g01950"
FT                   /locus_tag="PCH_Pc20g01950"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1492_0.tfa_3970wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01950"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85524"
FT                   /db_xref="GOA:B6HE69"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE69"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="CAP85524.1"
FT                   /translation="MTFTVAPHLNYFTIPLKDFVAARPEFEGFGVCAYIFSHADPAPRI
FT                   LLLQRALTDSMPGCWEGPGGACELDTDKTLFDSLVRETLEESGLHVSHILDLVAVDCWE
FT                   HHRRSGGKIRIAKYSFVVEVQEALGSSAGKQQAVPTLQIPVHLEPLEHQKFDWAVKEDV
FT                   LLSIRSPNGPYRFPLPLVGHQAPNILRAFELVEQRESRKECISHILRPSWCMWRYLVRY
FT                   LVYLEEAMQKPEHAPTSQATLISLCISGDFVGNLHLRRLQGSTVIPRQGNRYTVYIETY
FT                   RFPVNQAFRPPGMLCELLLMLLIMAGLVSVSIRAQFVHELVANSSR"
FT   exon            complement(444481..444726)
FT                   /gene="Pc20g01950"
FT                   /locus_tag="PCH_Pc20g01950"
FT                   /number=1
FT   intron          complement(444727..444800)
FT                   /gene="Pc20g01950"
FT                   /locus_tag="PCH_Pc20g01950"
FT                   /number=1
FT   exon            complement(444801..444927)
FT                   /gene="Pc20g01950"
FT                   /locus_tag="PCH_Pc20g01950"
FT                   /number=2
FT   intron          complement(444928..445023)
FT                   /gene="Pc20g01950"
FT                   /locus_tag="PCH_Pc20g01950"
FT                   /number=2
FT   exon            complement(445024..445634)
FT                   /gene="Pc20g01950"
FT                   /locus_tag="PCH_Pc20g01950"
FT                   /number=3
FT   mRNA            complement(<446073..>446936)
FT                   /gene="Pc20g01960"
FT                   /locus_tag="PCH_Pc20g01960"
FT   CDS_pept        complement(446073..446936)
FT                   /gene="Pc20g01960"
FT                   /locus_tag="PCH_Pc20g01960"
FT                   /note="unknown EC_number=3.5.1.10"
FT                   /note="Title: strong similarity to formyltetrahydrofolate
FT                   deformylase purU - Corynebacterium sp."
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01960"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85525"
FT                   /db_xref="GOA:B6HE70"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE70"
FT                   /inference="similar to AA sequence:PIR:I40891"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /inference="protein motif:PFAM:PF00551"
FT                   /inference="protein motif:COGS:COG0788"
FT                   /protein_id="CAP85525.1"
FT                   /translation="MAASFILTLSGPDRPGIVHAVTAFLVQNNLNIIDSSQFGDPTSQR
FT                   FFMRTQFATANGEDETPELEKLRTAFEPTAQSFSLNFEINPSVKKPRVLIMVSKIGHCL
FT                   NDLLFRQSTGQLSIEVPLIVSNHPDFATLAATYNIPFHHLPVTADTKAQQEAQILELVS
FT                   QHNIDLIVLARYMQVLSPTLCSAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGAT
FT                   AHFVTSDLDEGPIIEQNVVRVNHGMSPKELTHAGSNVESNVLATAVKYVTERRVILNGH
FT                   KTVVFN"
FT   exon            complement(446073..446936)
FT                   /gene="Pc20g01960"
FT                   /locus_tag="PCH_Pc20g01960"
FT                   /number=1
FT   mat_peptide     complement(446076..446876)
FT                   /gene="Pc20g01960"
FT                   /locus_tag="PCH_Pc20g01960"
FT   sig_peptide     complement(446877..446936)
FT                   /gene="Pc20g01960"
FT                   /locus_tag="PCH_Pc20g01960"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            <448041..>449630
FT                   /gene="Pc20g01970"
FT                   /locus_tag="PCH_Pc20g01970"
FT   CDS_pept        448041..449630
FT                   /gene="Pc20g01970"
FT                   /locus_tag="PCH_Pc20g01970"
FT                   /note="unknown EC_number=3.2.1.91"
FT                   /note="Title: strong similarity to 1,4-beta-D-glucan
FT                   cellobiohydrolase B precursor cbhB - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01970"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85526"
FT                   /db_xref="GOA:B6HE71"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR001722"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR035971"
FT                   /db_xref="InterPro:IPR037019"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE71"
FT                   /inference="similar to AA sequence:TREMBL:AF156269.1"
FT                   /inference="protein motif:PFAM:PF00840"
FT                   /inference="protein motif:PFAM:PF00734"
FT                   /protein_id="CAP85526.1"
FT                   /translation="MASALSFKIYKNALLLAAFLGAAQAQQVGTSTAEVHPSLTWQKCT
FT                   AGGSCTSQSGKVVIDSNWRWVHNTGGYTNCYTGNDWDRTLCPDDVTCATNCALDGADYK
FT                   GTYGVTASGSSLRLNFVTQASQKNIGSRLYLMADDSKYEMFQLLNQEFTFDVDVSNLPC
FT                   GLNGALYFVAMDEDGGMARYPTNKAGAKYGTGYCDAQCPRDLKFINGQANVEGWEPSSS
FT                   DVNGGTGSYGSCCAEMDIWEANSISTAFTPHPCDDPAQTRCTGDSCGGTYSSDRYGGTC
FT                   DPDGCDFNPYRMGNQSFYGPSKIVDTESPFTVVTQFITNDGTSTGTLSEIKRFYVQNGK
FT                   VIPQSVSTISAVTGNSITDSFCSAQKTAFKDTDVFAKHGGMAGMGAGLAEGMVLVMSLW
FT                   DDHAANMLWLDSTYPTSASSTTPGAARGSCDISSGEPSDVEANHPNAYVVYSNIKVGPL
FT                   GSTFGSTDSGSGTTTTKVTTTTATKTTTTTGPSTTGAAHYAQCGGQNWTGPTTCASPYT
FT                   CQKQGDYYSQCL"
FT   sig_peptide     448041..448115
FT                   /gene="Pc20g01970"
FT                   /locus_tag="PCH_Pc20g01970"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            448041..449630
FT                   /gene="Pc20g01970"
FT                   /locus_tag="PCH_Pc20g01970"
FT                   /number=1
FT   mat_peptide     448116..449627
FT                   /gene="Pc20g01970"
FT                   /locus_tag="PCH_Pc20g01970"
FT   mRNA            complement(join(<450033..450084,450140..450215,
FT                   450271..450387,450442..450616,450669..451553,
FT                   451604..>452113))
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT   CDS_pept        complement(join(450033..450084,450140..450215,
FT                   450271..450387,450442..450616,450669..451553,
FT                   451604..452113))
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT                   /note="unknown EC_number=1.14.13.7"
FT                   /note="Title: strong similarity to phenol 2-monooxygenase
FT                   -Trichosporon beigelii"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01980"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85527"
FT                   /db_xref="GOA:B6HE72"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038220"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE72"
FT                   /inference="similar to AA sequence:PIR:A47012"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /inference="protein motif:PFAM:PF01360"
FT                   /inference="protein motif:COGS:COG0644"
FT                   /inference="protein motif:COGS:COG0654"
FT                   /protein_id="CAP85527.1"
FT                   /translation="MEQVDVLICGSGSAGLCAATWLAKYGVRCKVLERRGGPMKMGQAD
FT                   GVQCRTVEIFESFGIGEELLREAYHVLEVNFWADNGTGAIKRTGRTADTQPGLSHQPHV
FT                   ILNQARINGLLIELMQKYNDQQIDYGYNVTDVKVDSTSAEDHDTYPVKVTAEKDGKTER
FT                   FAAKYALACDGAHSIVRKALGYKMIGDSSDAVWGVMDMVPRTNFPDIRKKSTIRSKSGN
FT                   ILIIPREGDSDNLTRFYIELAPGTNPKEVTLENLQAQAQSIFRPYRVDFVETVWWSAYA
FT                   IGQRHADFFHKDYRVFLAGDACHTHSPKAGQGMNVSLQDGYNIGWKLGEVLTGLATPSL
FT                   LETYVLERQKVAIDLITFDRYFSKLFSSGATTSPAEFQEGFIKSGKYTAGLTAKYEASP
FT                   ITSALASTNLASNVAVGMRLPSAQVVRFCDSKPLHLMKSLKSDGRWRIMAFIGDLTVLE
FT                   NRSKLNKLGDYLSAADGPIQTFTPKDQDIDSLIETIIIGHGKRHDVELEQIPECFYPVS
FT                   GKNQTRDLHKIYYDDESYNDGHGHAYEYLGIDPAQGALIIVRPDQYVSAVMGLGDHSEI
FT                   GKFFAGFLKRQTENDSSWQTSSPVGSRL"
FT   exon            complement(450033..450084)
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT                   /number=1
FT   intron          complement(450085..450139)
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT                   /number=1
FT   exon            complement(450140..450215)
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT                   /number=2
FT   intron          complement(450216..450270)
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT                   /number=2
FT   exon            complement(450271..450387)
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT                   /number=3
FT   intron          complement(450388..450441)
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT                   /number=3
FT   exon            complement(450442..450616)
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT                   /number=4
FT   intron          complement(450617..450668)
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT                   /number=4
FT   exon            complement(450669..451553)
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT                   /number=5
FT   intron          complement(451554..451603)
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT                   /number=5
FT   exon            complement(451604..452113)
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT                   /number=6
FT   mRNA            complement(join(<452537..452826,452887..453218,
FT                   453274..453661,453715..>453868))
FT                   /gene="Pc20g01990"
FT                   /locus_tag="PCH_Pc20g01990"
FT   CDS_pept        complement(join(452537..452826,452887..453218,
FT                   453274..453661,453715..453868))
FT                   /exception="reasons given in citation"
FT                   /gene="Pc20g01990"
FT                   /locus_tag="PCH_Pc20g01990"
FT                   /note="putative sequencing error"
FT                   /note="unknown EC_number=3.1.3.16"
FT                   /note="Title: strong similarity to cell shape control
FT                   protein phosphatase ppe1p - Schizosaccharomyces pombe
FT                   [putative sequencing error]"
FT                   /db_xref="GOA:B6HE73"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR041577"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE73"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /inference="protein motif:COGS:COG0639"
FT                   /protein_id="CAP85528.1"
FT                   /translation="GKYEXLTIPFRLYNTLATFXILINKTLXLFLGRIVVIYLDDILVF
FT                   LDTEDKYYKHLEEVLKCLRKXKLYAKPKKCILITIELEFYSYIISNREVRLLPEKLEAI
FT                   IGXLRLININEVRRFIRLVLYYRRFIYSFSEIAAPLYNLTKEANKELYKKRFRPINXIE
FT                   XCEVTFRRLKEVLISAPILIXLDXAKPFIIETDTLEXAISFVLGXEAKDRKVYLIAFDS
FT                   RKLRAAELNYLVYKKELLVIKEALRIXDRYLENGTTTTIIIDYKGLXYLTTI"
FT   exon            complement(452537..452826)
FT                   /gene="Pc20g01990"
FT                   /locus_tag="PCH_Pc20g01990"
FT                   /number=1
FT   intron          complement(452827..452886)
FT                   /gene="Pc20g01990"
FT                   /locus_tag="PCH_Pc20g01990"
FT                   /number=1
FT   exon            complement(452887..453218)
FT                   /gene="Pc20g01990"
FT                   /locus_tag="PCH_Pc20g01990"
FT                   /number=2
FT   intron          complement(453219..453273)
FT                   /gene="Pc20g01990"
FT                   /locus_tag="PCH_Pc20g01990"
FT                   /number=2
FT   exon            complement(453274..453661)
FT                   /gene="Pc20g01990"
FT                   /locus_tag="PCH_Pc20g01990"
FT                   /number=3
FT   intron          complement(453662..453714)
FT                   /gene="Pc20g01990"
FT                   /locus_tag="PCH_Pc20g01990"
FT                   /number=3
FT   exon            complement(453715..453868)
FT                   /gene="Pc20g01990"
FT                   /locus_tag="PCH_Pc20g01990"
FT                   /number=4
FT   mRNA            complement(<454443..>456104)
FT                   /gene="Pc20g02000"
FT                   /locus_tag="PCH_Pc20g02000"
FT   CDS_pept        complement(454443..456104)
FT                   /gene="Pc20g02000"
FT                   /locus_tag="PCH_Pc20g02000"
FT                   /note="unknown EC_number=3.1.1.24"
FT                   /note="Title: strong similarity to 3-oxoadipate
FT                   enol-lactone hydrolase catD - Pseudomonas sp."
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02000"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85529"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE74"
FT                   /inference="similar to AA sequence:TREMBL:AY044272.5"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /inference="protein motif:COGS:COG0596"
FT                   /protein_id="CAP85529.1"
FT                   /translation="MPTPGLLYVTMQPKGSLPDTQFHDWYNTEHGPLRLRLPFVTNGFR
FT                   FRATDGEQPEYVALYDITDMDELTRKTYLDLRTDLIKTEREKKTMAQIDVGRLLYDLVD
FT                   ERTSQNFRPLEDQADTDAETRGSVLIAVRVATHPDPAKQAELDKWYREEHFEMLSRVPG
FT                   WRRSRRFVTAAIDPAAPRESLALHEYAPVNGLGGDAHKAAMNTPWGARLMSEVVTSKKR
FT                   RVYEWYYTFGPAPRELTALAAPDVVGPWNSNDGRTRTFPSTTRPAVESFVTTSDGVEIP
FT                   YRLEGSTDPYAPVVVLSNSILVNWNIWDRFVDAFFAHQQNQRYRVVRYLTRGRHSQSGE
FT                   QPVNIDLLASDLATLLEALRVPPKAARLIGVSLGGVTVLNTALLHPERIGAFIACDTNS
FT                   SAPESNRKAWGDRVAICEKEGSTDPDTNEPIVGEELAELTTRRWFVPESYQTQPEVLAP
FT                   VKEAVRTNSLKGFAHSVQALCAYDIRERMAAATVPGLFVAGANDGVLPQTMQKMAADLR
FT                   GGADLKIIDRAGHLPMVEQPVAFAEVVTEFLSKIDG"
FT   exon            complement(454443..456104)
FT                   /gene="Pc20g02000"
FT                   /locus_tag="PCH_Pc20g02000"
FT                   /number=1
FT   mRNA            complement(join(<456392..456747,456800..457273,
FT                   457333..>457585))
FT                   /gene="Pc20g02010"
FT                   /locus_tag="PCH_Pc20g02010"
FT   CDS_pept        complement(join(456392..456747,456800..457273,
FT                   457333..457585))
FT                   /gene="Pc20g02010"
FT                   /locus_tag="PCH_Pc20g02010"
FT                   /note="unknown EC_number=5.5.1.5"
FT                   /note="Title: strong similarity to carboxy-cis,cis-muconate
FT                   cyclase CMLE - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85530"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE75"
FT                   /inference="similar to AA sequence:SWISSPROT:CCCM_NEUCR"
FT                   /inference="protein motif:COGS:COG2706"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP85530.1"
FT                   /translation="MKHHLMVGTWTAPGRIYTVQFDDDALTLELVKKTEIPEAEPISWM
FT                   TFSHDKKAIYGAAMKKWNSFAVNSPTEIVHQVSHPVAGHPLAPSSETNTRAIFVLAAHK
FT                   PPYNVYGNPFYNHAGYGNVFSVKPDGGLDRNIQNYEYLPNTGIHGMVFDPTETYLYSAD
FT                   LTANKIWTHIKDPKTGELALVDCLDAPDAGDHPRWVEMHPSGKYLYALMEAGNRLAVYV
FT                   IDERTHKPVFTHITYPLLPSGLPPRNKYRGDVTFCTKGGEYLFATTRSNHFDVTGYITA
FT                   FKLGPHGEIERQLFINPTSTSGGHSNAVSPCDFSDEWLALCDDQLGFVEMYRWRDEKLA
FT                   RVARVDIPEQGFGMNAIWYD"
FT   exon            complement(456392..456747)
FT                   /gene="Pc20g02010"
FT                   /locus_tag="PCH_Pc20g02010"
FT                   /number=1
FT   intron          complement(456748..456799)
FT                   /gene="Pc20g02010"
FT                   /locus_tag="PCH_Pc20g02010"
FT                   /number=1
FT   exon            complement(456800..457273)
FT                   /gene="Pc20g02010"
FT                   /locus_tag="PCH_Pc20g02010"
FT                   /number=2
FT   intron          complement(457274..457332)
FT                   /gene="Pc20g02010"
FT                   /locus_tag="PCH_Pc20g02010"
FT                   /number=2
FT   exon            complement(457333..457585)
FT                   /gene="Pc20g02010"
FT                   /locus_tag="PCH_Pc20g02010"
FT                   /number=3
FT   mRNA            <458144..>458902
FT                   /gene="Pc20g02020"
FT                   /locus_tag="PCH_Pc20g02020"
FT   CDS_pept        458144..458902
FT                   /gene="Pc20g02020"
FT                   /locus_tag="PCH_Pc20g02020"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg01347.1 - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85531"
FT                   /db_xref="GOA:B6HE76"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE76"
FT                   /inference="protein motif:COGS:COG2128"
FT                   /protein_id="CAP85531.1"
FT                   /translation="MSPTVKVPLRRTWLGNTYIRNWTLMYVIQRRLTIKNTFKSLGINH
FT                   TRTMRLPYAPSTPPVDAPPDTADIYARIAERRNPRPLIPLDLSLLHSPPVADGWNSFIG
FT                   AIRSRTLVDSGVMELAVCRVAVLNNAVYEWNAHAPLALKGGIKPDQLQAALTLPCTAEG
FT                   DIAGLESSALTPQQRAVLRYTDQMTRTIRVDDTVFAELKTVGYDDREIVELTTGIAGYN
FT                   CVSRFLVALDVGENNAREMKSVDEVVATLQ"
FT   exon            458144..458902
FT                   /gene="Pc20g02020"
FT                   /locus_tag="PCH_Pc20g02020"
FT                   /number=1
FT   mRNA            complement(join(<459153..459593,459645..459954,
FT                   460007..460179,460231..460492,460552..460993,
FT                   461045..>461084))
FT                   /gene="Pc20g02030"
FT                   /locus_tag="PCH_Pc20g02030"
FT   CDS_pept        complement(join(459153..459593,459645..459954,
FT                   460007..460179,460231..460492,460552..460993,
FT                   461045..461084))
FT                   /gene="Pc20g02030"
FT                   /locus_tag="PCH_Pc20g02030"
FT                   /note="Title: similarity to transcription activator of
FT                   lysine pathway Lys14 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85532"
FT                   /db_xref="GOA:B6HE77"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE77"
FT                   /inference="similar to AA sequence:PIR:S61580"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /protein_id="CAP85532.1"
FT                   /translation="MQGFGRNGPRSKSGCSTCRRRKVKCGEEKPVCARCSSLRLNCEWG
FT                   VPVKRGRSTQIRHLEPAPETSEQPSWPTPKAEDLVGFQPDALFASPSPVSWASDALPFD
FT                   TFNPVPIPTPICPSLNVNVACANSLTLTSLDRQYFQYFPSSSLVFYYMKRWKWSSLCHL
FT                   YEGPAASNRIIMRMILALSACDMHRNGLIVRSQDHGRYHYSQAVKEFRQLLETPRQVSL
FT                   DDVGTVFATVFLMIAWEWQFGNSVRHLQLHLQGVRSLLETHPQLFRIKDVNDMFCSPGV
FT                   NTLASDSGTMAKVSFIPEQLLLWILYIDASCRPIGLTDSLNDYVAQTGNPALQPDHLYR
FT                   CARLWGRCFWGEQYPDEEVLDDIENYRALELLHVGFCLRHRTWQVLVESAAGTAESAEA
FT                   LFREILATRETFSDLFITARFAGSVSARRTLNTIYMAVSTFYGQVLLHRRLLCVDSLPL
FT                   GIHQQATAGIIDICQKQFLSDPRLLRRLHWPLLMAAIETNDITHQSWLRQRLWELRDFH
FT                   SEFIWAHDVAEQVLALQDVGQGRYINLADFLLKRFHAR"
FT   exon            complement(459153..459593)
FT                   /gene="Pc20g02030"
FT                   /locus_tag="PCH_Pc20g02030"
FT                   /number=1
FT   intron          complement(459594..459644)
FT                   /gene="Pc20g02030"
FT                   /locus_tag="PCH_Pc20g02030"
FT                   /number=1
FT   exon            complement(459645..459954)
FT                   /gene="Pc20g02030"
FT                   /locus_tag="PCH_Pc20g02030"
FT                   /number=2
FT   intron          complement(459955..460006)
FT                   /gene="Pc20g02030"
FT                   /locus_tag="PCH_Pc20g02030"
FT                   /number=2
FT   exon            complement(460007..460179)
FT                   /gene="Pc20g02030"
FT                   /locus_tag="PCH_Pc20g02030"
FT                   /number=3
FT   intron          complement(460180..460230)
FT                   /gene="Pc20g02030"
FT                   /locus_tag="PCH_Pc20g02030"
FT                   /number=3
FT   exon            complement(460231..460492)
FT                   /gene="Pc20g02030"
FT                   /locus_tag="PCH_Pc20g02030"
FT                   /number=4
FT   intron          complement(460493..460551)
FT                   /gene="Pc20g02030"
FT                   /locus_tag="PCH_Pc20g02030"
FT                   /number=4
FT   exon            complement(460552..460993)
FT                   /gene="Pc20g02030"
FT                   /locus_tag="PCH_Pc20g02030"
FT                   /number=5
FT   intron          complement(460994..461044)
FT                   /gene="Pc20g02030"
FT                   /locus_tag="PCH_Pc20g02030"
FT                   /number=5
FT   exon            complement(461045..461084)
FT                   /gene="Pc20g02030"
FT                   /locus_tag="PCH_Pc20g02030"
FT                   /number=6
FT   mRNA            complement(join(<461387..461622,461685..461812,
FT                   461873..462176,462240..462328,462385..462767,
FT                   462827..>462922))
FT                   /gene="Pc20g02040"
FT                   /locus_tag="PCH_Pc20g02040"
FT   CDS_pept        complement(join(461387..461622,461685..461812,
FT                   461873..462176,462240..462328,462385..462767,
FT                   462827..462922))
FT                   /gene="Pc20g02040"
FT                   /locus_tag="PCH_Pc20g02040"
FT                   /note="Title: strong similarity to methicillin resistance
FT                   gene HmrA - Staphylococcus aureus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85533"
FT                   /db_xref="GOA:B6HE78"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE78"
FT                   /inference="similar to AA sequence:TREMBL:AP004829.111"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /inference="protein motif:COGS:COG1473"
FT                   /protein_id="CAP85533.1"
FT                   /translation="MTLTTINIEEVKTSVDAALEALQQDLRELNHRIWSNPELAYEEHR
FT                   AHDTICDFLEGQGFTVTRHAYGLETSFEVLSGTGGRLVNFNAEYDALPGIGHACGHNLI
FT                   ATSSIAAFLALSFAISKFNIPGRAQLLGTPAEENGGGKAKLIDAGAYKNVDISLMAHPG
FT                   PKKIYPDQEPSDGIAGTPMNARKNIHCEFTGRNAHAGGNPWEGINALDALVSSYNNVAV
FT                   LRQQLLPDQRVHCAFLDTPKVANVIPDYTKAFWQVRSPTLKGLNALVGKLRNCIEAGAL
FT                   ATGCQVKIEENELYTDVRLNDTLCERYQVHMGRYSRNVLKRHDKVLTGSSDIGNVSYET
FT                   PTLHTMFAIPAPATSFPHHPTFAAAAGTDEAHAEALIVGKSLALIGWDMIVENDMYDLA
FT                   RRQWKDEIVREE"
FT   exon            complement(461387..461622)
FT                   /gene="Pc20g02040"
FT                   /locus_tag="PCH_Pc20g02040"
FT                   /number=1
FT   intron          complement(461623..461684)
FT                   /gene="Pc20g02040"
FT                   /locus_tag="PCH_Pc20g02040"
FT                   /number=1
FT   exon            complement(461685..461812)
FT                   /gene="Pc20g02040"
FT                   /locus_tag="PCH_Pc20g02040"
FT                   /number=2
FT   intron          complement(461813..461872)
FT                   /gene="Pc20g02040"
FT                   /locus_tag="PCH_Pc20g02040"
FT                   /number=2
FT   exon            complement(461873..462176)
FT                   /gene="Pc20g02040"
FT                   /locus_tag="PCH_Pc20g02040"
FT                   /number=3
FT   intron          complement(462177..462239)
FT                   /gene="Pc20g02040"
FT                   /locus_tag="PCH_Pc20g02040"
FT                   /number=3
FT   exon            complement(462240..462328)
FT                   /gene="Pc20g02040"
FT                   /locus_tag="PCH_Pc20g02040"
FT                   /number=4
FT   intron          complement(462329..462384)
FT                   /gene="Pc20g02040"
FT                   /locus_tag="PCH_Pc20g02040"
FT                   /number=4
FT   exon            complement(462385..462767)
FT                   /gene="Pc20g02040"
FT                   /locus_tag="PCH_Pc20g02040"
FT                   /number=5
FT   intron          complement(462768..462826)
FT                   /gene="Pc20g02040"
FT                   /locus_tag="PCH_Pc20g02040"
FT                   /number=5
FT   exon            complement(462827..462922)
FT                   /gene="Pc20g02040"
FT                   /locus_tag="PCH_Pc20g02040"
FT                   /number=6
FT   mRNA            join(<464643..465029,465165..>466592)
FT                   /gene="Pc20g02050"
FT                   /locus_tag="PCH_Pc20g02050"
FT   CDS_pept        join(464643..465029,465165..466592)
FT                   /gene="Pc20g02050"
FT                   /locus_tag="PCH_Pc20g02050"
FT                   /note="Title: similarity to hypothetical exonuclease
FT                   -Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85534"
FT                   /db_xref="GOA:B6HE79"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE79"
FT                   /inference="similar to AA sequence:PIR:T39001"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /inference="protein motif:COGS:COG2176"
FT                   /inference="protein motif:COGS:COG0847"
FT                   /protein_id="CAP85534.1"
FT                   /translation="MDRKSEYHRGDLQALEHVEYPCPVCKDRMYETEQGFTDHLRNDHQ
FT                   IFSCSKCEKIFAAADELLRHKVEAGHTVPPKTKRKAKSRSPVKSCERARQLPKSPMHLS
FT                   TQETTASKGNDTDRRAQETPATPSTEVTIAPHQAVSLRVRMRSTLPTERDFIFNTSIDH
FT                   VDIACQLVDAGFTTLHAYNTSNATQTILRRAKIGYLEEADYTTAYEAEPNASALCFPPR
FT                   RYDTSHPRPVVIPDIPEHAPKQTKLPNGVTVYGDPDTVAKLAQVVNEFDIWARPGRKPG
FT                   LVNIPKERWMRLRLKPGVTLPRTQVYKLAPRAQNLLDTTFDKLHDEGKMSWATTGCHSL
FT                   ARLHCQGYTTPKTIRTAACTKRGEPHQAHTFTGGSAHRKAIVIACEMIETTVSTSVLAF
FT                   ITAIDFLTGEVLINSYVAPTAPVTNWLTPVTGITPEAMEAAIADGKAFLSNDAVRRALD
FT                   KFLDKDTVVIGHAIQHDLRALNLLHGRIVDISVVTAEAVFSNFSSKTTLPRIWELKTLA
FT                   KELRGIDIQPGLAHNPLEDAVATREVLIWCLRGPECLKAWAEKARSSYERVRLQRGENK
FT                   KGTKNVEKKAGGETVPSAKAQGKKRFSK"
FT   exon            464643..465029
FT                   /gene="Pc20g02050"
FT                   /locus_tag="PCH_Pc20g02050"
FT                   /number=1
FT   intron          465030..465164
FT                   /gene="Pc20g02050"
FT                   /locus_tag="PCH_Pc20g02050"
FT                   /number=1
FT   exon            465165..466592
FT                   /gene="Pc20g02050"
FT                   /locus_tag="PCH_Pc20g02050"
FT                   /number=2
FT   mRNA            complement(join(<467201..469659,469816..>469891))
FT                   /gene="Pc20g02060"
FT                   /locus_tag="PCH_Pc20g02060"
FT   CDS_pept        complement(join(467201..469659,469816..469891))
FT                   /gene="Pc20g02060"
FT                   /locus_tag="PCH_Pc20g02060"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An02g13370 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85535"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE80"
FT                   /protein_id="CAP85535.1"
FT                   /translation="MGCSSSCGKPQPSQLTSHLALRPVSPESVTQTLTLSSNPRFHQPF
FT                   LEVPRHTPKVFDEAHDSYDPSTLTTFARQRSPTVERPSTSADHQLRPPSASGSQRPLRR
FT                   IPRQTEVRQSLRRESLRAPVPHPNRPQPPRTTPVSVQVQHAPASGIAELRPALSEAATD
FT                   DNGSTIDDPYQLLNTSYWPQRTTRVSTRTASAILFALEEAIRGPLQLSTDWDEVNASMS
FT                   DMVGVAGPAGPVGNSRVQNGGARVPQNPISGTSQPPSGMRTPTDIMRQRRDREARRKAE
FT                   HEAREREQEELERQQLEQEQLAQAEAQAQTQAQAQAQQYAGVAADNTSQPRTRVPRPSR
FT                   GPEGQAPTVPVTSSGYRPAADAAPSTRPSEHQTAPLTATTGPMPNQSRLAQATGQQPQH
FT                   GRSQSAAENGGQPKPSAFSKSAQALPAGQPGAPQALQQPKRVGFPHAFERWETLSSHWE
FT                   GLTGYWMRKLEQNNEDLERDPLSQQLARQITDLSAAGANLFHAVVELQRLRASSERKFQ
FT                   RWFFDTRAEQERSKEVQADLNRQLKEERQGRADAFSAAQEAEKDKVKAEGLLKEMRREL
FT                   QISKEEARRAWEELGRREQEERDRTNSLRNGEPTLVGGVQVVPMVSGLPSRQNTTRPQT
FT                   RDGAYPGGQAATSMGTDAYGKSAGSTGGQYYEDGTPMSPTGSDPFIEPKKVDPPTSKAP
FT                   YPGPLYEHENPTVPYPGPATSEPDARSYVGSSEAGDEEYAHYSQDPHGNTFSYPPGPPS
FT                   EGSEEYDQSLQEGHYMPDGAYTSAASTIPPPAPASAADYTGAGWGPGTGWESVTPRHRH
FT                   PTRLSDVLEEDEPSRTNPSRATSRSQASRSIL"
FT   exon            complement(467201..469659)
FT                   /gene="Pc20g02060"
FT                   /locus_tag="PCH_Pc20g02060"
FT                   /number=1
FT   intron          complement(469660..469815)
FT                   /gene="Pc20g02060"
FT                   /locus_tag="PCH_Pc20g02060"
FT                   /number=1
FT   exon            complement(469816..469891)
FT                   /gene="Pc20g02060"
FT                   /locus_tag="PCH_Pc20g02060"
FT                   /number=2
FT   mRNA            join(<470882..471043,471178..471343,471473..471534,
FT                   471623..471669,471716..471735,471765..472065,
FT                   472164..>472230)
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT   CDS_pept        join(470882..471043,471178..471343,471473..471534,
FT                   471623..471669,471716..471735,471765..472065,
FT                   472164..472230)
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85536"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE81"
FT                   /protein_id="CAP85536.1"
FT                   /translation="MAKMLYNIHIHATVAPFPRNDIASRMFRGPRSKANLESKFRFFKF
FT                   NKNLRSNKKAVAEALEETRTTAAIPGFEVREATIQSREEIRGRYGVDLCSSLHIPNLGF
FT                   ISANNMSVQAKVLTEFRRDELKRRARVKPYSRAEGSVLMPKCYVGSNTSTPNSNTSSQE
FT                   ALNTTPHRDRNETPKQTEASTTEYGGRNTTSKVICTPCSKAWTSGAKGQQGPRNRKIRY
FT                   LNRAGEGLPAARTHEQKPAMSPERSGNPVLRVLELGAIGQRKYVLQDNSGDS"
FT   exon            470882..471043
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /number=1
FT   intron          471044..471177
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /number=1
FT   exon            471178..471343
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /number=2
FT   intron          471344..471472
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /number=2
FT   exon            471473..471534
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /number=3
FT   intron          471535..471622
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /number=3
FT   exon            471623..471669
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /number=4
FT   intron          471670..471715
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /number=4
FT   exon            471716..471735
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /number=5
FT   intron          471736..471764
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /number=5
FT   exon            471765..472065
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /number=6
FT   intron          472066..472163
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /number=6
FT   exon            472164..472230
FT                   /gene="Pc20g02070"
FT                   /locus_tag="PCH_Pc20g02070"
FT                   /number=7
FT   mRNA            <474298..>475998
FT                   /gene="Pc20g02080"
FT                   /locus_tag="PCH_Pc20g02080"
FT   CDS_pept        474298..475998
FT                   /gene="Pc20g02080"
FT                   /locus_tag="PCH_Pc20g02080"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1487_1.tfa_1460cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85537"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE82"
FT                   /protein_id="CAP85537.1"
FT                   /translation="MDQRGLYCPGELDVLHQDRNRSETTICLPSPSPAKRASSYYPAGP
FT                   KVLEESNLDPFYLEESLAATPSWNPYTSDMRNDSFEDEDQYYTLSLTHKDIHHPSQYGP
FT                   DRSTLAQVELENSLRFHRYTSSTEEHSPLHSSQVSFSSVHTDSTTPDLTPSSSFSSSYD
FT                   SPSCPDAVLEATQQLYKHANQVQIEPRRRFYLPASTPPTYSLPPPPPPPVAPLNPADTR
FT                   PTTPCFQHSNDSTTTITMGYEDTTASCSSRSRRRKQPPSGLTLSRTASSPSTSRRKQSS
FT                   PGTRPPLDPSMISPPSLINPVTMEPHMTHFDHPLFIPANDCPSPVPSPVASSAPISRQW
FT                   TATSMERPSISTIDAFCEQSVWESDSDSESAGRKSMSRRPIDTLRKVRSRAKLRAAKSQ
FT                   PKLHQAMLDGQTCEQFPCMPEDILGEPIPEAFRPSMDRPSTSKEAVRAHSGLQTLRLVA
FT                   PSSASLTRSRSRKNSSLNSSDVDRSAAAAFQAQFRRRQRSDSPEYSNSSSDKGDKEKLT
FT                   SFCYDQYSHTPTNGAREQRPLFERFMNSLRSLNCQKPQKSHKKTNVTTI"
FT   exon            474298..475998
FT                   /gene="Pc20g02080"
FT                   /locus_tag="PCH_Pc20g02080"
FT                   /number=1
FT   mRNA            complement(<478705..>479391)
FT                   /gene="Pc20g02090"
FT                   /locus_tag="PCH_Pc20g02090"
FT   CDS_pept        complement(478705..479391)
FT                   /gene="Pc20g02090"
FT                   /locus_tag="PCH_Pc20g02090"
FT                   /note="Title: strong similarity to caYAE1 protein YAE1 like
FT                   protein An02g13390 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85538"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="InterPro:IPR038881"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE83"
FT                   /inference="protein motif:COGS:COG1859"
FT                   /protein_id="CAP85538.1"
FT                   /translation="MSTQDNPAVDNDNSLDDIFGSSPPQNTLNAPLPPTTATSQSTEPS
FT                   DLPGLRRQHVTAGYRDGTSASKGAHVQEGFDGGFPVGAQLGMRAGTVLGIMEGLLRGFE
FT                   ERNGPGVVKKPVRGQSAVSTGTDGATEIAELRRQKREQLRVLYEAALKELDVQAVFAEA
FT                   GGAPEIAPRAEDGEEERAEVQLGRKGDVVIAKWEGRVGVPGWEENMEALEMKEEGKGGG
FT                   QAVEHS"
FT   exon            complement(478705..479391)
FT                   /gene="Pc20g02090"
FT                   /locus_tag="PCH_Pc20g02090"
FT                   /number=1
FT   mRNA            join(<480371..481107,481142..>481337)
FT                   /gene="Pc20g02100"
FT                   /locus_tag="PCH_Pc20g02100"
FT   CDS_pept        join(480371..481107,481142..481337)
FT                   /gene="Pc20g02100"
FT                   /locus_tag="PCH_Pc20g02100"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An02g13400 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02100"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85539"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE84"
FT                   /protein_id="CAP85539.1"
FT                   /translation="MSRLSLRLLGFTTAATGLAGYSIHRGLCHLEEKYPALPPAAGSEA
FT                   LRKAHSPNTQHCAYTDIYAAQIPLQVIEARVPNAKTPTQTELEYAWARSVTGSKILRVE
FT                   GSLLGLLTNFRFTPCDTGNSAEGFSPDKTTGAPRILLNGLLQVQRLPATDADSNGLLVS
FT                   MELPDAPRLFFEKIARWGYPWRLMSGVRHEMSVSEPFQRNGGIFVEVRFASAHDYEVVY
FT                   AEGELEKQKIIPAWVLRLHRGYASGKLRNNAANAGYMGYLHIPDLKLPGPSVCGGISQV
FT                   MEALAYSTLTLPSRYQAYIYLTILSIESN"
FT   sig_peptide     480371..480430
FT                   /gene="Pc20g02100"
FT                   /locus_tag="PCH_Pc20g02100"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            480371..481107
FT                   /gene="Pc20g02100"
FT                   /locus_tag="PCH_Pc20g02100"
FT                   /number=1
FT   mat_peptide     join(480431..481107,481142..481334)
FT                   /gene="Pc20g02100"
FT                   /locus_tag="PCH_Pc20g02100"
FT   intron          481108..481141
FT                   /gene="Pc20g02100"
FT                   /locus_tag="PCH_Pc20g02100"
FT                   /number=1
FT   exon            481142..481337
FT                   /gene="Pc20g02100"
FT                   /locus_tag="PCH_Pc20g02100"
FT                   /number=2
FT   mRNA            complement(join(<481481..481846,481899..>482000))
FT                   /gene="Pc20g02110"
FT                   /locus_tag="PCH_Pc20g02110"
FT   CDS_pept        complement(join(481481..481846,481899..482000))
FT                   /gene="Pc20g02110"
FT                   /locus_tag="PCH_Pc20g02110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85540"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA0"
FT                   /protein_id="CAP85540.1"
FT                   /translation="MKFLAVCLMAIGLSRWTVNALPSPEDLAVLAYRAWDFRFLSEAPP
FT                   VCNSSVNNIEYSILHYSGAKRRDCQVLNLAKFNSTNVKSISWKSPSETNRYDLCMFSSP
FT                   DCSGGEDSLLGSINNGWDVCYLYNGFESWSIIPNGDACVPDGGDEEEGQGE"
FT   exon            complement(481481..481846)
FT                   /gene="Pc20g02110"
FT                   /locus_tag="PCH_Pc20g02110"
FT                   /number=1
FT   mat_peptide     complement(join(481484..481846,481899..481940))
FT                   /gene="Pc20g02110"
FT                   /locus_tag="PCH_Pc20g02110"
FT   intron          complement(481847..481898)
FT                   /gene="Pc20g02110"
FT                   /locus_tag="PCH_Pc20g02110"
FT                   /number=1
FT   exon            complement(481899..482000)
FT                   /gene="Pc20g02110"
FT                   /locus_tag="PCH_Pc20g02110"
FT                   /number=2
FT   sig_peptide     complement(481941..482000)
FT                   /gene="Pc20g02110"
FT                   /locus_tag="PCH_Pc20g02110"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<482296..482526,482590..>482667)
FT                   /gene="Pc20g02120"
FT                   /locus_tag="PCH_Pc20g02120"
FT   CDS_pept        join(482296..482526,482590..482667)
FT                   /gene="Pc20g02120"
FT                   /locus_tag="PCH_Pc20g02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85541"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA1"
FT                   /protein_id="CAP85541.1"
FT                   /translation="MAPHGVEGSRIRFSWHRGESEVIWLPLDATSSTPLFVKVLVGYAA
FT                   VRLVRAWSRGKKRRAIPMVVVSSTQHLRNTAQGLVEDERQISRRLGVESDVAVSLGE"
FT   exon            482296..482526
FT                   /gene="Pc20g02120"
FT                   /locus_tag="PCH_Pc20g02120"
FT                   /number=1
FT   intron          482527..482589
FT                   /gene="Pc20g02120"
FT                   /locus_tag="PCH_Pc20g02120"
FT                   /number=1
FT   exon            482590..482667
FT                   /gene="Pc20g02120"
FT                   /locus_tag="PCH_Pc20g02120"
FT                   /number=2
FT   mRNA            complement(join(<483216..483561,483640..>485030))
FT                   /gene="Pc20g02130"
FT                   /locus_tag="PCH_Pc20g02130"
FT   CDS_pept        complement(join(483216..483561,483640..485030))
FT                   /gene="Pc20g02130"
FT                   /locus_tag="PCH_Pc20g02130"
FT                   /note="Title: strong similarity to acetyl-coenzyme A
FT                   transporter like protein An02g13410 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85542"
FT                   /db_xref="GOA:B6HEA2"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA2"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /inference="protein motif:COGS:COG2271"
FT                   /protein_id="CAP85542.1"
FT                   /translation="MTRKNATLSKRRSKANLTVATGSNGRANGKMNNNIEMRRRDTPSS
FT                   ETSAERTAQLMSRTSFSLDNEPIVPQTPVQTNTTFHNLPRSDRRNFLLLVLLYFLQGIP
FT                   MGLATGSVPFLLKPYLSYGQIGIFSLASYPYSLKLFWSPIVDAVWSTRFGRRKSWITPV
FT                   QVIAGLAMIYMGGHIEEMMVQAGADGGAGVWKFTYWWFMLVLFCATQDIAVDGWAITLM
FT                   SPPNISYASTAQTVGLTAGHFLSYTVFLAFNSKDFANRWFRTIPGDGGLLSLGTYLNFW
FT                   GWAYLIVTCGLAFLKKEERTKERDSIMDVYKSMWSVLKLKNIQTIIVIHLIAKIGFQAN
FT                   DGVTSLKLLDKGFGQDNMALVVLIDFPFEIMLGYYAGQWSTNYGAMRLWGWAFVGRLAA
FT                   AVLAQLTVMIYPTASEVPMWYMLTVIGEHVLSTFMNTVMFVSISAFHARIADPAIGGTY
FT                   MTLLATVSNLGGTFPRIFVLKLVDMFTQATCLPPTIPPPADSLKDTLIMTPFSCALEPE
FT                   KNRCINGGGTCHIDRDGYYMTNILCVLIGALTFIMFIKPAAQKLQDLPLRAWRLASNPQ
FT                   RG"
FT   exon            complement(483216..483561)
FT                   /gene="Pc20g02130"
FT                   /locus_tag="PCH_Pc20g02130"
FT                   /number=1
FT   intron          complement(483562..483639)
FT                   /gene="Pc20g02130"
FT                   /locus_tag="PCH_Pc20g02130"
FT                   /number=1
FT   exon            complement(483640..485030)
FT                   /gene="Pc20g02130"
FT                   /locus_tag="PCH_Pc20g02130"
FT                   /number=2
FT   mRNA            join(<485838..485916,485973..>486910)
FT                   /gene="Pc20g02140"
FT                   /locus_tag="PCH_Pc20g02140"
FT   CDS_pept        join(485838..485916,485973..486910)
FT                   /gene="Pc20g02140"
FT                   /locus_tag="PCH_Pc20g02140"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An02g13420 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85543"
FT                   /db_xref="GOA:B6HEA3"
FT                   /db_xref="InterPro:IPR018464"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA3"
FT                   /protein_id="CAP85543.1"
FT                   /translation="MASHAPASPDPEEEELDSEIASIRAEIRKLQKHKRILTSSLLTTD
FT                   PVQKLLRKPQPPTTNPTDPLTRIFPLVHAAGAHTSSNHHRIAFGATAFPFKDPSPAANG
FT                   VTLLGVRIDVCTRNGRFAKPYYVILQKERSRAGPGAGGADSKVLKVYRHTVPAFISIAK
FT                   LESVYLPRPGVTRDNGDGAGGGSSGEDEDTEPAKPWKKGGNSARKQDLRGFVRELRREL
FT                   VAWHMRVDAVEFLREKLGLVGEGGGPLPFDVSPDRDTGIVSLAAVAIEARYVRIEWVDG
FT                   RVGRFKLSNTGIVERAVVIGDQGRDKKVEDAITGGGGRVETVLDRLRAEVLSGSPGR"
FT   exon            485838..485916
FT                   /gene="Pc20g02140"
FT                   /locus_tag="PCH_Pc20g02140"
FT                   /number=1
FT   intron          485917..485972
FT                   /gene="Pc20g02140"
FT                   /locus_tag="PCH_Pc20g02140"
FT                   /number=1
FT   exon            485973..486910
FT                   /gene="Pc20g02140"
FT                   /locus_tag="PCH_Pc20g02140"
FT                   /number=2
FT   mRNA            complement(join(<487218..487912,487938..>488898))
FT                   /gene="Pc20g02150"
FT                   /locus_tag="PCH_Pc20g02150"
FT   CDS_pept        complement(join(487218..487912,487938..488898))
FT                   /gene="Pc20g02150"
FT                   /locus_tag="PCH_Pc20g02150"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An02g13430 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85544"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA4"
FT                   /protein_id="CAP85544.1"
FT                   /translation="MESSAGPIFDEAQYRTDVLHLPSPESEAAQAQQLAEEAEQLGLKV
FT                   PEIEVSAPLAASIASGMVDLSSPVLSSGSSTDRNSMCGSLTPSHEPSSPVPSVLDQIVS
FT                   SLSDVTLSSDHIKAGSTRSLASLSTRPTSFCSSEGKPGLIGHGYNDAFEARSHRHSILS
FT                   IASADKKEKRRSSLKSAIGRIHFRKKRTSSAIVLPSDGRIAVSTSDKGVEHVFFEPTQG
FT                   PDNAAHEDVPLHASDEVSLPRLEIPRFSKEELQRSLDDPELSELHERHQMERNRHLAFH
FT                   DAALSTLRRRHQTAVSEHQSDNQRQEDERREKVRVTRFYSLVQNIQAIVQIEERQLAVE
FT                   IEQQREFDRAKMNSRTRIKHMEGYLRNASPPPSPAGTPTKAERSGRSSESFSESGSTPP
FT                   ARVLTRQHMEQLEQQYHSHKSMDQLHDARIKVLRDRQELKLQEATARMEKELDEMRNRH
FT                   IQDVAALKAEHQREESSLVQALETKKTTLQRRWYLEEAILRRHLEVRHGQSYGPLPLVT
FT                   FNTSTTPVGMAEHSPLETSSTPDTIHPSQDCVPL"
FT   exon            complement(487218..487912)
FT                   /gene="Pc20g02150"
FT                   /locus_tag="PCH_Pc20g02150"
FT                   /number=1
FT   intron          complement(487913..487937)
FT                   /gene="Pc20g02150"
FT                   /locus_tag="PCH_Pc20g02150"
FT                   /number=1
FT   exon            complement(487938..488898)
FT                   /gene="Pc20g02150"
FT                   /locus_tag="PCH_Pc20g02150"
FT                   /number=2
FT   mRNA            complement(<489640..>490515)
FT                   /gene="Pc20g02160"
FT                   /locus_tag="PCH_Pc20g02160"
FT   CDS_pept        complement(489640..490515)
FT                   /gene="Pc20g02160"
FT                   /locus_tag="PCH_Pc20g02160"
FT                   /note="unknown EC_number=3.1.1.1"
FT                   /note="unknown EC_number=3.1.1.3"
FT                   /note="Title: similarity to lipase LipP - Pseudomonas sp."
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02160"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85545"
FT                   /db_xref="GOA:B6HEA5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA5"
FT                   /inference="similar to AA sequence:TREMBL:AF034088.1"
FT                   /inference="protein motif:COGS:COG0657"
FT                   /protein_id="CAP85545.1"
FT                   /translation="MDILTYYYNRCFAFIIRTFVYFASNVTASPDEIRHIKSRDAGRTI
FT                   KVHLYQPSGSGPSPVLLNFHGSGFVLPLHGSDDEFCRRVSHETKHTVLDIPYRLAPEHP
FT                   FPAALNDVEDAVRYVLTRPDEFDLTRISISGFSAGGNLALAAASTLFPRDTFRSLLAIY
FT                   PVTNLSPDPASKIAPARGESVIPLPVMRLFDRCYIPSSFDKRDPRISPHYAQADRFPQR
FT                   VLMITADGDTLALEGEELAQKIKKLQGWHVVSERMQGCSHGWDKNARAGTPQYQAKERA
FT                   YQLAFDMLND"
FT   exon            complement(489640..490515)
FT                   /gene="Pc20g02160"
FT                   /locus_tag="PCH_Pc20g02160"
FT                   /number=1
FT   mRNA            join(<491640..491729,491778..491850,491930..491939,
FT                   491999..492195,492249..492302,492384..493079,
FT                   493131..>493249)
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT   CDS_pept        join(491640..491729,491778..491850,491930..491939,
FT                   491999..492195,492249..492302,492384..493079,
FT                   493131..493249)
FT                   /pseudo
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   probably involved in autophagocytosis AN4832_2 -Aspergillus
FT                   nidulans"
FT                   /note="Gene-ID: Atg29"
FT                   /db_xref="PSEUDO:CAP85546.2"
FT                   /inference="similar to AA sequence:UNIPROT:Q5B3P8_EMENI"
FT   exon            491640..491729
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /number=1
FT   intron          491730..491777
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /number=1
FT   exon            491778..491850
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /number=2
FT   intron          491851..491929
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /number=2
FT   exon            491930..491939
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /number=3
FT   intron          491940..491998
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /number=3
FT   exon            491999..492195
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /number=4
FT   intron          492196..492248
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /number=4
FT   exon            492249..492302
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /number=5
FT   intron          492303..492383
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /number=5
FT   exon            492384..493079
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /number=6
FT   intron          493080..493130
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /number=6
FT                   /note="submitted as 493280..493130"
FT   exon            493131..493249
FT                   /gene="Pc20g02170"
FT                   /locus_tag="PCH_Pc20g02170"
FT                   /number=7
FT   mRNA            <493817..>495016
FT                   /gene="Pc20g02180"
FT                   /locus_tag="PCH_Pc20g02180"
FT   CDS_pept        493817..495016
FT                   /gene="Pc20g02180"
FT                   /locus_tag="PCH_Pc20g02180"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_82_scaffold_5.tfa_80cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85547"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA6"
FT                   /inference="protein motif:PFAM:PF04127"
FT                   /inference="protein motif:COGS:COG0452"
FT                   /protein_id="CAP85547.1"
FT                   /translation="MSTPLLGEMSPAEAESVYFNEYPPPKALPRHEALARAFIDLHVEA
FT                   HRRVVLVTSGGTTVPLEAQTVRFIDNFSAGTRGATSAEYFLEQGYAVIFLHRQYSLLPY
FT                   SRHYSHSTNCFLDFMDEAPASADSSNPGHGPIMVRDEYQDQMRSVLRKYRYAKQNNRLL
FT                   LLPFTTVSEYMFELRSIAKLMRPLGPDALFYLAAAVSDFFIPRSRMAEHKIQSSELPPH
FT                   MRGSAISSDEIYTGENEEKASSNSRKLVINLDPVPKFLHQLVDGWAPEGSMVVSFKLET
FT                   DPSLLVYKARTALQRYSHHLVIGNLLSTRKWEVVFITPDEPHERWLRVPKSRRSKSISG
FT                   VEDQVGLAEAKKGNPSTSEEAKAEQVNETSRDGIEIESLIIPELVKLHTKMIEKTQAAQ
FT                   "
FT   exon            493817..495016
FT                   /gene="Pc20g02180"
FT                   /locus_tag="PCH_Pc20g02180"
FT                   /number=1
FT   mRNA            join(<495698..496702,496778..>497107)
FT                   /gene="Pc20g02190"
FT                   /locus_tag="PCH_Pc20g02190"
FT   CDS_pept        join(495698..496702,496778..497107)
FT                   /gene="Pc20g02190"
FT                   /locus_tag="PCH_Pc20g02190"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   AAG27909.1 - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85548"
FT                   /db_xref="GOA:B6HEA7"
FT                   /db_xref="InterPro:IPR003378"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA7"
FT                   /inference="similar to AA sequence:PIR:C86456"
FT                   /protein_id="CAP85548.1"
FT                   /translation="MVPRRLSRRLIAVAAAIALFFLYHVSSLSSHNRQWRPHFTTTEVT
FT                   PAVGDNGEPAPFCPPLPGIEDVLVVMKTGVTESRDKVPIHFQTTLRCIPHFVIYSDFAE
FT                   EIEGVKIHDVLRNMDSAAKKNPDFDFYHRIVKYGRKGLEQQDFSDEANSAIGKPNNPGW
FT                   KLDKWKFLPMAQEALRHKPDAKWFIFVEADTYVSWPTVLTWLARFDHTKPHYLGTETQI
FT                   ADVIFAHGGSGFMLSNPALQRASDEYAAREVELNAFTDQHWAGDCVLGKVLSDAGVNLH
FT                   FTWPILQNSNLGELDEFTTDFYRKPWCFIAVALHHLSPIDIENLWKFEQKRWRDKNKRI
FT                   LLHGDLFREYISPEINSQPTRPNWNNMANEDQPFAHTFEDCRLICQTQNACVQFAFREG
FT                   KCFTSANPRLGHAVPSGDATSGWITSRIRDMTGKKGLCRKPDFGD"
FT   sig_peptide     495698..495787
FT                   /gene="Pc20g02190"
FT                   /locus_tag="PCH_Pc20g02190"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            495698..496702
FT                   /gene="Pc20g02190"
FT                   /locus_tag="PCH_Pc20g02190"
FT                   /number=1
FT   mat_peptide     join(495788..496702,496778..497104)
FT                   /gene="Pc20g02190"
FT                   /locus_tag="PCH_Pc20g02190"
FT   intron          496703..496777
FT                   /gene="Pc20g02190"
FT                   /locus_tag="PCH_Pc20g02190"
FT                   /number=1
FT   exon            496778..497107
FT                   /gene="Pc20g02190"
FT                   /locus_tag="PCH_Pc20g02190"
FT                   /number=2
FT   mRNA            complement(join(<497721..498040,498096..498181,
FT                   498234..498640,498803..>499273))
FT                   /gene="Pc20g02200"
FT                   /locus_tag="PCH_Pc20g02200"
FT   CDS_pept        complement(join(497721..498040,498096..498181,
FT                   498234..498640,498803..499273))
FT                   /gene="Pc20g02200"
FT                   /locus_tag="PCH_Pc20g02200"
FT                   /note="unknown EC_number=3.5.1.41"
FT                   /note="Title: similarity to peptidoglycan
FT                   N-acetylglucosamine deacetylase PgdA - Streptococcus
FT                   pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02200"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85549"
FT                   /db_xref="GOA:B6HEA8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA8"
FT                   /inference="similar to AA sequence:PIR:D95172"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /inference="protein motif:COGS:COG0726"
FT                   /protein_id="CAP85549.1"
FT                   /translation="MHWLFIGSAALFLFLPASALSRGIVDHGHWNELRDLTHNASHNGS
FT                   QAKSSPPLVIDTFKNPTRNDLGFWHGSGENLTVQHGPGFVRLFPTDPDQNFHTQFDSNA
FT                   CYGLIPWYNEYLHVIFEGTDQYSVSFNQHNDECNPQRRPFPGIADSVQAERYVLYIPLA
FT                   HFDIDFNRVVSVSFHGFYTNESITLHRVEIVPDVPLPSPENGHYLVPGKMPNGKLVLRC
FT                   SRPNSFAFGIDDGQPQYSQQVMRILDEEGVRVTFFVVGAGLRDPTSNFTEFYKEMLRKG
FT                   HQVAFHSNTHPKMESLPTLAEIDDEIMQSMRIFREQLGIESSYFRPPFGTVASRLRQEL
FT                   ARHIPNPSIVNWSVDVEDWLWADTSTPEKQLEAFFRSVEKGGNLAVMHYLHPTTIGYLP
FT                   EFIRHVKRAGYQIMRIDQCLGDASAPPL"
FT   exon            complement(497721..498040)
FT                   /gene="Pc20g02200"
FT                   /locus_tag="PCH_Pc20g02200"
FT                   /number=1
FT   mat_peptide     complement(join(497724..498040,498096..498181,
FT                   498234..498640,498803..499210))
FT                   /gene="Pc20g02200"
FT                   /locus_tag="PCH_Pc20g02200"
FT   intron          complement(498041..498095)
FT                   /gene="Pc20g02200"
FT                   /locus_tag="PCH_Pc20g02200"
FT                   /number=1
FT   exon            complement(498096..498181)
FT                   /gene="Pc20g02200"
FT                   /locus_tag="PCH_Pc20g02200"
FT                   /number=2
FT   intron          complement(498182..498233)
FT                   /gene="Pc20g02200"
FT                   /locus_tag="PCH_Pc20g02200"
FT                   /number=2
FT   exon            complement(498234..498640)
FT                   /gene="Pc20g02200"
FT                   /locus_tag="PCH_Pc20g02200"
FT                   /number=3
FT   intron          complement(498641..498802)
FT                   /gene="Pc20g02200"
FT                   /locus_tag="PCH_Pc20g02200"
FT                   /number=3
FT   exon            complement(498803..499273)
FT                   /gene="Pc20g02200"
FT                   /locus_tag="PCH_Pc20g02200"
FT                   /number=4
FT   sig_peptide     complement(499211..499273)
FT                   /gene="Pc20g02200"
FT                   /locus_tag="PCH_Pc20g02200"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<499950..500527,500612..500760,
FT                   500812..501005,501078..501229,501326..501405,
FT                   501468..501828,501882..502017,502069..502126,
FT                   502189..>502559))
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT   CDS_pept        complement(join(499950..500527,500612..500760,
FT                   500812..501005,501078..501229,501326..501405,
FT                   501468..501828,501882..502017,502069..502126,
FT                   502189..502559))
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /note="Title: strong similarity to ATP-dependent RNA
FT                   helicase Ded1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85550"
FT                   /db_xref="GOA:B6HEA9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA9"
FT                   /inference="similar to AA sequence:PIR:S62003"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /inference="protein motif:COGS:COG0513"
FT                   /protein_id="CAP85550.1"
FT                   /translation="MESYDDPEVASAADAPEVGDSAAAEAASAVGSDVGEPPVAGVLSG
FT                   VGPNAEAAHQIARDKGWTDPVPFEYAELANSKDHLEWAGVAARYEWKGEYGDIGPRVPE
FT                   LEEQLFSGDLIARAGAKLDALNGYKVKVESASEIESVTEWVNLGLHPVMLENVRLCGYE
FT                   HPTAVQSYAIPAVLANLDVIAVAQTGSGKTGAFLIPILSKLMGKARKLAAPRPNTAERF
FT                   NPREDAVRAEPLVLIVCPTRELATQIFDEARRLCYRSMLRPCVAYGGAPSRQQREELQK
FT                   GCDILIATPGRLLDFMAQTHVLSLRRVRYTVIDEADEMLESDWEEEFKKIMSGGDVNED
FT                   ADHRYMMFSATFNKEFRKLAKQYLNENHVRLRVGRAGSSHHNVVQDIIWADQPKKMRAL
FT                   YDLLISMPPVRTLIFVNSKEQVDFVDDYLFNSGMPTTSIHGGRTQREREDAMRAFRTAK
FT                   CPIMVATGVSARGLDVVNVLHVINYDLPSAIHGGITEYVHRIGRTARIGNEGIATSFYN
FT                   DRDEGIAEDLVKILIECDQAIPEFLQQYRPEGDVLEFDDDSDKEFFDNQSNAGAEAEAD
FT                   HESSNADAESAAAEAEADHESSNADAESAAAQAEAEESDKVVADDAEDDKPAVPRPTIT
FT                   SEEEEEASTWWGPTTIVTERKKPREEAKPKDTKAGLAGSHWAPKPKPAPKDDDAFWQ"
FT   exon            complement(499950..500527)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=1
FT   intron          complement(500528..500611)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=1
FT   exon            complement(500612..500760)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=2
FT   intron          complement(500761..500811)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=2
FT   exon            complement(500812..501005)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=3
FT   intron          complement(501006..501077)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=3
FT   exon            complement(501078..501229)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=4
FT   intron          complement(501230..501325)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=4
FT   exon            complement(501326..501405)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=5
FT   intron          complement(501406..501467)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=5
FT   exon            complement(501468..501828)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=6
FT   intron          complement(501829..501881)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=6
FT   exon            complement(501882..502017)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=7
FT   intron          complement(502018..502068)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=7
FT   exon            complement(502069..502126)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=8
FT   intron          complement(502127..502188)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=8
FT   exon            complement(502189..502559)
FT                   /gene="Pc20g02210"
FT                   /locus_tag="PCH_Pc20g02210"
FT                   /number=9
FT   mRNA            join(<503454..503672,503810..504092,504148..504676,
FT                   504726..>505053)
FT                   /gene="Pc20g02220"
FT                   /locus_tag="PCH_Pc20g02220"
FT   CDS_pept        join(503454..503672,503810..504092,504148..504676,
FT                   504726..505053)
FT                   /gene="Pc20g02220"
FT                   /locus_tag="PCH_Pc20g02220"
FT                   /note="unknown EC_number=2.7.1.33"
FT                   /note="Title: strong similarity to pantothenate kinase panK
FT                   - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85551"
FT                   /db_xref="GOA:B6HEB0"
FT                   /db_xref="InterPro:IPR004567"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB0"
FT                   /inference="similar to AA sequence:TREMBL:AF098669.1"
FT                   /inference="protein motif:PFAM:PF03630"
FT                   /inference="protein motif:COGS:COG5146"
FT                   /protein_id="CAP85551.1"
FT                   /translation="MAERVEVDTRKRPNRLEAAITNPGAVKINVTGAFIVDDEPRSKSP
FT                   VDAEGVHYENKDIRLPHHTGVVSHVAVDIGGTLAKLVYFTRELDTADNGGRLNFLNFET
FT                   HRIDLCINFIRQLKEEHEKRNGSTREGLCVVATGGGAYKYYDRLKEELNVNILREEEME
FT                   CLIIGLDFFITEIPNEVFTYSDADPEPMQYAEARADVYPYLLVNIGSGVSMIKVSGPRQ
FT                   FERVGGTHLGGGTFWGIMSLLTGSRTFDDMLAMADRGDNSAVDMLVGDIYGMDYTKIGL
FT                   KSTAIASTFGKVLRLKNDAEQGAEDGEGLIRDDPSEASESSKSSHGAKPNPEDMSRSLL
FT                   YAISNNIGQIAYLQSEKHSVKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRH
FT                   EGYLGAVGAFIRRQPQNWGRRNSVDDVVAPQAVRNLVQNNSVLQQHGRSSSDL"
FT   exon            503454..503672
FT                   /gene="Pc20g02220"
FT                   /locus_tag="PCH_Pc20g02220"
FT                   /number=1
FT   intron          503673..503809
FT                   /gene="Pc20g02220"
FT                   /locus_tag="PCH_Pc20g02220"
FT                   /number=1
FT   exon            503810..504092
FT                   /gene="Pc20g02220"
FT                   /locus_tag="PCH_Pc20g02220"
FT                   /number=2
FT   intron          504093..504147
FT                   /gene="Pc20g02220"
FT                   /locus_tag="PCH_Pc20g02220"
FT                   /number=2
FT   exon            504148..504676
FT                   /gene="Pc20g02220"
FT                   /locus_tag="PCH_Pc20g02220"
FT                   /number=3
FT   intron          504677..504725
FT                   /gene="Pc20g02220"
FT                   /locus_tag="PCH_Pc20g02220"
FT                   /number=3
FT   exon            504726..505053
FT                   /gene="Pc20g02220"
FT                   /locus_tag="PCH_Pc20g02220"
FT                   /number=4
FT   mRNA            <505713..>507248
FT                   /gene="Pc20g02230"
FT                   /locus_tag="PCH_Pc20g02230"
FT   CDS_pept        505713..507248
FT                   /gene="Pc20g02230"
FT                   /locus_tag="PCH_Pc20g02230"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An02g13560 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85552"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB1"
FT                   /protein_id="CAP85552.1"
FT                   /translation="MAESPLHVISDQLKRLAAQSPAARNASPVSAARVDATEPIIQGSV
FT                   LNAPEGTDSQVPTSTESDLTDIDESLLQDPSDPAPRPQSTPSETHFINPTAPRVSYQVS
FT                   ASGEVMIIEETQTPRPIARAPAPRPSPPAYLSFDRLAQGLSPKLASSPTTSTIQPPSLA
FT                   VERIIGPKQPIPARILELLEEWHEDSPYTEHPSALSGRAPTTWKHFKAFSDDGDECELS
FT                   IFQISLKGQTRRSVTYRIMILHSQNGPEELVVYGQPRPKFRGPLTKGTRGLYLLDWLEI
FT                   EQKGEVQACGLKLWRTDEQNITFSAHMFDYGRKCTRLSGPNDIFNMRASSSTPKKQSGA
FT                   NENIEDAGSNSSEPPYSPSRSSRQASTSNHPKPENEEDKTSVTPRPSPAKTGSPEFRPL
FT                   ASPWKPQKRRRGTWSSNDETSVLRYKLMSDESDQVRVFKTNDAKVLFEKAQQFYKGMEK
FT                   RTGLLCTVYGVEGVRYVGEGCVDEFDILQEDIRKTSGPGDEDRVVVVKPAMGF"
FT   exon            505713..507248
FT                   /gene="Pc20g02230"
FT                   /locus_tag="PCH_Pc20g02230"
FT                   /number=1
FT   mRNA            join(<507964..508291,508369..508634,508968..>509546)
FT                   /gene="Pc20g02240"
FT                   /locus_tag="PCH_Pc20g02240"
FT   CDS_pept        join(507964..508291,508369..508634,508968..509546)
FT                   /gene="Pc20g02240"
FT                   /locus_tag="PCH_Pc20g02240"
FT                   /note="Title: strong similarity to protein involved in
FT                   glycosylphosphatidylinositol biosynthesis pig-C - Homo
FT                   sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85553"
FT                   /db_xref="GOA:B6HEB2"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB2"
FT                   /inference="similar to AA sequence:PIR:JC4969"
FT                   /protein_id="CAP85553.1"
FT                   /translation="MASPPSLDPFPPPIPVDTHPNRATGSKPPELERSLPDPNRLAPED
FT                   AYFAPSLSRARSAPSNYEENLRSLNGDGSAHIGSTAALRKKLGGPGRRRKRKGAWKKLL
FT                   WVKQSYPDNYTDTETFLDHLQRNPRVRPYDFWPLVADSTVIVQHVCSVVIFVCCFVGIV
FT                   QDRVSPVSIVCWGSVGTAVGWILWDNWIWKEHGESRLTTVKSAFLIYFSLLGLSPILKS
FT                   LTKSTASDSIWAMSCWLLIMNIFSFDYGSGEGAGATTKFPASLSTNAAVMASTVLASRL
FT                   PSTTHVFSLMLFSMEVFGLFPIFRRQLRQKSWTGHVLLTLALVIVAGGAVGVTLSGGWA
FT                   AAIIGSVLGSILTAFVMGGCSWWLISLQKYKNVVIGPWDPARPIIRRHWN"
FT   exon            507964..508291
FT                   /gene="Pc20g02240"
FT                   /locus_tag="PCH_Pc20g02240"
FT                   /number=1
FT   intron          508292..508368
FT                   /gene="Pc20g02240"
FT                   /locus_tag="PCH_Pc20g02240"
FT                   /number=1
FT   exon            508369..508634
FT                   /gene="Pc20g02240"
FT                   /locus_tag="PCH_Pc20g02240"
FT                   /number=2
FT   intron          508635..508967
FT                   /gene="Pc20g02240"
FT                   /locus_tag="PCH_Pc20g02240"
FT                   /number=2
FT   exon            508968..509546
FT                   /gene="Pc20g02240"
FT                   /locus_tag="PCH_Pc20g02240"
FT                   /number=3
FT   mRNA            join(<510419..510483,510558..510850,510918..511521,
FT                   511575..>511938)
FT                   /gene="Pc20g02250"
FT                   /locus_tag="PCH_Pc20g02250"
FT   CDS_pept        join(510419..510483,510558..510850,510918..511521,
FT                   511575..511938)
FT                   /gene="Pc20g02250"
FT                   /locus_tag="PCH_Pc20g02250"
FT                   /note="unknown EC_number=3.2.1.14"
FT                   /note="Title: similarity to chitinase - Chelonus sp."
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85554"
FT                   /db_xref="GOA:B6HEB3"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018371"
FT                   /db_xref="InterPro:IPR036861"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB3"
FT                   /inference="similar to AA sequence:PIR:A53918"
FT                   /inference="protein motif:PFAM:PF00704"
FT                   /inference="protein motif:COGS:COG3325"
FT                   /inference="protein motif:COGS:COG3858"
FT                   /inference="protein motif:COGS:COG3469"
FT                   /protein_id="CAP85554.1"
FT                   /translation="MFKRLALGLLAAQSVAAMRFAMYHTTALPGQEKTEGIDYAIMSFA
FT                   ASKLFNSDSPAEYKPFESPETMRKRFSPDTKLMVAIGGWGDTAGFSEGAKDEASRTRYA
FT                   KNVASMLDAHGFDGVDIDWEYPGGNGQDYRQVPNEEKVDEIETYPLFLEALRKELGDKI
FT                   ISIAVPGRKQDLIAYTKEQGPKIWKSVDMVNVMSYDLTNRRDNVTNHASGVQGSLDTIN
FT                   EYLAIGADPEKLNLGFAYYAKWFTTNADSDCEENPLGCELAKLENDDGSDNGKSGALTF
FT                   EASTVAAPPKDLKDSTDGLCGFGAKTKCPSGQCCSSSGYCGTTDEFCQAGCLSDYGTCK
FT                   GISITDSWRKAQKDGKTDEKGGGQYYFDSENNLFWTWDTPEMIARKFKEIVAEKKLGGV
FT                   MAWSLGEDTYKFEHLEAMQKGIKSQSNSPKVEEPPVAERGCA"
FT   sig_peptide     510419..510469
FT                   /gene="Pc20g02250"
FT                   /locus_tag="PCH_Pc20g02250"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            510419..510483
FT                   /gene="Pc20g02250"
FT                   /locus_tag="PCH_Pc20g02250"
FT                   /number=1
FT   mat_peptide     join(510470..510483,510558..510850,510918..511521,
FT                   511575..511935)
FT                   /gene="Pc20g02250"
FT                   /locus_tag="PCH_Pc20g02250"
FT   intron          510484..510557
FT                   /gene="Pc20g02250"
FT                   /locus_tag="PCH_Pc20g02250"
FT                   /number=1
FT   exon            510558..510850
FT                   /gene="Pc20g02250"
FT                   /locus_tag="PCH_Pc20g02250"
FT                   /number=2
FT   intron          510851..510917
FT                   /gene="Pc20g02250"
FT                   /locus_tag="PCH_Pc20g02250"
FT                   /number=2
FT   exon            510918..511521
FT                   /gene="Pc20g02250"
FT                   /locus_tag="PCH_Pc20g02250"
FT                   /number=3
FT   intron          511522..511574
FT                   /gene="Pc20g02250"
FT                   /locus_tag="PCH_Pc20g02250"
FT                   /number=3
FT   exon            511575..511938
FT                   /gene="Pc20g02250"
FT                   /locus_tag="PCH_Pc20g02250"
FT                   /number=4
FT   mRNA            complement(join(<512152..515097,515148..>515444))
FT                   /gene="Pc20g02260"
FT                   /locus_tag="PCH_Pc20g02260"
FT   CDS_pept        complement(join(512152..515097,515148..515444))
FT                   /gene="Pc20g02260"
FT                   /locus_tag="PCH_Pc20g02260"
FT                   /note="unknown EC_number=1.2.1.31"
FT                   /note="Title: similarity to aminoadipate reductase enzyme
FT                   lys2 - Acremonium chrysogenum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85555"
FT                   /db_xref="GOA:B6HEB4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB4"
FT                   /inference="similar to AA sequence:TREMBL:ACH261064.1"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /inference="protein motif:COGS:COG1020"
FT                   /protein_id="CAP85555.1"
FT                   /translation="MATVTITTTEGGVKPLQTQDIATRLLNGTLHSQWPPFEQFATIDG
FT                   LLKSHAAQPDEAKRPLICYPIRGAADFEEHTAGAIDRYTDLAVRFYMQQGLVPADPNLE
FT                   QAPVVAMLAGSSFEVVVTFFALNRLGYAVLFLSTRLTAPAYIRLMEMANCSQLIKANQF
FT                   QQVVTEICAERPGCSTFSLLQREDWFNRPVSTPLFERPGADPSGEGKKIAWILHSSGST
FT                   GFPKPIFLTNLQTLANFCKSFGLRLFTISPLFHSHALMEFGRAFYTRAPAYLGNHSLPV
FT                   TYQNLFDALQVAKPQQISAVPYVIKLLAEKQEGIQALARPQLVLYGGSSCPDDLGDRLV
FT                   AQGVNLVGNYGATETGQIMTSFRAPEDKEWQYMRLHRPVADLTLMDEISPGVFECVALD
FT                   GLPSKGPSNSKPPYSAKNPENSFRTADLFTRHPDPEKDNYYKYLSRLDDRITLVNGEKV
FT                   LPIPIEGRVREEPIVSDCVVFGFQRTVPGALIFRAPGKVPHLSDAEFLEAIWPAVEAAN
FT                   SRAETFSRIPKELVVIEGSDVVYARTDKGTCIRAQVYQQFEEDIKQAYAKFEGSGQKRG
FT                   SLALSIPQLEDWLLSRFSEDLGVLIPGAEADIFSAGVDSLQTTQIWRCIMRDIDIGEGG
FT                   DQLSQNIVFEKGTVSALARHLYQLRTGQEFEREDELHSMREMIEKYSHFTHHFPTIARS
FT                   PETEVVMVTGATGNLGAFIVSELLKRPTVSEVWAIVRAPGQAAAGARLYKALADRSIVL
FT                   TEPEAAKLHAVPGDMSQPNLGLKDHDLQHLVSCLTCIIHSAWAVNFNLGVRSFEQQHIR
FT                   GTYNLINLCLRSHLPSPARFFFCSSVSAAGNTPKPASIPETIIEDLEHAQRTGYGRSKL
FT                   VTEHITRNAMRQTGMQARVLRIGQLGGDTVGAQWNDTEAVALMFRSALTTGALPELNER
FT                   PSWLPVDQCGRAISDIAMNVSGSADLNMVYHLVNPRTFSWKDDLLPALRQGSALAEFEV
FT                   VPPQEWLSRLATSEQDPEKNPSVKLIDFWRSKYASHGLSETGPGRNEEAGLTFETERTV
FT                   QDCPSLGLVEDPVASGLIQRYIESWMSRWAGE"
FT   exon            complement(512152..515097)
FT                   /gene="Pc20g02260"
FT                   /locus_tag="PCH_Pc20g02260"
FT                   /number=1
FT   intron          complement(515098..515147)
FT                   /gene="Pc20g02260"
FT                   /locus_tag="PCH_Pc20g02260"
FT                   /number=1
FT   exon            complement(515148..515444)
FT                   /gene="Pc20g02260"
FT                   /locus_tag="PCH_Pc20g02260"
FT                   /number=2
FT   mRNA            complement(join(<516004..516908,516980..517160,
FT                   517216..517612,517676..>518094))
FT                   /gene="Pc20g02270"
FT                   /locus_tag="PCH_Pc20g02270"
FT   CDS_pept        complement(join(516004..516908,516980..517160,
FT                   517216..517612,517676..518094))
FT                   /gene="Pc20g02270"
FT                   /locus_tag="PCH_Pc20g02270"
FT                   /note="Title: strong similarity to isoamyl alcohol oxidase
FT                   mreA - Aspergillus oryzae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85556"
FT                   /db_xref="GOA:B6HEB5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB5"
FT                   /inference="similar to AA sequence:TREMBL:AB048606.1"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /inference="protein motif:COGS:COG0277"
FT                   /protein_id="CAP85556.1"
FT                   /translation="MSPCSFMTGIFIVALLLVTHGDARAGQVSSASVAGAPLFDSEKFQ
FT                   LTDNDIAKLSQQQSALVKFGCDGTSKPTQPTRKCKVFPGDRQWPSQSVWSAFDDLLGGA
FT                   LIKTVPLAASCYSSWPQYDSDECERISSQWTDSHLHAADPASAMWPLFEGRTCLPTTNA
FT                   SASCTLGGYSSYSVNVSNVAQIQLAVNFARNADIRLVVKNTGHDFNGKSTGAGALGIWT
FT                   HNLKDIEYYENYRGSGYQGPAVKMGAGVQAFEVYAKGQELGFTAVGGEGKTVGVTGGYV
FT                   LGGGHSPMSSLYGLAADQVLALEVVLANGRFVTVTEESDPDHFWALRGGGGGTYGVVTS
FT                   LISRVYPKVGVTVSTFNFSTGKDVSVETFWAGVRSYLERFPTHADAGTYAYFWIMPTGP
FT                   NAFTFLMNPFFAVNHTVDEFNALVKPWYDDLHELGISFQPNTTYYDNFYDGWMAGFALE
FT                   TVASSTMMTGSRLFPRANWDTPTSLNATLNALRATITDGFALLAFNMKAELHEGFTSNS
FT                   ANPAWRQTLMHAITSTSWTNTTSDADIKVKMDDLTKAVGKWRAVCPDSGAYMSESDIQE
FT                   PHFQQAFYGTNYDRLYKLKQRYDPTGLFYAPTGVGSEDWVVKSLDGLPDQNGRLCRV"
FT   exon            complement(516004..516908)
FT                   /gene="Pc20g02270"
FT                   /locus_tag="PCH_Pc20g02270"
FT                   /number=1
FT   mat_peptide     complement(join(516007..516908,516980..517160,
FT                   517216..517612,517676..518019))
FT                   /gene="Pc20g02270"
FT                   /locus_tag="PCH_Pc20g02270"
FT   intron          complement(516909..516979)
FT                   /gene="Pc20g02270"
FT                   /locus_tag="PCH_Pc20g02270"
FT                   /number=1
FT   exon            complement(516980..517160)
FT                   /gene="Pc20g02270"
FT                   /locus_tag="PCH_Pc20g02270"
FT                   /number=2
FT   intron          complement(517161..517215)
FT                   /gene="Pc20g02270"
FT                   /locus_tag="PCH_Pc20g02270"
FT                   /number=2
FT   exon            complement(517216..517612)
FT                   /gene="Pc20g02270"
FT                   /locus_tag="PCH_Pc20g02270"
FT                   /number=3
FT   intron          complement(517613..517675)
FT                   /gene="Pc20g02270"
FT                   /locus_tag="PCH_Pc20g02270"
FT                   /number=3
FT   exon            complement(517676..518094)
FT                   /gene="Pc20g02270"
FT                   /locus_tag="PCH_Pc20g02270"
FT                   /number=4
FT   sig_peptide     complement(518020..518094)
FT                   /gene="Pc20g02270"
FT                   /locus_tag="PCH_Pc20g02270"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<519649..519772,519836..519861,519919..519955,
FT                   520009..520082,520149..520528,520601..>521126)
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT   CDS_pept        join(519649..519772,519836..519861,519919..519955,
FT                   520009..520082,520149..520528,520601..521126)
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT                   /note="Title: similarity to integral membrane protein PTH11
FT                   - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85557"
FT                   /db_xref="GOA:B6HEB6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB6"
FT                   /inference="similar to AA sequence:TREMBL:AF119670.1"
FT                   /protein_id="CAP85557.1"
FT                   /translation="MIDDHHQKTALGIVVAFTILGGIAVLLRLWSRWLSRSTLTVDDYL
FT                   IVVGYILAISQSVASWYYIKTNYVGIHVWDIPKSYNPRPGLNWNFANQLLYNPALTVVK
FT                   LSILVFLRRLDSRSRVVKYLILSSYVVVISLFIAVLFVDIFQCHPVQYVYDTTIPGGKC
FT                   INQGAFFVSTAALNLFTDIMVLAIPIIITARLQMPLRRKVAVCVILCLGGVATAIGVWR
FT                   VIILAKGFLSHTPNPDATYGIGFCSSAIEVNVAVVTACGPSLKAISSRFLPRLLDSSRG
FT                   KSTYGAGTGSRTLRSNRFKSASHAQPSVHSTRGADYEMADPLGGPRVDIIGDFEMRKYK
FT                   RGESSSLSSGDDKGIMKTTDISVGYSMEPRVGDGRSQEGRPASVDSMI"
FT   exon            519649..519772
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT                   /number=1
FT   intron          519773..519835
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT                   /number=1
FT   exon            519836..519861
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT                   /number=2
FT   intron          519862..519918
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT                   /number=2
FT   exon            519919..519955
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT                   /number=3
FT   intron          519956..520008
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT                   /number=3
FT   exon            520009..520082
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT                   /number=4
FT   intron          520083..520148
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT                   /number=4
FT   exon            520149..520528
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT                   /number=5
FT   intron          520529..520600
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT                   /number=5
FT   exon            520601..521126
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT                   /number=6
FT   mRNA            complement(<521455..>521964)
FT                   /gene="Pc20g02290"
FT                   /locus_tag="PCH_Pc20g02290"
FT   CDS_pept        complement(<521455..>521964)
FT                   /pseudo
FT                   /gene="Pc20g02290"
FT                   /locus_tag="PCH_Pc20g02290"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to dicarboxylic amino acid
FT                   permease Dip5 - Saccharomyces cerevisiae [truncated
FT                   ORF][putative pseudogene]"
FT                   /inference="similar to AA sequence:PIR:S65298"
FT                   /inference="protein motif:COGS:COG0833"
FT   mat_peptide     complement(<521455..521892)
FT                   /gene="Pc20g02290"
FT                   /locus_tag="PCH_Pc20g02290"
FT   exon            complement(<521455..>521964)
FT                   /gene="Pc20g02290"
FT                   /locus_tag="PCH_Pc20g02290"
FT                   /number=1
FT   sig_peptide     complement(521893..>521964)
FT                   /gene="Pc20g02290"
FT                   /locus_tag="PCH_Pc20g02290"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(<522388..>525876)
FT                   /gene="Pc20g02300"
FT                   /locus_tag="PCH_Pc20g02300"
FT   CDS_pept        complement(<522388..>525876)
FT                   /pseudo
FT                   /gene="Pc20g02300"
FT                   /locus_tag="PCH_Pc20g02300"
FT                   /note="putative pseudogene"
FT                   /note="Title: weak similarity to retrotransposon Tto1
FT                   -Nicotiana tabacum [truncated ORF][putative pseudogene]"
FT                   /inference="protein motif:PFAM:PF00665"
FT   exon            complement(<522388..>525876)
FT                   /gene="Pc20g02300"
FT                   /locus_tag="PCH_Pc20g02300"
FT                   /number=1
FT   mRNA            complement(<526297..>527178)
FT                   /gene="Pc20g02310"
FT                   /locus_tag="PCH_Pc20g02310"
FT   CDS_pept        complement(<526297..>527178)
FT                   /pseudo
FT                   /gene="Pc20g02310"
FT                   /locus_tag="PCH_Pc20g02310"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to retrotransposon like protein
FT                   An10g00740 - Aspergillus niger [truncated ORF][putative
FT                   pseudogene]"
FT   exon            complement(<526297..>527178)
FT                   /gene="Pc20g02310"
FT                   /locus_tag="PCH_Pc20g02310"
FT                   /number=1
FT   mRNA            complement(join(<527918..528640,528692..528799,
FT                   528857..529004,529059..>529183))
FT                   /gene="Pc20g02320"
FT                   /locus_tag="PCH_Pc20g02320"
FT   CDS_pept        complement(join(<527918..528640,528692..528799,
FT                   528857..529004,529059..>529183))
FT                   /pseudo
FT                   /gene="Pc20g02320"
FT                   /locus_tag="PCH_Pc20g02320"
FT                   /note="putative pseudogene"
FT                   /note="Title: strong similarity to dicarboxylic amino acid
FT                   permease Dip5 - Saccharomyces cerevisiae [truncated
FT                   ORF][putative pseudogene]"
FT                   /db_xref="PSEUDO:CAP85561.1"
FT                   /inference="similar to AA sequence:PIR:S65298"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /inference="protein motif:COGS:COG0833"
FT   exon            complement(<527918..528640)
FT                   /gene="Pc20g02320"
FT                   /locus_tag="PCH_Pc20g02320"
FT                   /number=1
FT   intron          complement(528641..528691)
FT                   /gene="Pc20g02320"
FT                   /locus_tag="PCH_Pc20g02320"
FT                   /number=1
FT   exon            complement(528692..528799)
FT                   /gene="Pc20g02320"
FT                   /locus_tag="PCH_Pc20g02320"
FT                   /number=2
FT   intron          complement(528800..528856)
FT                   /gene="Pc20g02320"
FT                   /locus_tag="PCH_Pc20g02320"
FT                   /number=2
FT   exon            complement(528857..529004)
FT                   /gene="Pc20g02320"
FT                   /locus_tag="PCH_Pc20g02320"
FT                   /number=3
FT   intron          complement(529005..529058)
FT                   /gene="Pc20g02320"
FT                   /locus_tag="PCH_Pc20g02320"
FT                   /number=3
FT   exon            complement(529059..>529183)
FT                   /gene="Pc20g02320"
FT                   /locus_tag="PCH_Pc20g02320"
FT                   /number=4
FT   mRNA            join(<529691..529880,529948..530165,530227..>531501)
FT                   /gene="Pc20g02330"
FT                   /locus_tag="PCH_Pc20g02330"
FT   CDS_pept        join(529691..529880,529948..530165,530227..531501)
FT                   /gene="Pc20g02330"
FT                   /locus_tag="PCH_Pc20g02330"
FT                   /note="unknown EC_number=3.1.6.1"
FT                   /note="Title: strong similarity to arylsulfatase atsA
FT                   -Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02330"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85562"
FT                   /db_xref="GOA:B6HED5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED5"
FT                   /inference="similar to AA sequence:PIR:S69336"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /inference="protein motif:COGS:COG3119"
FT                   /protein_id="CAP85562.1"
FT                   /translation="MTRPNFLVIVADDLGFSDTGAFGGEIKTPNIDNLANGRLRFTDFH
FT                   AASACSPTRAMLLSGTDNHIAGIGTMSETWTGDQKGKPGYEGYLNDRVAPFPELLQAAG
FT                   YHTLMSGKWHLGLTPERWPCRRGFDRSFSLLPGAANHYAWEPQLEESNNAPGLLGETNV
FT                   FYVENDKHIQPQELGDDFYSSDAFATKLIRYLDERDAAEKEKPFFAYLAFSAPHWPLQA
FT                   PDSDIQDYRGVYDEGPEALRQRRLKRLKELGLIPEHTVPHDVVAVGGHDLSRDWGELDA
FT                   EKQAFSARTMECYSGMVQNMDRHIGRVVEYLREQGELENTFILFMSDNGAEGLLLEAIP
FT                   IIKGDVHDHIAQYYDNSLQNMGRKNSYVWYGPHWASAATAPGRLYKSFTTEGGIRVPFI
FT                   LNYPPLTARSYPGGIDHSFATVMDIAPTILELAGVDHPGTTYRGRTVAPIRGKSWVPYL
FT                   TGQTGSIHSDNAVMAWELFGRQAIRKGRYKAVYIPKPYGPERWQLYDLVQDPGERDDLT
FT                   DHLPDTFADLIKEWDRYVYDVGLVQGSAQPSYVVEEKGYCYED"
FT   exon            529691..529880
FT                   /gene="Pc20g02330"
FT                   /locus_tag="PCH_Pc20g02330"
FT                   /number=1
FT   intron          529881..529947
FT                   /gene="Pc20g02330"
FT                   /locus_tag="PCH_Pc20g02330"
FT                   /number=1
FT   exon            529948..530165
FT                   /gene="Pc20g02330"
FT                   /locus_tag="PCH_Pc20g02330"
FT                   /number=2
FT   intron          530166..530226
FT                   /gene="Pc20g02330"
FT                   /locus_tag="PCH_Pc20g02330"
FT                   /number=2
FT   exon            530227..531501
FT                   /gene="Pc20g02330"
FT                   /locus_tag="PCH_Pc20g02330"
FT                   /number=3
FT   mRNA            complement(<531801..>532268)
FT                   /gene="Pc20g02340"
FT                   /locus_tag="PCH_Pc20g02340"
FT   CDS_pept        complement(531801..532268)
FT                   /gene="Pc20g02340"
FT                   /locus_tag="PCH_Pc20g02340"
FT                   /note="Title: similarity to 2-aminomuconate deaminase like
FT                   protein - Dictyostelium discoideum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85563"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED6"
FT                   /inference="similar to AA sequence:TREMBL:AC116305.72"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /inference="protein motif:COGS:COG0251"
FT                   /protein_id="CAP85563.1"
FT                   /translation="MSSTIPYFRPSNHAQGLANYPHARTVPSSNGQGSYIYVSGTSSRR
FT                   GDGTFVGATRTEDSAGKVTLDLDIRQQTASVLSNIHADIQAASKGKAGIHDVVDATVFL
FT                   TSINGDYSGMNEEWNRVWPDRTTAPARTTVEVRALPREEILVEIKCVAYYQ"
FT   exon            complement(531801..532268)
FT                   /gene="Pc20g02340"
FT                   /locus_tag="PCH_Pc20g02340"
FT                   /number=1
FT   mRNA            complement(join(<533127..534001,534057..534295,
FT                   534379..>534788))
FT                   /gene="Pc20g02350"
FT                   /locus_tag="PCH_Pc20g02350"
FT   CDS_pept        complement(join(533127..534001,534057..534295,
FT                   534379..534788))
FT                   /gene="Pc20g02350"
FT                   /locus_tag="PCH_Pc20g02350"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig31_part_ii.tfa_3530wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85564"
FT                   /db_xref="GOA:B6HED7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED7"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /inference="protein motif:COGS:COG1012"
FT                   /protein_id="CAP85564.1"
FT                   /translation="MDAVSTLWELDTLESANDYLASHGSNAPRLQHFIDGSFGRHSEPV
FT                   EWIESLNPRSGRLLAQIPSGTVTDVDRAVDAASIAFLTWSKTSRQERSQVLMRISDILG
FT                   EKKELFAVWESIDQGKTLARARVEVERAISNFRLFSLRYFATYILHEEGAVRYVDGQPF
FT                   TLTYEHRSPVGVFGLISPWNMPLYLLTWKIAPCLAFGCTGVAKPSEVTSITAFLLGEVF
FT                   RQAKLPAGVMNLVFGDGPGTGSALVKSSRVRGVSFTGGTNTGIRIRQDTVADIGKHLSL
FT                   ELGGKNPVLVFDDVDLTKAVPLAARAAFENSGQVCLCGSRIYVQRAVYAKFLSALVEYV
FT                   ESNYKLGETMGPVVSREHYLKIRGYLVQAQEENAVFHTGDVPDEEPQQGFWITPTVLTN
FT                   LPTGSRVMREEIFGPVVTVCPFGTEEEAIALANDNPNGLAGIVMTNNLARMRRVGERID
FT                   AGLIWVNCWLVRELGTGFGGMKASGTGREGGAHSRDVFTNLRTLHVSHF"
FT   exon            complement(533127..534001)
FT                   /gene="Pc20g02350"
FT                   /locus_tag="PCH_Pc20g02350"
FT                   /number=1
FT   intron          complement(534002..534056)
FT                   /gene="Pc20g02350"
FT                   /locus_tag="PCH_Pc20g02350"
FT                   /number=1
FT   exon            complement(534057..534295)
FT                   /gene="Pc20g02350"
FT                   /locus_tag="PCH_Pc20g02350"
FT                   /number=2
FT   intron          complement(534296..534378)
FT                   /gene="Pc20g02350"
FT                   /locus_tag="PCH_Pc20g02350"
FT                   /number=2
FT   exon            complement(534379..534788)
FT                   /gene="Pc20g02350"
FT                   /locus_tag="PCH_Pc20g02350"
FT                   /number=3
FT   mRNA            complement(join(<535150..535612,535674..>536296))
FT                   /gene="Pc20g02360"
FT                   /locus_tag="PCH_Pc20g02360"
FT   CDS_pept        complement(join(535150..535612,535674..536296))
FT                   /gene="Pc20g02360"
FT                   /locus_tag="PCH_Pc20g02360"
FT                   /note="Title: similarity to hypothetical conserved protein
FT                   SCIF3.07c - Streptomyces coelicolor"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02360"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85565"
FT                   /db_xref="GOA:B6HED8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED8"
FT                   /inference="similar to AA sequence:TREMBL:SCO939127.49"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /inference="protein motif:COGS:COG2159"
FT                   /inference="protein motif:COGS:COG3618"
FT                   /protein_id="CAP85565.1"
FT                   /translation="MPPYLPDFSTSHCMSQSNSQEWITLRPHDTPGGISDGQNSPTASK
FT                   VDMFVGDRFFRTVEPNCFDPYVRIAEMDASGVDVQVISTVPVLFSYDKPVEPAAAMARY
FT                   LNDHIASVCRDHPRRFVGLATVPLQDVAVSIKELRRAKDILGLKGVEIGTEVSGKTLNS
FT                   ADFEPFWTACEELDFPIFVHPLGYELEQENKERWGKYWSAWLIGMPSETALAMHSILSS
FT                   GVLVRHPNLRFCFAHAGGAYLPLLGRIQHGYDCRPDLVAHSSQGVLPQDYIQSQQHNIW
FT                   LDSLVHDPDLLQFICKKIGAERIIMGSDYPFPLGEMPVPGEMLASDAQVGSFLSQEKRA
FT                   QMLSGNAIEFLGLEGMFPGCK"
FT   exon            complement(535150..535612)
FT                   /gene="Pc20g02360"
FT                   /locus_tag="PCH_Pc20g02360"
FT                   /number=1
FT   intron          complement(535613..535673)
FT                   /gene="Pc20g02360"
FT                   /locus_tag="PCH_Pc20g02360"
FT                   /number=1
FT   exon            complement(535674..536296)
FT                   /gene="Pc20g02360"
FT                   /locus_tag="PCH_Pc20g02360"
FT                   /number=2
FT   mRNA            join(<536814..536988,537065..537078,537150..537255,
FT                   537305..>537567)
FT                   /gene="Pc20g02370"
FT                   /locus_tag="PCH_Pc20g02370"
FT   CDS_pept        join(536814..536988,537065..537078,537150..537255,
FT                   537305..537567)
FT                   /gene="Pc20g02370"
FT                   /locus_tag="PCH_Pc20g02370"
FT                   /note="unknown EC_number=1.13.11.6"
FT                   /note="Title: strong similarity to 3-hydroxyanthranilic
FT                   acid dioxygenase Bna1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85566"
FT                   /db_xref="GOA:B6HED9"
FT                   /db_xref="InterPro:IPR010329"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED9"
FT                   /inference="similar to AA sequence:PIR:S57043"
FT                   /inference="protein motif:PFAM:PF06052"
FT                   /protein_id="CAP85566.1"
FT                   /translation="MEHASSAQTSIPGPVTLHSWLSANAQKLQPPVNNQCLYSGKDFIL
FT                   MAVGGPNTRNDYHINQTEEWFYQIKGDMLLKIVENGTCFRDIEIREGEMFLLPGDIPHC
FT                   PIRYEETIGLVMERTRPPHVVDRIRWYCPNADAHRTVPSIIREESFHCADIETQLKDLI
FT                   NHWMTDESTRKCGGCGEIAPPH"
FT   exon            536814..536988
FT                   /gene="Pc20g02370"
FT                   /locus_tag="PCH_Pc20g02370"
FT                   /number=1
FT   intron          536989..537064
FT                   /gene="Pc20g02370"
FT                   /locus_tag="PCH_Pc20g02370"
FT                   /number=1
FT   exon            537065..537078
FT                   /gene="Pc20g02370"
FT                   /locus_tag="PCH_Pc20g02370"
FT                   /number=2
FT   intron          537079..537149
FT                   /gene="Pc20g02370"
FT                   /locus_tag="PCH_Pc20g02370"
FT                   /number=2
FT   exon            537150..537255
FT                   /gene="Pc20g02370"
FT                   /locus_tag="PCH_Pc20g02370"
FT                   /number=3
FT   intron          537256..537304
FT                   /gene="Pc20g02370"
FT                   /locus_tag="PCH_Pc20g02370"
FT                   /number=3
FT   exon            537305..537567
FT                   /gene="Pc20g02370"
FT                   /locus_tag="PCH_Pc20g02370"
FT                   /number=4
FT   mRNA            complement(join(<537709..539818,539884..>540038))
FT                   /gene="Pc20g02380"
FT                   /locus_tag="PCH_Pc20g02380"
FT   CDS_pept        complement(join(537709..539818,539884..540038))
FT                   /gene="Pc20g02380"
FT                   /locus_tag="PCH_Pc20g02380"
FT                   /note="Title: weak similarity to hypothetical transcription
FT                   regulator SPBC530.05 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85567"
FT                   /db_xref="GOA:B6HEE0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE0"
FT                   /inference="similar to AA sequence:PIR:T40521"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP85567.1"
FT                   /translation="MNERQRVWRACQICRRKKVKCDGEHPCESCTRNQAECVYIDPSVN
FT                   MRMVDPQYLMKLERQIQLMEKRLHQQSQAQPSTGHDDQLSENVQAGEEDLDSGGAMLRS
FT                   VPRPIAANVSHSDDANHGPCLLPDQPADGLHEGPEAQQQEDVVTAPQPPEPAAIDVTRL
FT                   PEPLLRLMIDLFYRSIYPIFPIISQRDFQPQFDRWLSAHQGCLGSEDDDFLLLLYALLA
FT                   VASFLLPEEHAIFDQPHLKAYKRVDLGGLLCSHATSKFPGRPTAHNATSATNLVVAQGL
FT                   LTFYLTECGKVNDAWITVGHAIRLYQALDLENGVDAAAEVEARCGVHGNIWWCLYILDR
FT                   SLSTALLKPLAIDNSESNMDHYDGESQLTLIPEDKIDPWFAVIAEFHIIMGRIYKSVRW
FT                   IRRRHQPQNAAHGDNSMLQSYMKKYDTELQTYYTKRVLPKMEGPHSAARPLALQNVAES
FT                   SYYIGIVLLYRTFIERLKIEDPEVFLRCAEAASNCIRVTPQVMATVPASHFVIQQCRAV
FT                   YTSTKVLLHCIRMAKNTGYTNKAWPDVQRGCDMLRKTKIQWPEVKRYQQVTEEDMYLTQ
FT                   VHLSKHELFHRVFGRYGMESQIRPSGNGETNHGSPCRTRTSHTDRPQGSPGVADNDAIS
FT                   SHRDPLNNAPEVDLTRTPQSLLSHNYGQESRLPERQPKRRRLSQNFNVHPAPSPYYALN
FT                   TPPILSEADRLPMLNAAIGSSDFLLPGIPPLPSVPRDCTPDLLDDSMLMSSFDLFFSHS
FT                   E"
FT   exon            complement(537709..539818)
FT                   /gene="Pc20g02380"
FT                   /locus_tag="PCH_Pc20g02380"
FT                   /number=1
FT   intron          complement(539819..539883)
FT                   /gene="Pc20g02380"
FT                   /locus_tag="PCH_Pc20g02380"
FT                   /number=1
FT   exon            complement(539884..540038)
FT                   /gene="Pc20g02380"
FT                   /locus_tag="PCH_Pc20g02380"
FT                   /number=2
FT   mRNA            <540948..>542402
FT                   /gene="Pc20g02390"
FT                   /locus_tag="PCH_Pc20g02390"
FT   CDS_pept        540948..542402
FT                   /gene="Pc20g02390"
FT                   /locus_tag="PCH_Pc20g02390"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   ydcJ - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02390"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85568"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE1"
FT                   /inference="similar to AA sequence:PIR:B64894"
FT                   /inference="protein motif:COGS:COG5383"
FT                   /protein_id="CAP85568.1"
FT                   /translation="MKSETTSRHHAAPAKIRDAFSRAMSAMYASEVPLYGRLLSLVSRV
FT                   NKTTLEQDGLLRQRLEATDDLDRIDMERHGAIRVGTPAELHSVRRVLHVMNMLPTGFYD
FT                   LSAAGVPVYATCFRPHSASELSKNPFRLFVSLLQLHLITDEKLRTIATETLARRQIFSD
FT                   RMYELLDICERYGGLTDAEAEEFVQEARDSFRWHASAAVPYDDYMRLLRDNSVLADIVA
FT                   FRSPHINHLTPRTLDIDEVQSDMLNQGIPLKEYVEGPPKRKCPILLRQTSFKAIEEAIE
FT                   FPNGNKCDPRVLPSAVSGYHTARFGEVEQRGVALTIKGRQMYDSMLQSALQDGITAAHG
FT                   DAYSLKFARFPDSWEELRAEGLAWFQYRVDWDQLQSSETPKSDDLEYLIRSGYVVYEPI
FT                   VYEDFLPISAAGIFQSNLAKPGTTNGGSPKMVPCSNRREFELALGAATMDEMILYKNIQ
FT                   EESLLKCRQCVQDLKLGAATRQENSM"
FT   exon            540948..542402
FT                   /gene="Pc20g02390"
FT                   /locus_tag="PCH_Pc20g02390"
FT                   /number=1
FT   mRNA            complement(<542632..>543633)
FT                   /gene="Pc20g02400"
FT                   /locus_tag="PCH_Pc20g02400"
FT   CDS_pept        complement(542632..543633)
FT                   /gene="Pc20g02400"
FT                   /locus_tag="PCH_Pc20g02400"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg06586.1 - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85569"
FT                   /db_xref="GOA:B6HEE2"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE2"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /inference="protein motif:COGS:COG0604"
FT                   /inference="protein motif:COGS:COG1064"
FT                   /protein_id="CAP85569.1"
FT                   /translation="MDTLPQSMKAVVIDKHGDSSVLRLETQHPLPVMNETDVLVKVHYA
FT                   GINFVDTYQRSGLYPVKLPLQVGREGAGTIVDIGSNVPPSYGLQVGNRVAVFTQGTTAE
FT                   YVSAPAESVMVLPRSVSTEQGAAIMLQGLTAWTIVQDAHKVEQGQTILIQAAAGGTGGM
FT                   LVQMCKHLGATVIGTVSTPKKAETARKHGCDHVILYKDNDVQEEVMRITSTKGCHAVLS
FT                   GVGEATFAEDLACTRRKGTLVSYGNSSGAVSSFRVLDLSKKNVKLVRPTLANYIMERDE
FT                   FVLRSQQLLDLVGSGVVRPELGGEYRLGEVAQAQDDLTTQKTTGKLLINIQT"
FT   exon            complement(542632..543633)
FT                   /gene="Pc20g02400"
FT                   /locus_tag="PCH_Pc20g02400"
FT                   /number=1
FT   mRNA            join(<544742..544771,544857..544944,545000..546244,
FT                   546295..>546431)
FT                   /gene="Pc20g02410"
FT                   /locus_tag="PCH_Pc20g02410"
FT   CDS_pept        join(544742..544771,544857..544944,545000..546244,
FT                   546295..546431)
FT                   /gene="Pc20g02410"
FT                   /locus_tag="PCH_Pc20g02410"
FT                   /note="unknown EC_number=1.2.1.16"
FT                   /note="Title: strong similarity to succinate-semialdehyde
FT                   dehydrogenase NAD(P)+ gabD - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85570"
FT                   /db_xref="GOA:B6HEE3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE3"
FT                   /inference="similar to AA sequence:PIR:F65045"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /inference="protein motif:COGS:COG1012"
FT                   /protein_id="CAP85570.1"
FT                   /translation="MATQYQLPFKLSDPSLLKFDSVIGDKWVGAKSGKRFEVLDPGTDK
FT                   PWASCPANAAEDVSAAVENAHTAFEQFRKVNPRQRAKWLLEWHNLTVAARDDLAQIVTH
FT                   ETGKPLSEAYGEIDYSLGFLWWFAGEAERIQGSVSTAAAPNRRIFTIKQPIGVAAALVP
FT                   WNFPVAMVLRKVGAALAAGCTMVVKPSPETPISALVLAELAHRAGIPAGVLNVLTTDLE
FT                   NTPALSEALCKHPLVKKVTFTGSTRVGKLVASHCAHGLKKLTLELGGNCPFLVFDDANL
FT                   DQAVEQLMSLKWRHAGQACITANRIYVQAGIYDRFAALLKERTAAIVVGHGAVAGTTMG
FT                   PLTTPRSLDKASAQVEDALRLGADVILGGKAVTSQPGYFFEPTILSGMTEEMLISQEES
FT                   FAPIAALYRFETEEQTVKLANDTSMGLASYAFTKNIDRMWRLLENLEAGMIGMNTGNSS
FT                   AAESPFGGLKESGYGKESGKDVAVNEYLVTKTGTLTIEGQY"
FT   exon            544742..544771
FT                   /gene="Pc20g02410"
FT                   /locus_tag="PCH_Pc20g02410"
FT                   /number=1
FT   intron          544772..544856
FT                   /gene="Pc20g02410"
FT                   /locus_tag="PCH_Pc20g02410"
FT                   /number=1
FT   exon            544857..544944
FT                   /gene="Pc20g02410"
FT                   /locus_tag="PCH_Pc20g02410"
FT                   /number=2
FT   intron          544945..544999
FT                   /gene="Pc20g02410"
FT                   /locus_tag="PCH_Pc20g02410"
FT                   /number=2
FT   exon            545000..546244
FT                   /gene="Pc20g02410"
FT                   /locus_tag="PCH_Pc20g02410"
FT                   /number=3
FT   intron          546245..546294
FT                   /gene="Pc20g02410"
FT                   /locus_tag="PCH_Pc20g02410"
FT                   /number=3
FT   exon            546295..546431
FT                   /gene="Pc20g02410"
FT                   /locus_tag="PCH_Pc20g02410"
FT                   /number=4
FT   mRNA            join(<546638..547738,547804..>547938)
FT                   /gene="Pc20g02420"
FT                   /locus_tag="PCH_Pc20g02420"
FT   CDS_pept        join(546638..547738,547804..547938)
FT                   /gene="Pc20g02420"
FT                   /locus_tag="PCH_Pc20g02420"
FT                   /note="Title: strong similarity to fluG - Aspergillus
FT                   nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85571"
FT                   /db_xref="GOA:B6HEE4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE4"
FT                   /inference="similar to AA sequence:PIR:A53186"
FT                   /inference="protein motif:COGS:COG2159"
FT                   /inference="protein motif:COGS:COG0418"
FT                   /inference="protein motif:COGS:COG3618"
FT                   /protein_id="CAP85571.1"
FT                   /translation="MDDLSLLRHLIQNHPLIDHHAHNLLNPEPATDYDNYPLEAIATSA
FT                   GGRALENARTTLPSLRAASQLSELYGRPCADWNDVQSAHDESMRGDYSNLIQKSLSGTH
FT                   ALLLDDYLSDDEDIESSSWHDSFTASPTKRIVQIEAMAESTILQVSNSRKNGESVWNNF
FT                   RQRFQDALATAMEDANIVGFVSEICCRTGLDVDAYSSDDTTLGGSLIRILDSGTTKSGF
FT                   AVDDKEICDWIVQQTLKAISFKKRAGIVKPLLFHTGLGDNRINLLRANPACLQPLIAQY
FT                   PVADIVLLNAGYPYTREAGYLAATYPNVYLDLGKVFPMVSREAQMKVLRESLELAPTDR
FT                   LLWSTGGRFHPETFWLANRQFRQALETVLVDYVQNGDFMASQAMKIAADVLFYNANRLY
FT                   SLNLTPSYTAAE"
FT   exon            546638..547738
FT                   /gene="Pc20g02420"
FT                   /locus_tag="PCH_Pc20g02420"
FT                   /number=1
FT   intron          547739..547803
FT                   /gene="Pc20g02420"
FT                   /locus_tag="PCH_Pc20g02420"
FT                   /number=1
FT   exon            547804..547938
FT                   /gene="Pc20g02420"
FT                   /locus_tag="PCH_Pc20g02420"
FT                   /number=2
FT   mRNA            complement(join(<548826..550761,550833..552217,
FT                   552323..>552784))
FT                   /gene="Pc20g02430"
FT                   /locus_tag="PCH_Pc20g02430"
FT   CDS_pept        complement(join(548826..550761,550833..552217,
FT                   552323..552784))
FT                   /gene="Pc20g02430"
FT                   /locus_tag="PCH_Pc20g02430"
FT                   /note="Title: strong similarity to two component sensor
FT                   regulator like protein An02g13590 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85572"
FT                   /db_xref="GOA:B6HEE5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE5"
FT                   /inference="protein motif:PFAM:PF00512"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /inference="protein motif:COGS:COG0642"
FT                   /protein_id="CAP85572.1"
FT                   /translation="MDLPRARQDGLHNADRRARELYRYYKPASQAEVVPTWLPANDGFP
FT                   FTANSGNIITPPISEGSVPSHSPPSRPASAGSEALVLGTSNSTMTSFAQLAALRLNAER
FT                   VFVSVLDRDQQHIIAEATKSVNLNDPSIHDDNDNIWLGTSDTRKAWSVCKDIVSLPPND
FT                   RKNADYQFLIVNDMTENERYKHLSFVEKDPNFRFFAGTPLTTERNINLGCFFVLDKKPR
FT                   DGLTPLEKDTLGSISMLVMDYLRVCRQASEGRRAARLSRGLSYFVEGSSSFVDNVDPSR
FT                   TDSVGHLSATPASSYNRISASSRSHGDGSENASQAPSNSPPNDRSLSNDARSFSSVPSD
FT                   LKLDYDWKLGSGSKLDNGSNVESGTVESSLPEWLTSSSRNRLPPDDSQGTSWSFRRAAN
FT                   LLRESLDLSGDGGVIFLEANNSPLMDADMGGDCSDTGGPASVLSASTNEEPFAPQAGSM
FT                   TTCPAANLDRSFLQLLLRRYPKGKLWSFHRDGLISTSDDDDQEAQDKGPLGTSATSRSP
FT                   PNAQPSKPTRKRRKAAENSVLNQYFPHAAQIMFVPLWDAVSSQWFGGCFCWSTIETQVF
FT                   TTSVELSSVLGFSSSIMAEYSRVESLIADRQKGDFIGSISHELRSPLHGILAAAEFLNS
FT                   THLNEFQDSLLETINSCGRTLLDTMNQVLDFSKVVSLERTWRSMKRKKESQLDYKGSDK
FT                   LPHHLDTLVATDVAILAEEVVEGICLGNVYGQSSTASADLPVLMPHQTKSQHQRSNVEV
FT                   VIDVPFRDWVYRTQPGALRRIIMNIFGNAMKYTEFGRVTLSLAASSQSEGRSRRQGLED
FT                   LVTLTVTDTGKGISEEFLRGKLYTPFAQEDALAVGTGLGLSIVRSLVKALNGSIRIRSR
FT                   PGEGTVVRVSLPLERPVGKESPEIEPSGQLMQQRETLTQTLLLREGYLGRRASIWGIDP
FT                   SEVTANSNWSEIARYLSEWYDIEIVAWTPDAHIDLVLMDENDLPNFRTIAPSATLPALL
FT                   VLCHKSVDYTGSKSEWLSLANSVNIIRRPCGPHKLARSVMRCLTHGQPRSTTPASALQP
FT                   LNLPIRTSSLPSELASPHMSTGDDIGAPEQDCPGGRPMTVSPLRQPSPMTALKEEISEA
FT                   PLPDPLVEGAKPSRRLARVLVVDDNRINLNLMMTFLKKRQLTDLDPAENGKLAVEAVER
FT                   MQSGYDIIFMDMSMPVMNGFEATRAIRSLERDTDGRKPAIIIALTGLSSSRDESDAIAS
FT                   GVDLFLTKPVSFREVARLLNEWERGELVTERKMTC"
FT   exon            complement(548826..550761)
FT                   /gene="Pc20g02430"
FT                   /locus_tag="PCH_Pc20g02430"
FT                   /number=1
FT   intron          complement(550762..550832)
FT                   /gene="Pc20g02430"
FT                   /locus_tag="PCH_Pc20g02430"
FT                   /number=1
FT   exon            complement(550833..552217)
FT                   /gene="Pc20g02430"
FT                   /locus_tag="PCH_Pc20g02430"
FT                   /number=2
FT   intron          complement(552218..552322)
FT                   /gene="Pc20g02430"
FT                   /locus_tag="PCH_Pc20g02430"
FT                   /number=2
FT   exon            complement(552323..552784)
FT                   /gene="Pc20g02430"
FT                   /locus_tag="PCH_Pc20g02430"
FT                   /number=3
FT   mRNA            complement(join(<553864..554215,554286..554490,
FT                   554541..554603,554662..555004,555055..555317,
FT                   555376..555487,555544..>555774))
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT   CDS_pept        complement(join(553864..554215,554286..554490,
FT                   554541..554603,554662..555004,555055..555317,
FT                   555376..555487,555544..555774))
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /note="Title: strong similarity to brain-specific
FT                   Na-dependent inorganic phosphate cotransporter like protein
FT                   An04g02720 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85573"
FT                   /db_xref="GOA:B6HEE6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE6"
FT                   /inference="protein motif:COGS:COG2271"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP85573.1"
FT                   /translation="MADDTSDSKSVDVVSAPVREDIKTPSEEPSDNSDDSDGRKPPPLA
FT                   AKLCAVALISCISFGSHWSSGVTGAMKSTMKKEMHIDNVQFSLLEASEDFMATVLLLIS
FT                   GVITDRVGGAQMIVYGNIVYTIGSILVAAAATVRSFDFMIGGRIILALGDIATQIAQYK
FT                   MFSSWFPPSNGFASTLGFELAIGKIGGFIGKSTSNIIASKTGNFAWVFWTAVFMNLFTN
FT                   AASAAFWFFNIYCNRHYKGRRDEATKEQLTEKNKKFEFKKMFELPWMFWAVMGFSIFQT
FT                   SAASVFSQNATELAEKRFNVDSIKAGWYSSLSQYAGFFLVPCLGVFIDVLGNRASVLFI
FT                   CGLGMLLSMVLINFATSHAGTGAAFGIYGIAVSFGPTSVIDSIRTTLWHQSVFGSAYAL
FT                   KVTMNNAMSIIIRIITGALQDADDNSYRRVVQVYLVLGAGATVVGAAILIGSFVTDNLA
FT                   PLQWTRHKRLTSGAAVIERIRERSLVTQRERTRKISILCFAALLLLTVGSWVAYIWGAV
FT                   TGHNS"
FT   exon            complement(553864..554215)
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /number=1
FT   intron          complement(554216..554285)
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /number=1
FT   exon            complement(554286..554490)
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /number=2
FT   intron          complement(554491..554540)
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /number=2
FT   exon            complement(554541..554603)
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /number=3
FT   intron          complement(554604..554661)
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /number=3
FT   exon            complement(554662..555004)
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /number=4
FT   intron          complement(555005..555054)
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /number=4
FT   exon            complement(555055..555317)
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /number=5
FT   intron          complement(555318..555375)
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /number=5
FT   exon            complement(555376..555487)
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /number=6
FT   intron          complement(555488..555543)
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /number=6
FT   exon            complement(555544..555774)
FT                   /gene="Pc20g02440"
FT                   /locus_tag="PCH_Pc20g02440"
FT                   /number=7
FT   mRNA            complement(join(<556632..557376,557428..557624,
FT                   557679..557897,557993..558306,558369..558453,
FT                   558518..>558706))
FT                   /gene="Pc20g02450"
FT                   /locus_tag="PCH_Pc20g02450"
FT   CDS_pept        complement(join(556632..557376,557428..557624,
FT                   557679..557897,557993..558306,558369..558453,
FT                   558518..558706))
FT                   /gene="Pc20g02450"
FT                   /locus_tag="PCH_Pc20g02450"
FT                   /note="Title: strong similarity to trichothecene efflux
FT                   pump TRI12 - Fusarium sporotrichioides"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85574"
FT                   /db_xref="GOA:B6HEE7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR010573"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE7"
FT                   /inference="similar to AA sequence:TREMBL:AF359360.16"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP85574.1"
FT                   /translation="MGSLSTTGNEDGKGLQVDHLETANMAHQEQHVETDRAPEAMGREQ
FT                   AELPKGYFYSPYFIGSYCAIGVAFACGTGGYALVAPILTDINNDLGGSGSSDINWVGIV
FT                   YSLTQAIVLMLAGRLSDLFGRRWFFVIGSVIGLVGSIVGARAGTIGQLIAGETLIGIAA
FT                   GFQCSFFWIVSEIVPMKRRFIANSGLFLWTLPTNNTAVQWRGCFYYLTGLNALSVALWF
FT                   FFYHPPSFHMLHRDKTVKQMVLEFDFIGLVLFSAGMILFLIGLNWGGSIYPWKSGQVLG
FT                   TLLSGVAILAVCIAYELKSSLKEPYLPLQLFKNVKYTSCVVWCAIEAMNFYAFGIIWPR
FT                   AVAILYPSLSPASSATMSGLVTMSFALGQMAGPFFANWLPAKPLVIVGTFIGTGLLAAC
FT                   AANPLNLDLTVGVLVTGNLVIGMADGIGLPMTTFPIKNQEALGTAGGLSGCIRLAGTSV
FT                   AVAMYNTILNNRLLQTIPAAVTPVALSAGVPESFIPQLIANLTRTNRVGGGIPGLTAGD
FT                   VPLIQSAFQLGNSQAYSTVFLSTLGFGGVALILCFLIGGVDESNGEYVAALIQHGDGSD
FT                   QQTEKV"
FT   exon            complement(556632..557376)
FT                   /gene="Pc20g02450"
FT                   /locus_tag="PCH_Pc20g02450"
FT                   /number=1
FT   intron          complement(557377..557427)
FT                   /gene="Pc20g02450"
FT                   /locus_tag="PCH_Pc20g02450"
FT                   /number=1
FT   exon            complement(557428..557624)
FT                   /gene="Pc20g02450"
FT                   /locus_tag="PCH_Pc20g02450"
FT                   /number=2
FT   intron          complement(557625..557678)
FT                   /gene="Pc20g02450"
FT                   /locus_tag="PCH_Pc20g02450"
FT                   /number=2
FT   exon            complement(557679..557897)
FT                   /gene="Pc20g02450"
FT                   /locus_tag="PCH_Pc20g02450"
FT                   /number=3
FT   intron          complement(557898..557992)
FT                   /gene="Pc20g02450"
FT                   /locus_tag="PCH_Pc20g02450"
FT                   /number=3
FT   exon            complement(557993..558306)
FT                   /gene="Pc20g02450"
FT                   /locus_tag="PCH_Pc20g02450"
FT                   /number=4
FT   intron          complement(558307..558368)
FT                   /gene="Pc20g02450"
FT                   /locus_tag="PCH_Pc20g02450"
FT                   /number=4
FT   exon            complement(558369..558453)
FT                   /gene="Pc20g02450"
FT                   /locus_tag="PCH_Pc20g02450"
FT                   /number=5
FT   intron          complement(558454..558517)
FT                   /gene="Pc20g02450"
FT                   /locus_tag="PCH_Pc20g02450"
FT                   /number=5
FT   exon            complement(558518..558706)
FT                   /gene="Pc20g02450"
FT                   /locus_tag="PCH_Pc20g02450"
FT                   /number=6
FT   mRNA            complement(join(<559352..559801,559865..559946,
FT                   560049..560126,560196..560343,560424..>560496))
FT                   /gene="Pc20g02460"
FT                   /locus_tag="PCH_Pc20g02460"
FT   CDS_pept        complement(join(559352..559801,559865..559946,
FT                   560049..560126,560196..560343,560424..560496))
FT                   /gene="Pc20g02460"
FT                   /locus_tag="PCH_Pc20g02460"
FT                   /note="unknown EC_number=1.1.1.-"
FT                   /note="Title: similarity to short-chain dehydrogenase sou1
FT                   - Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85575"
FT                   /db_xref="GOA:B6HEE8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE8"
FT                   /inference="similar to AA sequence:SWISSPROT:SOU1_CANAL"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /inference="protein motif:COGS:COG1028"
FT                   /protein_id="CAP85575.1"
FT                   /translation="MASQSAIQESLQSYKTTSTVDDFHSGGDGIGLALVKAVVEFGGHV
FT                   AVIDYREVPHLDLCEIQDLHKESRVKYFSVDITNEMLVTKAFDGILAEFGRIDGVIACA
FT                   GVCVEKPFVDHTWEEVVRLQMVNSVGLFFAVQLAVKAMLKNQPTSGDFTPKGSVILIGS
FT                   IATESGVESQGLTAYSASKGAANGLLRGLAVELAPMGIRVNMISPGHTVTDMSISQFTN
FT                   RPELAMIMRNAVPMGRMGDRRDLKGAAVYFLSDASLYTTGSNLVISGGLHAGRL"
FT   exon            complement(559352..559801)
FT                   /gene="Pc20g02460"
FT                   /locus_tag="PCH_Pc20g02460"
FT                   /number=1
FT   intron          complement(559802..559864)
FT                   /gene="Pc20g02460"
FT                   /locus_tag="PCH_Pc20g02460"
FT                   /number=1
FT   exon            complement(559865..559946)
FT                   /gene="Pc20g02460"
FT                   /locus_tag="PCH_Pc20g02460"
FT                   /number=2
FT   intron          complement(559947..560048)
FT                   /gene="Pc20g02460"
FT                   /locus_tag="PCH_Pc20g02460"
FT                   /number=2
FT   exon            complement(560049..560126)
FT                   /gene="Pc20g02460"
FT                   /locus_tag="PCH_Pc20g02460"
FT                   /number=3
FT   intron          complement(560127..560195)
FT                   /gene="Pc20g02460"
FT                   /locus_tag="PCH_Pc20g02460"
FT                   /number=3
FT   exon            complement(560196..560343)
FT                   /gene="Pc20g02460"
FT                   /locus_tag="PCH_Pc20g02460"
FT                   /number=4
FT   intron          complement(560344..560423)
FT                   /gene="Pc20g02460"
FT                   /locus_tag="PCH_Pc20g02460"
FT                   /number=4
FT   exon            complement(560424..560496)
FT                   /gene="Pc20g02460"
FT                   /locus_tag="PCH_Pc20g02460"
FT                   /number=5
FT   mRNA            <560857..>561303
FT                   /gene="Pc20g02470"
FT                   /locus_tag="PCH_Pc20g02470"
FT   CDS_pept        560857..561303
FT                   /gene="Pc20g02470"
FT                   /locus_tag="PCH_Pc20g02470"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1190_scaffold_2.tfa_630wg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85576"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE9"
FT                   /inference="protein motif:COGS:COG3631"
FT                   /protein_id="CAP85576.1"
FT                   /translation="MGTKKFTAREVLDAFYKAEREYMQATPEQRDYASIAATLAPNVRM
FT                   EQTSALPYAGVYIGPDGMQDWTRRMADYFEVVDVQNPEIFERAGSEKIVVLSNVHFKVR
FT                   KTGKEMDFPFCQAITVDLERGVIVELRPFYWDVAEVNKSLGYAP"
FT   exon            560857..561303
FT                   /gene="Pc20g02470"
FT                   /locus_tag="PCH_Pc20g02470"
FT                   /number=1
FT   mRNA            <561986..>563425
FT                   /gene="Pc20g02480"
FT                   /locus_tag="PCH_Pc20g02480"
FT   CDS_pept        561986..563425
FT                   /gene="Pc20g02480"
FT                   /locus_tag="PCH_Pc20g02480"
FT                   /note="unknown EC_number=1.2.1.-"
FT                   /note="Title: strong similarity to salicylaldehyde
FT                   dehydrogenase doxF - Pseudomonas sp."
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85577"
FT                   /db_xref="GOA:B6HEG4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG4"
FT                   /inference="similar to AA sequence:PIR:E49343"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /inference="protein motif:COGS:COG1012"
FT                   /protein_id="CAP85577.1"
FT                   /translation="MSLAFNTDSVVPLWLNGAQRVTKTTFDVVSPVSHQALWKASAADE
FT                   GDVEDAIASAATAFETWRWTKPQERREIFLRAYELLKERRDQSMAYSTAETGVPPVMFG
FT                   VEYNGAIDICLQLAGLSAHYGTVVDPDANDTSAVVISQPYGVVLGIGPWNAPHTLGMRA
FT                   CLFPLAAGNTVILKGPEMAPATYWHFVSILHEAGLPAGCLNTIYHRPSDAAAITKQLIS
FT                   HPAIRKVNFTGSTAVGSVIAGLCGQYIKPCLLELGGKASVIVCEDANLELAAEQCALGA
FT                   FSHAGQVCMSTERIIVHDTVADRFRPILKAAIDRIFGEGQPASILINETAAAKVRGLVQ
FT                   DAVTKGANLLYGSLSDGSEGVNRLLPVVVEDVQPGMDIYYNESFGPSVSLYTFTDDEQA
FT                   LKLANDTAYGLTGAVFTEDLRRGLSLAKRLETGAVHINNMTAHDEASLPHGGVKDSGFG
FT                   RFNGPDGLREWVKTKSITWRD"
FT   exon            561986..563425
FT                   /gene="Pc20g02480"
FT                   /locus_tag="PCH_Pc20g02480"
FT                   /number=1
FT   mRNA            complement(join(<563880..564538,564603..564624,
FT                   564673..564764,564912..564997,565044..>565180))
FT                   /gene="Pc20g02490"
FT                   /locus_tag="PCH_Pc20g02490"
FT   CDS_pept        complement(join(563880..564538,564603..564624,
FT                   564673..564764,564912..564997,565044..565180))
FT                   /gene="Pc20g02490"
FT                   /locus_tag="PCH_Pc20g02490"
FT                   /note="unknown EC_number=1.1.1.1"
FT                   /note="Title: strong similarity to alcohol dehydrogenase 2
FT                   Adh2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85578"
FT                   /db_xref="GOA:B6HEG5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG5"
FT                   /inference="similar to AA sequence:TREMBL:SCADHR2.1"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /inference="protein motif:COGS:COG1064"
FT                   /inference="protein motif:COGS:COG0604"
FT                   /inference="protein motif:COGS:COG1063"
FT                   /protein_id="CAP85578.1"
FT                   /translation="MSLPQKQLCAWVESPGPEAKIEFRDIEVPNPTAGQVLVKLEVSGV
FT                   CHSDHHSIYGNTPMTTHIAGHEGVGIVVADYLRWLHRACRKCATCEMDYTHCPHQDNSG
FT                   RNVPGTFQADADYISRIPAEVPAALAAPLLCGGITMYGALSRAELRAGDFVVIPGAGGG
FT                   LGHLGVQIATSMGFQVIAIDSGDKEDICRDSGARHFFDFRQSGASLVDDVRAAAGGIGA
FT                   HAVICITGAPSAYDSALAMLRNLGRLVCVGIPPAEYRLQLNPFEVLVRGLRVIGSTVGN
FT                   SAQMPLLMDLVLQGKVRPHVQVYTFQELRDVMDKLEHGTVAGRAVLRISD"
FT   exon            complement(563880..564538)
FT                   /gene="Pc20g02490"
FT                   /locus_tag="PCH_Pc20g02490"
FT                   /number=1
FT   intron          complement(564539..564602)
FT                   /gene="Pc20g02490"
FT                   /locus_tag="PCH_Pc20g02490"
FT                   /number=1
FT   exon            complement(564603..564624)
FT                   /gene="Pc20g02490"
FT                   /locus_tag="PCH_Pc20g02490"
FT                   /number=2
FT   intron          complement(564625..564672)
FT                   /gene="Pc20g02490"
FT                   /locus_tag="PCH_Pc20g02490"
FT                   /number=2
FT   exon            complement(564673..564764)
FT                   /gene="Pc20g02490"
FT                   /locus_tag="PCH_Pc20g02490"
FT                   /number=3
FT   intron          complement(564765..564911)
FT                   /gene="Pc20g02490"
FT                   /locus_tag="PCH_Pc20g02490"
FT                   /number=3
FT   exon            complement(564912..564997)
FT                   /gene="Pc20g02490"
FT                   /locus_tag="PCH_Pc20g02490"
FT                   /number=4
FT   intron          complement(564998..565043)
FT                   /gene="Pc20g02490"
FT                   /locus_tag="PCH_Pc20g02490"
FT                   /number=4
FT   exon            complement(565044..565180)
FT                   /gene="Pc20g02490"
FT                   /locus_tag="PCH_Pc20g02490"
FT                   /number=5
FT   mRNA            complement(join(<565592..565788,565859..566065,
FT                   566113..566630,566849..567638,567701..567942,
FT                   568007..568110,568164..>568259))
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT   CDS_pept        complement(join(565592..565788,565859..566065,
FT                   566113..566630,566849..567638,567701..567942,
FT                   568007..568110,568164..568259))
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /note="Title: weak similarity to thiamine repressible gene
FT                   thi1p - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85579"
FT                   /db_xref="GOA:B6HEG6"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG6"
FT                   /inference="similar to AA sequence:PIR:S41962"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP85579.1"
FT                   /translation="MLANPAVPATEQQPKRRRVTLACISCRARKSRCSGQRPKCSTCTE
FT                   LGLTCQYVSSGQTDQTVVVGKEHFQTIEERLHHLESLLDQGRASSKRSWSDVDTPDIDN
FT                   QPALTPNLVSTSDGPLTGSIGSDDPTDGMGHFVIAHEEHRAYFGPSSNIAFASELSRTL
FT                   KRLSRSRGEFSPGSKQTTLRDFHIARVSRPSSPMSQSATWAPNNHQQDAATSSIFYLPP
FT                   DQETSVLIDQYFGNTGLLFPYIHEDTFRESYAQLRQNSAGTRRTWLGVLNMVLAMATHT
FT                   TTLPMGKVDKRQAQSEAFYARADGLCSQHVMNGASLEIGQLLVFLSICPGHELFDAIVR
FT                   DIDRKTVQYLLLVSQYMQGTRSSIQTWATHGLAVKVALQLGLHSVEASRRFSPVEREVR
FT                   KRTWFGCIVLDRYPVKETRIGRSDCQGNSQDCSRLYSIMGNAIDLLYDGNLGSEDKILN
FT                   YELITRVLRMRHSLEEWIEQLPAHMRLIRAENCAAELGKDPTNDRFRTILTLRYHNLQV
FT                   LIHRAVLLRLCDYQDQNILALQDIAWSTEQITIESATEIINIVRFVVEAGLVQQGLLGA
FT                   WWFTLYYMFDAALILFTILLVKRFSSIKLYPPTTLDSIKEVFLSCIEPLRRLDEGNRTV
FT                   DKCCRCLQALSEVWNSIEINNEESLAQDIPLLTQPRDYNYHHDNSVVGQEFADQSLSFL
FT                   DFDLMANELFDVTDGLVPGWGVQ"
FT   exon            complement(565592..565788)
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /number=1
FT   intron          complement(565789..565858)
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /number=1
FT   exon            complement(565859..566065)
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /number=2
FT   intron          complement(566066..566112)
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /number=2
FT   exon            complement(566113..566630)
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /number=3
FT   intron          complement(566631..566848)
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /number=3
FT   exon            complement(566849..567638)
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /number=4
FT   intron          complement(567639..567700)
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /number=4
FT   exon            complement(567701..567942)
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /number=5
FT   intron          complement(567943..568006)
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /number=5
FT   exon            complement(568007..568110)
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /number=6
FT   intron          complement(568111..568163)
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /number=6
FT   exon            complement(568164..568259)
FT                   /gene="Pc20g02500"
FT                   /locus_tag="PCH_Pc20g02500"
FT                   /number=7
FT   mRNA            complement(join(<569035..569339,569404..569838,
FT                   569891..>570179))
FT                   /gene="Pc20g02510"
FT                   /locus_tag="PCH_Pc20g02510"
FT   CDS_pept        complement(join(569035..569339,569404..569838,
FT                   569891..570179))
FT                   /gene="Pc20g02510"
FT                   /locus_tag="PCH_Pc20g02510"
FT                   /note="unknown EC_number=1.13.11.4"
FT                   /note="Title: weak similarity to gentisate 1,2-dioxygenases
FT                   xlnE - Pseudomonas alcaligenes"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85580"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG7"
FT                   /inference="protein motif:COGS:COG3435"
FT                   /inference="protein motif:COGS:COG2140"
FT                   /inference="protein motif:COGS:COG3257"
FT                   /protein_id="CAP85580.1"
FT                   /translation="MATETETVSKVEASKNVEASDQEIDTSDGLALALEKLETKPLWTQ
FT                   MTKLNPPLLNPSCVPHVWRYDQIRPSLLKAGELVNESQAERRVLMLVNPARDAPYTTDT
FT                   LYAGLQLVMPNETAQAHRHTAFAMRFIIEGQGGFTAVHGQRISMQRGDVILTPRWNWHD
FT                   HGKDGTGPMIWLDGLDLPNFRHFPVHFVEHYQHARYPADDVDSNTSPIVFPWVKMKQAL
FT                   DDTPGDWASKDYLKSDGRPVSKVLGGSAERLRAGQSSPEIRETASSVYHVVSGRGYSTI
FT                   GDSRITWGPGDTFCIPSWHRYEHFADTEEDVYLYRFHDKPMLDALGFYRVEGVDVESLV
FT                   SD"
FT   exon            complement(569035..569339)
FT                   /gene="Pc20g02510"
FT                   /locus_tag="PCH_Pc20g02510"
FT                   /number=1
FT   intron          complement(569340..569403)
FT                   /gene="Pc20g02510"
FT                   /locus_tag="PCH_Pc20g02510"
FT                   /number=1
FT   exon            complement(569404..569838)
FT                   /gene="Pc20g02510"
FT                   /locus_tag="PCH_Pc20g02510"
FT                   /number=2
FT   intron          complement(569839..569890)
FT                   /gene="Pc20g02510"
FT                   /locus_tag="PCH_Pc20g02510"
FT                   /number=2
FT   exon            complement(569891..570179)
FT                   /gene="Pc20g02510"
FT                   /locus_tag="PCH_Pc20g02510"
FT                   /number=3
FT   mRNA            join(<570487..570734,570769..570952,571026..571395,
FT                   571456..>571565)
FT                   /gene="Pc20g02520"
FT                   /locus_tag="PCH_Pc20g02520"
FT   CDS_pept        join(570487..570734,570769..570952,571026..571395,
FT                   571456..571565)
FT                   /gene="Pc20g02520"
FT                   /locus_tag="PCH_Pc20g02520"
FT                   /note="Title: strong similarity to hypothetical
FT                   2-hydroxyhepta-2,4-diene-1,7-dioate isomerase BH2000
FT                   -Bacillus halodurans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85581"
FT                   /db_xref="GOA:B6HEG8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG8"
FT                   /inference="similar to AA sequence:PIR:H83899"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /inference="protein motif:COGS:COG0179"
FT                   /protein_id="CAP85581.1"
FT                   /translation="MRVAWQRFIRFQAADGRILQGEPILSKPDLDLGYVTEKDRLQARV
FT                   IVGDDILDETGVTRVSDEIVTVRRILSPLAPSDVPTIRGKSTNLQELSELITAVQQAKR
FT                   TPPPFPFIFFKPQTTILDHGDNVVIPKIAQDDQADYEGELTIVIGKDAKDVSQENALDY
FT                   VAAYTVGNDISSRKLQRDPEYAGRIPQWGFSKGFDTYAPIGPCLLASSLVDDPKNLHLT
FT                   TIVDGDVRQDESVDDLLFDCRYLISYLSQGTTLQKGSIIMTGTPGGVGGDMKPPRWLQP
FT                   GTQMEVRISKIGTLRNGVVFAE"
FT   exon            570487..570734
FT                   /gene="Pc20g02520"
FT                   /locus_tag="PCH_Pc20g02520"
FT                   /number=1
FT   intron          570735..570768
FT                   /gene="Pc20g02520"
FT                   /locus_tag="PCH_Pc20g02520"
FT                   /number=1
FT   exon            570769..570952
FT                   /gene="Pc20g02520"
FT                   /locus_tag="PCH_Pc20g02520"
FT                   /number=2
FT   intron          570953..571025
FT                   /gene="Pc20g02520"
FT                   /locus_tag="PCH_Pc20g02520"
FT                   /number=2
FT   exon            571026..571395
FT                   /gene="Pc20g02520"
FT                   /locus_tag="PCH_Pc20g02520"
FT                   /number=3
FT   intron          571396..571455
FT                   /gene="Pc20g02520"
FT                   /locus_tag="PCH_Pc20g02520"
FT                   /number=3
FT   exon            571456..571565
FT                   /gene="Pc20g02520"
FT                   /locus_tag="PCH_Pc20g02520"
FT                   /number=4
FT   mRNA            complement(join(<571971..572158,572221..574056,
FT                   574130..>574301))
FT                   /gene="Pc20g02530"
FT                   /locus_tag="PCH_Pc20g02530"
FT   CDS_pept        complement(join(571971..572158,572221..574056,
FT                   574130..574301))
FT                   /gene="Pc20g02530"
FT                   /locus_tag="PCH_Pc20g02530"
FT                   /note="Title: similarity to multidrug resistance protein
FT                   Hol1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85582"
FT                   /db_xref="GOA:B6HEG9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG9"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP85582.1"
FT                   /translation="MEERTGSDPVQSQPTASRWRRVFGGKAKEDPESGEGQTYRSKSTL
FT                   GILSDKETDEVPGTVLLLSSNRNEPLGMRHQPHRTSTSSITSSYRPSRSNSRTRSAVPT
FT                   QKKTADGQFVLDPQPDDSVNDPLNWPVWQRDAALVSLGFYCLMGGGMTPILAAGFNDVA
FT                   AAYDVSTQQVAFTTGFYMLGLGLGSVVMSPTAILYGKRPVYLLGATLFVVSAVWCAASP
FT                   NYPSLVVARIFQGLAVSPVECLPSATIAEIYFLHERAYRVGIYTLLLLGGKNLIPLVSA
FT                   AIIESLSWRWVFWIVAMIVGMCLVLLFFFVPETFWDRTPRPRVPKQKRPRGPGRSVSDI
FT                   VSHGFRGRRPYVQPQDESTEQDLHDPALAPKKSKHAHVGFADDHPEEGGHAIEPEKSDL
FT                   VPEAGNATNGEQSTNNPPTPSNEKGDDFLQPLPQALVPGAHPDDLETARRAAISPARTE
FT                   SLEPASTPLTATLQYTNRLRERPKIPYSQLLKVWNGRIAQDSWVRVAARPFVLFAYPAV
FT                   LWSTVVYSLSVGWLIVLSESVAHIFQSKDHYNFTSLQTGLIYISPFVGGLLGTAVAGKV
FT                   SDVIARFMTRRNGGVYEPEFRLVMAIPIALSTVIGLMAFGWSAEIGDSWIVPTVFFGLI
FT                   SFGCCLGSTTAITFCVDSYRQYAGEALVTLNFSKNILHGLIFSLFIVDWLDTNGSRTVF
FT                   LSIGGIQLFFMLMSIPMYLYGKRARMWTVRKRLMERL"
FT   exon            complement(571971..572158)
FT                   /gene="Pc20g02530"
FT                   /locus_tag="PCH_Pc20g02530"
FT                   /number=1
FT   intron          complement(572159..572220)
FT                   /gene="Pc20g02530"
FT                   /locus_tag="PCH_Pc20g02530"
FT                   /number=1
FT   exon            complement(572221..574056)
FT                   /gene="Pc20g02530"
FT                   /locus_tag="PCH_Pc20g02530"
FT                   /number=2
FT   intron          complement(574057..574129)
FT                   /gene="Pc20g02530"
FT                   /locus_tag="PCH_Pc20g02530"
FT                   /number=2
FT   exon            complement(574130..574301)
FT                   /gene="Pc20g02530"
FT                   /locus_tag="PCH_Pc20g02530"
FT                   /number=3
FT   mRNA            join(<574868..574963,575051..575173,575261..575397,
FT                   575503..575712,575880..>575925)
FT                   /gene="Pc20g02540"
FT                   /locus_tag="PCH_Pc20g02540"
FT   CDS_pept        join(574868..574963,575051..575173,575261..575397,
FT                   575503..575712,575880..575925)
FT                   /gene="Pc20g02540"
FT                   /locus_tag="PCH_Pc20g02540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85583"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH0"
FT                   /protein_id="CAP85583.1"
FT                   /translation="MWQWGEAVRPFKVLAEYLDLGVVAMVKASSLEVDESDDASPISRF
FT                   RAMLSSPQYVVNNAPHGSTFRVERSISKYPTMKVTHTRIFPFAECARPFLVYAKPFKSG
FT                   ACRESFTSRGVSIDVCELRGNGVPALVSSWRWILMSPFVSARAGMASWIRLWLRIYNLI
FT                   YRVWKRSIQQASGAHACYRFWGRHLMWALKGSPFLGGSKT"
FT   exon            574868..574963
FT                   /gene="Pc20g02540"
FT                   /locus_tag="PCH_Pc20g02540"
FT                   /number=1
FT   intron          574964..575050
FT                   /gene="Pc20g02540"
FT                   /locus_tag="PCH_Pc20g02540"
FT                   /number=1
FT   exon            575051..575173
FT                   /gene="Pc20g02540"
FT                   /locus_tag="PCH_Pc20g02540"
FT                   /number=2
FT   intron          575174..575260
FT                   /gene="Pc20g02540"
FT                   /locus_tag="PCH_Pc20g02540"
FT                   /number=2
FT   exon            575261..575397
FT                   /gene="Pc20g02540"
FT                   /locus_tag="PCH_Pc20g02540"
FT                   /number=3
FT   intron          575398..575502
FT                   /gene="Pc20g02540"
FT                   /locus_tag="PCH_Pc20g02540"
FT                   /number=3
FT   exon            575503..575712
FT                   /gene="Pc20g02540"
FT                   /locus_tag="PCH_Pc20g02540"
FT                   /number=4
FT   intron          575713..575879
FT                   /gene="Pc20g02540"
FT                   /locus_tag="PCH_Pc20g02540"
FT                   /number=4
FT   exon            575880..575925
FT                   /gene="Pc20g02540"
FT                   /locus_tag="PCH_Pc20g02540"
FT                   /number=5
FT   mRNA            complement(join(<576196..576420,576444..>576581))
FT                   /gene="Pc20g02550"
FT                   /locus_tag="PCH_Pc20g02550"
FT   CDS_pept        complement(join(576196..576420,576444..576581))
FT                   /gene="Pc20g02550"
FT                   /locus_tag="PCH_Pc20g02550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02550"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85584"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH1"
FT                   /protein_id="CAP85584.1"
FT                   /translation="MRMNFSGHSVILYFERLPKGWMGLSSDIGAHKITQQRALSAAHVE
FT                   QAISYHGDEEGRKMRYGPMERRLCMKPPRMANATNWANAQCAQRKTHTLHASHVCMRVN
FT                   NTEVKWRCGGRLKERK"
FT   exon            complement(576196..576420)
FT                   /gene="Pc20g02550"
FT                   /locus_tag="PCH_Pc20g02550"
FT                   /number=1
FT   intron          complement(576421..576443)
FT                   /gene="Pc20g02550"
FT                   /locus_tag="PCH_Pc20g02550"
FT                   /number=1
FT   exon            complement(576444..576581)
FT                   /gene="Pc20g02550"
FT                   /locus_tag="PCH_Pc20g02550"
FT                   /number=2
FT   mRNA            join(<578349..578957,579028..579970,580029..>580096)
FT                   /gene="Pc20g02560"
FT                   /locus_tag="PCH_Pc20g02560"
FT   CDS_pept        join(578349..578957,579028..579970,580029..580096)
FT                   /gene="Pc20g02560"
FT                   /locus_tag="PCH_Pc20g02560"
FT                   /note="Title: strong similarity to human secreted protein
FT                   fragment like protein An02g13670 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02560"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85585"
FT                   /db_xref="GOA:B6HEH2"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH2"
FT                   /inference="protein motif:PFAM:PF01169"
FT                   /inference="protein motif:COGS:COG2119"
FT                   /inference="protein motif:COGS:COG0730"
FT                   /protein_id="CAP85585.1"
FT                   /translation="MKINHSSFLLFLLPAISAVLADTTYNDNIDSRVSRETAGNNARLV
FT                   DSDIVASNVAKGAPDVPVDGKDGRPHAGPWVETNADRDRKGVKGTDDIDSVSTKYDTKI
FT                   PSSEHLSTEEGKMIPHSNGGVMDDPHRAGPKEGTRGTEGGVSEKGKEGKLTSEKAPGGP
FT                   KEAPPLPHSETKKLGSDSDDTTTGTGSRSAESQGSLGMLGKPADLPEKPHDIPYPKPPA
FT                   MVKDDPLGLGHDSVASGSPSSSSSSSLTHDYDYDHDSGIPDAGSSLHSLVFSFTMILVS
FT                   EIGDKTFLVAALMAMRHPRLVVFSAAFSALILMTVLSAVLGHAVPTLIPKTFTKFMAAI
FT                   LFLIFGVKMLKEGREMSPDEGVGEEMREVEAELEEKEHEQLRMDRRRSSVTPHNLEAGR
FT                   AGGRPKTRGSGNRLPSPPESLSSSSSRGSSPQPRQRLDSIFSGLSNLFSLLLSPAWVQT
FT                   FVMTFLGEWGDRSQIATIAMAAGQDYWWVTIGASAGHGICTAAAVIGGRAIAGRVSMRV
FT                   VTLGGAVAFLVFGVIYFIEAIF"
FT   sig_peptide     578349..578411
FT                   /gene="Pc20g02560"
FT                   /locus_tag="PCH_Pc20g02560"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            578349..578957
FT                   /gene="Pc20g02560"
FT                   /locus_tag="PCH_Pc20g02560"
FT                   /number=1
FT   mat_peptide     join(578412..578957,579028..579970,580029..580093)
FT                   /gene="Pc20g02560"
FT                   /locus_tag="PCH_Pc20g02560"
FT   intron          578958..579027
FT                   /gene="Pc20g02560"
FT                   /locus_tag="PCH_Pc20g02560"
FT                   /number=1
FT   exon            579028..579970
FT                   /gene="Pc20g02560"
FT                   /locus_tag="PCH_Pc20g02560"
FT                   /number=2
FT   intron          579971..580028
FT                   /gene="Pc20g02560"
FT                   /locus_tag="PCH_Pc20g02560"
FT                   /number=2
FT   exon            580029..580096
FT                   /gene="Pc20g02560"
FT                   /locus_tag="PCH_Pc20g02560"
FT                   /number=3
FT   mRNA            join(<580904..581000,581196..582564,582617..>583673)
FT                   /gene="Pc20g02570"
FT                   /locus_tag="PCH_Pc20g02570"
FT   CDS_pept        join(580904..581000,581196..582564,582617..583673)
FT                   /gene="Pc20g02570"
FT                   /locus_tag="PCH_Pc20g02570"
FT                   /note="Title: similarity to Ser/Arg-related nuclear matrix
FT                   protein like protein An02g13680 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02570"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85586"
FT                   /db_xref="GOA:B6HEH3"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH3"
FT                   /protein_id="CAP85586.1"
FT                   /translation="MARLMGSRMMRSRSREAANPGFMPNKGSLERNWLTGVTEEPSTPS
FT                   PGFIAPRHVVPESPENHEGHTNVSGTTLGHNDVEPVGSQVADKIATHLPFVQQQATLVM
FT                   SLLVRPELNPDSLAAESKRLLDSNHPNRKRLRRSVEGLTDELEDSPLSRDGRSFLDISQ
FT                   ARRLLSPAQLDASIAYIYMTNCALLTLNMFLPSMGIESQSEVMQQLDSQFPGCVMSNLV
FT                   ESSMTRDIGASNTTETTFNLALGIRTQFFIMELERRQHEQDFNPLSILRQIFAMDLAPS
FT                   EDDSPASFRGFNLPGVLQDEDGHLPEYLPERFLIAISDRFNELHEEISEWDSLDIDGLR
FT                   KAYRWRSFERDLARWVYARDREIKDDIRRLSERLRISPSPRRLTSVPAGTPNRRPGSTV
FT                   PPSGDISRPRPLPQQTHSPQKERLVNAPGANRAPQAETVVQAEQSAQAGNIPGDIASRS
FT                   GITSQTVPEQSVSNQVAQTVSKDPGRRKSKSNYRDPASLAALMRRQATSRPQPASNVAS
FT                   QAQNISTGTNIVTQADPSANRGVDSVEIQQSPDMTYRDIGDESTYVNNDEDLDLGQGPE
FT                   PDVMTSTSPPTSSRIGRVSHNPNPRFFDSPRDGNTQRSVPAARRFLDKQSNARVVSPIS
FT                   QYDAPSPGNQFTVLGKRNRNADPPDDDLSDESDVEFEQNNQDLDPRRRVEKPQQKLPAA
FT                   KRQRPEDNAGSVGERLPSSINQSFRHNQPISTQGAQRVQRAESDDITDDETAVEQYEAP
FT                   TRTQGPWAASNSQAALVNRRVRGATHRWTEEEDERLIYLLGIYGTSYSAIKKQDNACPP
FT                   SEGGPMLERRSQVNCKDRARNLKKKYLR"
FT   exon            580904..581000
FT                   /gene="Pc20g02570"
FT                   /locus_tag="PCH_Pc20g02570"
FT                   /number=1
FT   intron          581001..581195
FT                   /gene="Pc20g02570"
FT                   /locus_tag="PCH_Pc20g02570"
FT                   /number=1
FT   exon            581196..582564
FT                   /gene="Pc20g02570"
FT                   /locus_tag="PCH_Pc20g02570"
FT                   /number=2
FT   intron          582565..582616
FT                   /gene="Pc20g02570"
FT                   /locus_tag="PCH_Pc20g02570"
FT                   /number=2
FT   exon            582617..583673
FT                   /gene="Pc20g02570"
FT                   /locus_tag="PCH_Pc20g02570"
FT                   /number=3
FT   mRNA            join(<584958..585211,585247..585420,585472..585535,
FT                   585699..>586937)
FT                   /gene="Pc20g02580"
FT                   /locus_tag="PCH_Pc20g02580"
FT   CDS_pept        join(584958..585211,585247..585420,585472..585535,
FT                   585699..586937)
FT                   /gene="Pc20g02580"
FT                   /locus_tag="PCH_Pc20g02580"
FT                   /note="Title: strong similarity to F-box/WD-repeat protein
FT                   op2p - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02580"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85587"
FT                   /db_xref="GOA:B6HEH4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH4"
FT                   /inference="similar to AA sequence:PIR:T43557"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP85587.1"
FT                   /translation="MGNGKGKNKGKGRGKKRSRSLKENKVAAKVEIKPEDKIEDKIEIK
FT                   GKHHCLRKRPTHAPTSRCLRLGHVVQCPIHPNSFPRRLSDATGAQGQKEVEQQLISFFW
FT                   SFKVDRACQRTLLDICLLLLWLCYVGLYILASYYSTEERFIFLSIPDFGEKLHIEQYKG
FT                   YRRHSVCAHNNHPMWKNTKPRHLAFRAHHRHVITCLQFDADKIIVGSDNTHINVYDTKT
FT                   GALRAKLEGHEGGVWALEYHDNTLVSASTDRTIRVWDIAKAKCTHVFQGHTSTVRCMKI
FT                   LLPVQIDQHERPQIISGSRDSTMRIWKLPQPGDSEYFPPTESVEECPYLIRVLTGHQHS
FT                   VRAIAAYGDTVVSGSYDCTVRVWKISTGESLHCLQGHTFKVYNVCLDHERNRCISGSMD
FT                   STVKIWSLDTGALLYNLEGHSSLVGLLDLKEDLLVSASADSTLRVWNPANGHCQSTLGS
FT                   HTGAITCFQHDGQKIISGSDASLKMWDTRTGVFERDLLTDLSGTWQVQFDTQHCVAAAQ
FT                   RGDVSYIEVSTHPTDIPSIYNLLFMKILDFGASPETIPSGQFGKRVLVDELGNEIESPK
FT                   "
FT   exon            584958..585211
FT                   /gene="Pc20g02580"
FT                   /locus_tag="PCH_Pc20g02580"
FT                   /number=1
FT   intron          585212..585246
FT                   /gene="Pc20g02580"
FT                   /locus_tag="PCH_Pc20g02580"
FT                   /number=1
FT   exon            585247..585420
FT                   /gene="Pc20g02580"
FT                   /locus_tag="PCH_Pc20g02580"
FT                   /number=2
FT   intron          585421..585471
FT                   /gene="Pc20g02580"
FT                   /locus_tag="PCH_Pc20g02580"
FT                   /number=2
FT   exon            585472..585535
FT                   /gene="Pc20g02580"
FT                   /locus_tag="PCH_Pc20g02580"
FT                   /number=3
FT   intron          585536..585698
FT                   /gene="Pc20g02580"
FT                   /locus_tag="PCH_Pc20g02580"
FT                   /number=3
FT   exon            585699..586937
FT                   /gene="Pc20g02580"
FT                   /locus_tag="PCH_Pc20g02580"
FT                   /number=4
FT   mRNA            <588003..>591038
FT                   /gene="Pc20g02590"
FT                   /locus_tag="PCH_Pc20g02590"
FT   CDS_pept        588003..591038
FT                   /gene="Pc20g02590"
FT                   /locus_tag="PCH_Pc20g02590"
FT                   /note="Title: strong similarity to saframycin Mx1 synthase
FT                   safA - Myxococcus xanthus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02590"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85588"
FT                   /db_xref="GOA:B6HEH5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH5"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /inference="protein motif:COGS:COG1020"
FT                   /protein_id="CAP85588.1"
FT                   /translation="MEQLLCNRANEASNALAVIDGDHRFTYRDLLAKADILAADLLKKG
FT                   LGTEEPVGIVVGPGWQQIIARVAVLRAGGTSVPIDPSAPDIQLHAMLGDLSTRFVMTTN
FT                   NLAGKVSQFNILPIETVLDPEYQTEKHGEINAMSGKSEGHRSHILHTSGSTGKPKAVQI
FT                   SSKAVLHLAASLPVDIGEGDKVGQLNNPGFDLSLFEVWVTLLSGGTVVHIPKSIIKDPV
FT                   SFAAFLKDTGLTALILPCALFTAVSASTPSAFQSVRHVVSAGESPSPQAMQKVLSSDGP
FT                   PENLWNGYGPTETTCLSTLQRVTLEEAECGPISAGVPFGDTVLHLLDEAQKPIVDDEIP
FT                   GEICIGGPGLSAGYLNHTEANAEKFIRIEVADSQDPRRVKITRLYRTGDIGMWKGLPKR
FT                   LQYIGRVDLQVKHQGFRVELEAIEQTIAANDSIRAVACLHQKAGDGPGLDRLIAVVAPA
FT                   NDMPLDPQKIIEWTQNRHPYYMVPNQVRVVSEIPLNSRGKVDRDALHKEIKESRPLKST
FT                   QDNAKDESSLAKVTKILEENLGLSNIGPDDNIISLGLSSLQVARFLGLIKQKIGKLISI
FT                   KDLYINPSIRSLVHHLHQADETNYGPSEVLQFEADAHLADDIELIPDWTSEGRVFLTGA
FT                   TGFIGVNLLYRWLSRPSMKEVEIACLARGNENYSPMDRIKNALKKYDLWSEDISQEMKR
FT                   VIVLDGDMTQERLGLPHSDYQWLINWAPAVFHAAAKVNWCDSYNGHFAQNVQGTKNVLR
FT                   VAAEGRRKTMHYISSIDVWAVTGLILGTDVVSEDGPLKVHLASLPFDTGYAQSQWVADE
FT                   MVQRVRDKGLPVTIYRPGFVVGDSKTGAGNPDDFFGRLIAGCIQLGYWPHMPHQNQEYV
FT                   TVDYVCDSIIRIASDNRNIGHAYTLSSPNPGQITNMERLCVLINQAGFSVQEIPYAEWL
FT                   EKMQAWDGFESSPCLPLMPLLAEPILRGDTRLQTSKYSPRYDCANTLKAIGACDDIRFV
FT                   QLTPDLVKKYIDFWARKGFYNF"
FT   exon            588003..591038
FT                   /gene="Pc20g02590"
FT                   /locus_tag="PCH_Pc20g02590"
FT                   /number=1
FT   mRNA            complement(join(<591529..591768,591837..>591941))
FT                   /gene="Pc20g02600"
FT                   /locus_tag="PCH_Pc20g02600"
FT   CDS_pept        complement(join(591529..591768,591837..591941))
FT                   /gene="Pc20g02600"
FT                   /locus_tag="PCH_Pc20g02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02600"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85589"
FT                   /db_xref="GOA:B6HEH6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH6"
FT                   /protein_id="CAP85589.1"
FT                   /translation="MPRLGLRGFAVVLAVIIMSLLGALFGNTGWVYYIVVGIPGIWSLA
FT                   NLALIVFKRPVHPGAHIALDFIFTIVQLFFGIISLLAEQVSSLYGSSLHSSHSSWSMAV
FT                   AAFALMVING"
FT   exon            complement(591529..591768)
FT                   /gene="Pc20g02600"
FT                   /locus_tag="PCH_Pc20g02600"
FT                   /number=1
FT   intron          complement(591769..591836)
FT                   /gene="Pc20g02600"
FT                   /locus_tag="PCH_Pc20g02600"
FT                   /number=1
FT   exon            complement(591837..591941)
FT                   /gene="Pc20g02600"
FT                   /locus_tag="PCH_Pc20g02600"
FT                   /number=2
FT   mRNA            join(<593413..593908,593965..595539,595632..>595708)
FT                   /gene="Pc20g02610"
FT                   /locus_tag="PCH_Pc20g02610"
FT   CDS_pept        join(593413..593908,593965..595539,595632..595708)
FT                   /gene="Pc20g02610"
FT                   /locus_tag="PCH_Pc20g02610"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig589.tfa_60wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02610"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85590"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH7"
FT                   /protein_id="CAP85590.1"
FT                   /translation="MGNPEHDFSSKHTEAVSNTEAVSNHPPYSSITESIDEPPTYGQSN
FT                   ASYRVSHDGFPRSVVVVVDECITHLKLLSAIAKLRNFIKGTDKLFGIHDAEIRNFSNNQ
FT                   QAQAAARIREKRWAVYVARAVDRFTIWWQSYLPSLKTSHISTLNTASEANIAWSANMMP
FT                   PLDVIMVWHAFMLNPRAFLEDCLRQSKMSVWATGMPWDIINASIDDKTLVFYPDRDSEA
FT                   RINFEAITGHSWENIHDSPAKSLPCIGCKQEIIAPWTEGSIGCDTDVAFAHCTGYADKS
FT                   LRVSCPACKFNTTHDTLRVQKFRSDVQKLLKDDIPMPGTLLSQNGTPADDGNGDNVSFP
FT                   NRLIKEGIRSELLQLTDLTENESTTIETIRDHLEAYLKSRSVMRRVNKTILASGNSSMP
FT                   ERISLRNMLSRYWDNSSPFAIDLVGAVIRQGTFVDKMDNIGWVRSPNPRSTMGHFIGKY
FT                   GVFFQIMVKNKGHAVVPTLDVDLIWHTHQLSPIRYYIFSTTQMEGIFINHDDKIDETKL
FT                   NDAFAWTSRQYQKLTGGKIYSECTCWYCEAVRESNNQGLGRLISPSTLHAKTNAALLHN
FT                   SADNATDGKSKEPHISSHNAVRILAQADPKAMQTKTAQLESCWEKAQRRSHNRSRSRGG
FT                   GSAHGDPPRKTVYGPYARDPDIHREIYPCNPACVNITAGVVGNCMSGTQGVGLAQASQQ
FT                   MCKYLWTEPSVLQVSRELDNV"
FT   exon            593413..593908
FT                   /gene="Pc20g02610"
FT                   /locus_tag="PCH_Pc20g02610"
FT                   /number=1
FT   intron          593909..593964
FT                   /gene="Pc20g02610"
FT                   /locus_tag="PCH_Pc20g02610"
FT                   /number=1
FT   exon            593965..595539
FT                   /gene="Pc20g02610"
FT                   /locus_tag="PCH_Pc20g02610"
FT                   /number=2
FT   intron          595540..595631
FT                   /gene="Pc20g02610"
FT                   /locus_tag="PCH_Pc20g02610"
FT                   /number=2
FT   exon            595632..595708
FT                   /gene="Pc20g02610"
FT                   /locus_tag="PCH_Pc20g02610"
FT                   /number=3
FT   mRNA            complement(join(<596131..596174,596276..596584,
FT                   596655..>596946))
FT                   /gene="Pc20g02620"
FT                   /locus_tag="PCH_Pc20g02620"
FT   CDS_pept        complement(join(596131..596174,596276..596584,
FT                   596655..596946))
FT                   /gene="Pc20g02620"
FT                   /locus_tag="PCH_Pc20g02620"
FT                   /note="Title: similarity to glucoamylase III Wsc2
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85591"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH8"
FT                   /inference="similar to AA sequence:PIR:S63257"
FT                   /inference="protein motif:PFAM:PF01822"
FT                   /protein_id="CAP85591.1"
FT                   /translation="MHTNYFFSALALALPVYSLSATARMGCYSEVDSFKNQGPYTYQSP
FT                   GYCQTECAENGFKVAALSRGNMCYCGNKMPSDSAKVADDKCDLSCSGWPAESCGGQDTF
FT                   NIIQATENLQASASENASTTIAPTAATAAGGIIVAPSTASSQTGIVTAASTASSKGGNV
FT                   VSKAAGSGSVATASPTPTYNAAGTVRAGSSLLGAVVAVILYPSLVRQQDVS"
FT   exon            complement(596131..596174)
FT                   /gene="Pc20g02620"
FT                   /locus_tag="PCH_Pc20g02620"
FT                   /number=1
FT   mat_peptide     complement(join(596134..596174,596276..596584,
FT                   596655..596877))
FT                   /gene="Pc20g02620"
FT                   /locus_tag="PCH_Pc20g02620"
FT   intron          complement(596175..596275)
FT                   /gene="Pc20g02620"
FT                   /locus_tag="PCH_Pc20g02620"
FT                   /number=1
FT   exon            complement(596276..596584)
FT                   /gene="Pc20g02620"
FT                   /locus_tag="PCH_Pc20g02620"
FT                   /number=2
FT   intron          complement(596585..596654)
FT                   /gene="Pc20g02620"
FT                   /locus_tag="PCH_Pc20g02620"
FT                   /number=2
FT   exon            complement(596655..596946)
FT                   /gene="Pc20g02620"
FT                   /locus_tag="PCH_Pc20g02620"
FT                   /number=3
FT   sig_peptide     complement(596878..596946)
FT                   /gene="Pc20g02620"
FT                   /locus_tag="PCH_Pc20g02620"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<599867..600228,600297..601633,601690..>601733)
FT                   /gene="Pc20g02630"
FT                   /locus_tag="PCH_Pc20g02630"
FT   CDS_pept        join(599867..600228,600297..601633,601690..601733)
FT                   /gene="Pc20g02630"
FT                   /locus_tag="PCH_Pc20g02630"
FT                   /note="unknown EC_number=3.4.17.4"
FT                   /note="Title: strong similarity to Gly-X carboxypeptidase
FT                   precursor Yscs - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02630"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85592"
FT                   /db_xref="GOA:B6HEH9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH9"
FT                   /inference="similar to AA sequence:TREMBL:SCCPS1.1"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /inference="protein motif:COGS:COG0624"
FT                   /protein_id="CAP85592.1"
FT                   /translation="MMKTLALLTLAVVPSLALNIPTQQRLFPESKLSGNHYNPLSTPST
FT                   RETCPQPRKVNTPNDGLHSSQTFLSDDAFRARQAKRLSRAVQIPTTVGDYMKDPYDEAF
FT                   EPIVEFQSLLEEMFPLVHDHANVEHINRLGLVFTFEGADTSLKPLLFMAHQDVVPIDDA
FT                   SDWTHPPFAGVFDGEWIWGRGSSDCKNVLIGLMSVVEDLLSQDWQPQRTVLFAFGFDEE
FT                   SHGFLGAGAISAALEEKYGKDSFEFILDEGGMGLQSLGDESNPNGEILYALPAVGEKGS
FT                   LDLIIDIAVPGGHSSIPPAHTGIGIMAEILYELERKELFPAWLDTTHPAYGMLECQAQY
FT                   SPEHVETWLSDKLAANDPAALGEAVASSRGPAVRYTVQTSQAADLIHGGVKTNALPEKI
FT                   SAVVNYRVALHQTPDELRERAIRLIRPIAESHNLTLRVDFPGVAESTEGDVSDRTLTLS
FT                   PLSVPLSPAPISPTNPLTSKVWAHFAGVARSVFESHSNPLSKSESGSKPTVVVTGDVMT
FT                   GNTDTRFYWSLSDNIYRWSPSRAGGSLNIHTVDERIRLDVHLEGMMLYYDLIRSFDAWD
FT                   GKSE"
FT   sig_peptide     599867..599917
FT                   /gene="Pc20g02630"
FT                   /locus_tag="PCH_Pc20g02630"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            599867..600228
FT                   /gene="Pc20g02630"
FT                   /locus_tag="PCH_Pc20g02630"
FT                   /number=1
FT   mat_peptide     join(599918..600228,600297..601633,601690..601730)
FT                   /gene="Pc20g02630"
FT                   /locus_tag="PCH_Pc20g02630"
FT   intron          600229..600296
FT                   /gene="Pc20g02630"
FT                   /locus_tag="PCH_Pc20g02630"
FT                   /number=1
FT   exon            600297..601633
FT                   /gene="Pc20g02630"
FT                   /locus_tag="PCH_Pc20g02630"
FT                   /number=2
FT   intron          601634..601689
FT                   /gene="Pc20g02630"
FT                   /locus_tag="PCH_Pc20g02630"
FT                   /number=2
FT   exon            601690..601733
FT                   /gene="Pc20g02630"
FT                   /locus_tag="PCH_Pc20g02630"
FT                   /number=3
FT   mRNA            complement(join(<602275..602344,602396..602531,
FT                   602585..602728,602779..602981,603031..604054,
FT                   604104..604396,604461..>604654))
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT   CDS_pept        complement(join(602275..602344,602396..602531,
FT                   602585..602728,602779..602981,603031..604054,
FT                   604104..604396,604461..604654))
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /note="Title: strong similarity to glutaminase A gtaA
FT                   -Aspergillus oryzae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02640"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85593"
FT                   /db_xref="GOA:B6HEI0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014870"
FT                   /db_xref="InterPro:IPR032514"
FT                   /db_xref="InterPro:IPR033433"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEI0"
FT                   /inference="similar to AA sequence:TREMBL:AB029552.1"
FT                   /protein_id="CAP85593.1"
FT                   /translation="MQLYRLGLLVASFVSSIGAQSTFSPARPPAIPLAVRSPYLSTWLN
FT                   VGKDGGNGGYLAGQWPVFWENQVNGWTGMIRVDGNTYTWMGLPGSKTVNQTAFEYTSTK
FT                   SIFTMNVENKLEMNITFLSPVTPTDLKRQSLVFSYLNVEVSSLDGQKHDVQVYTDISAE
FT                   WVSGDRNAIAEWEYGTTDGVAYHKVHRQTQLAFTEKSQQGEWGNWYWATDDSKDMTHQS
FT                   GADTDVRGQFATTGKLSNGDDTNFRAISSVWPVFGFSYDLGSVDSSPVSTLFSLGLTQD
FT                   EAIQYEGASQYAPVPSLWKSYFATELAALSFFHKDYTESSNLASSLDRRVAQDSIATAG
FT                   QDYLVVTSLSVRQAFGATQLCGTQDKMYMFLKEISSNGNMNTVDVIFPAYPIFLYTNPE
FT                   LLKLVLTPLLENQEAGKYPNDYSIHDLGSSYPNATGHSDGSDEKMPLEECGNMLIMSLA
FT                   YVQKSGDSDFLNDHYSLLKQWTSYLVEDSLYPANQISTDDFAGPLANQTNLALKGMIGI
FT                   QAMAVIANMTGHTADAADYSRIAKDYITQWQDLAIAKGANPPRTTLSYGDTASHGLLYN
FT                   LFADAQLGLNLVPQSVYQMQSDFYPTVANKYGVPLDTRHTYTKGDWECFAAAVSSVDTR
FT                   DMFINDLATWINETPTNRALTDLYDTISGDYPQNTFVARPVMGGCFAPILVR"
FT   exon            complement(602275..602344)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /number=1
FT   mat_peptide     complement(join(602278..602344,602396..602531,
FT                   602585..602728,602779..602981,603031..604054,
FT                   604104..604396,604461..604597))
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT   intron          complement(602345..602395)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /number=1
FT   exon            complement(602396..602531)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /number=2
FT   intron          complement(602532..602584)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /number=2
FT   exon            complement(602585..602728)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /number=3
FT   intron          complement(602729..602778)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /number=3
FT   exon            complement(602779..602981)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /number=4
FT   intron          complement(602982..603030)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /number=4
FT   exon            complement(603031..604054)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /number=5
FT   intron          complement(604055..604103)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /number=5
FT   exon            complement(604104..604396)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /number=6
FT   intron          complement(604397..604460)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /number=6
FT   exon            complement(604461..604654)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /number=7
FT   sig_peptide     complement(604598..604654)
FT                   /gene="Pc20g02640"
FT                   /locus_tag="PCH_Pc20g02640"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            join(<604763..604811,604892..604964,605095..>605275)
FT                   /gene="Pc20g02650"
FT                   /locus_tag="PCH_Pc20g02650"
FT   CDS_pept        join(604763..604811,604892..604964,605095..605275)
FT                   /gene="Pc20g02650"
FT                   /locus_tag="PCH_Pc20g02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02650"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85594"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEI1"
FT                   /protein_id="CAP85594.1"
FT                   /translation="MPSTLTGRLKKGIKGIGPSETRMPECALYGGISKRLGILEGKGDR
FT                   GVVTVKKVVYFPRMAQMQSQIPKTRSGSFRKKRHAFRLHGRQAAVYADRRNEWRQ"
FT   exon            604763..604811
FT                   /gene="Pc20g02650"
FT                   /locus_tag="PCH_Pc20g02650"
FT                   /number=1
FT   intron          604812..604891
FT                   /gene="Pc20g02650"
FT                   /locus_tag="PCH_Pc20g02650"
FT                   /number=1
FT   exon            604892..604964
FT                   /gene="Pc20g02650"
FT                   /locus_tag="PCH_Pc20g02650"
FT                   /number=2
FT   intron          604965..605094
FT                   /gene="Pc20g02650"
FT                   /locus_tag="PCH_Pc20g02650"
FT                   /number=2
FT   exon            605095..605275
FT                   /gene="Pc20g02650"
FT                   /locus_tag="PCH_Pc20g02650"
FT                   /number=3
FT   mRNA            complement(join(<606688..607034,607116..607208,
FT                   607278..>608271))
FT                   /gene="Pc20g02660"
FT                   /locus_tag="PCH_Pc20g02660"
FT   CDS_pept        complement(join(606688..607034,607116..607208,
FT                   607278..608271))
FT                   /gene="Pc20g02660"
FT                   /locus_tag="PCH_Pc20g02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85595"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES1"
FT                   /protein_id="CAP85595.1"
FT                   /translation="MPFEPFKRERDGAKAFLERMRNGVSNNEILAELLDKESNIFTDHV
FT                   YELPKAQMTKARLPDVAKYKLQLHASFNKPDLNADYSGHSSVYLVGQPNRWARRLSRTP
FT                   KPCHWSIYSEGHFYHLKLEDGAQGSSIVLRDEPQREWKALSGPFIAYHIGVTDYYPDEI
FT                   SLLAKWVITQMNHDTLSTAAYEQFVFGLAIRILRGPSNTTAFIGNFWQIMEHDIGCRRQ
FT                   ALAPNGFLTGIQLASPEEDISTWLKRWYLIYRIETDARGLDLCWRKGTKGQISWKAHEF
FT                   HPFIRPLAVGPPAIANVLAKVGQRIPLLSKAVPPKHRKKMPMMAVYRRKKGAPLPRDLM
FT                   LKHYYASLFSIHIRPGCNMSDKDFWFQVNDYLNSGCVEHITFNRGFSYKFIFGPEIIGS
FT                   VRFVRYREPPAEEVLHSSSSTIVEKECLESESTIDAEQSTGECIYPPDTLATNLFEHKG
FT                   VPCQVLIDMAETFKSPVEI"
FT   exon            complement(606688..607034)
FT                   /gene="Pc20g02660"
FT                   /locus_tag="PCH_Pc20g02660"
FT                   /number=1
FT   intron          complement(607035..607115)
FT                   /gene="Pc20g02660"
FT                   /locus_tag="PCH_Pc20g02660"
FT                   /number=1
FT   exon            complement(607116..607208)
FT                   /gene="Pc20g02660"
FT                   /locus_tag="PCH_Pc20g02660"
FT                   /number=2
FT   intron          complement(607209..607277)
FT                   /gene="Pc20g02660"
FT                   /locus_tag="PCH_Pc20g02660"
FT                   /number=2
FT   exon            complement(607278..608271)
FT                   /gene="Pc20g02660"
FT                   /locus_tag="PCH_Pc20g02660"
FT                   /number=3
FT   mRNA            complement(join(<609746..610036,610143..>612422))
FT                   /gene="Pc20g02670"
FT                   /locus_tag="PCH_Pc20g02670"
FT   CDS_pept        complement(join(609746..610036,610143..612422))
FT                   /gene="Pc20g02670"
FT                   /locus_tag="PCH_Pc20g02670"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1487_1.tfa_1240wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85596"
FT                   /db_xref="GOA:B6HES2"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="InterPro:IPR037104"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES2"
FT                   /protein_id="CAP85596.1"
FT                   /translation="MSLQVNDPRSRTRSKSPGRSRSRSRSRDSRVPSPSPSPSHRSRSP
FT                   AVEVPRTKGYNPDEEAEIERQYKLISERRRETNDEPPVIPRAPRSSRYDVDRSDSDSES
FT                   RRRDVESARRRRDDRYEHSDEERGSAAASSRSHRRRPSPDRGSRVNHHDSDSDDDLAYG
FT                   DAPGTHPSYARPNRYSYAQPTQFASAAPGYPAAPGYPAAPGYPAAPIDWASVPECERPG
FT                   FVPPSSQPAAPATMPGAFPVASTYPASSGAVPAPVNPSLQYTGLPAQYATSAGYAPSHY
FT                   RTASASDAGYAPPAAGYANPGVYQYAQIDPNVKYSSKPVPVPTTAPASKPIYPAATHEQ
FT                   FSRPMPQQLQQQPPDQSYRYKHEPQRQEPQKQEPQFVEIAPGSRSSARPHSHSPSSSSL
FT                   AVGGASAAHSAHPPASPLLEPYHGTYQSMSPMPSPIVIPSIRDDDISDLEPLDGGTSAS
FT                   ESGRRSKHSRSHSSVGEKESRSRSSRDKERDNGKEDKRITRPAASHNRHDSSSSILSSD
FT                   ARVLISPTTGRKRVSFYDAGPDAAAMHSALNHARNIDNKTIIQVLPRLTSDEILLLRQE
FT                   YKTRVRMQGKGINLAKHLRLKLGSSSFGKVCYATALGRWESEAYWANCYYQAGTSRREL
FT                   LIESLMGRSNAAIREIKNSFRDTRYDNSLERCMRAELRADKFRVAILLALEGQRQDERE
FT                   PLDRRLVRHDVQDLHHAIVREGGETAMIHIIVSRSDSHLREVLRAYEDNYGHNFTRAMI
FT                   SKSRNLVGETLAHILNGAINRPMRDALLLHQALRESRTGRERSELLISRLVRLHWEPRH
FT                   LDLVKNEYRRRYHERLEEAIAEEILSLNGGQNWGEFCIELARNA"
FT   exon            complement(609746..610036)
FT                   /gene="Pc20g02670"
FT                   /locus_tag="PCH_Pc20g02670"
FT                   /number=1
FT   intron          complement(610037..610142)
FT                   /gene="Pc20g02670"
FT                   /locus_tag="PCH_Pc20g02670"
FT                   /number=1
FT   exon            complement(610143..612422)
FT                   /gene="Pc20g02670"
FT                   /locus_tag="PCH_Pc20g02670"
FT                   /number=2
FT   mRNA            complement(join(<613111..614260,614326..>614759))
FT                   /gene="Pc20g02680"
FT                   /locus_tag="PCH_Pc20g02680"
FT   CDS_pept        complement(join(613111..614260,614326..614759))
FT                   /gene="Pc20g02680"
FT                   /locus_tag="PCH_Pc20g02680"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1487_1.tfa_1230wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02680"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85597"
FT                   /db_xref="GOA:B6HES3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES3"
FT                   /inference="protein motif:PFAM:PF00735"
FT                   /inference="protein motif:COGS:COG5019"
FT                   /inference="protein motif:COGS:COG3842"
FT                   /protein_id="CAP85597.1"
FT                   /translation="MATRLGPETDVNRRTSLGFLRRSKSTEPLGDQKSRKKMSKSQEEE
FT                   MRRQRESYAPKIPPRLPDLSPAPQLETFGGEERDKFDPIPIRPQSGLPASPSMGSVNNV
FT                   DPYARTESMTHRGRYSYASSAVSTVNSPRRVRRRKDPTSYNVLVIGARNSGKTSFLNFL
FT                   RSALTMPAHKHPSRTPEEVEELERQTSAWEGFTSQYLETEFDGERVGLTLWDSVGLERN
FT                   IADLQLRGVTGFLESKFEETLAEEMKVIRSPGARDTHIHCTFLLLDPMRLDENIAMAER
FT                   AANGTSKPTDAPVVGILDQNLDIQVLRTVLGKTTVVPVISKADTITSAHMSYLRKAVWN
FT                   SLKQANIDPLEILTLEDQEEEYSSESADEEEILVLETKPESTETGDANEANEAKESENA
FT                   TDNVPGSPSQLSQGTRRSNASQAANQHVPFSILSPDPHSLAAGDKPVGRRFPWGFADPY
FT                   DAEHCDFVRLKDSVFSDWRSELREASRVVWYERWRTNRLNRNGQPTPASPAQKQNYGGR
FT                   QGPHDGRRTR"
FT   exon            complement(613111..614260)
FT                   /gene="Pc20g02680"
FT                   /locus_tag="PCH_Pc20g02680"
FT                   /number=1
FT   intron          complement(614261..614325)
FT                   /gene="Pc20g02680"
FT                   /locus_tag="PCH_Pc20g02680"
FT                   /number=1
FT   exon            complement(614326..614759)
FT                   /gene="Pc20g02680"
FT                   /locus_tag="PCH_Pc20g02680"
FT                   /number=2
FT   mRNA            join(<616139..616232,616335..616523,616583..616719,
FT                   616776..>616904)
FT                   /gene="Pc20g02690"
FT                   /locus_tag="PCH_Pc20g02690"
FT   CDS_pept        join(616139..616232,616335..616523,616583..616719,
FT                   616776..616904)
FT                   /gene="Pc20g02690"
FT                   /locus_tag="PCH_Pc20g02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02690"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85598"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES4"
FT                   /protein_id="CAP85598.1"
FT                   /translation="MGVGHTGLACHANHYNIQHTEYSYFPGTSCQGKGLAFPTRNDRVE
FT                   QKWGGFPSRAGTFFFKENSQRDASVRVKGGIKVGTKLPFEQDSFSFDPQRAHITRLQVE
FT                   GQAFTLNSLSTLITVYQQNIPGGFGRPPDPQPLLLSTTKYSTDIYRLSVTLTLRRGFEA
FT                   YYKIEASEIEAYNLMEIPL"
FT   exon            616139..616232
FT                   /gene="Pc20g02690"
FT                   /locus_tag="PCH_Pc20g02690"
FT                   /number=1
FT   intron          616233..616334
FT                   /gene="Pc20g02690"
FT                   /locus_tag="PCH_Pc20g02690"
FT                   /number=1
FT   exon            616335..616523
FT                   /gene="Pc20g02690"
FT                   /locus_tag="PCH_Pc20g02690"
FT                   /number=2
FT   intron          616524..616582
FT                   /gene="Pc20g02690"
FT                   /locus_tag="PCH_Pc20g02690"
FT                   /number=2
FT   exon            616583..616719
FT                   /gene="Pc20g02690"
FT                   /locus_tag="PCH_Pc20g02690"
FT                   /number=3
FT   intron          616720..616775
FT                   /gene="Pc20g02690"
FT                   /locus_tag="PCH_Pc20g02690"
FT                   /number=3
FT   exon            616776..616904
FT                   /gene="Pc20g02690"
FT                   /locus_tag="PCH_Pc20g02690"
FT                   /number=4
FT   mRNA            complement(join(<617373..617721,617774..617935,
FT                   617986..618042,618091..618421,618476..>618587))
FT                   /gene="Pc20g02700"
FT                   /locus_tag="PCH_Pc20g02700"
FT   CDS_pept        complement(join(617373..617721,617774..617935,
FT                   617986..618042,618091..618421,618476..618587))
FT                   /gene="Pc20g02700"
FT                   /locus_tag="PCH_Pc20g02700"
FT                   /note="Title: strong similarity to hypothetical membrane
FT                   protein YPR157w - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02700"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85599"
FT                   /db_xref="InterPro:IPR009291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES5"
FT                   /inference="similar to AA sequence:PIR:S61141"
FT                   /protein_id="CAP85599.1"
FT                   /translation="MRLSISLALVGLSTTQLVCASLTDRAASDLPPYVLEYAPLVWLHS
FT                   QETYMPSDIQQQLDHTRPHVNWTALEGVESPLTLNNLDTLNSMGNTSVYLTSLEGIEAD
FT                   PQPAWFQGIRPDSQGRTENGTASIIVIADRGNGTVDAFYFYFYAFNKGGTVLGLEFGDH
FT                   IGDWEHNMIRFVDGSPDAIWYSQHASGQAFTYAAVEKKDKRPYVYSAKGTHANYAIEGQ
FT                   HDHTIPGFNLPTGFLLDYTDRGVLWDPVLNGYTYTYDETAGFQAVNSEDPVAWLDFNGR
FT                   WGDDQPPNEPSVFGEAKNVAGPNGPKFKGLDRELVCPSKPCIVLPFRTFSVDTTS"
FT   exon            complement(617373..617721)
FT                   /gene="Pc20g02700"
FT                   /locus_tag="PCH_Pc20g02700"
FT                   /number=1
FT   mat_peptide     complement(join(617376..617721,617774..617935,
FT                   617986..618042,618091..618421,618476..618527))
FT                   /gene="Pc20g02700"
FT                   /locus_tag="PCH_Pc20g02700"
FT   intron          complement(617722..617773)
FT                   /gene="Pc20g02700"
FT                   /locus_tag="PCH_Pc20g02700"
FT                   /number=1
FT   exon            complement(617774..617935)
FT                   /gene="Pc20g02700"
FT                   /locus_tag="PCH_Pc20g02700"
FT                   /number=2
FT   intron          complement(617936..617985)
FT                   /gene="Pc20g02700"
FT                   /locus_tag="PCH_Pc20g02700"
FT                   /number=2
FT   exon            complement(617986..618042)
FT                   /gene="Pc20g02700"
FT                   /locus_tag="PCH_Pc20g02700"
FT                   /number=3
FT   intron          complement(618043..618090)
FT                   /gene="Pc20g02700"
FT                   /locus_tag="PCH_Pc20g02700"
FT                   /number=3
FT   exon            complement(618091..618421)
FT                   /gene="Pc20g02700"
FT                   /locus_tag="PCH_Pc20g02700"
FT                   /number=4
FT   intron          complement(618422..618475)
FT                   /gene="Pc20g02700"
FT                   /locus_tag="PCH_Pc20g02700"
FT                   /number=4
FT   exon            complement(618476..618587)
FT                   /gene="Pc20g02700"
FT                   /locus_tag="PCH_Pc20g02700"
FT                   /number=5
FT   sig_peptide     complement(618528..618587)
FT                   /gene="Pc20g02700"
FT                   /locus_tag="PCH_Pc20g02700"
FT                   /inference="protein motif:SignalP:2.0"
FT   mRNA            complement(join(<619968..620227,620333..620390,
FT                   620451..620583,620634..>620704))
FT                   /gene="Pc20g02710"
FT                   /locus_tag="PCH_Pc20g02710"
FT   CDS_pept        complement(join(619968..620227,620333..620390,
FT                   620451..620583,620634..620704))
FT                   /gene="Pc20g02710"
FT                   /locus_tag="PCH_Pc20g02710"
FT                   /note="Title: weak similarity to DOPA-dioxygenase dodA
FT                   -Amanita muscaria"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02710"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85600"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES6"
FT                   /inference="similar to AA sequence:TREMBL:AMDOPADI.1"
FT                   /inference="protein motif:COGS:COG3805"
FT                   /protein_id="CAP85600.1"
FT                   /translation="MTDAYAFSYPSPLEGYENLEPLTDERTEDGKSLKNPQHGVLSKAY
FT                   TEFPDPLSKGREGGFDVHIYHFQNNPDQAAYARALWERIRREFPELRIYTFFDRPVGPH
FT                   PVAMFEVNLFTPAQFGAFVPWLVINRGPLSALIHPNTVESEDERNHTQRATWLGDRIPL
FT                   DLSIFRPRKN"
FT   exon            complement(619968..620227)
FT                   /gene="Pc20g02710"
FT                   /locus_tag="PCH_Pc20g02710"
FT                   /number=1
FT   intron          complement(620228..620332)
FT                   /gene="Pc20g02710"
FT                   /locus_tag="PCH_Pc20g02710"
FT                   /number=1
FT   exon            complement(620333..620390)
FT                   /gene="Pc20g02710"
FT                   /locus_tag="PCH_Pc20g02710"
FT                   /number=2
FT   intron          complement(620391..620450)
FT                   /gene="Pc20g02710"
FT                   /locus_tag="PCH_Pc20g02710"
FT                   /number=2
FT   exon            complement(620451..620583)
FT                   /gene="Pc20g02710"
FT                   /locus_tag="PCH_Pc20g02710"
FT                   /number=3
FT   intron          complement(620584..620633)
FT                   /gene="Pc20g02710"
FT                   /locus_tag="PCH_Pc20g02710"
FT                   /number=3
FT   exon            complement(620634..620704)
FT                   /gene="Pc20g02710"
FT                   /locus_tag="PCH_Pc20g02710"
FT                   /number=4
FT   mRNA            complement(join(<621336..622542,622602..>622699))
FT                   /gene="Pc20g02720"
FT                   /locus_tag="PCH_Pc20g02720"
FT   CDS_pept        complement(join(621336..622542,622602..622699))
FT                   /gene="Pc20g02720"
FT                   /locus_tag="PCH_Pc20g02720"
FT                   /note="Title: similarity to tight junction protein ZO-1
FT                   -Hydra vulgaris"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02720"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85601"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES7"
FT                   /inference="protein motif:COGS:COG0532"
FT                   /inference="protein motif:COGS:COG1530"
FT                   /protein_id="CAP85601.1"
FT                   /translation="MDDDYVAKVLAKEAKESSIKYASQGMSAFMPSRPTSNAPKPNTRF
FT                   LRNLIKVTDNHNTALKLKEEREARERMRQLKDKASGALGPTSPDHPSKRSDDRSEVRGS
FT                   RDHRRGDREDRNRSHRKRTRSRSPSAERDRSRRHRRRNEEYDGIRERDKDRDGHRREHR
FT                   DHGSSRKGRRDRDKEHTRRRRERSYSRSPSYSPHRDPSTDRHRHRRHKRQSGRSARSVS
FT                   RSRSPESYRSRRSKREDASPHGSRRSHLETSTQHKRVSPLSTITARQSEMGDESDPLED
FT                   LVGPLPPRQDEAPIRSRGRGAYKHNMSNIDAHFAPGYDPATDVHLDEDKLHSIGQESSR
FT                   RPVAGLMTKDDDWDMAMEALRDRERWRSKGEERLRTAGIDEAVIDKWKNNTAFAGMDGE
FT                   GKPEDVQWSKKGEGREWDRGKFVDDDGHIDIRASW"
FT   exon            complement(621336..622542)
FT                   /gene="Pc20g02720"
FT                   /locus_tag="PCH_Pc20g02720"
FT                   /number=1
FT   intron          complement(622543..622601)
FT                   /gene="Pc20g02720"
FT                   /locus_tag="PCH_Pc20g02720"
FT                   /number=1
FT   exon            complement(622602..622699)
FT                   /gene="Pc20g02720"
FT                   /locus_tag="PCH_Pc20g02720"
FT                   /number=2
FT   mRNA            join(<623023..623241,623313..623532,623596..>624032)
FT                   /gene="Pc20g02730"
FT                   /locus_tag="PCH_Pc20g02730"
FT   CDS_pept        join(623023..623241,623313..623532,623596..624032)
FT                   /gene="Pc20g02730"
FT                   /locus_tag="PCH_Pc20g02730"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An02g13830 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02730"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85602"
FT                   /db_xref="GOA:B6HES8"
FT                   /db_xref="InterPro:IPR037475"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES8"
FT                   /protein_id="CAP85602.1"
FT                   /translation="MTDSSPEALAALQQLEQNGKLKDRLAIIRISDPISTEVGGSYPSP
FT                   SKRSSDASLSNFDDPTPASLEADLSHYKELFSKLRFSYLEQVTKEKFLRAIVGDPPVIV
FT                   GHNENMELETQLADVKAELKARKEDARIMIEEMEQMGRDLASRYKNVELQTTQLSTLPA
FT                   SIENLESTIAELRAKQIATMDPSDPNNSSSQNLPLPATLALLAEREAELAALNRQLAAV
FT                   HSALPRKTREAEAVERERSVLERRKSDAIAQAREAQRKKQQGESDGLEEIGRWYRGAEE
FT                   TLKELVGTQT"
FT   exon            623023..623241
FT                   /gene="Pc20g02730"
FT                   /locus_tag="PCH_Pc20g02730"
FT                   /number=1
FT   intron          623242..623312
FT                   /gene="Pc20g02730"
FT                   /locus_tag="PCH_Pc20g02730"
FT                   /number=1
FT   exon            623313..623532
FT                   /gene="Pc20g02730"
FT                   /locus_tag="PCH_Pc20g02730"
FT                   /number=2
FT   intron          623533..623595
FT                   /gene="Pc20g02730"
FT                   /locus_tag="PCH_Pc20g02730"
FT                   /number=2
FT   exon            623596..624032
FT                   /gene="Pc20g02730"
FT                   /locus_tag="PCH_Pc20g02730"
FT                   /number=3
FT   mRNA            complement(join(<624401..624809,624910..625008,
FT                   625086..625104,625161..625198,625256..>625263))
FT                   /gene="Pc20g02740"
FT                   /locus_tag="PCH_Pc20g02740"
FT   CDS_pept        complement(join(624401..624809,624910..625008,
FT                   625086..625104,625161..625198,625256..625263))
FT                   /gene="Pc20g02740"
FT                   /locus_tag="PCH_Pc20g02740"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the small subunit S9 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85603"
FT                   /db_xref="GOA:B6HES9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES9"
FT                   /inference="similar to AA sequence:TREMBLNEW:BC007857.1"
FT                   /inference="protein motif:PFAM:PF00163"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /inference="protein motif:COGS:COG0522"
FT                   /protein_id="CAP85603.1"
FT                   /translation="MAPRVSSKTYKVPRRPFESARLDAELKTVGEFGLRNKREVWRVQL
FT                   TLSKIRRAARELLTLDEKDPKRLFEGNALIRRLVRIGVLDEGRMKLDYVLALKADDFLE
FT                   RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFMVRLDSQKHIDFSLTSPFG
FT                   GGRPGRVRRKKAAAAAGGEDAEEEEEE"
FT   exon            complement(624401..624809)
FT                   /gene="Pc20g02740"
FT                   /locus_tag="PCH_Pc20g02740"
FT                   /number=1
FT   intron          complement(624810..624909)
FT                   /gene="Pc20g02740"
FT                   /locus_tag="PCH_Pc20g02740"
FT                   /number=1
FT   exon            complement(624910..625008)
FT                   /gene="Pc20g02740"
FT                   /locus_tag="PCH_Pc20g02740"
FT                   /number=2
FT   intron          complement(625009..625085)
FT                   /gene="Pc20g02740"
FT                   /locus_tag="PCH_Pc20g02740"
FT                   /number=2
FT   exon            complement(625086..625104)
FT                   /gene="Pc20g02740"
FT                   /locus_tag="PCH_Pc20g02740"
FT                   /number=3
FT   intron          complement(625105..625160)
FT                   /gene="Pc20g02740"
FT                   /locus_tag="PCH_Pc20g02740"
FT                   /number=3
FT   exon            complement(625161..625198)
FT                   /gene="Pc20g02740"
FT                   /locus_tag="PCH_Pc20g02740"
FT                   /number=4
FT   intron          complement(625199..625255)
FT                   /gene="Pc20g02740"
FT                   /locus_tag="PCH_Pc20g02740"
FT                   /number=4
FT   exon            complement(625256..625263)
FT                   /gene="Pc20g02740"
FT                   /locus_tag="PCH_Pc20g02740"
FT                   /number=5
FT   mRNA            join(<626863..626898,627017..627084,627153..627200,
FT                   627316..>627646)
FT                   /gene="Pc20g02750"
FT                   /locus_tag="PCH_Pc20g02750"
FT   CDS_pept        join(626863..626898,627017..627084,627153..627200,
FT                   627316..627646)
FT                   /gene="Pc20g02750"
FT                   /locus_tag="PCH_Pc20g02750"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit Urp1 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02750"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85604"
FT                   /db_xref="GOA:B6HET0"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET0"
FT                   /inference="similar to AA sequence:PIR:S28921"
FT                   /inference="protein motif:PFAM:PF01157"
FT                   /inference="protein motif:COGS:COG2139"
FT                   /protein_id="CAP85604.1"
FT                   /translation="MPHSYGLRAGTRYAFSRGFKEHGMIRLSTYMKTYRVGDIVDLKVN
FT                   GAVQKGMPHKVYHGKTGVVYNVTKSAVGVILYKKVDNRYLEKRISVRIEHVQHSRSRED
FT                   FIKRVKENAIKKREAKEKGVHVHLKRQAVGPREAHFVKQAGNKPETVVPIAYDTHI"
FT   exon            626863..626898
FT                   /gene="Pc20g02750"
FT                   /locus_tag="PCH_Pc20g02750"
FT                   /number=1
FT   intron          626899..627016
FT                   /gene="Pc20g02750"
FT                   /locus_tag="PCH_Pc20g02750"
FT                   /number=1
FT   exon            627017..627084
FT                   /gene="Pc20g02750"
FT                   /locus_tag="PCH_Pc20g02750"
FT                   /number=2
FT   intron          627085..627152
FT                   /gene="Pc20g02750"
FT                   /locus_tag="PCH_Pc20g02750"
FT                   /number=2
FT   exon            627153..627200
FT                   /gene="Pc20g02750"
FT                   /locus_tag="PCH_Pc20g02750"
FT                   /number=3
FT   intron          627201..627315
FT                   /gene="Pc20g02750"
FT                   /locus_tag="PCH_Pc20g02750"
FT                   /number=3
FT   exon            627316..627646
FT                   /gene="Pc20g02750"
FT                   /locus_tag="PCH_Pc20g02750"
FT                   /number=4
FT   mRNA            join(<628481..628665,628716..629669,629732..>629771)
FT                   /gene="Pc20g02760"
FT                   /locus_tag="PCH_Pc20g02760"
FT   CDS_pept        join(628481..628665,628716..629669,629732..629771)
FT                   /gene="Pc20g02760"
FT                   /locus_tag="PCH_Pc20g02760"
FT                   /note="Title: strong similarity to mitochondrial carrier
FT                   protein Rim2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02760"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85605"
FT                   /db_xref="GOA:B6HET1"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET1"
FT                   /inference="similar to AA sequence:PIR:S36081"
FT                   /inference="protein motif:PFAM:PF00153"
FT                   /protein_id="CAP85605.1"
FT                   /translation="MTFSTTAAPSSAPAQLGSTPPSVNKDLIPQSREMGDVIPNRTPPA
FT                   SQEKPEAKPFAHFVAGGLGGMTAATLTSPLDVLKTRLQSDFYQAQLQALRAAKPAPAPT
FT                   SNALVSVTRTAGMHFSETFQILRSIHVHEGWRALFKGLGPNLIGVVPARAINFYVYGNG
FT                   KRILSDYFDYRTAEQTPMGIHLAAAAIAGIATGTATNPIWLVKTRLQLDKSNAEIGKSR
FT                   QYRNSFDCIKQTVRHEGIRGLYRGLSASYLGVTESSLQWVMYEQMKMYLARRDALKQAD
FT                   PAYDYTSWDSAELWGGRITAAGLAKLVAAAITYPHEVVRTRLRQAPTVSLGNGKVEMKY
FT                   TGLVQCFKTVWKEEGMVAMYGGLTPHLLRVVPSAAIMFGMYEFILRMFGTTS"
FT   exon            628481..628665
FT                   /gene="Pc20g02760"
FT                   /locus_tag="PCH_Pc20g02760"
FT                   /number=1
FT   intron          628666..628715
FT                   /gene="Pc20g02760"
FT                   /locus_tag="PCH_Pc20g02760"
FT                   /number=1
FT   exon            628716..629669
FT                   /gene="Pc20g02760"
FT                   /locus_tag="PCH_Pc20g02760"
FT                   /number=2
FT   intron          629670..629731
FT                   /gene="Pc20g02760"
FT                   /locus_tag="PCH_Pc20g02760"
FT                   /number=2
FT   exon            629732..629771
FT                   /gene="Pc20g02760"
FT                   /locus_tag="PCH_Pc20g02760"
FT                   /number=3
FT   mRNA            complement(join(<633751..633900,633968..634138,
FT                   634203..>634250))
FT                   /gene="Pc20g02770"
FT                   /locus_tag="PCH_Pc20g02770"
FT   CDS_pept        complement(join(633751..633900,633968..634138,
FT                   634203..634250))
FT                   /gene="Pc20g02770"
FT                   /locus_tag="PCH_Pc20g02770"
FT                   /note="Title: similarity to hypothetical protein ncu09372.1
FT                   - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02770"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85606"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET2"
FT                   /protein_id="CAP85606.1"
FT                   /translation="MKWQSTLFILGALSTQALGAKIMCNVDHDYADKGAIESGISYIRG
FT                   LSGQPTAEANKCNRVSCSWGSGIYLCADDGKDHTLQNWGVLADATQAVLDSCGNDSGVK
FT                   GRLMHEKGWGVAVQGAPC"
FT   exon            complement(633751..633900)
FT                   /gene="Pc20g02770"
FT                   /locus_tag="PCH_Pc20g02770"
FT                   /number=1
FT   mat_peptide     complement(join(633754..633900,633968..634129))
FT                   /gene="Pc20g02770"
FT                   /locus_tag="PCH_Pc20g02770"
FT   intron          complement(633901..633967)
FT                   /gene="Pc20g02770"
FT                   /locus_tag="PCH_Pc20g02770"
FT                   /number=1
FT   exon            complement(633968..634138)
FT                   /gene="Pc20g02770"
FT                   /locus_tag="PCH_Pc20g02770"
FT                   /number=2
FT   sig_peptide     complement(join(634130..634138,634203..634250))
FT                   /gene="Pc20g02770"
FT                   /locus_tag="PCH_Pc20g02770"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(634139..634202)
FT                   /gene="Pc20g02770"
FT                   /locus_tag="PCH_Pc20g02770"
FT                   /number=2
FT   exon            complement(634203..634250)
FT                   /gene="Pc20g02770"
FT                   /locus_tag="PCH_Pc20g02770"
FT                   /number=3
FT   mRNA            join(<635679..636186,636241..636397,636462..>636714)
FT                   /gene="Pc20g02780"
FT                   /locus_tag="PCH_Pc20g02780"
FT   CDS_pept        join(635679..636186,636241..636397,636462..636714)
FT                   /gene="Pc20g02780"
FT                   /locus_tag="PCH_Pc20g02780"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   PA3829 - Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02780"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85607"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET3"
FT                   /inference="similar to AA sequence:PIR:B83167"
FT                   /inference="protein motif:COGS:COG1073"
FT                   /inference="protein motif:COGS:COG0596"
FT                   /inference="protein motif:COGS:COG1506"
FT                   /protein_id="CAP85607.1"
FT                   /translation="MSRENVEFQTADHVTLRGWFFRPSMEPLETKLPCLVMSHGFSALK
FT                   EMGLDAFAEYFALNLPISCLVYDNRGFGDSDTKEGQPRQEVLPSQQISDISDAITYAQS
FT                   RADVDPNRIGIWGSSYSGGHVLYVGAVDRRVKVVLSHVPFTDGWETLSRLLPSDAIDGV
FT                   NKAFQEDRLARAAGKPAGMIAVVEKDPLKPSTLPTPDSYQFFSEWEAKSNWKNEITLKS
FT                   LEAARGYNPTAHIHHISPTPLLMTVAENDVVAPTDIALDAYSRAGEPKKLRMFPGGHFD
FT                   GYAGEGFERNASVHAEFLKEHLVG"
FT   exon            635679..636186
FT                   /gene="Pc20g02780"
FT                   /locus_tag="PCH_Pc20g02780"
FT                   /number=1
FT   intron          636187..636240
FT                   /gene="Pc20g02780"
FT                   /locus_tag="PCH_Pc20g02780"
FT                   /number=1
FT   exon            636241..636397
FT                   /gene="Pc20g02780"
FT                   /locus_tag="PCH_Pc20g02780"
FT                   /number=2
FT   intron          636398..636461
FT                   /gene="Pc20g02780"
FT                   /locus_tag="PCH_Pc20g02780"
FT                   /number=2
FT   exon            636462..636714
FT                   /gene="Pc20g02780"
FT                   /locus_tag="PCH_Pc20g02780"
FT                   /number=3
FT   mRNA            join(<639475..639620,639662..>642131)
FT                   /gene="Pc20g02790"
FT                   /locus_tag="PCH_Pc20g02790"
FT   CDS_pept        join(639475..639620,639662..642131)
FT                   /gene="Pc20g02790"
FT                   /locus_tag="PCH_Pc20g02790"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   contig1487_1.tfa_1190cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02790"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85608"
FT                   /db_xref="GOA:B6HET4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET4"
FT                   /protein_id="CAP85608.1"
FT                   /translation="MNSNFNFNNEEVNETMQWPGPPGSFTSSEGFTGTDNDRVGAHPET
FT                   TASRTSSSADLTSLTSSEAYPQESGWMNIDPFSQVREAPQRYDSDLDGIDPRYHLEDEN
FT                   NIPQSLAEDLGSSTITQRPADDPSESTVLPLGGLDRTTIGIPNPAHFSLQPPTQPSYEG
FT                   IVDQVVNTYRALMSDQTCSPHQISQGLQNLETIKYFFHTKLPASPISIASSEPDTRDKP
FT                   LFRCWQCDPQKKKATFPSFGAFKRHLTMHGILDCEWRCTYCDVTLHRRDRMRNHLIHVH
FT                   NKFNLLPADVEATRVRYPPPTNCPIPICLDRTPSWAVYFEHIKSHCLISPVSGNASTNG
FT                   DRSDHSGNGGGNGNRHVHGSSSAGPSNSNRGSQSSQSSNQSGGTPYPSTIFGGFSNRGN
FT                   VCAGPVSHSTSDDQLNTSRRQSATEAIEQISIDDLLRSPHGPRASHLPRGVSGQPNNLL
FT                   PPQDPRLSRSNHSSKRKRQDKQKEPTDEQAPSSNKCRRCNHDMARCGHCQSVDSCHKCG
FT                   DLPRSGIQVGASTTMPAQALPDASSAFINLDESYLNSEALANLVTPQNMPTQLPHYNPN
FT                   EIMHSFDPQSFGDMTNTFMDEFPNDPFIRVAMDVVSHPPLRDLGDKIQGSPVFESDAKL
FT                   LRTIGLGTLIDPLSTKRQLIQPQAKASSGPAPGSYADLRNNGSSSILEAPQPVSRCQCP
FT                   CVTVPAVDYEAHASLQLSPDERVEMAFKMTPARESSHPLRTRVRVFVKLFSLRASAARS
FT                   NTEKQRTRSFSSETTDEDAESETDSDQELTPTSPSSSEITPLLHWTEDVQDWSFSFDIK
FT                   WALTKLAQWTSGIDADTCRKLLLSDPGHILDLMSMYIVYKFKISWLLMGRNGLSVFLSI
FT                   "
FT   exon            639475..639620
FT                   /gene="Pc20g02790"
FT                   /locus_tag="PCH_Pc20g02790"
FT                   /number=1
FT   intron          639621..639661
FT                   /gene="Pc20g02790"
FT                   /locus_tag="PCH_Pc20g02790"
FT                   /number=1
FT   exon            639662..642131
FT                   /gene="Pc20g02790"
FT                   /locus_tag="PCH_Pc20g02790"
FT                   /number=2
FT   mRNA            complement(join(<643389..643561,643622..644223,
FT                   644303..>644751))
FT                   /gene="Pc20g02800"
FT                   /locus_tag="PCH_Pc20g02800"
FT   CDS_pept        complement(join(643389..643561,643622..644223,
FT                   644303..644751))
FT                   /gene="Pc20g02800"
FT                   /locus_tag="PCH_Pc20g02800"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   MDF20.11 - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02800"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85609"
FT                   /db_xref="GOA:B6HET5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034771"
FT                   /db_xref="InterPro:IPR034772"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET5"
FT                   /inference="similar to AA sequence:TREMBLNEW:AB009050.11"
FT                   /inference="protein motif:PFAM:PF00076"
FT                   /protein_id="CAP85609.1"
FT                   /translation="MATDDDNFDIDIYGDGTYNANEPGEFKQDDSELVLDAPENQPQPS
FT                   TGPSNDANQENPTSTQGQQVNNNGAPSAPQQPSNHGLPAPPQGVKRKEFEDQSVDPDAT
FT                   TALLISDLSWWITEDDIRGLANQAGVEDQLKDVTFSEHKVNGKSKGQAFVEFTTARAAT
FT                   ATRHHIERNDTPARRHTVQYTTPHQNPFRTLPKDAPMRNAGGRGGGAAHPTGGNYGMNN
FT                   AGGGFRGRGSGFNRGMGHMNNFNNRNNFNPMGGFQGGGPNPMMGGFQGAPMGGMPNYGF
FT                   NNRGNMMGGGMRGNMRGGRGVGMGGGPNMMGMPAMTPPMGGMGMNPMAGMNPMMGGGMA
FT                   GGMGGNMPMQGQQGFQGPNPGFNQGYYNPNNPNNPNNPNNQNQASGSGSGSDGGSWNPH
FT                   GAKRSRQD"
FT   exon            complement(643389..643561)
FT                   /gene="Pc20g02800"
FT                   /locus_tag="PCH_Pc20g02800"
FT                   /number=1
FT   intron          complement(643562..643621)
FT                   /gene="Pc20g02800"
FT                   /locus_tag="PCH_Pc20g02800"
FT                   /number=1
FT   exon            complement(643622..644223)
FT                   /gene="Pc20g02800"
FT                   /locus_tag="PCH_Pc20g02800"
FT                   /number=2
FT   intron          complement(644224..644302)
FT                   /gene="Pc20g02800"
FT                   /locus_tag="PCH_Pc20g02800"
FT                   /number=2
FT   exon            complement(644303..644751)
FT                   /gene="Pc20g02800"
FT                   /locus_tag="PCH_Pc20g02800"
FT                   /number=3
FT   mRNA            join(<645620..645704,645774..645832,645897..645924,
FT                   646001..>646041)
FT                   /gene="Pc20g02810"
FT                   /locus_tag="PCH_Pc20g02810"
FT   CDS_pept        join(645620..645704,645774..645832,645897..645924,
FT                   646001..646041)
FT                   /gene="Pc20g02810"
FT                   /locus_tag="PCH_Pc20g02810"
FT                   /note="Title: similarity to translocation complex component
FT                   Sss1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02810"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85610"
FT                   /db_xref="GOA:B6HET6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET6"
FT                   /inference="similar to AA sequence:PIR:S48775"
FT                   /inference="protein motif:PFAM:PF00584"
FT                   /inference="protein motif:COGS:COG2443"
FT                   /protein_id="CAP85610.1"
FT                   /translation="MSETLQELADIPKDFVREGSQFVRRCTKPDKREFIKISQAVGMGF
FT                   LVMGAIGYFVKLIHIPVNQVLVGGA"
FT   exon            645620..645704
FT                   /gene="Pc20g02810"
FT                   /locus_tag="PCH_Pc20g02810"
FT                   /number=1
FT   intron          645705..645773
FT                   /gene="Pc20g02810"
FT                   /locus_tag="PCH_Pc20g02810"
FT                   /number=1
FT   exon            645774..645832
FT                   /gene="Pc20g02810"
FT                   /locus_tag="PCH_Pc20g02810"
FT                   /number=2
FT   intron          645833..645896
FT                   /gene="Pc20g02810"
FT                   /locus_tag="PCH_Pc20g02810"
FT                   /number=2
FT   exon            645897..645924
FT                   /gene="Pc20g02810"
FT                   /locus_tag="PCH_Pc20g02810"
FT                   /number=3
FT   intron          645925..646000
FT                   /gene="Pc20g02810"
FT                   /locus_tag="PCH_Pc20g02810"
FT                   /number=3
FT   exon            646001..646041
FT                   /gene="Pc20g02810"
FT                   /locus_tag="PCH_Pc20g02810"
FT                   /number=4
FT   mRNA            complement(join(<646678..646877,646981..647746,
FT                   647807..648172,648247..648623,648680..648778,
FT                   648841..>649144))
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT   CDS_pept        complement(join(646678..646877,646981..647746,
FT                   647807..648172,648247..648623,648680..648778,
FT                   648841..649144))
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT                   /note="Title: strong similarity to cDNA LEC14B
FT                   -Lithospermum erythrorhizon"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02820"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85611"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET7"
FT                   /inference="similar to AA sequence:SWISSPROT:L14B_PRUAR"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP85611.1"
FT                   /translation="MNDITQNQPVTEVGTYLCTISIHGSLLISTTTIQNMSSRTPDDGT
FT                   ESSRGSEGIWHPAHEWLENDELDTDYHPALEPSEHDGAWEDDIPNEDQQMGSGVASENT
FT                   HINIGNIQIELTADDSESEDTDDLNEGHTRVPASRLFELLASSGLQHILQANGWPTAME
FT                   EEQETLEDEDDELSDEDFMPIFRNRLRARRSTETLKLPPVPNPEGKKLMSEGHFGTDQF
FT                   YGDRLRQRKKFLATSLMWRELGIDTDGVRKRAGQSISQGLIPSSIADKIIHYDTRSYSG
FT                   QFSDDGNFFFCCAQDFKVRMYDTSNPYDWKYYKTVDYPFGQWTITDATLSPDNRFLVYS
FT                   SIRSQAYMASTDPEDNSDPTVLDLSTPPGQRRRRSWGSSHFGIWSLRFSGDGREVVAGT
FT                   SEDSVIVYDLETRQPVLNLRERHQHHVNAVCYGDTSSPHILYSGSDDTTIRVWDRRSMG
FT                   DGREAGAFMGHTEGLTYVDSKGDGRYVLSNSKDQTMKLWDLRKMMTSADIENIDPFDYS
FT                   TGFDYRFEQYPDQYRRNAKNDCSVVTYRGHRVLKTLIRCHFSPPGSTNSRYVYSGSEDG
FT                   KVYVYNLDATLAGTIDVGQATFNSRPRDPDAYATAYEMSGEMLWRTCVRDASWHPNAPV
FT                   LAVHSWNAGAAKDEGDPPAGKSYDDRLRHIPEFDQYRESAPHGRPRRPLRSRPVRRWVG
FT                   DEEAEDAIW"
FT   exon            complement(646678..646877)
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT                   /number=1
FT   intron          complement(646878..646980)
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT                   /number=1
FT   exon            complement(646981..647746)
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT                   /number=2
FT   intron          complement(647747..647806)
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT                   /number=2
FT   exon            complement(647807..648172)
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT                   /number=3
FT   intron          complement(648173..648246)
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT                   /number=3
FT   exon            complement(648247..648623)
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT                   /number=4
FT   intron          complement(648624..648679)
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT                   /number=4
FT   exon            complement(648680..648778)
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT                   /number=5
FT   intron          complement(648779..648840)
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT                   /number=5
FT   exon            complement(648841..649144)
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT                   /number=6
FT   mRNA            complement(join(<649471..649644,649689..649763,
FT                   649890..649928,650033..650236,650317..650414,
FT                   650480..>650531))
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT   CDS_pept        complement(join(649471..649644,649689..649763,
FT                   649890..649928,650033..650236,650317..650414,
FT                   650480..650531))
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02830"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85612"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF44"
FT                   /protein_id="CAP85612.1"
FT                   /translation="MRLSNHLILFSTHLALSIAAGCGDADACVGTEICTTATFTTPTAT
FT                   TITTCRIVSPAVRAKSAAPHTVRPLNVDRLTQTGRTARRIMAHVWQMRTAATETSVWTD
FT                   FVLDLESRLSRELVVNVALELPNCPNYLSLYYPSGRTTIHCNGEPKPIPIERNIHIQKP
FT                   EIRLLQASVFQHIMRSSWFLKGQLSSTPYGNNAIPSHQSHRAGAGNTKWV"
FT   exon            complement(649471..649644)
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /number=1
FT   mat_peptide     complement(join(649474..649644,649689..649763,
FT                   649890..649928,650033..650236,650317..650391))
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT   intron          complement(649645..649688)
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /number=1
FT   exon            complement(649689..649763)
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /number=2
FT   intron          complement(649764..649889)
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /number=2
FT   exon            complement(649890..649928)
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /number=3
FT   intron          complement(649929..650032)
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /number=3
FT   exon            complement(650033..650236)
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /number=4
FT   intron          complement(650237..650316)
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /number=4
FT   exon            complement(650317..650414)
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /number=5
FT   sig_peptide     complement(join(650392..650414,650480..650531))
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /inference="protein motif:SignalP:2.0"
FT   intron          complement(650415..650479)
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /number=5
FT   exon            complement(650480..650531)
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /number=6
FT   mRNA            <651517..>652554
FT                   /gene="Pc20g02840"
FT                   /locus_tag="PCH_Pc20g02840"
FT   CDS_pept        651517..652554
FT                   /gene="Pc20g02840"
FT                   /locus_tag="PCH_Pc20g02840"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig31_part_i.tfa_3700cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02840"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85613"
FT                   /db_xref="GOA:B6HF45"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF45"
FT                   /protein_id="CAP85613.1"
FT                   /translation="MATKTLMASCQCKNFQFTVAVPTECFPLNIHLCHCSICRYTHGAP
FT                   CSFHAPLPVGVEPQFIAPSSLNKLTSYQHPASTATGYFCSTCGCQIGGADGQWVITPAI
FT                   FDANREDEGIWKFNAHMLPTSAPDGGLAAVFSLIDGHRMEIENLGLSPQAIAGSDSQPP
FT                   DPESKELLAQCHCGGVSFTIARPSEEFIASPRSKGWISPLDKSKWLASMDLCDDCRLVT
FT                   GTHVISWMFVSIDHITPRLPKDLLIGSAKGYRSSKDVLRVFCGTCGATVFYHCDGRPEI
FT                   VDVAMGILRAPEGAMAENWSVWRAGRASFPENGMRYHAGFSRALIEGMQRWGAERGHPQ
FT                   DFEIA"
FT   exon            651517..652554
FT                   /gene="Pc20g02840"
FT                   /locus_tag="PCH_Pc20g02840"
FT                   /number=1
FT   mRNA            join(<653177..653254,653433..653754,653818..>653846)
FT                   /gene="Pc20g02850"
FT                   /locus_tag="PCH_Pc20g02850"
FT   CDS_pept        join(653177..653254,653433..653754,653818..653846)
FT                   /gene="Pc20g02850"
FT                   /locus_tag="PCH_Pc20g02850"
FT                   /note="Title: strong similarity to component of the
FT                   retrieval machinery Grd19 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02850"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85614"
FT                   /db_xref="GOA:B6HF46"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="InterPro:IPR042138"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF46"
FT                   /inference="similar to AA sequence:PIR:S67269"
FT                   /inference="protein motif:PFAM:PF00787"
FT                   /inference="protein motif:COGS:COG5391"
FT                   /protein_id="CAP85614.1"
FT                   /translation="MQSVPESRQQSFEEIYGPPENFLEIEVRNPQTHGTSRNMYTSYEI
FT                   VCRTNIPAFKLKHSVVRRRYSDFEYFRDILERESTRVTIPPLPGKVFTNRFSDDVIEHR
FT                   REGLQRFLQIVAGHPLLQTGSKVLASFIQDPNWDRNAW"
FT   exon            653177..653254
FT                   /gene="Pc20g02850"
FT                   /locus_tag="PCH_Pc20g02850"
FT                   /number=1
FT   intron          653255..653432
FT                   /gene="Pc20g02850"
FT                   /locus_tag="PCH_Pc20g02850"
FT                   /number=1
FT   exon            653433..653754
FT                   /gene="Pc20g02850"
FT                   /locus_tag="PCH_Pc20g02850"
FT                   /number=2
FT   intron          653755..653817
FT                   /gene="Pc20g02850"
FT                   /locus_tag="PCH_Pc20g02850"
FT                   /number=2
FT   exon            653818..653846
FT                   /gene="Pc20g02850"
FT                   /locus_tag="PCH_Pc20g02850"
FT                   /number=3
FT   mRNA            complement(join(<654576..655497,655553..655582,
FT                   655642..>656690))
FT                   /gene="Pc20g02860"
FT                   /locus_tag="PCH_Pc20g02860"
FT   CDS_pept        complement(join(654576..655497,655553..655582,
FT                   655642..656690))
FT                   /gene="Pc20g02860"
FT                   /locus_tag="PCH_Pc20g02860"
FT                   /note="Title: similarity to hypothetical myb-like DNA
FT                   binding protein SPAC13G7.10 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02860"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85615"
FT                   /db_xref="GOA:B6HF47"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF47"
FT                   /inference="protein motif:PFAM:PF00249"
FT                   /protein_id="CAP85615.1"
FT                   /translation="MESSSALRPLDESLLRELPQLSLRIAPLREPVSSRTLSVPSPLEP
FT                   NASGARDSNNISNSSSNSGKIQANAKEGLPTVTEFLNAARIRKTELSADSQSNVERPPR
FT                   PILPAFVNLRALEKFPFSSSFDDDALQGPRKRRRRDPQPDSFSEHLQLPIPQAQKEQRP
FT                   PPFGPFAILNGLNEPPPNAALLPPIEAGSNISQLLNKPSRGDAAADSGTSVSAHAAISD
FT                   GQPAERRDTRLEDILRTSLNADGDHDQNDNAENVQSTNPVDPDEIALAVREAEKLKDSK
FT                   ESPLPPAADAPMSPKTRGRSRKNLRKWSEEETTNLLRGVIKCGIGNWTAILAQPELKFN
FT                   QRTASNLKDRFRVLCPWAYSASDPDLAAKQLHDTLANSLLKAKAEGSDESPSKLHLSHL
FT                   IPSNFEPNFGAGSPACNPQEPLISSTAPDTDPRGSTTAQSQSPSSGNSTPALSSKSRTT
FT                   LASLGIPEPHVSRTKRRSRRPFTAAEDEALLKGYAVHGFQWTLIQQDSRLNLSHRKATD
FT                   LRDRFRTKFPHAYRDGGSVSGKALTSQNQAQESAVGTSTPRPHAGTEQSPSKAYAMTPT
FT                   QTPATTPRTSVSRSRHAATPSQSNPAQIDPALLPPPPQGFLEHSMYLPPAAAAGALSFS
FT                   LDDGPGTGASSAVETPWEDNTLAPMIWDELT"
FT   exon            complement(654576..655497)
FT                   /gene="Pc20g02860"
FT                   /locus_tag="PCH_Pc20g02860"
FT                   /number=1
FT   intron          complement(655498..655552)
FT                   /gene="Pc20g02860"
FT                   /locus_tag="PCH_Pc20g02860"
FT                   /number=1
FT   exon            complement(655553..655582)
FT                   /gene="Pc20g02860"
FT                   /locus_tag="PCH_Pc20g02860"
FT                   /number=2
FT   intron          complement(655583..655641)
FT                   /gene="Pc20g02860"
FT                   /locus_tag="PCH_Pc20g02860"
FT                   /number=2
FT   exon            complement(655642..656690)
FT                   /gene="Pc20g02860"
FT                   /locus_tag="PCH_Pc20g02860"
FT                   /number=3
FT   mRNA            join(<657129..657190,657259..>657667)
FT                   /gene="Pc20g02870"
FT                   /locus_tag="PCH_Pc20g02870"
FT   CDS_pept        join(657129..657190,657259..657667)
FT                   /gene="Pc20g02870"
FT                   /locus_tag="PCH_Pc20g02870"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_81_scaffold_5.tfa_210cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02870"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85616"
FT                   /db_xref="GOA:B6HF48"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF48"
FT                   /protein_id="CAP85616.1"
FT                   /translation="MPTIFPTWPHILFGVLEPISLALGSVFPLYDLEGFIAGQTPTIAA
FT                   PATLHPSSVALAYQLGNVYSLLFLVGVGVCHATTEPRVLRNYLIGLAIADVGHVYATYL
FT                   AMGWDAFADVGAWNALTWGNIGITMFLFVNRIAYFLGIFGYAKAPKAAAKRE"
FT   sig_peptide     join(657129..657190,657259..657268)
FT                   /gene="Pc20g02870"
FT                   /locus_tag="PCH_Pc20g02870"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            657129..657190
FT                   /gene="Pc20g02870"
FT                   /locus_tag="PCH_Pc20g02870"
FT                   /number=1
FT   intron          657191..657258
FT                   /gene="Pc20g02870"
FT                   /locus_tag="PCH_Pc20g02870"
FT                   /number=1
FT   exon            657259..657667
FT                   /gene="Pc20g02870"
FT                   /locus_tag="PCH_Pc20g02870"
FT                   /number=2
FT   mat_peptide     657269..657664
FT                   /gene="Pc20g02870"
FT                   /locus_tag="PCH_Pc20g02870"
FT   mRNA            complement(join(<658434..658736,658807..659292,
FT                   659356..>659961))
FT                   /gene="Pc20g02880"
FT                   /locus_tag="PCH_Pc20g02880"
FT   CDS_pept        complement(join(658434..658736,658807..659292,
FT                   659356..659961))
FT                   /gene="Pc20g02880"
FT                   /locus_tag="PCH_Pc20g02880"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An11g09490 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02880"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85617"
FT                   /db_xref="GOA:B6HF49"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR023578"
FT                   /db_xref="InterPro:IPR036964"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF49"
FT                   /protein_id="CAP85617.1"
FT                   /translation="MSAQSSIAASDWGHSYPSIFQLNLEIPAFFMPYRWWEDEATTVFW
FT                   AFDIQGISRVIQFGLFRDENFPRTSLCARNVDTIDTFLMALSEPHEYQLLGNLSHIQRV
FT                   EEILRRSSISPFQAIPWSWLPPQPSPTLDAREIAAAIEAESHFHFKQVAFEELVRAALG
FT                   YNAIFVDWFLQQHEALYIILRDHLGAYPEDIPLYTEVGKHLRSRSPFAYRALVQCLIAV
FT                   RPGGNRDVTKPTAGFEFIAGPIQALFKEQPGRLIAMLKMLSVLTIRFRRKYVHAPTMDW
FT                   RTPFDTSIPFLDDYLESTSPTDLARSMRGLDEHHFAELTRQSLIAEDAVVGQLKVQWRE
FT                   LSVSVWECCAALPDLIPYLQECAQTLLTTRNYHSFTAIIKGLHTYSILKTRPGNTGTQG
FT                   NVVTLETLFPQEILSLMSPAQNYAAYRQHYQKFPGIPFLIPHIRDHKENGESVLQPVFQ
FT                   YLQSTQ"
FT   exon            complement(658434..658736)
FT                   /gene="Pc20g02880"
FT                   /locus_tag="PCH_Pc20g02880"
FT                   /number=1
FT   intron          complement(658737..658806)
FT                   /gene="Pc20g02880"
FT                   /locus_tag="PCH_Pc20g02880"
FT                   /number=1
FT   exon            complement(658807..659292)
FT                   /gene="Pc20g02880"
FT                   /locus_tag="PCH_Pc20g02880"
FT                   /number=2
FT   intron          complement(659293..659355)
FT                   /gene="Pc20g02880"
FT                   /locus_tag="PCH_Pc20g02880"
FT                   /number=2
FT   exon            complement(659356..659961)
FT                   /gene="Pc20g02880"
FT                   /locus_tag="PCH_Pc20g02880"
FT                   /number=3
FT   mRNA            complement(join(<661670..661729,661767..661906,
FT                   662126..>662252))
FT                   /gene="Pc20g02890"
FT                   /locus_tag="PCH_Pc20g02890"
FT   CDS_pept        complement(join(661670..661729,661767..661906,
FT                   662126..662252))
FT                   /gene="Pc20g02890"
FT                   /locus_tag="PCH_Pc20g02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02890"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85618"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF50"
FT                   /protein_id="CAP85618.1"
FT                   /translation="MEGGEQNNLIDPNSILALGRPTFGSPLGILGIRFACSKRHTVVSP
FT                   RRTNGHIIWGMHNNAVVDYFLTVTPGTRNIERNILLPKVPNWSILELGSGSGILCITLH
FT                   FPLL"
FT   exon            complement(661670..661729)
FT                   /gene="Pc20g02890"
FT                   /locus_tag="PCH_Pc20g02890"
FT                   /number=1
FT   intron          complement(661730..661766)
FT                   /gene="Pc20g02890"
FT                   /locus_tag="PCH_Pc20g02890"
FT                   /number=1
FT   exon            complement(661767..661906)
FT                   /gene="Pc20g02890"
FT                   /locus_tag="PCH_Pc20g02890"
FT                   /number=2
FT   intron          complement(661907..662125)
FT                   /gene="Pc20g02890"
FT                   /locus_tag="PCH_Pc20g02890"
FT                   /number=2
FT   exon            complement(662126..662252)
FT                   /gene="Pc20g02890"
FT                   /locus_tag="PCH_Pc20g02890"
FT                   /number=3
FT   mRNA            complement(join(<664188..664241,664296..664590,
FT                   664723..665007,665076..665213,665360..>665370))
FT                   /gene="Pc20g02900"
FT                   /locus_tag="PCH_Pc20g02900"
FT   CDS_pept        complement(join(664188..664241,664296..664590,
FT                   664723..665007,665076..665213,665360..665370))
FT                   /gene="Pc20g02900"
FT                   /locus_tag="PCH_Pc20g02900"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the small subunit S4.e - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02900"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85619"
FT                   /db_xref="GOA:B6HF51"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="InterPro:IPR032277"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF51"
FT                   /inference="similar to AA sequence:PIR:S20054"
FT                   /inference="protein motif:PFAM:PF00900"
FT                   /inference="protein motif:COGS:COG1471"
FT                   /protein_id="CAP85619.1"
FT                   /translation="MRGPGKHQKRLSAPSHWLLDKMSGTYAPKASPGPHKLRDCLPLIV
FT                   FIRNRLKYALNGREVKAIMMQRLVKVDGKVRTDTTYPAGFMDVISLEKTGEHFRLIYDT
FT                   KGRFTVHRIQAEEAEYKLCKVKRVQLGKGGIPFLVTHDARTIRYPDPAIKVNDTVKVDI
FT                   ATGKILDFVKFDSGVVIMATGGRNMGRVGVITHRERHDGGFNIVHVRDALDNQFATRES
FT                   NVFVIGQDKPWVSLPKGKGVKLSIAEERDRRRAHDLAN"
FT   exon            complement(664188..664241)
FT                   /gene="Pc20g02900"
FT                   /locus_tag="PCH_Pc20g02900"
FT                   /number=1
FT   intron          complement(664242..664295)
FT                   /gene="Pc20g02900"
FT                   /locus_tag="PCH_Pc20g02900"
FT                   /number=1
FT   exon            complement(664296..664590)
FT                   /gene="Pc20g02900"
FT                   /locus_tag="PCH_Pc20g02900"
FT                   /number=2
FT   intron          complement(664591..664722)
FT                   /gene="Pc20g02900"
FT                   /locus_tag="PCH_Pc20g02900"
FT                   /number=2
FT   exon            complement(664723..665007)
FT                   /gene="Pc20g02900"
FT                   /locus_tag="PCH_Pc20g02900"
FT                   /number=3
FT   intron          complement(665008..665075)
FT                   /gene="Pc20g02900"
FT                   /locus_tag="PCH_Pc20g02900"
FT                   /number=3
FT   exon            complement(665076..665213)
FT                   /gene="Pc20g02900"
FT                   /locus_tag="PCH_Pc20g02900"
FT                   /number=4
FT   intron          complement(665214..665359)
FT                   /gene="Pc20g02900"
FT                   /locus_tag="PCH_Pc20g02900"
FT                   /number=4
FT   exon            complement(665360..665370)
FT                   /gene="Pc20g02900"
FT                   /locus_tag="PCH_Pc20g02900"
FT                   /number=5
FT   mRNA            complement(join(<665672..666477,666539..666796,
FT                   666855..>666885))
FT                   /gene="Pc20g02910"
FT                   /locus_tag="PCH_Pc20g02910"
FT   CDS_pept        complement(join(665672..666477,666539..666796,
FT                   666855..666885))
FT                   /gene="Pc20g02910"
FT                   /locus_tag="PCH_Pc20g02910"
FT                   /note="unknown EC_number=1.2.1.11"
FT                   /note="Title: strong similarity to aspartate-semialdehyde
FT                   dehydrogenase Hom2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02910"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85620"
FT                   /db_xref="GOA:B6HF52"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF52"
FT                   /inference="similar to AA sequence:PIR:JQ0198"
FT                   /inference="protein motif:PFAM:PF01118"
FT                   /inference="protein motif:PFAM:PF02774"
FT                   /inference="protein motif:COGS:COG0136"
FT                   /protein_id="CAP85620.1"
FT                   /translation="MAPSFPKKKCGVLGATGSVGQRFILLLADHPFLELHAVGASERSA
FT                   NKKYKDAVNWKQSKPMSEKLSNLVMRDCKPEQFSDCDLVFSGLNSDVAGETEMAFIKAE
FT                   IPVFSNAKNFRKDPMVPLVVPTVNPQHLDLIPHQREQYGLKKGFLVCNSNCAVIGIVIP
FT                   FAALQAKFGPVEEVEVFTEQAVSGAGYPGVPTMDILDNVIPYISGEEDKLENEAQKILG
FT                   SLNASATGFDEQTGLRIGATCTRVGVTDGHMAFVSLRFKNRQTPTAEQVKEALREYKSE
FT                   AQKLGAPSAPEPAIKVFDAPDRPQPRLDRDISGGYTVSVGRVREGAPGGHFDIRFAALS
FT                   HNTVIGAAGSSILNAEVAVIKGYI"
FT   exon            complement(665672..666477)
FT                   /gene="Pc20g02910"
FT                   /locus_tag="PCH_Pc20g02910"
FT                   /number=1
FT   intron          complement(666478..666538)
FT                   /gene="Pc20g02910"
FT                   /locus_tag="PCH_Pc20g02910"
FT                   /number=1
FT   exon            complement(666539..666796)
FT                   /gene="Pc20g02910"
FT                   /locus_tag="PCH_Pc20g02910"
FT                   /number=2
FT   intron          complement(666797..666854)
FT                   /gene="Pc20g02910"
FT                   /locus_tag="PCH_Pc20g02910"
FT                   /number=2
FT   exon            complement(666855..666885)
FT                   /gene="Pc20g02910"
FT                   /locus_tag="PCH_Pc20g02910"
FT                   /number=3
FT   mRNA            complement(<667461..>667695)
FT                   /gene="Pc20g02920"
FT                   /locus_tag="PCH_Pc20g02920"
FT   CDS_pept        complement(<667461..>667695)
FT                   /pseudo
FT                   /gene="Pc20g02920"
FT                   /locus_tag="PCH_Pc20g02920"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig52.tfa_390cg - Aspergillus fumigatus [truncated
FT                   ORF][putative pseudogene]"
FT   exon            complement(<667461..>667695)
FT                   /gene="Pc20g02920"
FT                   /locus_tag="PCH_Pc20g02920"
FT                   /number=1
FT   mRNA            complement(join(<667974..668141,668194..668375,
FT                   668427..669519,669560..>669838))
FT                   /gene="Pc20g02930"
FT                   /locus_tag="PCH_Pc20g02930"
FT   CDS_pept        complement(join(667974..668141,668194..668375,
FT                   668427..669519,669560..669838))
FT                   /gene="Pc20g02930"
FT                   /locus_tag="PCH_Pc20g02930"
FT                   /note="Title: strong similarity to D-lactate dehydrogenase
FT                   dld - Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02930"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85622"
FT                   /db_xref="GOA:B6HF53"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF53"
FT                   /inference="similar to AA sequence:PIR:S51528"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /inference="protein motif:COGS:COG0277"
FT                   /protein_id="CAP85622.1"
FT                   /translation="MRVLRVSRALPTPFCRPQISRTILARGARLNSSDAGTENTKESNS
FT                   SSQNTPPSPFWTPGKALLVSAFAAGLGYGVSSYTQTPTQTSKKPQYGSHNPRAIQTNNH
FT                   PQAINELRTKLDEDTISTDEDDLHQHGFSEWSSLNADRLPVAIAYPKTTQEVSEIAKVC
FT                   NKYRMPMIPYSGGSSLEANFSAPHGGMTIDFAFMNKVLEIHPDDMDVVVQPSIQWMDLN
FT                   EQIKETGMFFPVDPGPSAMIGGMVGTNCSGTNAVRYGTMKDWVINLTVVLADGRIIKTR
FT                   RRPRKTSAGYNLTGMFVGSEGTLGIVTEATLKLAPIPEQTRVGVVAFPTIRDAASTAMQ
FT                   LIRKGVSVQCMEIMDDVQMDVINRAGGTGREWKVSPTLFFKFSGTVAGVADSIDMTTKL
FT                   AQGNNAQSFEFARDDREAHDLWSARKQSLWSMMALRKEGSEVWSTDVAVPISRLPDIIE
FT                   ISKKELVDLGLFASILGHIGDGNFHASIMYDRNNPAERERVEKVVHDMVDRGLEMEGSC
FT                   TGEHGIGLGKKGSLKKEVGLDTINVMRSIKRSLDPNWLLNPGKIFDYDEETPGPGH"
FT   exon            complement(667974..668141)
FT                   /gene="Pc20g02930"
FT                   /locus_tag="PCH_Pc20g02930"
FT                   /number=1
FT   intron          complement(668142..668193)
FT                   /gene="Pc20g02930"
FT                   /locus_tag="PCH_Pc20g02930"
FT                   /number=1
FT   exon            complement(668194..668375)
FT                   /gene="Pc20g02930"
FT                   /locus_tag="PCH_Pc20g02930"
FT                   /number=2
FT   intron          complement(668376..668426)
FT                   /gene="Pc20g02930"
FT                   /locus_tag="PCH_Pc20g02930"
FT                   /number=2
FT   exon            complement(668427..669519)
FT                   /gene="Pc20g02930"
FT                   /locus_tag="PCH_Pc20g02930"
FT                   /number=3
FT   intron          complement(669520..669559)
FT                   /gene="Pc20g02930"
FT                   /locus_tag="PCH_Pc20g02930"
FT                   /number=3
FT   exon            complement(669560..669838)
FT                   /gene="Pc20g02930"
FT                   /locus_tag="PCH_Pc20g02930"
FT                   /number=4
FT   mRNA            join(<670302..670311,670580..670653,670723..670849,
FT                   670900..670994,671056..671667,671721..671873,
FT                   671927..673147,673213..673341,673400..673516,
FT                   673571..>674182)
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT   CDS_pept        join(670302..670311,670580..670653,670723..670849,
FT                   670900..670994,671056..671667,671721..671873,
FT                   671927..673147,673213..673341,673400..673516,
FT                   673571..674182)
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An11g09530 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02940"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85623"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF54"
FT                   /inference="protein motif:COGS:COG1196"
FT                   /inference="protein motif:COGS:COG1511"
FT                   /inference="protein motif:COGS:COG5022"
FT                   /protein_id="CAP85623.1"
FT                   /translation="MADAMEQLAQLVREVERIVTAPYVPSLQQSQSSTIGAWAFCKPCQ
FT                   LGLLADVFIEALSRSRVALPLITAFASTATFRDALLERHPVVLDAFLEKAMDTNGAEYL
FT                   PACIALFSSPLPAGVVPPARIAPFITKLVSMMAENPCVETVAPLQALISGLKGSPRILD
FT                   DIPSEVMSNLQLEFTKTLRNLDDHMGNLLCLATFAQIATALGTTSPNQHGSEAPWLLNI
FT                   KHFFGQKRGLKTLDLVVLRVILACSSSCNLAPPEAAESIRLAICIAGAIEPEQKQVWIA
FT                   GNNPKIAKLCEKAVRDGLCGQTQTMVIVFLHTLLPAHLLPSQLRELGLKVILSKNSQET
FT                   VGTIPHQLIPRLAKSLAESGELATRQLLTFTFDVLRSSKSSGMGEMATLQLAHLVLAGV
FT                   QDVHPEILLSCAKNSMVPLREVLGELVEHFPRRPSESQCSDRAWCASKLYTKQNRLFLS
FT                   LLGLYNMATAQSGSDLIMKSFMRRVEQSMPSLDCAFSTITSKAFRGSLTLRDRHDLWPT
FT                   KVNRNWRSGVTELFMQNAQTSHDSMMRKIEDTCSDLERRCYDVEGPLRAAEEERDIYAS
FT                   ENEQLKRQNKELNEQLCTNNTEVQTKLQNSHECFVELGHEKTRLEQLLQGQYEYTEELT
FT                   VSLASTREELQQQQRSSEKALLEEKEKARSKELEMMATLTGKDDQLEELQEEMCSLQMK
FT                   NEQTRQSLDQVTSEKAKLSEHCSSLEQELASATEALKQTRLLADEREDEVNRLLAQEEE
FT                   LRKELGTVETTVAQQNVEVERLYSTLEESEEGSRREIERLKHDREAEASRAASEIAKHE
FT                   TDNRRLHAAMQAAALDASKDAQLKDKRIQHLERKVQALRDERAAKAREFSEAQQHIGRL
FT                   MGVMGFSANAPESNAAPRHQRARSSANTTPAARIPQHISDDEDGTQLAQSFESITSNFH
FT                   EPTPKRPRGNRKSTNHPYNFDTPSAAAPKSKSPLRASDMSRSMRKPLAEADRNSPTKSQ
FT                   SSSALKRNQVDDAFQEMQTQENTEENRLHNLDLDMDLEFSRDFLFSSTAFTGSTDQIAP
FT                   Q"
FT   exon            670302..670311
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=1
FT   intron          670312..670579
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=1
FT   exon            670580..670653
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=2
FT   intron          670654..670722
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=2
FT   exon            670723..670849
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=3
FT   intron          670850..670899
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=3
FT   exon            670900..670994
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=4
FT   intron          670995..671055
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=4
FT   exon            671056..671667
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=5
FT   intron          671668..671720
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=5
FT   exon            671721..671873
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=6
FT   intron          671874..671926
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=6
FT   exon            671927..673147
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=7
FT   intron          673148..673212
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=7
FT   exon            673213..673341
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=8
FT   intron          673342..673399
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=8
FT   exon            673400..673516
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=9
FT   intron          673517..673570
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=9
FT   exon            673571..674182
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /number=10
FT   mRNA            join(<675232..675527,675586..675742,675796..676243,
FT                   676302..>679507)
FT                   /gene="Pc20g02950"
FT                   /locus_tag="PCH_Pc20g02950"
FT   CDS_pept        join(675232..675527,675586..675742,675796..676243,
FT                   676302..679507)
FT                   /gene="Pc20g02950"
FT                   /locus_tag="PCH_Pc20g02950"
FT                   /note="unknown EC_number=2.7.7.48"
FT                   /note="Title: strong similarity to RNA-directed RNA
FT                   polymerase like protein An11g09540 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02950"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85624"
FT                   /db_xref="GOA:B6HF55"
FT                   /db_xref="InterPro:IPR007855"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF55"
FT                   /inference="protein motif:PFAM:PF05183"
FT                   /protein_id="CAP85624.1"
FT                   /translation="MTGPDLPSLQHPKSNLLRMVPPNIPTPARRNPPVLDLPVRDWITW
FT                   RSWRTCAVDLLNLPREMNTHDIYDAFHRYGNMISIDLWEDASGRPDCKGRIRFKPPPTE
FT                   EFWRTGSFGVKLRSGRVAVISLSVCCGDSNGTIQSPVRPDIQLPGEVELKTVQVDIGVL
FT                   LGLSTFHSMQSFTNLAYPRCVVDVMRKCLFLYFRVGIRGSDTADVNQHDHRVKITFLQL
FT                   TQIYQQYDKATRERSLLIVLDSAAIWHRKAKDIQSTLTEPLSWREEDSWYRQTSVTHNP
FT                   NSLKTLPANLKKTGHIIDLGRWNVFKISFAPDVDPNVRRVDDTSHYLMRVEEIFKDYNI
FT                   TVQDGSHFVEKADRPVPVWHWIDFSESKSNKASALLQDLGNQNYLHLPFKVRYQLEVCL
FT                   SQGYLSEFTMTREFIETLKGLGDDQATRLLEFVATEKKQYLAPMEIFDLKFFKGVTDSR
FT                   IPNYCCFMRTARITPTTIYYNTPTVDISNRVVREWSTKGTPGRFLRVRFTDEKTEGRIN
FT                   ASQRGCNDEVYTRVKRTLANGIAIGDRHYEFLAFGNSQFREHGAYFVAPDAGISAGTIR
FT                   AWMGQFNHIRNVAKYTARLGQCFSTTRAFTGSSVQTIPCDDIIRNGFTFSDGVGKISKF
FT                   LAQMVTSQHDIKTLTGEPPSAFQFRLGGAKGMLVVSTDPLPQEVHIRPSQQKFETSQAG
FT                   LEIIRWSQYSLATLNRQIILVLSALGIPDEVFHSKLNTMLGSFHRAMLNDSKAINLLQK
FT                   YIDPNQMTLTLAQMVSDGFRRNEEPFVNTMLELWKSWHLKHLKEKAKIAIDQGANVLGV
FT                   MDETGVLKGYFRKELPSRRASYAEKLAALPEIFVQVCRLDGGGEYEVIEGLCILARNPS
FT                   LHPGDIRVVRAVNRSELHALRDVVVLPQTGDQDIASMCSGGDLDGDDYLVIWDPNLIPA
FT                   NWFVECMDYKGSKAPDLDHDVTVDEITSFFVTYMKNDCLPRIAHAHLAWADRLPRGVWE
FT                   DKCIRLAQLHSDAVDYNKSGAHARMARSLDPKFWPHFMEKRFKRPSSIYKSTKILGQLY
FT                   DAVITPDFVPKLEKPFDSRILESPLAPASEAYMEYARELKAEFDMNMRQIMAQYEINTE
FT                   FEVWSTFVLRHGFVIKDYKMQEDLGRIVGTLRRGFRHQCYDKVGRDGGNIPALVIAMYR
FT                   VTQEQVAAALEARRNEALQREDVSIAEVNSTELPLISFPWIFPDVLGDVATGRARQAMI
FT                   SDGQESADSAKPIGEGLVFTHKQILKIVEDMDGDIKSTAENMKLKDPKNMEPKAEAGSN
FT                   SAPPDQELIARRRIDKTKPKQKSEDRDTGLYIEEDDEKEGGVAIGSAKTEEKIDKREAV
FT                   TEDIVEMEGDVKPSALDDLIKMIGG"
FT   exon            675232..675527
FT                   /gene="Pc20g02950"
FT                   /locus_tag="PCH_Pc20g02950"
FT                   /number=1
FT   intron          675528..675585
FT                   /gene="Pc20g02950"
FT                   /locus_tag="PCH_Pc20g02950"
FT                   /number=1
FT   exon            675586..675742
FT                   /gene="Pc20g02950"
FT                   /locus_tag="PCH_Pc20g02950"
FT                   /number=2
FT   intron          675743..675795
FT                   /gene="Pc20g02950"
FT                   /locus_tag="PCH_Pc20g02950"
FT                   /number=2
FT   exon            675796..676243
FT                   /gene="Pc20g02950"
FT                   /locus_tag="PCH_Pc20g02950"
FT                   /number=3
FT   intron          676244..676301
FT                   /gene="Pc20g02950"
FT                   /locus_tag="PCH_Pc20g02950"
FT                   /number=3
FT   exon            676302..679507
FT                   /gene="Pc20g02950"
FT                   /locus_tag="PCH_Pc20g02950"
FT                   /number=4
FT   mRNA            complement(join(<679747..684605,684656..>684890))
FT                   /gene="Pc20g02960"
FT                   /locus_tag="PCH_Pc20g02960"
FT   CDS_pept        complement(join(679747..684605,684656..684890))
FT                   /gene="Pc20g02960"
FT                   /locus_tag="PCH_Pc20g02960"
FT                   /note="unknown EC_number=2.7.7.7"
FT                   /note="Title: strong similarity to DNA-directed DNA
FT                   polymerase Rev3 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02960"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85625"
FT                   /db_xref="GOA:B6HF56"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR025687"
FT                   /db_xref="InterPro:IPR030559"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF56"
FT                   /inference="protein motif:PFAM:PF03104"
FT                   /inference="protein motif:PFAM:PF00136"
FT                   /inference="protein motif:COGS:COG0417"
FT                   /protein_id="CAP85625.1"
FT                   /translation="MEPFRVRLNCIDHYQATASELDPPLLFRDEVSEKDFKPKVPVIRI
FT                   FGATETGQRVCVHVHGAFPYLYIEYNGSLAPEDVNSAIRTLHLSIDHALAVSFRRNAYD
FT                   RRTAFVAHITLVKGVPFYGYHVGWRFFFKIYLLNPFHMTRLVDLLHQGAVMKRPLQPYE
FT                   AHVQYIPQWMCDYNLYGCAIMSCSQAKFRAPVPEYFELSNLAHRWHDRSILPESILDHP
FT                   ALQKQSHCALEVDVCVQDILNRLDVKERPLHHDFTELLKPVAVNERLVPSVAGLWQDET
FT                   RRRKKRMGLTDPGSTPFGPEELVSMSADPRDQSKGGWIHEEEFREMASQLAANEKQADG
FT                   GKDTSFGTFLDTDDQAKYVKTALDSTEDFFPGKISTSTFDSSRSQEPAEQKLSEISVDE
FT                   GLALSSQTDGQYYSDSDQGGHSLEGIIEHEPETKQDPLGDSFYDEIFDEMPFLDVAAPA
FT                   ESAETNCPEAAMDGGYKEGDYVAQERRPRDQSQNKSVAPKRQRSETLDCHHSPTKRARH
FT                   IAEHGLSDGPLESPNTRKHQQDDKPKNVSFDSNLDSHAETPSSESKSSSQRTVRPKAHS
FT                   YTSGLKFPVVKDPNDPLTILRYSQDEATSSRKDPESSQPLLNSFPSGSATELSGKTSET
FT                   QSSSELHSSATVMGPVSLDPHLSQTVKSIRQSFSFAPNTSLHCFKFASPTFSEVSSSIN
FT                   EHGRPSVVYQKAFYSDEADVPERPREYGGREFRLESNTIHYLPDFDPTAEAPAMFGEQT
FT                   PTAHDRDQQEKVDQQLREWCTSKVWEFAPVPPSRSEVIRWFEELEASQEPDRKAAQPIP
FT                   PEMKSNLLSQIEGPTQKNAHGFKYSQNGVSTSVEHQAQHMSTMSLEVHVNTRGTLMPNP
FT                   EEDEITSLFWCIQSEDEDIEVNSHLPGVHVGMVYHGEGERPEAKISKALTIDVEHEPTE
FT                   LDLINRLIDIVRYYDPDIITGYEVHNASWGYVIERARKKYDFDICEELSRTKSQSNGRF
FT                   GKEADQWGFNHSSSIRITGRHMFNIWRAMKSELNLLQYTMENVVFHVLHRRIPHYSPKH
FT                   LTQWHQSGRPRNILKVVQYFTSRVQMNLEILEANELTPRTSEQARLLGIDFASVITRGS
FT                   QFKVESLMFRIAKPENFLLVSPSRKQVGQQNALECLPLVMEPQSDFYTSPLLVLDFQSL
FT                   YPSVMIAYNYCYSTFLGRAMHWRGRDKMGFIDYKRQPRILELLKDKINIAPNGMMYAKQ
FT                   EARQSLLAKMLSEILETRVMVKNGMKADKDDKVLQRLLNNRQLALKLIANVTYGYTSAS
FT                   FSGRMPCSEIADSIVQTGRETLEKAIAFIHSVERWGAEVVYGDTDSLFVYLKGRTRDQA
FT                   FDIGEEIAQAVTDLNPRPVKLKFEKVYHPCVLLAKKRYVGFKYEHRNQKEPEFDAKGIE
FT                   TVRRDGTPAEQKIEEKALKTLFRTADLSQVKSYFQRQCAKIMQGRISIQDFCFAREVRL
FT                   GTYSDRHLPAGAVISTKRMLEDPRSEPQTGERVPYVVVTGAPGARLVDRCVAPQTLLHD
FT                   AQLELDAEYYITKNIIPPLERIFNLVGANVRQWYDEMPKVQRIRRVEGSALARPNSVGG
FT                   ASRKTLESYMRSSSCVVCRSRLSDAAVPVCGDCLQKPHLTLLDVVSRLQRAEKRVVDLE
FT                   AICRSCMGVSPGDEVSCDSLDCPIFYSRARDAANWRHSKAVLEPVVELLERKGDEGLDW
FT                   "
FT   exon            complement(679747..684605)
FT                   /gene="Pc20g02960"
FT                   /locus_tag="PCH_Pc20g02960"
FT                   /number=1
FT   intron          complement(684606..684655)
FT                   /gene="Pc20g02960"
FT                   /locus_tag="PCH_Pc20g02960"
FT                   /number=1
FT   exon            complement(684656..684890)
FT                   /gene="Pc20g02960"
FT                   /locus_tag="PCH_Pc20g02960"
FT                   /number=2
FT   mRNA            <685215..>686627
FT                   /gene="Pc20g02970"
FT                   /locus_tag="PCH_Pc20g02970"
FT   CDS_pept        685215..686627
FT                   /gene="Pc20g02970"
FT                   /locus_tag="PCH_Pc20g02970"
FT                   /note="Title: strong similarity to pre-mRNA splicing factor
FT                   hSLU7 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02970"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85626"
FT                   /db_xref="GOA:B6HF57"
FT                   /db_xref="InterPro:IPR021715"
FT                   /db_xref="InterPro:IPR039974"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF57"
FT                   /inference="similar to AA sequence:TREMBL:BC010634.1"
FT                   /protein_id="CAP85626.1"
FT                   /translation="MSRKPADVASKTPNEYIPSFISKKPFYVDDETNNDYLEHQRLQKA
FT                   TPDQSKWYDRGKRAGPAATKYRKGACENCGAMTHKTKECLSRPRKQGARWTGKDIQADE
FT                   LIQKVDMGWDAKRDRWNGYDATEYRQVVEEYEEMEAIKRMAKENSDLKKLQAGEDGDEG
FT                   PDSDIRYAEESDMGRQQSTATRNLRIREDTAKYLLNLDLDSAKYDPKTRRMVDMGAQDD
FT                   QAAALVAEENFVRASGDAAEFEKAQKYAWESQEKGLPQIHIQANPTSGEVLRKKEMVDS
FT                   EAKREAHRKALLDKYGGVEYTKPNALRETMVVENERFIEYDESGAIKGAPKNATKSKYP
FT                   EDVMVNNHSSVFGSWWYQFKWGYACCYSTVKNSYCTGEDGKKAFEEEGNMLMMTGAADD
FT                   NDEISDNAGNANLSHESEQADDRGQEQDSNTNGKKRTLEELKSGVTEEEYESYKRSRLA
FT                   AEDPMANFIGKD"
FT   exon            685215..686627
FT                   /gene="Pc20g02970"
FT                   /locus_tag="PCH_Pc20g02970"
FT                   /number=1
FT   mRNA            join(<687130..687133,687208..687270,687421..687492,
FT                   687603..>687742)
FT                   /gene="Pc20g02980"
FT                   /locus_tag="PCH_Pc20g02980"
FT   CDS_pept        join(687130..687133,687208..687270,687421..687492,
FT                   687603..687742)
FT                   /gene="Pc20g02980"
FT                   /locus_tag="PCH_Pc20g02980"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit L37.b - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02980"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85627"
FT                   /db_xref="GOA:B6HF58"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF58"
FT                   /inference="similar to AA sequence:PIR:S69558"
FT                   /inference="protein motif:PFAM:PF01907"
FT                   /inference="protein motif:COGS:COG2126"
FT                   /protein_id="CAP85627.1"
FT                   /translation="MTKGTSSFGKRHNKTHTLCRRCGKRSFHIQKSTCANCGYPAAKTR
FT                   KFNWGEKAKRRKTTGSGRMRSLRDVHRRFQNGFQTGTPKGARGPVTN"
FT   exon            687130..687133
FT                   /gene="Pc20g02980"
FT                   /locus_tag="PCH_Pc20g02980"
FT                   /number=1
FT   intron          687134..687207
FT                   /gene="Pc20g02980"
FT                   /locus_tag="PCH_Pc20g02980"
FT                   /number=1
FT   exon            687208..687270
FT                   /gene="Pc20g02980"
FT                   /locus_tag="PCH_Pc20g02980"
FT                   /number=2
FT   intron          687271..687420
FT                   /gene="Pc20g02980"
FT                   /locus_tag="PCH_Pc20g02980"
FT                   /number=2
FT   exon            687421..687492
FT                   /gene="Pc20g02980"
FT                   /locus_tag="PCH_Pc20g02980"
FT                   /number=3
FT   intron          687493..687602
FT                   /gene="Pc20g02980"
FT                   /locus_tag="PCH_Pc20g02980"
FT                   /number=3
FT   exon            687603..687742
FT                   /gene="Pc20g02980"
FT                   /locus_tag="PCH_Pc20g02980"
FT                   /number=4
FT   mRNA            complement(join(<688260..688571,688638..689108,
FT                   689228..>689488))
FT                   /gene="Pc20g02990"
FT                   /locus_tag="PCH_Pc20g02990"
FT   CDS_pept        complement(join(688260..688571,688638..689108,
FT                   689228..689488))
FT                   /gene="Pc20g02990"
FT                   /locus_tag="PCH_Pc20g02990"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   YMR312w - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02990"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85628"
FT                   /db_xref="GOA:B6HF59"
FT                   /db_xref="InterPro:IPR018627"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF59"
FT                   /inference="similar to AA sequence:PIR:S59305"
FT                   /protein_id="CAP85628.1"
FT                   /translation="MPSQPPLPPLLAPYVSNLPDSSLTLVSSILGATSNWLILRFLHAA
FT                   LSSPSPNAAFGSDELHNGTKKKVVLVSFMRSYEFWRTEAKRLGLDLARLAEKQQFAFID
FT                   GLSELFYAPQPTATSPSISPAGLGSSPRTTLPMRSPPGAVPGRSPQPAGPTATGARGNA
FT                   TSKQAEPGIAKKLHFSGRGLASLDALEKDISSVIEQQKSSMEDGDELLLIIDQPDLLLA
FT                   ATGPSMGIGATEMSEWITALQQHAHATVLTLATDAPLIHNASTSGGLATPIETEHAALV
FT                   IGLAHRARSVMQLRTLDTGAAKDVSGVLRISRGGGLNASEESLEEREALYFIQRDGGVK
FT                   VFGRGES"
FT   exon            complement(688260..688571)
FT                   /gene="Pc20g02990"
FT                   /locus_tag="PCH_Pc20g02990"
FT                   /number=1
FT   intron          complement(688572..688637)
FT                   /gene="Pc20g02990"
FT                   /locus_tag="PCH_Pc20g02990"
FT                   /number=1
FT   exon            complement(688638..689108)
FT                   /gene="Pc20g02990"
FT                   /locus_tag="PCH_Pc20g02990"
FT                   /number=2
FT   intron          complement(689109..689227)
FT                   /gene="Pc20g02990"
FT                   /locus_tag="PCH_Pc20g02990"
FT                   /number=2
FT   exon            complement(689228..689488)
FT                   /gene="Pc20g02990"
FT                   /locus_tag="PCH_Pc20g02990"
FT                   /number=3
FT   mRNA            join(<690393..690425,690498..690527,690589..690683,
FT                   690742..691052,691119..691798,691853..692373,
FT                   692455..>692878)
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT   CDS_pept        join(690393..690425,690498..690527,690589..690683,
FT                   690742..691052,691119..691798,691853..692373,
FT                   692455..692878)
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /note="Title: similarity to positive regulator of the
FT                   lactose-galactose regulon LAC9 - Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03000"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85629"
FT                   /db_xref="GOA:B6HF60"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR005600"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF60"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP85629.1"
FT                   /translation="MASTRDSHSFACDECRLRKSRCSKERPVCLQCRQLNKECIYSPKV
FT                   SRSPLTRQHLTYVEDRLHSFETALGRLFPGGDLDATLRSLLQNPEVARAPSSKSSSRHS
FT                   TPKHEPERAEPAPEALPQQADGFDWAEKEITLGDLTDGMAALSIKPEGAGYFGASSSVV
FT                   PLRALFDHGFDLNIPVRSAKSGGVPLKAQLLESAPSGLIEQAFIDAFFLNYHTSYPFIH
FT                   EPTFRMQFNDPSLRPHGTAWHILLNTILALGAWCIGDDSSDLDITFYQEARGYLQQASV
FT                   FETGNLTLVQGLLLLSNYAQKRNKPNTGWNYLGLAVRMAMSLGLHKEFPGWKISLLQRE
FT                   IRRRLWWGVFIFDSGAAKTFGRPILLPEDSVMDAKQVRNIHEEDLTPTTTTLPAESPGP
FT                   TIYSGLIAQASFHLLTNSVYQRLISSPSLTPEDTLNLQKPIEEWYNGLPSYLKHQQLPL
FT                   SMQPANPDPDSLALVRNRLLWRNWNLTILIYRPILLRWAARRWAPLSGSGTATPDAGSE
FT                   DPFETECRLRCLQNARLTISSISDYMANYMCTRLGAWYMLYFLFQAGLIPIVFLMTDPS
FT                   NPEAASWLQDIETTKSLLTHPSLGTNRFATRCLEVINRLLGPPTHPMPQGIPTEGDQLN
FT                   PQHQQQHEHMLPQLQPNMMPFPGQLFSDPGFGGSLFPVEQQMQMHNAGGMDFSEWVNFP
FT                   PAE"
FT   exon            690393..690425
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /number=1
FT   intron          690426..690497
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /number=1
FT   exon            690498..690527
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /number=2
FT   intron          690528..690588
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /number=2
FT   exon            690589..690683
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /number=3
FT   intron          690684..690741
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /number=3
FT   exon            690742..691052
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /number=4
FT   intron          691053..691118
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /number=4
FT   exon            691119..691798
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /number=5
FT   intron          691799..691852
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /number=5
FT   exon            691853..692373
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /number=6
FT   intron          692374..692454
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /number=6
FT   exon            692455..692878
FT                   /gene="Pc20g03000"
FT                   /locus_tag="PCH_Pc20g03000"
FT                   /number=7
FT   mRNA            complement(join(<693136..693285,693364..693490,
FT                   693551..693647,693717..694022,694076..694166,
FT                   694219..694661,694713..695109,695159..>695239))
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT   CDS_pept        complement(join(693136..693285,693364..693490,
FT                   693551..693647,693717..694022,694076..694166,
FT                   694219..694661,694713..695109,695159..695239))
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /note="Title: strong similarity to glucose transporter
FT                   rco-3 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85630"
FT                   /db_xref="GOA:B6HFE4"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE4"
FT                   /inference="similar to AA sequence:SWISSPROT:RCO3_NEUCR"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP85630.1"
FT                   /translation="MATIAESSPKGGFALVLQNPFLCGVASFSTLGGLLFGYDQGVISG
FT                   VITMESFGARYPRVFSESGFKGWFVSTLLLAAWAGSLINGPITDRIGRKMSINLAVVVF
FT                   VIGSVIQCAAMNISMLFAGRAIAGLAVGQLTMVVPLYISEVSIPEIRGGLVVLQQLSVT
FT                   LGILFSYWIDYGTNYIGGTRCAPDIPYSGGTISKPTFDPYHDVPAGGCNGQSEVSWRLP
FT                   LALQIVPAVILGIGMLFFPDSPRWLLMKERDDDSLHALSRLRRQDRDSPVLLNEYLEIK
FT                   ASIMLENSFARDNFPNLSGYQLHAAQYMSFFTTWSRFRRLAIGCIVMFFQQFMGCNAMI
FT                   YYAPTIFGQLGLDGNTTSLLATGVYGIVNCLSTLPALFFIDKVGRRPLLMAGAAGTCIS
FT                   LVIVGGILGGFGSSLVSNKSAGWAGIAFIYIYDINFSYSFAPIGWVLPSEIFNLSIRSK
FT                   AISITTSATWMCNFIIGLVTPDMLESITWGTYIFFAAFCLLAFAFTFLCIPETRGKTLE
FT                   DMDLIFGDTAAHEEKKRIKHIEAELRGTPIEEDDLIKPVGSHVEQA"
FT   exon            complement(693136..693285)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=1
FT   mat_peptide     complement(join(693139..693285,693364..693490,
FT                   693551..693647,693717..694022,694076..694166,
FT                   694219..694661,694713..695109))
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT   intron          complement(693286..693363)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=1
FT   exon            complement(693364..693490)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=2
FT   intron          complement(693491..693550)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=2
FT   exon            complement(693551..693647)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=3
FT   intron          complement(693648..693716)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=3
FT   exon            complement(693717..694022)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=4
FT   intron          complement(694023..694075)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=4
FT   exon            complement(694076..694166)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=5
FT   intron          complement(694167..694218)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=5
FT   exon            complement(694219..694661)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=6
FT   intron          complement(694662..694712)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=6
FT   exon            complement(694713..695109)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=7
FT   intron          complement(695110..695158)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=7
FT   sig_peptide     complement(695159..695239)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            complement(695159..695239)
FT                   /gene="Pc20g03010"
FT                   /locus_tag="PCH_Pc20g03010"
FT                   /number=8
FT   mRNA            join(<696233..696761,696870..>697078)
FT                   /gene="Pc20g03020"
FT                   /locus_tag="PCH_Pc20g03020"
FT   CDS_pept        join(696233..696761,696870..697078)
FT                   /gene="Pc20g03020"
FT                   /locus_tag="PCH_Pc20g03020"
FT                   /note="Title: weak similarity to hypothetical transcription
FT                   regulator SC5F2A.29 - Streptomyces coelicolor"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85631"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE5"
FT                   /inference="similar to AA sequence:PIR:T35271"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /inference="protein motif:COGS:COG4977"
FT                   /inference="protein motif:COGS:COG0693"
FT                   /protein_id="CAP85631.1"
FT                   /translation="MSSPLRIGVLLVGTVQLLDLSAVDLLYMTTPEYLQECSLPRPLVD
FT                   LGRPCEIHYIAHNANDTAKTTAQMSLQLTDSLTDSAVSPGKLDIVLIPGPPPKAMPPPE
FT                   EYLDFVRAHFAAGAPILSVCTGAYVIGHAGITKGREVTAPRLLIPEMRRKFPEAKLWDD
FT                   SVRVARDGNLWTSGGITNGHDLVAGYLREHYPAALVNTILVAADIPSRPAAYATPAVSD
FT                   TLYILWQIIRAVPNAVVGWFRGR"
FT   sig_peptide     696233..696298
FT                   /gene="Pc20g03020"
FT                   /locus_tag="PCH_Pc20g03020"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            696233..696761
FT                   /gene="Pc20g03020"
FT                   /locus_tag="PCH_Pc20g03020"
FT                   /number=1
FT   mat_peptide     join(696299..696761,696870..697075)
FT                   /gene="Pc20g03020"
FT                   /locus_tag="PCH_Pc20g03020"
FT   intron          696762..696869
FT                   /gene="Pc20g03020"
FT                   /locus_tag="PCH_Pc20g03020"
FT                   /number=1
FT   exon            696870..697078
FT                   /gene="Pc20g03020"
FT                   /locus_tag="PCH_Pc20g03020"
FT                   /number=2
FT   mRNA            complement(join(<698044..698119,698181..698639,
FT                   698693..698953,699221..699234,699442..699567,
FT                   699619..>699690))
FT                   /gene="Pc20g03030"
FT                   /locus_tag="PCH_Pc20g03030"
FT   CDS_pept        complement(join(698044..698119,698181..698639,
FT                   698693..698953,699221..699234,699442..699567,
FT                   699619..699690))
FT                   /gene="Pc20g03030"
FT                   /locus_tag="PCH_Pc20g03030"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1487_1.tfa_1020wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85632"
FT                   /db_xref="InterPro:IPR019400"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR042467"
FT                   /db_xref="InterPro:IPR042468"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE6"
FT                   /protein_id="CAP85632.1"
FT                   /translation="MNALSADEMERFQKLSNSYQPDVQGPLVSTKQSSHSIALDYSNAD
FT                   PTLATKTNVSFGGLSLLCYHNIRRMNAWMKLNPNRYQAFLPMPLNQYCSSRIDPVKTEI
FT                   DEVGLQALIDGVIEGSGFGVEILYLDRSEGGAVTPHQLSSDSPSGATIRLLYRPGHYDI
FT                   LYPVEPLNMAPIVNLQYGMTSDYSPWDPTALGFDVNSSLMAIPNLMQDTSFGMGAPMSP
FT                   MPSVSPTPASPFRMSPQQDMYQSPMPTHAAPIPPIPVSPPPQIAPPSSAPPPMTSLPSR
FT                   SSDGPQIRLNPLVMKPNLSRSLPVTTPFKNSPYNQAHFQNSDFEPIHWEPHERR"
FT   exon            complement(698044..698119)
FT                   /gene="Pc20g03030"
FT                   /locus_tag="PCH_Pc20g03030"
FT                   /number=1
FT   intron          complement(698120..698180)
FT                   /gene="Pc20g03030"
FT                   /locus_tag="PCH_Pc20g03030"
FT                   /number=1
FT   exon            complement(698181..698639)
FT                   /gene="Pc20g03030"
FT                   /locus_tag="PCH_Pc20g03030"
FT                   /number=2
FT   intron          complement(698640..698692)
FT                   /gene="Pc20g03030"
FT                   /locus_tag="PCH_Pc20g03030"
FT                   /number=2
FT   exon            complement(698693..698953)
FT                   /gene="Pc20g03030"
FT                   /locus_tag="PCH_Pc20g03030"
FT                   /number=3
FT   intron          complement(698954..699220)
FT                   /gene="Pc20g03030"
FT                   /locus_tag="PCH_Pc20g03030"
FT                   /number=3
FT   exon            complement(699221..699234)
FT                   /gene="Pc20g03030"
FT                   /locus_tag="PCH_Pc20g03030"
FT                   /number=4
FT   intron          complement(699235..699441)
FT                   /gene="Pc20g03030"
FT                   /locus_tag="PCH_Pc20g03030"
FT                   /number=4
FT   exon            complement(699442..699567)
FT                   /gene="Pc20g03030"
FT                   /locus_tag="PCH_Pc20g03030"
FT                   /number=5
FT   intron          complement(699568..699618)
FT                   /gene="Pc20g03030"
FT                   /locus_tag="PCH_Pc20g03030"
FT                   /number=5
FT   exon            complement(699619..699690)
FT                   /gene="Pc20g03030"
FT                   /locus_tag="PCH_Pc20g03030"
FT                   /number=6
FT   mRNA            complement(join(<700627..700658,700714..>700915))
FT                   /gene="Pc20g03040"
FT                   /locus_tag="PCH_Pc20g03040"
FT   CDS_pept        complement(join(700627..700658,700714..>700915))
FT                   /pseudo
FT                   /gene="Pc20g03040"
FT                   /locus_tag="PCH_Pc20g03040"
FT                   /note="putative pseudogene"
FT                   /note="Title: similarity to hypothetical rac GTPase
FT                   AAD50299.1 - Xenopus laevis [truncated ORF][putative
FT                   pseudogene]"
FT                   /inference="similar to AA sequence:TREMBL:AF174644.1"
FT                   /inference="protein motif:COGS:COG1100"
FT   exon            complement(700627..700658)
FT                   /gene="Pc20g03040"
FT                   /locus_tag="PCH_Pc20g03040"
FT                   /number=1
FT   intron          complement(700659..700713)
FT                   /gene="Pc20g03040"
FT                   /locus_tag="PCH_Pc20g03040"
FT                   /number=1
FT   exon            complement(700714..>700915)
FT                   /gene="Pc20g03040"
FT                   /locus_tag="PCH_Pc20g03040"
FT                   /number=2
FT   gap             700959..701058
FT                   /estimated_length=unknown
FT   mRNA            complement(join(<703128..704324,704386..704446,
FT                   704504..704662,704716..>704759))
FT                   /gene="Pc20g03050"
FT                   /locus_tag="PCH_Pc20g03050"
FT   CDS_pept        complement(join(703128..704324,704386..704446,
FT                   704504..704662,704716..704759))
FT                   /gene="Pc20g03050"
FT                   /locus_tag="PCH_Pc20g03050"
FT                   /note="Title: strong similarity to signalosome subunit like
FT                   protein An11g09610 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85634"
FT                   /db_xref="GOA:B6HFE7"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037750"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE7"
FT                   /inference="protein motif:PFAM:PF01399"
FT                   /inference="protein motif:COGS:COG5159"
FT                   /inference="protein motif:COGS:COG0457"
FT                   /inference="protein motif:COGS:COG5187"
FT                   /protein_id="CAP85634.1"
FT                   /translation="MSDDDDFMQDSGDEDYDFEYEDADEDESGDIGIENKYYNAKQIKV
FT                   DNPEEAVDEFLGIAPMEQDKSDWGFKGLKQAIKLEFKLGRYSDTVAHYRELLTYVKSAV
FT                   TRNYSEKSINNMLDFIEKGSDNAEAYQCMEEFYSLTLESFQNTNNERLWLKTNIKLARL
FT                   WLERKQYGQLGKKVRELHRACQREDGSDDTSKGTYLLELYALEIQMSSETKNNKRLKAL
FT                   YQRALRVRSAVPHPKIMGIIRECGGKMHMSEENWKEAQSDFFESFRNYDEAGSMQRIQV
FT                   LKYLVLTTMLMKSDINPFDSQETKPYKNDPRISAMTDLVDAFQRDDIHAYEDVLSKHPD
FT                   VLADPFIAENIDEVSRNMRTKAVLKLIAPYTRFSLQFISKHIKVSVPEVLDILSFLILD
FT                   KKLNAKIDQDNGTVVVESASDVERLRAVGEWSSALRNLWQTTLNGEGLRANDPSQGSIF
FT                   QSSLLGDEGMRSTRARKDGRGKMPAKWF"
FT   exon            complement(703128..704324)
FT                   /gene="Pc20g03050"
FT                   /locus_tag="PCH_Pc20g03050"
FT                   /number=1
FT   intron          complement(704325..704385)
FT                   /gene="Pc20g03050"
FT                   /locus_tag="PCH_Pc20g03050"
FT                   /number=1
FT   exon            complement(704386..704446)
FT                   /gene="Pc20g03050"
FT                   /locus_tag="PCH_Pc20g03050"
FT                   /number=2
FT   intron          complement(704447..704503)
FT                   /gene="Pc20g03050"
FT                   /locus_tag="PCH_Pc20g03050"
FT                   /number=2
FT   exon            complement(704504..704662)
FT                   /gene="Pc20g03050"
FT                   /locus_tag="PCH_Pc20g03050"
FT                   /number=3
FT   intron          complement(704663..704715)
FT                   /gene="Pc20g03050"
FT                   /locus_tag="PCH_Pc20g03050"
FT                   /number=3
FT   exon            complement(704716..704759)
FT                   /gene="Pc20g03050"
FT                   /locus_tag="PCH_Pc20g03050"
FT                   /number=4
FT   mRNA            join(<705768..705817,705874..705920,705990..706091,
FT                   706238..706359,706412..706613,706669..>706787)
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT   CDS_pept        join(705768..705817,705874..705920,705990..706091,
FT                   706238..706359,706412..706613,706669..706787)
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /note="unknown EC_number=3.1.5.1"
FT                   /note="Title: strong similarity to GTPase Rho3
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85635"
FT                   /db_xref="GOA:B6HFE8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE8"
FT                   /inference="similar to AA sequence:PIR:S49891"
FT                   /inference="protein motif:PFAM:PF00071"
FT                   /inference="protein motif:COGS:COG1217"
FT                   /inference="protein motif:COGS:COG0481"
FT                   /protein_id="CAP85635.1"
FT                   /translation="MQLCGRQKVVQRKMVLLGDGACGKTSALNVFTPSSPRFSKKFYYL
FT                   QKHTSKCRLLTLVIGCTQRAYNIFVDNIHVELSLWDTAGQEEFDRLRALSYEDTHVLML
FT                   CFSVDSPDSFENVSSKWIAEINENCPGVRVVLTALKCDLRKDEDMNENPNTISFDQGLA
FT                   KAKEIGAVKYLECSAVQNRGIRESFYEAAKVALEVNAGGSSSSGSQCIIQ"
FT   exon            705768..705817
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /number=1
FT   intron          705818..705873
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /number=1
FT   exon            705874..705920
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /number=2
FT   intron          705921..705989
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /number=2
FT   exon            705990..706091
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /number=3
FT   intron          706092..706237
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /number=3
FT   exon            706238..706359
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /number=4
FT   intron          706360..706411
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /number=4
FT   exon            706412..706613
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /number=5
FT   intron          706614..706668
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /number=5
FT   exon            706669..706787
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /number=6
FT   mRNA            complement(<707706..>708614)
FT                   /gene="Pc20g03070"
FT                   /locus_tag="PCH_Pc20g03070"
FT   CDS_pept        complement(707706..708614)
FT                   /gene="Pc20g03070"
FT                   /locus_tag="PCH_Pc20g03070"
FT                   /note="Title: similarity to lipoyl-protein ligase LIPB
FT                   -Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85636"
FT                   /db_xref="GOA:B6HFE9"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE9"
FT                   /inference="similar to AA sequence:SWISSPROT:LIPB_KLULA"
FT                   /inference="protein motif:PFAM:PF03099"
FT                   /inference="protein motif:COGS:COG0321"
FT                   /protein_id="CAP85636.1"
FT                   /translation="MRLAHLHLPHTTPFSRVSHLQQTLTTRLLTHKKLASPGSISSQEP
FT                   SNPSATLSKTPPSPPDPTIITFTPNPVYTTGRRDLPPSNTSPPSTTNPILSLPPALEPI
FT                   RSLFTPDGTKPAKAEYHPTLRGGQTTYHGPGQMVAYTILDLKRLGLTPRCHIRVLENSV
FT                   IDLLKSYGVEGFTTEDPGVWVNPVSGSRSASGSALQPRKITAVGVHLRRNISSFGIGLN
FT                   VTDEPMWFFKQIVACGLEGKEATSLQGVGVPGLEVGDVAAAFVEKFVSRVNADFACGEN
FT                   SLGEKIDEVYQVREEDLLNSV"
FT   exon            complement(707706..708614)
FT                   /gene="Pc20g03070"
FT                   /locus_tag="PCH_Pc20g03070"
FT                   /number=1
FT   mRNA            complement(join(<709087..709698,709763..>709879))
FT                   /gene="Pc20g03080"
FT                   /locus_tag="PCH_Pc20g03080"
FT   CDS_pept        complement(join(709087..709698,709763..709879))
FT                   /gene="Pc20g03080"
FT                   /locus_tag="PCH_Pc20g03080"
FT                   /note="Title: strong similarity to hypothetical GTPase
FT                   activating protein homolog GAP1 - Cochliobolus
FT                   heterostrophus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85637"
FT                   /db_xref="GOA:B6HFF0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF0"
FT                   /inference="similar to AA sequence:TREMBL:AF027687.2"
FT                   /protein_id="CAP85637.1"
FT                   /translation="MAESLNPPLSYEASATTTHPHVATSLPSEVIACLKNSRFLHLATC
FT                   DDKTPHISLMSYTYLPSTPFDPHPIIIMTTNPASRKTNHLLSNPRVSLLVHDWVSHRPP
FT                   TRAPTQGDREGSPPPAATRSSLASLLLNLNTSALSSISTTITGEAQFLEPGSEEESWCK
FT                   ARHLENNTFEEEEINLFGQQQQQDPSARRPSLSIDTDVRVVTVRVTEGRIADWKGGVRD
FT                   WVLLPAEQQDAGLVNGVASS"
FT   exon            complement(709087..709698)
FT                   /gene="Pc20g03080"
FT                   /locus_tag="PCH_Pc20g03080"
FT                   /number=1
FT   intron          complement(709699..709762)
FT                   /gene="Pc20g03080"
FT                   /locus_tag="PCH_Pc20g03080"
FT                   /number=1
FT   exon            complement(709763..709879)
FT                   /gene="Pc20g03080"
FT                   /locus_tag="PCH_Pc20g03080"
FT                   /number=2
FT   mRNA            complement(join(<710322..710407,710503..710606,
FT                   710688..710771,710846..>710922))
FT                   /gene="Pc20g03090"
FT                   /locus_tag="PCH_Pc20g03090"
FT   CDS_pept        complement(join(710322..710407,710503..710606,
FT                   710688..710771,710846..710922))
FT                   /gene="Pc20g03090"
FT                   /locus_tag="PCH_Pc20g03090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85638"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF1"
FT                   /protein_id="CAP85638.1"
FT                   /translation="MRLTNDESEVDNKLGRRIKWEEEEEELKLQGRGRVEEGAMIGVGV
FT                   PIRSESMRITPSQYHVGMSGDAVDFILLNGSCLCAGKELPRVLDVLGTIGLPQATACTW
FT                   NSVLRTSPLIRD"
FT   exon            complement(710322..710407)
FT                   /gene="Pc20g03090"
FT                   /locus_tag="PCH_Pc20g03090"
FT                   /number=1
FT   intron          complement(710408..710502)
FT                   /gene="Pc20g03090"
FT                   /locus_tag="PCH_Pc20g03090"
FT                   /number=1
FT   exon            complement(710503..710606)
FT                   /gene="Pc20g03090"
FT                   /locus_tag="PCH_Pc20g03090"
FT                   /number=2
FT   intron          complement(710607..710687)
FT                   /gene="Pc20g03090"
FT                   /locus_tag="PCH_Pc20g03090"
FT                   /number=2
FT   exon            complement(710688..710771)
FT                   /gene="Pc20g03090"
FT                   /locus_tag="PCH_Pc20g03090"
FT                   /number=3
FT   intron          complement(710772..710845)
FT                   /gene="Pc20g03090"
FT                   /locus_tag="PCH_Pc20g03090"
FT                   /number=3
FT   exon            complement(710846..710922)
FT                   /gene="Pc20g03090"
FT                   /locus_tag="PCH_Pc20g03090"
FT                   /number=4
FT   mRNA            join(<710950..711607,711668..>712152)
FT                   /gene="Pc20g03100"
FT                   /locus_tag="PCH_Pc20g03100"
FT   CDS_pept        join(710950..711607,711668..712152)
FT                   /gene="Pc20g03100"
FT                   /locus_tag="PCH_Pc20g03100"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   NIPSNAP1 - Danio rerio"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03100"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85639"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF2"
FT                   /inference="similar to AA sequence:TREMBL:DRE249796.1"
FT                   /protein_id="CAP85639.1"
FT                   /translation="MLAPRAARSVRSVTSLLRPFSSSAVAYRAPSIRDITAQSTEEYLR
FT                   RRKEFRENLEQARLKREQQESQSVNASASSSTPSREYAPTAPEVSNASIHDRIYPTFDA
FT                   ATALDQKGLGSLSTHRYLGDDQNQEAAAKRGPLSSLIYGTKEGQHFDKDMERSFSQVLA
FT                   RGKYVHSIVMHDVKPDKVDEYVDLVGQWYPRMAGTEENRVNLVGSWRTQVGDNDTFVHI
FT                   WEYQRYEGYHDSLHNISQHPEFREFDRKLKSLIKSKRTSLMQEFSFWPTTPPRRLGGLF
FT                   ELRSYTLHPGNLLEWETHWRRGLTARREVMEGVGAWFVQIGELNTVHHLWQFANLEERK
FT                   ICREQSWGIEGWAETVHKTVPLIQSMQSRILVPMPWSPVG"
FT   sig_peptide     710950..711027
FT                   /gene="Pc20g03100"
FT                   /locus_tag="PCH_Pc20g03100"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            710950..711607
FT                   /gene="Pc20g03100"
FT                   /locus_tag="PCH_Pc20g03100"
FT                   /number=1
FT   mat_peptide     join(711028..711607,711668..712149)
FT                   /gene="Pc20g03100"
FT                   /locus_tag="PCH_Pc20g03100"
FT   intron          711608..711667
FT                   /gene="Pc20g03100"
FT                   /locus_tag="PCH_Pc20g03100"
FT                   /number=1
FT   exon            711668..712152
FT                   /gene="Pc20g03100"
FT                   /locus_tag="PCH_Pc20g03100"
FT                   /number=2
FT   mRNA            join(<713065..713204,713409..713418,713495..713652,
FT                   713712..713758,713831..713926,713982..714649,
FT                   714711..>714824)
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT   CDS_pept        join(713065..713204,713409..713418,713495..713652,
FT                   713712..713758,713831..713926,713982..714649,
FT                   714711..714824)
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /note="unknown EC_number=2.7.8.-"
FT                   /note="Title: strong similarity to
FT                   aminoalcoholphosphotransferase AAPT1 - Glycine max"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85640"
FT                   /db_xref="GOA:B6HFF3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF3"
FT                   /inference="similar to AA sequence:PIR:T06384"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /inference="protein motif:COGS:COG5050"
FT                   /inference="protein motif:COGS:COG0558"
FT                   /protein_id="CAP85640.1"
FT                   /translation="MVYIRQHELANLKNYKYAGVDHSPVSRFILKPFYNKCVIPCFPMG
FT                   MAPNAITLSGFMFVVINFLTVMWYNPNLDTDCPPWVYASCAIGLFLYQTFDAVDGMQAR
FT                   RTRQSGPLGELFDHSVDACNTGLSVLVFAAAMNMGQSWMTFIALFGSTMTFYVQTWDEY
FT                   YTQILTLGVISGPVEGILTLCVVYIFTAYMGGGSFWHQPMLETIGVPKPSFLSSQVYNM
FT                   PFTQWYLVYGAIMLCFAISSSVMHVMKVRRERGQDPFSPLYGLLPLAVIWTLIPAYLYL
FT                   QPVILENHTIPFGLFVSLVNAYSVGRIIIGHLTQTSFPYQNVLLYPLALGVLDSVGALI
FT                   GLWSAPMLGYGVGQVGFVFGLLGLAVGVYGSFVFDIITTICDYIDIWCLTIKYPFVEET
FT                   ERKTGVSKKTI"
FT   exon            713065..713204
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /number=1
FT   intron          713205..713408
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /number=1
FT   exon            713409..713418
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /number=2
FT   intron          713419..713494
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /number=2
FT   exon            713495..713652
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /number=3
FT   intron          713653..713711
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /number=3
FT   exon            713712..713758
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /number=4
FT   intron          713759..713830
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /number=4
FT   exon            713831..713926
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /number=5
FT   intron          713927..713981
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /number=5
FT   exon            713982..714649
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /number=6
FT   intron          714650..714710
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /number=6
FT   exon            714711..714824
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /number=7
FT   mRNA            join(<715399..715401,715531..715593,715818..>716000)
FT                   /gene="Pc20g03120"
FT                   /locus_tag="PCH_Pc20g03120"
FT   CDS_pept        join(715399..715401,715531..715593,715818..716000)
FT                   /gene="Pc20g03120"
FT                   /locus_tag="PCH_Pc20g03120"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1487_1.tfa_970cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85641"
FT                   /db_xref="GOA:B6HFF4"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF4"
FT                   /inference="protein motif:PFAM:PF01667"
FT                   /inference="protein motif:COGS:COG2051"
FT                   /protein_id="CAP85641.1"
FT                   /translation="MVLAVDLLNPTPQAEARKHKLKTLVPQPRSFFMDVKCPGCFTITT
FT                   VFSHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK"
FT   exon            715399..715401
FT                   /gene="Pc20g03120"
FT                   /locus_tag="PCH_Pc20g03120"
FT                   /number=1
FT   intron          715402..715530
FT                   /gene="Pc20g03120"
FT                   /locus_tag="PCH_Pc20g03120"
FT                   /number=1
FT   exon            715531..715593
FT                   /gene="Pc20g03120"
FT                   /locus_tag="PCH_Pc20g03120"
FT                   /number=2
FT   intron          715594..715817
FT                   /gene="Pc20g03120"
FT                   /locus_tag="PCH_Pc20g03120"
FT                   /number=2
FT   exon            715818..716000
FT                   /gene="Pc20g03120"
FT                   /locus_tag="PCH_Pc20g03120"
FT                   /number=3
FT   mRNA            complement(join(<717788..718088,718205..>718242))
FT                   /gene="Pc20g03130"
FT                   /locus_tag="PCH_Pc20g03130"
FT   CDS_pept        complement(join(717788..718088,718205..718242))
FT                   /gene="Pc20g03130"
FT                   /locus_tag="PCH_Pc20g03130"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1487_1.tfa_960wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85642"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF5"
FT                   /protein_id="CAP85642.1"
FT                   /translation="MSTTNIQDLNAKISAFESHPQCKPPNTHPTIFFLYDFVRNTHNQL
FT                   KAVDAEKYAAGDNGAKNAVGEVEGRNAFANMLINDTSGKLSMMTGGNPSNPADFGAEIK
FT                   AKAQILTQ"
FT   exon            complement(717788..718088)
FT                   /gene="Pc20g03130"
FT                   /locus_tag="PCH_Pc20g03130"
FT                   /number=1
FT   intron          complement(718089..718204)
FT                   /gene="Pc20g03130"
FT                   /locus_tag="PCH_Pc20g03130"
FT                   /number=1
FT   exon            complement(718205..718242)
FT                   /gene="Pc20g03130"
FT                   /locus_tag="PCH_Pc20g03130"
FT                   /number=2
FT   gap             718486..718585
FT                   /estimated_length=unknown
FT   mRNA            <718586..>719395
FT                   /gene="Pc20g03140"
FT                   /locus_tag="PCH_Pc20g03140"
FT   CDS_pept        <718586..719395
FT                   /gene="Pc20g03140"
FT                   /locus_tag="PCH_Pc20g03140"
FT                   /note="Title: similarity to dihydrofolate reductase dfr1p
FT                   -Schizosaccharomyces pombe [truncated ORF]"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85643"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP5"
FT                   /inference="similar to AA sequence:PIR:T43248"
FT                   /inference="protein motif:PFAM:PF03959"
FT                   /protein_id="CAP85643.1"
FT                   /translation="HGYTQSGSLFHAKSRALTKHIQKAFPLHEVTAIYPTAPIRLLPAD
FT                   IPGYEPSSEGGADNEIESYGWWRRSNTANPPLYIGIEEGFATVARTLKQEGPFDGVIGF
FT                   SQGAALAAMVAALLEPGRKASFEQFSKISAEGAAGMTIPAPFGEEGFQHPQLKFAVCYS
FT                   GFRAPGARYRGFYEEPAIQTPVLHVLGSLDAVVEEARSQALVEACAGEPEKDGLVVWHP
FT                   GGHFLPSQRPYLDATVRFIREQMERSDGSNGKGKEVEEDVNDMDLPF"
FT   exon            <718586..719395
FT                   /gene="Pc20g03140"
FT                   /locus_tag="PCH_Pc20g03140"
FT                   /number=1
FT   mRNA            complement(join(<719670..720272,720326..720814,
FT                   720867..721103,721168..721224,721280..>721363))
FT                   /gene="Pc20g03150"
FT                   /locus_tag="PCH_Pc20g03150"
FT   CDS_pept        complement(join(719670..720272,720326..720814,
FT                   720867..721103,721168..721224,721280..721363))
FT                   /gene="Pc20g03150"
FT                   /locus_tag="PCH_Pc20g03150"
FT                   /note="deleted EC_number 3.4.99.46"
FT                   /note="Title: strong similarity to proteasome 19S
FT                   regulatory particle subunit Rpn5 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85644"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR035297"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040134"
FT                   /db_xref="InterPro:IPR040896"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP6"
FT                   /inference="similar to AA sequence:PIR:S67695"
FT                   /inference="protein motif:PFAM:PF01399"
FT                   /inference="protein motif:COGS:COG5071"
FT                   /protein_id="CAP85644.1"
FT                   /translation="MSGGLLKPEKDFTKDADKLIPEAEALAKTDVQGAVDKLLGLEKQS
FT                   RQASDLATTSRLLIAIVTISKNSGDWNLLNDQVLLLSKKHAQLKQATTKMVQTVMTFLD
FT                   ETPNLEVKMSVIETLRTVTEGKIFVEVERARVTRILSNIKKTQGDLTSAADILCELQVE
FT                   TFGSMTRREKTEFILEQVSLCIERGDWTQAQILSRKINKRYFSRKPKKSAEQIETLKKE
FT                   AEEREKTRAPDEPPMEVDDDVTDLKLRYFEQQIILANHDNKYLEVCKNYREVLDTEAVE
FT                   NNPEHLRASLARIVYYVVLSPYDNEQSDLLHRIKQDSRLSQIPEESRLLKLFTIPELMR
FT                   WPMVAEQFGPHLCSTDVFDAEAKQSTENQANQRWQDLRKRVIEHNVRVVAKYYTRIQMG
FT                   RLTQLLDLTEEETEKYISDLVTSKTIYAKIDRPARLVNFAKPRDADDVLNEWSSDMKNL
FT                   LGLLERIDHLITKEEMMARIQPTRSDKGKAH"
FT   exon            complement(719670..720272)
FT                   /gene="Pc20g03150"
FT                   /locus_tag="PCH_Pc20g03150"
FT                   /number=1
FT   intron          complement(720273..720325)
FT                   /gene="Pc20g03150"
FT                   /locus_tag="PCH_Pc20g03150"
FT                   /number=1
FT   exon            complement(720326..720814)
FT                   /gene="Pc20g03150"
FT                   /locus_tag="PCH_Pc20g03150"
FT                   /number=2
FT   intron          complement(720815..720866)
FT                   /gene="Pc20g03150"
FT                   /locus_tag="PCH_Pc20g03150"
FT                   /number=2
FT   exon            complement(720867..721103)
FT                   /gene="Pc20g03150"
FT                   /locus_tag="PCH_Pc20g03150"
FT                   /number=3
FT   intron          complement(721104..721167)
FT                   /gene="Pc20g03150"
FT                   /locus_tag="PCH_Pc20g03150"
FT                   /number=3
FT   exon            complement(721168..721224)
FT                   /gene="Pc20g03150"
FT                   /locus_tag="PCH_Pc20g03150"
FT                   /number=4
FT   intron          complement(721225..721279)
FT                   /gene="Pc20g03150"
FT                   /locus_tag="PCH_Pc20g03150"
FT                   /number=4
FT   exon            complement(721280..721363)
FT                   /gene="Pc20g03150"
FT                   /locus_tag="PCH_Pc20g03150"
FT                   /number=5
FT   mRNA            join(<722482..722806,722860..>724223)
FT                   /gene="Pc20g03160"
FT                   /locus_tag="PCH_Pc20g03160"
FT   CDS_pept        join(722482..722806,722860..724223)
FT                   /gene="Pc20g03160"
FT                   /locus_tag="PCH_Pc20g03160"
FT                   /note="Title: strong similarity to siroheme synthase cysG
FT                   -Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03160"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85645"
FT                   /db_xref="GOA:B6HFP7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012066"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR028162"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP7"
FT                   /inference="similar to AA sequence:TREMBL:ECNIRBC.4"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /inference="protein motif:COGS:COG0007"
FT                   /inference="protein motif:COGS:COG1648"
FT                   /protein_id="CAP85645.1"
FT                   /translation="MKDASCDPKPPVPLMAAWNTESQVHLIVGSNPLAAARCARSLEVG
FT                   ATPIIIAPETDDMHFTLSEHIANGSAQWIRHEFEDKDLTTLGREEVDHIVDLVFVTLGS
FT                   NNSLSPHISKLCRRLRIPVNVSDAPELCSFTLLSTYSDGPLHIGITTSGRGCKLASRLR
FT                   REIASFLPQNLGTAIDRLGAVRRRLWEEDSAAGLIEGIFDREDDDSTGQKHTFNNLVTE
FT                   GDAAAAKTRRVRWLSQICEYWPLRKLVSITDADMDAILKAYTAGNDTTNGTNGLDALSK
FT                   KGKIVLAGSGPGHPDLLTRATYHAIHNADIILADKLVPAPVLDLIPRRTEVHIARKFPG
FT                   NADQAQEEFLVMGLAALKQGRQVLRLKQGDPYLYGRGAEEFEFFRKEGYSPVVLPGITS
FT                   AMSASLFADIPATHRGVSDQVLVCTGTGRKGAAPNPPTYVPTQTVVFLMALHRLSALVE
FT                   SLTTFPAEDTGPQSRTLWPKETPCAIVERASCPDQRVIRSTLEHVCLAFEEAGSRPPGL
FT                   LVVGASCHVLHNPQGQRWVIEEGFHGLDELRSEVDVVAVSMDEKQ"
FT   exon            722482..722806
FT                   /gene="Pc20g03160"
FT                   /locus_tag="PCH_Pc20g03160"
FT                   /number=1
FT   intron          722807..722859
FT                   /gene="Pc20g03160"
FT                   /locus_tag="PCH_Pc20g03160"
FT                   /number=1
FT   exon            722860..724223
FT                   /gene="Pc20g03160"
FT                   /locus_tag="PCH_Pc20g03160"
FT                   /number=2
FT   mRNA            join(<724533..724588,724619..724727,724847..724931,
FT                   724936..725133,725545..>726365)
FT                   /gene="Pc20g03170"
FT                   /locus_tag="PCH_Pc20g03170"
FT   CDS_pept        join(724533..724588,724619..724727,724847..724931,
FT                   724936..725133,725545..726365)
FT                   /gene="Pc20g03170"
FT                   /locus_tag="PCH_Pc20g03170"
FT                   /note="Title: strong similarity to deoxyribose-phosphate
FT                   aldolase like protein An11g09730 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03170"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85646"
FT                   /db_xref="GOA:B6HFP8"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP8"
FT                   /inference="protein motif:PFAM:PF01791"
FT                   /inference="protein motif:COGS:COG0274"
FT                   /protein_id="CAP85646.1"
FT                   /translation="MSARPPKPVYFSNGQALQSQTANQRAHSPPLTVRLTRFIESIYFF
FT                   LGLYFTTLFSLDSYAAAENSSFNINNQKNRYTTRSRWGAQPHSVEEAEAEVEVAVVRDL
FT                   VRDALAVWMMSVGRSARAVNKQTVKAVELLLKCNLKEEKSPNGPRCALHQPPSMSEIPA
FT                   TNAEWADKIANMKKQLPRRSLTQPPIPTQIHRTIDHTLLTTPVDASQIDTLCKEALEYD
FT                   FAGVCVRLEHVARAAGHLKGSNTAVACVVGFPEGTHETIEKVREAKEAVQQGATELDMV
FT                   IRYNLLKEGRYKEVFDDVLAVRHAAPTPIVLKAILEATELEEHQLIDATIVSCMAGADY
FT                   IKTSTGWNGGASAQHLKLMNFAAQMCGCTCLIKASGGIRNAEELLRMLKAGANRIGTSS
FT                   GVKIMKEIDEGEVLEQGCGHAVA"
FT   exon            724533..724588
FT                   /gene="Pc20g03170"
FT                   /locus_tag="PCH_Pc20g03170"
FT                   /number=1
FT   intron          724589..724618
FT                   /gene="Pc20g03170"
FT                   /locus_tag="PCH_Pc20g03170"
FT                   /number=1
FT   exon            724619..724727
FT                   /gene="Pc20g03170"
FT                   /locus_tag="PCH_Pc20g03170"
FT                   /number=2
FT   intron          724728..724846
FT                   /gene="Pc20g03170"
FT                   /locus_tag="PCH_Pc20g03170"
FT                   /number=2
FT   exon            724847..724931
FT                   /gene="Pc20g03170"
FT                   /locus_tag="PCH_Pc20g03170"
FT                   /number=3
FT   intron          724932..724935
FT                   /gene="Pc20g03170"
FT                   /locus_tag="PCH_Pc20g03170"
FT                   /number=3
FT   exon            724936..725133
FT                   /gene="Pc20g03170"
FT                   /locus_tag="PCH_Pc20g03170"
FT                   /number=4
FT   intron          725134..725544
FT                   /gene="Pc20g03170"
FT                   /locus_tag="PCH_Pc20g03170"
FT                   /number=4
FT   exon            725545..726365
FT                   /gene="Pc20g03170"
FT                   /locus_tag="PCH_Pc20g03170"
FT                   /number=5
FT   mRNA            complement(join(<727198..728562,728624..>728968))
FT                   /gene="Pc20g03180"
FT                   /locus_tag="PCH_Pc20g03180"
FT   CDS_pept        complement(join(727198..728562,728624..728968))
FT                   /gene="Pc20g03180"
FT                   /locus_tag="PCH_Pc20g03180"
FT                   /note="Title: similarity to damage and replication
FT                   checkpoint control protein crb3p - Schizosaccharomyces
FT                   pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85647"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP9"
FT                   /inference="similar to AA sequence:PIR:S67437"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP85647.1"
FT                   /translation="MLSESFVASTLSSAKSPTASLRDVGVCIHELQPSSILRSTFKKSS
FT                   TLTNCLAVSPSHIFTAQADKAVLHVYNREKGNQEGVVPFPERIRSIAVAGGKYGDVLVL
FT                   GTEGGRLIVWETCTGRQVATTASHLQPVTSLVVDPTSNFILSGSADASVHVWSLPGILS
FT                   FSKPALSATRQPTNSPIRTFSNHRAAITSLAVGHSNGRHNIVVSTAKDNTAIAWDYHTG
FT                   RALRTFLLPLSATSVALDPVDRAFYVGYEDGSVQSVDFYRSQSAQHPLHDPSVQSTPAQ
FT                   VSMEDRWLPPSAETGSAKAISLTYDGTTLLSGHANGKVLSWNVARRKYTSSVADYTHPI
FT                   TNLVMLPPGGIPHPSSDLKRKAHTIVKPRHDSGLSAPNHAPGAVPAEYMFHTQIIAPSD
FT                   SRKPTEFSQALTHSSFPTSMIEDGLAELAAFRQPGSAEVTRVASNAVPARETLEDTAAR
FT                   DSQVTELENEVAVLKKKVAVNETARHNADDEVVQLRSDLANLQDYINELHEKQEAAQQE
FT                   KVLRQARKQEHETKKREAWLAAEKKGRNGDAVIQKMDIDGDVTSDSDDPSDE"
FT   exon            complement(727198..728562)
FT                   /gene="Pc20g03180"
FT                   /locus_tag="PCH_Pc20g03180"
FT                   /number=1
FT   intron          complement(728563..728623)
FT                   /gene="Pc20g03180"
FT                   /locus_tag="PCH_Pc20g03180"
FT                   /number=1
FT   exon            complement(728624..728968)
FT                   /gene="Pc20g03180"
FT                   /locus_tag="PCH_Pc20g03180"
FT                   /number=2
FT   mRNA            join(<730217..731329,731389..>732381)
FT                   /gene="Pc20g03190"
FT                   /locus_tag="PCH_Pc20g03190"
FT   CDS_pept        join(730217..731329,731389..732381)
FT                   /gene="Pc20g03190"
FT                   /locus_tag="PCH_Pc20g03190"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An11g09750 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85648"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ0"
FT                   /protein_id="CAP85648.1"
FT                   /translation="MDSGATDIPSHACFPAQIQTHIRNQGSNSSSMSHDVMAMAEPIPS
FT                   PRRWSPTYVPRRRSRQMPSLSFVPSPVMPRIESHDFSTSASRRTTDRGPACMSPFRSVR
FT                   RMKEPFQLMLPTSPASLEGPPPNFPEKTRRPSKAPADHTLRTWRSDQNLTCGSLEAFGL
FT                   LPSPPISESRPASTGPELSYFDSQSSDESVRSSDGKDEKDEPGTQPEVSTKAATLEIGE
FT                   KIQYTAYRPPDWKNQPRTDVMNVHEAHSEFVRQCESGNAQQSNPQSPKKAAPSQASPKP
FT                   ESSETVLIPGSSPRPQRPRTATVSSEASWVPSNFSYCERWLQGVPVDKVDDQKTSTKEF
FT                   TNRRKFQIVENDPPMPKLDIIPGAKALEEPVRFVVASKTKPKLVDIARQSSPSPPLLPP
FT                   PCLQPNTVPTTPDQRQEEVSAFSPDTPLDMSDSGYGTRDSGYSFDSFEGSKVDDDDDAY
FT                   TDPGSLTSSDSVGSTVICEKPESTQGEREISPQPEIRSGSVSPKASSPPTTHAPGRKSP
FT                   MSEQEDEKPRILHHDWTLDDHEWTLDELDHSVKDFPRHMLRLASPVMVFLRKNDEKALI
FT                   KPFRTIFPDVAENLLDGLCAALLARNYLLSLSTTCRTKPTTSPRKDAYTIDGVPKKAYN
FT                   TLGIQLPPGSASKPKDPLFSSRSADLQTQLERIVDNLLFAICGRSDPTLKSAVEVLAQV
FT                   LETNASH"
FT   exon            730217..731329
FT                   /gene="Pc20g03190"
FT                   /locus_tag="PCH_Pc20g03190"
FT                   /number=1
FT   intron          731330..731388
FT                   /gene="Pc20g03190"
FT                   /locus_tag="PCH_Pc20g03190"
FT                   /number=1
FT   exon            731389..732381
FT                   /gene="Pc20g03190"
FT                   /locus_tag="PCH_Pc20g03190"
FT                   /number=2
FT   mRNA            <733195..>734445
FT                   /gene="Pc20g03200"
FT                   /locus_tag="PCH_Pc20g03200"
FT   CDS_pept        733195..734445
FT                   /gene="Pc20g03200"
FT                   /locus_tag="PCH_Pc20g03200"
FT                   /note="unknown EC_number=2.8.1.-"
FT                   /note="Title: strong similarity to lipoic acid synthase
FT                   Lip5 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03200"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85649"
FT                   /db_xref="GOA:B6HFQ1"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HFQ1"
FT                   /inference="similar to AA sequence:PIR:S42159"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /inference="protein motif:COGS:COG0320"
FT                   /protein_id="CAP85649.1"
FT                   /translation="MAAPTRSLRRLSSFRTTISPSLTVTAPIGCRSYATTDSSSATNTP
FT                   GTTRRRATKFQDKLNAGPSFSDFVSGGQDEPLDPSEAYALKTALVGPAGRKKEMTRLPE
FT                   WLKTPIPDSKNYQRLKKDLRGLNLHTVCEEARCPNISDCWGGSDKSSATATIMLMGDTC
FT                   TRGCRFCSVKTSRAPPPLDPHEPENTAEAISRWSLGYVVLTSVDRDDLVDGGARHFAET
FT                   VIKIKQKKPSMLVECLTGDFRGDTEMAALVARSGLDVYAHNVETVEELTPFVRDRRATF
FT                   QQSIRVLDSAKKAVPELVTKTSLMLGLGETDEQLWDALRQLRAVNVDVVTFGQYMRPTK
FT                   RHMAVHEYVTPDRFELWRQRALDMGFLYCASGPLVRSSYKAGEAFIENVLKKRRAGSGT
FT                   AERTVDQTAATTDEATR"
FT   sig_peptide     733195..733290
FT                   /gene="Pc20g03200"
FT                   /locus_tag="PCH_Pc20g03200"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            733195..734445
FT                   /gene="Pc20g03200"
FT                   /locus_tag="PCH_Pc20g03200"
FT                   /number=1
FT   mat_peptide     733291..734442
FT                   /gene="Pc20g03200"
FT                   /locus_tag="PCH_Pc20g03200"
FT   mRNA            complement(join(<735132..735455,735516..735773,
FT                   735831..>736652))
FT                   /gene="Pc20g03210"
FT                   /locus_tag="PCH_Pc20g03210"
FT   CDS_pept        complement(join(735132..735455,735516..735773,
FT                   735831..736652))
FT                   /gene="Pc20g03210"
FT                   /locus_tag="PCH_Pc20g03210"
FT                   /note="unknown EC_number=3.1.3.3"
FT                   /note="Title: strong similarity to phosphoserine
FT                   phosphatase Ser2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85650"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ2"
FT                   /inference="similar to AA sequence:PIR:S53931"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /inference="protein motif:COGS:COG0560"
FT                   /protein_id="CAP85650.1"
FT                   /translation="MAESTRTTRPSLGQMRSSSFLQDHQQYKPMAPINPISQTIGEVLA
FT                   NQTEDQLVLNSNPIKPDPERVTDSGIIHSIFNHQANPLPTGTSQVVATIYYKSNNPVHP
FT                   HYHPDSGPQNVPGDKIPAPKVPEGSAPTEDMDKFPREPPAPEPEPLDHLYGPYVSQLCL
FT                   TNFLQILETLPTPYQRMNTSHRCLDRDEHPRVVEVTFSPPPNPEYLSFPDLRKHESIWR
FT                   FEREWNVEVVLQKESVFRRHKRLAVFDMDSTLIDNECIDEIAKFIGVEKEVSEITERAM
FT                   NGELDFTASLKERVGLLNGVSADVFEKLKSVLKIAKGARELCRALKALGYKIAVVSGGF
FT                   QPLAEWLAGQLGIDIAIANHLEIDEATQTLTGKLVPSYPIVDAAHKRTLLKSIAAENGI
FT                   PLSQTMAVGDGANDLLMLHAAGLGVAWRAKSKVQLEAPVRINGESLVDVLYLLGMDNED
FT                   IAELTSDVQ"
FT   exon            complement(735132..735455)
FT                   /gene="Pc20g03210"
FT                   /locus_tag="PCH_Pc20g03210"
FT                   /number=1
FT   intron          complement(735456..735515)
FT                   /gene="Pc20g03210"
FT                   /locus_tag="PCH_Pc20g03210"
FT                   /number=1
FT   exon            complement(735516..735773)
FT                   /gene="Pc20g03210"
FT                   /locus_tag="PCH_Pc20g03210"
FT                   /number=2
FT   intron          complement(735774..735830)
FT                   /gene="Pc20g03210"
FT                   /locus_tag="PCH_Pc20g03210"
FT                   /number=2
FT   exon            complement(735831..736652)
FT                   /gene="Pc20g03210"
FT                   /locus_tag="PCH_Pc20g03210"
FT                   /number=3
FT   mRNA            join(<737635..737818,737884..>738629)
FT                   /gene="ParA"
FT                   /locus_tag="PCH_Pc20g03220"
FT   CDS_pept        join(737635..737818,737884..738629)
FT                   /gene="ParA"
FT                   /locus_tag="PCH_Pc20g03220"
FT                   /product="3-phosphoadenosine-5-phosphosulfate reductase
FT                   ParA-Penicillium chrysogenum"
FT                   /note="unknown EC_number=1.8.4.8"
FT                   /note="Gene-ID: ParA"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85651"
FT                   /db_xref="GOA:B6HFQ3"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ3"
FT                   /inference="similar to AA sequence:TREMBL:AF227433.1"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /inference="protein motif:COGS:COG0175"
FT                   /protein_id="CAP85651.1"
FT                   /translation="MPAKMPNYSSEMEGVDNHDNMTESGYVSAGSGSSEDYVPEIVFTK
FT                   PHLQFLNRQLQFLEPQEILRWCITSLPHLFQTTAFGLTGLVTLDMLSKLEVPRPQMVDL
FT                   VFLDTLYHFDETMSLVDRVRRRYPNNNVHIYKPAGVETTAEFEAKYGAKLWEVDDQLYD
FT                   WVAKVEPAQRAYREMNVHAVLTGRRRSQGGKRGDLDIIEVDEAGLIKINPMANWSFDQV
FT                   KQYVKENDVPYNELLDRGYKSIGDWHSTQPVAEGEDERSGRWKGQQKTECGIHNPRSKY
FT                   AQYLMEMERKRQEEALSQALQTQLTPVV"
FT   exon            737635..737818
FT                   /gene="ParA"
FT                   /locus_tag="PCH_Pc20g03220"
FT                   /number=1
FT   intron          737819..737883
FT                   /gene="ParA"
FT                   /locus_tag="PCH_Pc20g03220"
FT                   /number=1
FT   exon            737884..738629
FT                   /gene="ParA"
FT                   /locus_tag="PCH_Pc20g03220"
FT                   /number=2
FT   mRNA            join(<739240..739863,739916..>742921)
FT                   /gene="Pc20g03230"
FT                   /locus_tag="PCH_Pc20g03230"
FT   CDS_pept        join(739240..739863,739916..742921)
FT                   /gene="Pc20g03230"
FT                   /locus_tag="PCH_Pc20g03230"
FT                   /note="Title: strong similarity to erythrocyte splice form
FT                   1 of ankyrin like protein An12g05680 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85652"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031359"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ4"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /inference="protein motif:COGS:COG0666"
FT                   /protein_id="CAP85652.1"
FT                   /translation="MKWLPRFRPRKASSGDPKGNSAVAPSPPVGPEMIAPSTNSIPASS
FT                   LSEQATSPSVVDSSPFPTAVCAAQLQAGQAAASISPSAGSPPAPSTSAVQDIDIWTTAY
FT                   EVVENREPELMTDYASHLASIQGNPTTKNHISSSEFVEDVVTQLLEEREKKQWRLPLLG
FT                   NNVIVRKQAERLAKVLLWADPVVKRAVSTQPYAALAWSSVSILLPLLTGAATPDVAMLK
FT                   GFNSISDVQVYWAIFEETYLSSSHRQHYENLIEPLAKLYSYIIEYQARAICHLSKTQLS
FT                   RGWQNVAGEDDWAEKASEIEALSEARSSLISHDNETEIRERWGRQLREIQESSAILKEI
FT                   RQVLDETQRQTQGNYEDKAEKDLLHDLASDYEGYKDFNRLRVQGTCEWFFNDEKFCKWR
FT                   DSNTSGLLWLSAGPGCGKSILSRALIDERRLSLNVTTSTVCHFFFKDGYEDRMYSVNAL
FT                   CAVLHQLFSHDPSGALIKLALPAHKNYGKSLVRNFSELWNILLDCAKSPHAGEIVCIFD
FT                   ALDECEQQSRLQLISKLKDFYCQPQGSSALSSKLSFLITSRPYAEIERNFSGFSTTEYL
FT                   HFDGDKKSVAITREIDLVIDDHVSQIIGNFTANDQLEISKRLKTMENRTYLWLYVIFET
FT                   IKEDPSRHGKRSSVEKLLNNIPSKLSEAYEKILGRSRCQEETQHLLEIILAAARPLTLD
FT                   EANVALTLALAEEDFTSHSALENDLWPKNNFESIVKGLSGLFISVHDSKLFFIHQTARE
FT                   FLIDPSGRGTWEGRLSMSKSSRTISRTCFKFLMLPDLRASVKDADFWDDDDYDLNDPNH
FT                   VTLEQLPPFFCYAADHWPSHFLSQGATDIDQSLKDARTLCNRHQAWVWVTASGWTPGGR
FT                   LTLFHHMTDLSLASYFGLKQVVENILTEEHIDVNTEDESSTLALRSSRSALSAACLGGK
FT                   SDVVTLLLDKGANVNSYHKLHATALYTALVYGHQDIVPILLEKGADVNITGEHHGTALY
FT                   MASHLGNPDIVLSILERGADINYNHKWHGTALYRACRSGHPKVVKILLENGANVNIGDR
FT                   GYGSALLAASTHNCPDIVIDLLKKDADTDYNNQKYGTALRMASGHGWQNVVEVLLAHGA
FT                   DPNIRGTEYGSSPIQVASFFGHQGAVEELLKHGADVNFPDQQGNTALLAAARQGHREIV
FT                   SMLLRCGADVTVKGERYGTALNAATEAGHTEIIEMLAKRGAKV"
FT   exon            739240..739863
FT                   /gene="Pc20g03230"
FT                   /locus_tag="PCH_Pc20g03230"
FT                   /number=1
FT   intron          739864..739915
FT                   /gene="Pc20g03230"
FT                   /locus_tag="PCH_Pc20g03230"
FT                   /number=1
FT   exon            739916..742921
FT                   /gene="Pc20g03230"
FT                   /locus_tag="PCH_Pc20g03230"
FT                   /number=2
FT   mRNA            complement(<743002..>744297)
FT                   /gene="Pc20g03240"
FT                   /locus_tag="PCH_Pc20g03240"
FT   CDS_pept        complement(743002..744297)
FT                   /gene="Pc20g03240"
FT                   /locus_tag="PCH_Pc20g03240"
FT                   /note="unknown EC_number=4.4.1.14"
FT                   /note="Title: strong similarity to ACC synthase acs
FT                   -Penicillium citrinum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85653"
FT                   /db_xref="GOA:B6HFQ5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ5"
FT                   /inference="similar to AA sequence:PIR:JC7730"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /inference="protein motif:COGS:COG0436"
FT                   /protein_id="CAP85653.1"
FT                   /translation="MTQSVLSRRAQDVVDAGSENPMWDVMKDTWHASTNPTGYVNVGVA
FT                   ENALMHDELLEFINKKLELPAKYLTYNDGGGGSSRLKAAIAAFLNHNLKPVIPLEPSHI
FT                   MATNGVSSAIEHVAWSFADPGEGILLGRPYYGMFIPDMSLRTGSSVVPVSFGELDPLSV
FT                   EGVDKYEEALLEFHRTTGKKVKALMLAHPHNPLGRCYSREVLVKLMRLCQKYQVHFISD
FT                   EIYALSVFENTVGEHPPPVKFESALSIDLTGIIDPRLVHVLWGMSKDFGANGIRLGVII
FT                   SQANRDIHMALTGPSLYSYASGITDHLTALILEDFDFTTRYIQQNQKLLSESYAYTANY
FT                   LKEHGIEYATGCNAAFFVWMNLGKKYRELHPEDECENVGERIMQRLLQKKVFLASGFLF
FT                   GSEKDGWFRIVFTQGHDYLSVALERINAALEE"
FT   exon            complement(743002..744297)
FT                   /gene="Pc20g03240"
FT                   /locus_tag="PCH_Pc20g03240"
FT                   /number=1
FT   mRNA            complement(join(<744878..744928,744974..>745576))
FT                   /gene="Pc20g03250"
FT                   /locus_tag="PCH_Pc20g03250"
FT   CDS_pept        complement(join(744878..744928,744974..745576))
FT                   /gene="Pc20g03250"
FT                   /locus_tag="PCH_Pc20g03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85654"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ6"
FT                   /protein_id="CAP85654.1"
FT                   /translation="MSSLNITLRGHHTATRFPEQAMVYLTVESTGESEATVMCEVNSTT
FT                   NDLLRGLEIPPAIEEDGTISPIAVSDISFSNIYLTTKNRNAHDSKNVSDSPRIYDAVIT
FT                   IYVIFCDFNGLHRFIQKADKYPNARLNNVVWYLTDATKDDIGAESRKKAVRDAVTKASQ
FT                   YAEAVGFGDVIPVDIREIDESLNPSALPQKPTYRHPSGVVFEASCDIGSEARTE"
FT   exon            complement(744878..744928)
FT                   /gene="Pc20g03250"
FT                   /locus_tag="PCH_Pc20g03250"
FT                   /number=1
FT   intron          complement(744929..744973)
FT                   /gene="Pc20g03250"
FT                   /locus_tag="PCH_Pc20g03250"
FT                   /number=1
FT   exon            complement(744974..745576)
FT                   /gene="Pc20g03250"
FT                   /locus_tag="PCH_Pc20g03250"
FT                   /number=2
FT   mRNA            complement(join(<745826..746101,746265..746311,
FT                   746367..>746418))
FT                   /gene="Pc20g03260"
FT                   /locus_tag="PCH_Pc20g03260"
FT   CDS_pept        complement(join(745826..746101,746265..746311,
FT                   746367..746418))
FT                   /gene="Pc20g03260"
FT                   /locus_tag="PCH_Pc20g03260"
FT                   /note="Title: similarity to hypothetical protein mlr1783
FT                   -Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85655"
FT                   /db_xref="GOA:B6HFQ7"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ7"
FT                   /inference="similar to AA sequence:TREMBL:AP002998.97"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /inference="protein motif:COGS:COG3791"
FT                   /protein_id="CAP85655.1"
FT                   /translation="MALTGSCMCGGITYTVEADTYLSALCHCTDCQKFLTPLFHTGATK
FT                   NYDVVGNSGKINKHFFCPTCGSGLYTELEVMPDNTVIKAGTLDGGEANLKGKIDVEFYV
FT                   KDRPTYLAAVEGAKQEPMFG"
FT   exon            complement(745826..746101)
FT                   /gene="Pc20g03260"
FT                   /locus_tag="PCH_Pc20g03260"
FT                   /number=1
FT   intron          complement(746102..746264)
FT                   /gene="Pc20g03260"
FT                   /locus_tag="PCH_Pc20g03260"
FT                   /number=1
FT   exon            complement(746265..746311)
FT                   /gene="Pc20g03260"
FT                   /locus_tag="PCH_Pc20g03260"
FT                   /number=2
FT   intron          complement(746312..746366)
FT                   /gene="Pc20g03260"
FT                   /locus_tag="PCH_Pc20g03260"
FT                   /number=2
FT   exon            complement(746367..746418)
FT                   /gene="Pc20g03260"
FT                   /locus_tag="PCH_Pc20g03260"
FT                   /number=3
FT   mRNA            complement(join(<747097..748638,748699..748855,
FT                   748914..>748969))
FT                   /gene="Pc20g03270"
FT                   /locus_tag="PCH_Pc20g03270"
FT   CDS_pept        complement(join(747097..748638,748699..748855,
FT                   748914..748969))
FT                   /gene="Pc20g03270"
FT                   /locus_tag="PCH_Pc20g03270"
FT                   /note="Title: strong similarity to myocyte-specific
FT                   enhancer factor like protein An02g12210 - Aspergillus
FT                   niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85656"
FT                   /db_xref="GOA:B6HFQ8"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="InterPro:IPR033896"
FT                   /db_xref="InterPro:IPR036879"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ8"
FT                   /inference="protein motif:PFAM:PF00319"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /inference="protein motif:COGS:COG5068"
FT                   /protein_id="CAP85656.1"
FT                   /translation="MGRRKIEIKAIKDDRNRSVTFLKRKGGLFKKAHELAVLCSVDVAV
FT                   IIFGHNKKLYEYSSCDMHDALGRYQYFGPPHEHKGPEDFAGKRDDDDEEDEASPAPEDI
FT                   QAVQQNHPAIPPHLQSQPAFQHMNHAPSASPPIHHAMTRHGTPQPQGTSRPSSRNHIRR
FT                   VSSNLGPQQHGTPPPPPPPGPQNGGFTYMPNPSMYNPNVHAMNQQPRPAQFAHYGHPPG
FT                   QHQGTPPMHPHGLPQQMPPQHQGQQHFQHGHPVGMPPGPHQHVQQAYMQEHGRNSMPPG
FT                   FAPDHQERPASEHPQDDSVMKAEHSQSPPQIKSLSKSRSIFTPIDDRGSVLARHFGAGA
FT                   GSYESHNSHSLKVEAPQASIASKSMPVRAATEAPRAGSIASTPKIKPPSRTNSGPLPSK
FT                   RPQLKVQIPSETSDAGSATADSSHDSAVNKNSPPAKGNVENGPPGVVLPPPSPSAGAIL
FT                   SAGAQGPPNPFARPPPPVAATRNDSYGSNSGNPNNGNNSNNIETPISALPSRFVSDALL
FT                   PSPSSFFPEWGFGRSGPDSNMLPSPLTFPTPAVQSGPSFSREDEQDKKRKSPDSGSAGE
FT                   GAHKKPKT"
FT   exon            complement(747097..748638)
FT                   /gene="Pc20g03270"
FT                   /locus_tag="PCH_Pc20g03270"
FT                   /number=1
FT   intron          complement(748639..748698)
FT                   /gene="Pc20g03270"
FT                   /locus_tag="PCH_Pc20g03270"
FT                   /number=1
FT   exon            complement(748699..748855)
FT                   /gene="Pc20g03270"
FT                   /locus_tag="PCH_Pc20g03270"
FT                   /number=2
FT   intron          complement(748856..748913)
FT                   /gene="Pc20g03270"
FT                   /locus_tag="PCH_Pc20g03270"
FT                   /number=2
FT   exon            complement(748914..748969)
FT                   /gene="Pc20g03270"
FT                   /locus_tag="PCH_Pc20g03270"
FT                   /number=3
FT   mRNA            join(<750664..750853,750927..751084,751148..751241,
FT                   751295..751523,751577..753951,753995..>754086)
FT                   /gene="Pc20g03280"
FT                   /locus_tag="PCH_Pc20g03280"
FT   CDS_pept        join(750664..750853,750927..751084,751148..751241,
FT                   751295..751523,751577..753951,753995..754086)
FT                   /gene="Pc20g03280"
FT                   /locus_tag="PCH_Pc20g03280"
FT                   /note="Title: similarity to morphogenesis-related protein
FT                   Msb1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85657"
FT                   /db_xref="InterPro:IPR012965"
FT                   /db_xref="InterPro:IPR037508"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ9"
FT                   /protein_id="CAP85657.1"
FT                   /translation="MSFFSRVFRGKDSTATKKQVKPTAPVNTAPAKPKWTDAWQRTEVA
FT                   PEEVQDLVRGCVHELKARALDTPFLLLPFRPSSDPSAARTFIRNYFNQSFEKGSPVNGD
FT                   ALSQELRLTEPMVVCGVMKWCWSRLPGGVVTWEAYETFKMGEHDSDMARDAFSTFIPIG
FT                   GDSEARTNIILDFFDLLAAIAAHGKSNGLGGRKLSRYAGWWAFEHVDTGNGFEAAYKNW
FT                   AAAADATSHLFFAYLRSLSPDVPGGVSGISSLPISLQSLVEATEYPPETPTLLQMTTTK
FT                   VVMIVENVSPTPFSLLRRAKNFEYRDDDWHLQEFANYEDPVSALTDECLRVLTCISSTN
FT                   QSSVSSTKQSTSLRDASWSRFEDIGFGGSIESDPEDEAKETAPPVTAKSGSAAGLKSVP
FT                   QSGTGDLGRPTTPSWADFMSSGFADENNLKQHVGPLLLPPDKVLPPIASARGMSSQSHK
FT                   RSLDIEPALEPAELASINTLDMDDSFWWVWISSLSGDEPSARKAVFGRCALLETRIRDT
FT                   KWLILEEQVKGAAPEPEAGAQIVEKKRFFSFGSRKGKLGRRKSSAKKVPSSIEDSYKRP
FT                   NNLGTQSKTSIGPDQHKRIQEAAAALQRKHREQEAEAKENRAAPNNSRYSKTNSVMTLQ
FT                   PAIVNEASQAMKWTKNYDKGAFRAAYLSDNRAGTGHIEEPEETPEPISKDPEEKPTAPL
FT                   APLPTNTAKSAPPPLPKEAAAAVSTPLPPFPKEVPTKPVNVATPEEEKPITKPAVVEQP
FT                   TERRESMDEMGKKLKKKTGNSAFKSMFSAKKKPEQQQPPVKNGDSKEISNVAATRAALE
FT                   AKAKAAQESGPVKKKPLPTAAAVAVTPVATEPEKPSSPQPVQPTINEPVTNPTSPTPPS
FT                   ASLKENGENGAPPKTRRAVEYDALSRVGTNERDAADQEFSKFDQGPLTDQPAFVPADSP
FT                   VEVTPAAQKPELPQTPTNGNGVRPVSATSPESTEATQDRWKAIREAAAQRTAAAQAEKA
FT                   HEHDTEANTRTSQSERTDEGDTSGEEIAFPAIEARVARIKARVAELTGNAEDGPRR"
FT   exon            750664..750853
FT                   /gene="Pc20g03280"
FT                   /locus_tag="PCH_Pc20g03280"
FT                   /number=1
FT   intron          750854..750926
FT                   /gene="Pc20g03280"
FT                   /locus_tag="PCH_Pc20g03280"
FT                   /number=1
FT   exon            750927..751084
FT                   /gene="Pc20g03280"
FT                   /locus_tag="PCH_Pc20g03280"
FT                   /number=2
FT   intron          751085..751147
FT                   /gene="Pc20g03280"
FT                   /locus_tag="PCH_Pc20g03280"
FT                   /number=2
FT   exon            751148..751241
FT                   /gene="Pc20g03280"
FT                   /locus_tag="PCH_Pc20g03280"
FT                   /number=3
FT   intron          751242..751294
FT                   /gene="Pc20g03280"
FT                   /locus_tag="PCH_Pc20g03280"
FT                   /number=3
FT   exon            751295..751523
FT                   /gene="Pc20g03280"
FT                   /locus_tag="PCH_Pc20g03280"
FT                   /number=4
FT   intron          751524..751576
FT                   /gene="Pc20g03280"
FT                   /locus_tag="PCH_Pc20g03280"
FT                   /number=4
FT   exon            751577..753951
FT                   /gene="Pc20g03280"
FT                   /locus_tag="PCH_Pc20g03280"
FT                   /number=5
FT   intron          753952..753994
FT                   /gene="Pc20g03280"
FT                   /locus_tag="PCH_Pc20g03280"
FT                   /number=5
FT   exon            753995..754086
FT                   /gene="Pc20g03280"
FT                   /locus_tag="PCH_Pc20g03280"
FT                   /number=6
FT   mRNA            complement(join(<754698..755089,755199..755436,
FT                   755551..>755628))
FT                   /gene="Pc20g03290"
FT                   /locus_tag="PCH_Pc20g03290"
FT   CDS_pept        complement(join(754698..755089,755199..755436,
FT                   755551..755628))
FT                   /gene="Pc20g03290"
FT                   /locus_tag="PCH_Pc20g03290"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1495_2.tfa_640cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03290"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85658"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFR0"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /inference="protein motif:COGS:COG0693"
FT                   /protein_id="CAP85658.1"
FT                   /translation="MTPKVLVVLTSHDKLGSTGNPTGWYLPEFAHPWEVLHEKVSLTIA
FT                   SPKGGEAPLDPASVKMFESDEASQKFLKEQKALWTNTHKLADVLPRAGEFDAIFYVGGH
FT                   GPMFDLTEDPTSLALIQTFAAANKPVAAVCHGPCVLLNATAPSGVPLISGVGVTGFSNA
FT                   EEDAVSLSAAMPFMLETELGRVSGGKYVKAAEPWGEMVVVGKAAGTGSTIITGQNPGSA
FT                   TGVGKEILKALGL"
FT   exon            complement(754698..755089)
FT                   /gene="Pc20g03290"
FT                   /locus_tag="PCH_Pc20g03290"
FT                   /number=1
FT   intron          complement(755090..755198)
FT                   /gene="Pc20g03290"
FT                   /locus_tag="PCH_Pc20g03290"
FT                   /number=1
FT   exon            complement(755199..755436)
FT                   /gene="Pc20g03290"
FT                   /locus_tag="PCH_Pc20g03290"
FT                   /number=2
FT   intron          complement(755437..755550)
FT                   /gene="Pc20g03290"
FT                   /locus_tag="PCH_Pc20g03290"
FT                   /number=2
FT   exon            complement(755551..755628)
FT                   /gene="Pc20g03290"
FT                   /locus_tag="PCH_Pc20g03290"
FT                   /number=3
FT   mRNA            complement(join(<756311..756458,757060..>757493))
FT                   /gene="Pc20g03300"
FT                   /locus_tag="PCH_Pc20g03300"
FT   CDS_pept        complement(join(756311..756458,757060..757493))
FT                   /gene="Pc20g03300"
FT                   /locus_tag="PCH_Pc20g03300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03300"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85659"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFR1"
FT                   /protein_id="CAP85659.1"
FT                   /translation="MAYNSDVEEYLRLHQLFQLSGEELNYHPGTSATQPPVHSTEWSLY
FT                   NPSISHASESLDPSWSMHTTIGHPTADNLYQSTMQSSSTSQHRGTEDGIQDHFSPDRTT
FT                   IQIQSSRSSPPTQLASPSNYHNVEVADVEATSTRHEPQQQEKKDGSPTSPVPEFPISSR
FT                   VPDSKAVSSMPRYPCRDENALVYMYVQQNG"
FT   exon            complement(756311..756458)
FT                   /gene="Pc20g03300"
FT                   /locus_tag="PCH_Pc20g03300"
FT                   /number=1
FT   intron          complement(756459..757059)
FT                   /gene="Pc20g03300"
FT                   /locus_tag="PCH_Pc20g03300"
FT                   /number=1
FT   exon            complement(757060..757493)
FT                   /gene="Pc20g03300"
FT                   /locus_tag="PCH_Pc20g03300"
FT                   /number=2
FT   mRNA            complement(join(<759272..760158,760211..760323,
FT                   760380..760569,760623..760694,760748..760814,
FT                   760890..761134,761217..>761223))
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT   CDS_pept        complement(join(759272..760158,760211..760323,
FT                   760380..760569,760623..760694,760748..760814,
FT                   760890..761134,761217..761223))
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /note="Title: strong similarity to sucrose transport
FT                   protein suc1 - Plantago major"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03310"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85660"
FT                   /db_xref="GOA:B6HFR2"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFR2"
FT                   /inference="similar to AA sequence:PIR:S52377"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /inference="protein motif:COGS:COG2211"
FT                   /protein_id="CAP85660.1"
FT                   /translation="MTYCTPYLLQLGLTKSKTSLVWIAGPLSGLIIQPLIGVIADRSRS
FT                   KWGRRRPFMVFGSLVVAFCLFVLGWTAEIVGLFVKDPEKAKNGTIALAVLSIYAVDFSI
FT                   NVVQACCRGLIVDTLPIPSQQAGSAWAGRMSAIGQLFAYVVGAIDTVSIFGTFLGDTQF
FT                   KQMTVIAALSLMLAVGVTSYSVKERVLISARDDGSAGAIQVLSQLFKTTFELPPRIQAI
FT                   CWAQFWAWIGWFPFLFYSTTWVGETYFRYEVPKDDMAKATDMLGEVGRVGSLSLTVFSF
FT                   ITVLSSVLLPFCIMQPDAKRTRFTARPPPKVAAILKAISAIRPDLQTAWLISHVMFAAT
FT                   MIFAPLAHSRAFATFLVAVCGIPWAISGWAPFAFMGVEINRLTMGGYYPTIPSSRSGVT
FT                   MITSASLRNSAADTELDVLRLNHHDPTDSDTDEEEQASNIPSTGELAGIYLGVLNVYTT
FT                   LPQFVGTFISWIVFSILEPGEEPANSNSDTQWMNLDKDRYNAISICLFIGAISALVAAE
FT                   ATRRLRYIL"
FT   exon            complement(759272..760158)
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /number=1
FT   intron          complement(760159..760210)
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /number=1
FT   exon            complement(760211..760323)
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /number=2
FT   intron          complement(760324..760379)
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /number=2
FT   exon            complement(760380..760569)
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /number=3
FT   intron          complement(760570..760622)
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /number=3
FT   exon            complement(760623..760694)
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /number=4
FT   intron          complement(760695..760747)
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /number=4
FT   exon            complement(760748..760814)
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /number=5
FT   intron          complement(760815..760889)
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /number=5
FT   exon            complement(760890..761134)
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /number=6
FT   intron          complement(761135..761216)
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /number=6
FT   exon            complement(761217..761223)
FT                   /gene="Pc20g03310"
FT                   /locus_tag="PCH_Pc20g03310"
FT                   /number=7
FT   mRNA            join(<761455..761601,761656..>761952)
FT                   /gene="Pc20g03320"
FT                   /locus_tag="PCH_Pc20g03320"
FT   CDS_pept        join(761455..761601,761656..761952)
FT                   /gene="Pc20g03320"
FT                   /locus_tag="PCH_Pc20g03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03320"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85661"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG20"
FT                   /protein_id="CAP85661.1"
FT                   /translation="MEGVPAHLAACGILIIHVLACTQLSSHEPKPESERAGGLASNRSK
FT                   LKTPGLGYVRDWERGRQVSNPFGELSRVLFSEPSGELAGAETVHGTLGVRCLLAVRILG
FT                   GGCVGCDGGADGCLYSCREASKGILRGKTLSQSKKKERKSALA"
FT   sig_peptide     761455..761526
FT                   /gene="Pc20g03320"
FT                   /locus_tag="PCH_Pc20g03320"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            761455..761601
FT                   /gene="Pc20g03320"
FT                   /locus_tag="PCH_Pc20g03320"
FT                   /number=1
FT   mat_peptide     join(761527..761601,761656..761949)
FT                   /gene="Pc20g03320"
FT                   /locus_tag="PCH_Pc20g03320"
FT   intron          761602..761655
FT                   /gene="Pc20g03320"
FT                   /locus_tag="PCH_Pc20g03320"
FT                   /number=1
FT   exon            761656..761952
FT                   /gene="Pc20g03320"
FT                   /locus_tag="PCH_Pc20g03320"
FT                   /number=2
FT   mRNA            complement(join(<762666..762778,762842..763498,
FT                   763555..763639,763694..763891,763961..764311,
FT                   764370..764390,764445..>764534))
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT   CDS_pept        complement(join(762666..762778,762842..763498,
FT                   763555..763639,763694..763891,763961..764311,
FT                   764370..764390,764445..764534))
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /note="unknown EC_number=1.1.1.49"
FT                   /note="Title: strong similarity to glucose-6-phosphat
FT                   1-dehydrogenase gsdA - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03330"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85662"
FT                   /db_xref="GOA:B6HG21"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG21"
FT                   /inference="similar to AA sequence:TREMBL:ANNGSDA.1"
FT                   /inference="protein motif:PFAM:PF00479"
FT                   /inference="protein motif:PFAM:PF02781"
FT                   /inference="protein motif:COGS:COG0364"
FT                   /protein_id="CAP85662.1"
FT                   /translation="MDMAFSTIELKDDTIIVVLGASGDLAKKKTFPALFGLFRNKFLPK
FT                   DIRIVGYARTKMDTDEYLKRVRSYIKVPTKEIEDQLDQFCKMCTYVSGQYDQDDSFINL
FT                   NKHLEEIENNRQSKEQNRVFYMALPPSVFTTVSDQLKRNCYPKSGLARIIVEKPFGKDL
FT                   QSSRDLQKALEPNWKEEEIFRIDHYLGKEMVKNILILRFGNEFFNATWNRRHIDNVQIT
FT                   FKEPFGTEGRGGYFDEFGIIRDVMQNHLLQVLTLLAMERPISFSSEDIRDEKVRVLRAM
FT                   DAIEPKNVIIGQYGRSLDGSKPGYLEDDTVPKESRCPTFCAMVAYIKNERWDGVPFILK
FT                   AGKALNEQKTEVRIQFKDVTSGIFKDIPRNELVIRVQPNESVYIKMNSKLPGLSMQTVV
FT                   TELDLTYRRRFSDLKIPEAYESLILDAFKGDHSNFVRDDELDASWRIFTPLLHYLDDNK
FT                   EIIPMEYPYGSRGPAVLDDFTASYGYKFSDAAGYQWPVTTSAPNRL"
FT   exon            complement(762666..762778)
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /number=1
FT   intron          complement(762779..762841)
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /number=1
FT   exon            complement(762842..763498)
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /number=2
FT   intron          complement(763499..763554)
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /number=2
FT   exon            complement(763555..763639)
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /number=3
FT   intron          complement(763640..763693)
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /number=3
FT   exon            complement(763694..763891)
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /number=4
FT   intron          complement(763892..763960)
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /number=4
FT   exon            complement(763961..764311)
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /number=5
FT   intron          complement(764312..764369)
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /number=5
FT   exon            complement(764370..764390)
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /number=6
FT   intron          complement(764391..764444)
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /number=6
FT   exon            complement(764445..764534)
FT                   /gene="Pc20g03330"
FT                   /locus_tag="PCH_Pc20g03330"
FT                   /number=7
FT   mRNA            join(<766904..766928,767062..767071,767214..767267,
FT                   767332..767474,767572..>767669)
FT                   /gene="Pc20g03340"
FT                   /locus_tag="PCH_Pc20g03340"
FT   CDS_pept        join(766904..766928,767062..767071,767214..767267,
FT                   767332..767474,767572..767669)
FT                   /gene="Pc20g03340"
FT                   /locus_tag="PCH_Pc20g03340"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit Rpl37b - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85663"
FT                   /db_xref="GOA:B6HG22"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="InterPro:IPR038661"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG22"
FT                   /inference="similar to AA sequence:SWISSPROT:R372_YEAST"
FT                   /inference="protein motif:PFAM:PF01247"
FT                   /inference="protein motif:COGS:COG2451"
FT                   /protein_id="CAP85663.1"
FT                   /translation="MPSEQGHRLYVKGRHLSFQRSKHALTQNTSLVKIEGVDDTKAAKF
FT                   YLGKKVAFVYRAKREVRGSNIRVIWGKVTRPHGNSGVVRAKFRNNLPPKSLGATVRVML
FT                   YPSNI"
FT   exon            766904..766928
FT                   /gene="Pc20g03340"
FT                   /locus_tag="PCH_Pc20g03340"
FT                   /number=1
FT   intron          766929..767061
FT                   /gene="Pc20g03340"
FT                   /locus_tag="PCH_Pc20g03340"
FT                   /number=1
FT   exon            767062..767071
FT                   /gene="Pc20g03340"
FT                   /locus_tag="PCH_Pc20g03340"
FT                   /number=2
FT   intron          767072..767213
FT                   /gene="Pc20g03340"
FT                   /locus_tag="PCH_Pc20g03340"
FT                   /number=2
FT   exon            767214..767267
FT                   /gene="Pc20g03340"
FT                   /locus_tag="PCH_Pc20g03340"
FT                   /number=3
FT   intron          767268..767331
FT                   /gene="Pc20g03340"
FT                   /locus_tag="PCH_Pc20g03340"
FT                   /number=3
FT   exon            767332..767474
FT                   /gene="Pc20g03340"
FT                   /locus_tag="PCH_Pc20g03340"
FT                   /number=4
FT   intron          767475..767571
FT                   /gene="Pc20g03340"
FT                   /locus_tag="PCH_Pc20g03340"
FT                   /number=4
FT   exon            767572..767669
FT                   /gene="Pc20g03340"
FT                   /locus_tag="PCH_Pc20g03340"
FT                   /number=5
FT   mRNA            complement(join(<768446..768466,768554..768577,
FT                   768621..>769349))
FT                   /gene="Pc20g03350"
FT                   /locus_tag="PCH_Pc20g03350"
FT   CDS_pept        complement(join(768446..768466,768554..768577,
FT                   768621..769349))
FT                   /gene="Pc20g03350"
FT                   /locus_tag="PCH_Pc20g03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85664"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG23"
FT                   /protein_id="CAP85664.1"
FT                   /translation="MAWSTRNSIIPESSFPWSDGELENWRTEYLKQPETLFMSPSPDPS
FT                   TTTRTPTARPPSYNYQQQLPSNQLPSAQFPSTPVALGTMLSPTPSSSYLDPSTIKRSIS
FT                   NHSPRSVPTQATATVLSPASLYDVRCPSPWDDLPVSTPIIKETLQSESDEVRTEPSQTK
FT                   MPCLTRRRTTKRKCVFCSLLKAIMSIRMLNICRLEKPRITELSNANGRTVNMTVCSRAK
FT                   VCSSGTFRHSISILGLSSVPGTIDSQGNVWSSDWI"
FT   exon            complement(768446..768466)
FT                   /gene="Pc20g03350"
FT                   /locus_tag="PCH_Pc20g03350"
FT                   /number=1
FT   intron          complement(768467..768553)
FT                   /gene="Pc20g03350"
FT                   /locus_tag="PCH_Pc20g03350"
FT                   /number=1
FT   exon            complement(768554..768577)
FT                   /gene="Pc20g03350"
FT                   /locus_tag="PCH_Pc20g03350"
FT                   /number=2
FT   intron          complement(768578..768620)
FT                   /gene="Pc20g03350"
FT                   /locus_tag="PCH_Pc20g03350"
FT                   /number=2
FT   exon            complement(768621..769349)
FT                   /gene="Pc20g03350"
FT                   /locus_tag="PCH_Pc20g03350"
FT                   /number=3
FT   mRNA            join(<771693..771790,771850..772083,772143..773887,
FT                   773946..>774676)
FT                   /gene="Pc20g03360"
FT                   /locus_tag="PCH_Pc20g03360"
FT   CDS_pept        join(771693..771790,771850..772083,772143..773887,
FT                   773946..774676)
FT                   /gene="Pc20g03360"
FT                   /locus_tag="PCH_Pc20g03360"
FT                   /note="Title: strong similarity to hypothetical
FT                   oxidoreductase - Streptomyces coelicolor"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03360"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85665"
FT                   /db_xref="GOA:B6HG24"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG24"
FT                   /inference="similar to AA sequence:TREMBL:SCO939131.123"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /inference="protein motif:PFAM:PF01568"
FT                   /inference="protein motif:COGS:COG0243"
FT                   /inference="protein motif:COGS:COG3383"
FT                   /protein_id="CAP85665.1"
FT                   /translation="MDIGVRDGKVVGVRGRVSDRVNKGRLGPKGLHGWASINHADRLKH
FT                   PLIRRNGKLERASWDEAMSLIVDKAHEVQSRLSNHGIGFYTSGQLFLEEYYVLAMVGKA
FT                   GLNTLHMDGNTRLCTATAAASMRESFGSDGQPGSYSDIDYTDCLFLVGHNMAHTQTVLW
FT                   SRVLDRLQGPQPPKLIVVDPRRSDTAKQADVHLAPKNGTNVALLNGLQYLLFSNGWINE
FT                   DYVSKHVVGLEDLRTVVNRYTPDVVERITGVPVTQLHQAAEILGTTSSLLSTALQGVYQ
FT                   SNQATASACQINNINLLLGLIGKPGSGILQMNGQPTAQNNRETGCDGEYPGFRNFQNPT
FT                   HIQEIADIWNIEPVKVPHWNLPTHVENMLKYISDGSIKMFWISGTNPLVSLPHLQKVRE
FT                   LLTKPELFVVTQDIFLTETAAISDVVLPAAQWGEKTGCFTNADRTMHLSQKAVEPPGQS
FT                   KADMDIWLDFARRMDFQDKDGKPLIPFTSAEEVFNAWRKMSCGRPLDCTEMSYQKLAGG
FT                   SGIQWPCTSVYPQGKERLFDDAKFFTDTAYCESYGHDLETGAPFTKSQYEAMNPAGRAI
FT                   LKAAHYQLPLEETSEQYPLRLTTGRNVYQFHTRTKTGRSKRLQEAYPEPVIQVSIADAD
FT                   ALHLVDGEMVVVRSRRGSVELPVVIGDITEGHVFIPFHFGYFDATDDRARAANELTREQ
FT                   WDPVSKQPMFKSGAVRIEKCVQIEGGKTNHAKEKHTEAVRSVEKGKGMAEPADENGGHT
FT                   GNKEPVRRLELWMGALNEGLEILVEIYRDLVPRLVHDLEVQSGLEVMRRLTTEVLHQFK
FT                   PVIDRYHGSHQYGRTVAQYLQKAVFPAVEETNDPYEALAALQSLDLFLTYIEGHLTALS
FT                   PASQALWDSEFVNVISSAQGSIQRQKAWVNQHIKVKSPQTLLVPTVAAEDLYDSQSSMA
FT                   GRIRS"
FT   exon            771693..771790
FT                   /gene="Pc20g03360"
FT                   /locus_tag="PCH_Pc20g03360"
FT                   /number=1
FT   intron          771791..771849
FT                   /gene="Pc20g03360"
FT                   /locus_tag="PCH_Pc20g03360"
FT                   /number=1
FT   exon            771850..772083
FT                   /gene="Pc20g03360"
FT                   /locus_tag="PCH_Pc20g03360"
FT                   /number=2
FT   intron          772084..772142
FT                   /gene="Pc20g03360"
FT                   /locus_tag="PCH_Pc20g03360"
FT                   /number=2
FT   exon            772143..773887
FT                   /gene="Pc20g03360"
FT                   /locus_tag="PCH_Pc20g03360"
FT                   /number=3
FT   intron          773888..773945
FT                   /gene="Pc20g03360"
FT                   /locus_tag="PCH_Pc20g03360"
FT                   /number=3
FT   exon            773946..774676
FT                   /gene="Pc20g03360"
FT                   /locus_tag="PCH_Pc20g03360"
FT                   /number=4
FT   mRNA            <775155..>775934
FT                   /gene="Pc20g03370"
FT                   /locus_tag="PCH_Pc20g03370"
FT   CDS_pept        775155..775934
FT                   /pseudo
FT                   /gene="Pc20g03370"
FT                   /locus_tag="PCH_Pc20g03370"
FT                   /note="submitted as non-pseudo"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_168_scaffold_14.tfa_490cg - Aspergillus nidulans"
FT                   /inference="protein motif:COGS:COG0746"
FT                   /inference="protein motif:COGS:COG1207"
FT   exon            775155..775934
FT                   /gene="Pc20g03370"
FT                   /locus_tag="PCH_Pc20g03370"
FT                   /number=1
FT   mRNA            complement(join(<776090..776103,776150..>777344))
FT                   /gene="Pc20g03380"
FT                   /locus_tag="PCH_Pc20g03380"
FT   CDS_pept        complement(join(776090..776103,776150..777344))
FT                   /gene="Pc20g03380"
FT                   /locus_tag="PCH_Pc20g03380"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   ncu09417.1 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85667"
FT                   /db_xref="GOA:B6HG25"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG25"
FT                   /inference="protein motif:PFAM:PF03453"
FT                   /inference="protein motif:PFAM:PF00994"
FT                   /inference="protein motif:COGS:COG0303"
FT                   /protein_id="CAP85667.1"
FT                   /translation="MALSYHEALRMVEAEAQRRARTLQLNMEKLPLNLSLNRVTGCEMR
FT                   SPISTPQYDTSAMDGYAVDSGATRDASPDNPILFHVEGLVAAGNEPFPLFNTASQSCSC
FT                   VEIMTGGRFPTAVEPDNVRLDCCVKFEDTKKVPGPYTGDEYIEITKPARYRQNRRSAGE
FT                   DFQRHHVIMPAGTIIRPHHIMALASVGITEIAVLPKLRVGLYSTGAELLASHGNQPVTG
FT                   RVEDANGPYIAAALADSGVDVEFLGILDDDVEMMMHTLRSNLEKKDCDLIISTGAVSTG
FT                   RFDLIPSALQRLGAHIVFHKIGIRPGHPVMFATVPNISPERSDEIPFFGLPGNPVASAA
FT                   CLRFLVMHYLKCLQSQLPETPLTARMSCPNDAKTARQSAHVITSFPSEKDVFRPGVFHS
FT                   LEK"
FT   exon            complement(776090..776103)
FT                   /gene="Pc20g03380"
FT                   /locus_tag="PCH_Pc20g03380"
FT                   /number=1
FT   intron          complement(776104..776149)
FT                   /gene="Pc20g03380"
FT                   /locus_tag="PCH_Pc20g03380"
FT                   /number=1
FT   exon            complement(776150..777344)
FT                   /gene="Pc20g03380"
FT                   /locus_tag="PCH_Pc20g03380"
FT                   /number=2
FT   mRNA            complement(join(<777936..778137,778205..>778671))
FT                   /gene="Pc20g03390"
FT                   /locus_tag="PCH_Pc20g03390"
FT   CDS_pept        complement(join(777936..778137,778205..778671))
FT                   /gene="Pc20g03390"
FT                   /locus_tag="PCH_Pc20g03390"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An12g03400 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03390"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85668"
FT                   /db_xref="GOA:B6HG26"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG26"
FT                   /inference="protein motif:COGS:COG5048"
FT                   /protein_id="CAP85668.1"
FT                   /translation="MAGPPHHVPLSASGTPGQDESTRDLYLPYGYAAHQYPPSLAAEPS
FT                   TFSENHLLYNTLMQHSSAPVHLSYSMPFSSAHGTFNPASHNMAHHPSSENNTPSDPSTM
FT                   GYISSGYSTACTTPLGSGRSSPSMQEIPQSSVSRPEVPTICGRGRAHRPKHDELYGMYQ
FT                   CNWKDCKYRGMFSRKGVLMRHIETQHVAPHSFDCPVCGKLFCRRDNMTEHLGKVQCQRV
FT                   "
FT   exon            complement(777936..778137)
FT                   /gene="Pc20g03390"
FT                   /locus_tag="PCH_Pc20g03390"
FT                   /number=1
FT   intron          complement(778138..778204)
FT                   /gene="Pc20g03390"
FT                   /locus_tag="PCH_Pc20g03390"
FT                   /number=1
FT   exon            complement(778205..778671)
FT                   /gene="Pc20g03390"
FT                   /locus_tag="PCH_Pc20g03390"
FT                   /number=2
FT   mRNA            complement(join(<779515..779618,780107..780235,
FT                   780306..780495,780588..780797,780883..>781218))
FT                   /gene="Pc20g03400"
FT                   /locus_tag="PCH_Pc20g03400"
FT   CDS_pept        complement(join(779515..779618,780107..780235,
FT                   780306..780495,780588..780797,780883..781218))
FT                   /gene="Pc20g03400"
FT                   /locus_tag="PCH_Pc20g03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85669"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG27"
FT                   /protein_id="CAP85669.1"
FT                   /translation="MTASPPSTSGTSTSTCNPYGSFLRGILAEISAMRGLRISRYYAEP
FT                   GRGYTPSDKSGRDCGADQLVALRSWVTIQCISFPRTRLAVERWIRRGALLRMLKVARVS
FT                   IDFTVEDVRRIMAKTANTATSRTSPARLYELRTSYSYIPLPAREHTQIAFAVHKAIDKA
FT                   LARMGLDEATHDYLGVDIDQIGIQQDLHLWRYPRPSRPSRQNDLLNKHIVHPSIGNVGE
FT                   NLGLQAELQSGGSYFAAVFEDTARLSIGELRVRQGTSFIATRKEGELFYPAATGKELLK
FT                   YLGWGSPCTRSKEYGPYDQVIGRVVASAKVTGTKEIETARL"
FT   exon            complement(779515..779618)
FT                   /gene="Pc20g03400"
FT                   /locus_tag="PCH_Pc20g03400"
FT                   /number=1
FT   intron          complement(779619..780106)
FT                   /gene="Pc20g03400"
FT                   /locus_tag="PCH_Pc20g03400"
FT                   /number=1
FT   exon            complement(780107..780235)
FT                   /gene="Pc20g03400"
FT                   /locus_tag="PCH_Pc20g03400"
FT                   /number=2
FT   intron          complement(780236..780305)
FT                   /gene="Pc20g03400"
FT                   /locus_tag="PCH_Pc20g03400"
FT                   /number=2
FT   exon            complement(780306..780495)
FT                   /gene="Pc20g03400"
FT                   /locus_tag="PCH_Pc20g03400"
FT                   /number=3
FT   intron          complement(780496..780587)
FT                   /gene="Pc20g03400"
FT                   /locus_tag="PCH_Pc20g03400"
FT                   /number=3
FT   exon            complement(780588..780797)
FT                   /gene="Pc20g03400"
FT                   /locus_tag="PCH_Pc20g03400"
FT                   /number=4
FT   intron          complement(780798..780882)
FT                   /gene="Pc20g03400"
FT                   /locus_tag="PCH_Pc20g03400"
FT                   /number=4
FT   exon            complement(780883..781218)
FT                   /gene="Pc20g03400"
FT                   /locus_tag="PCH_Pc20g03400"
FT                   /number=5
FT   mRNA            join(<781313..781391,781523..781635,781721..781895,
FT                   781971..782179,782310..782360,782425..782524,
FT                   782647..782905,783080..>783266)
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT   CDS_pept        join(781313..781391,781523..781635,781721..781895,
FT                   781971..782179,782310..782360,782425..782524,
FT                   782647..782905,783080..783266)
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85670"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG28"
FT                   /protein_id="CAP85670.1"
FT                   /translation="MTYFSKCQNSLQYKQSAAAFPARAWVATTSSSLPLCLRHAGRPCG
FT                   SVDLGLNCAFSSIKAPASSVCLTNVCTTDNAINVKEANAHGPGAIVLQAACEDLPPSLD
FT                   AHAALTIATCVVAVNFLSGSFSTTAALIRWSRTAENNRIAHLFLVPTFPSRLIRRGSGL
FT                   VHRTGGRMLEVFNDVEKQASPISIDGRRSVFELALGGTRRWPDPSRALRRRTLRATVFL
FT                   SSPFTTLGRIDELQGFSHGSGQLVRETHSTWWGDPFSVVITGDRRREWCARAVQGARWI
FT                   YPGWVRIVTTRALSWSLGRLQLVECRSSLAWPAASAHWSQPSKIESPKLARMRISVSAA
FT                   PMQRMSPISSSVDWVPLFIHAELACFLYLRLGLHNEGYQSLEDAGTYGCD"
FT   exon            781313..781391
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=1
FT   intron          781392..781522
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=1
FT   exon            781523..781635
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=2
FT   intron          781636..781720
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=2
FT   exon            781721..781895
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=3
FT   intron          781896..781970
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=3
FT   exon            781971..782179
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=4
FT   intron          782180..782309
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=4
FT   exon            782310..782360
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=5
FT   intron          782361..782424
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=5
FT   exon            782425..782524
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=6
FT   intron          782525..782646
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=6
FT   exon            782647..782905
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=7
FT   intron          782906..783079
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=7
FT   exon            783080..783266
FT                   /gene="Pc20g03410"
FT                   /locus_tag="PCH_Pc20g03410"
FT                   /number=8
FT   mRNA            complement(join(<783889..784197,784270..>784272))
FT                   /gene="Pc20g03420"
FT                   /locus_tag="PCH_Pc20g03420"
FT   CDS_pept        complement(join(783889..784197,784270..784272))
FT                   /gene="Pc20g03420"
FT                   /locus_tag="PCH_Pc20g03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85671"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG29"
FT                   /protein_id="CAP85671.1"
FT                   /translation="MFNYILHCPHSIYTSTKDAYSQWVSSRSSLVVPGDLAVNFDSEWA
FT                   KLSVESSHYPRLRAAEESARSWYTGVVAFRQDVRDLVDDFELGVAVGPFLQSHLANFP"
FT   exon            complement(783889..784197)
FT                   /gene="Pc20g03420"
FT                   /locus_tag="PCH_Pc20g03420"
FT                   /number=1
FT   intron          complement(784198..784269)
FT                   /gene="Pc20g03420"
FT                   /locus_tag="PCH_Pc20g03420"
FT                   /number=1
FT   exon            complement(784270..784272)
FT                   /gene="Pc20g03420"
FT                   /locus_tag="PCH_Pc20g03420"
FT                   /number=2
FT   mRNA            complement(join(<785678..786905,786956..787266,
FT                   787421..>787651))
FT                   /gene="Pc20g03430"
FT                   /locus_tag="PCH_Pc20g03430"
FT   CDS_pept        complement(join(785678..786905,786956..787266,
FT                   787421..787651))
FT                   /gene="Pc20g03430"
FT                   /locus_tag="PCH_Pc20g03430"
FT                   /note="Title: strong similarity to hypothetical membrane
FT                   transport protein SPAC3H1.06c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85672"
FT                   /db_xref="GOA:B6HG30"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG30"
FT                   /inference="similar to AA sequence:PIR:T38738"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP85672.1"
FT                   /translation="MTSERQQPDAASSNTEIDHANVEKPLDTPEQENEAAQPSDAENVP
FT                   EQPTEGAPLDQAPSQAAKMSKNKIIVVMTALCTIISTALPTIAAQFGASESGFSWIASS
FT                   YLLANAACIPLWGKISDIWGRKSIIVLANVVFLVGSLVCALAHNMTTIIAGRAVQGVGG
FT                   GGILILANISVSDLFSLRDRPMYYGLFGATWAVAGALGPVIGGAFTTNVTWRWCFYLNL
FT                   PVGGVSLLILILFLHIESPKTPFWAGMRCIDWTGTFLIIGGTLMFLFGLEFGGVNYPWD
FT                   SPTVICLIVFGVFTWALAMFLEWKVAKFPIIPPRLFNEWYNVLILLVCFCHGFTFIAAT
FT                   YYLPLYFQTVLQASPILSGVYVLPLVLSLAVGSMITGAVMKKTGRFREMIIGGMTLMAL
FT                   GFGLFIDLKVYASWPRIIIYQLIAGLGIGPNFQAPLVAFQANIRPADMATATATFGFVR
FT                   QLSTSMSVVLGTVIYQNIMGQQSAKLIASLGPETAAAISSSFGGSSKSLIESLTPSQRD
FT                   VVLGAYTHALNRMWIFYTATACLGFVLALFIRRRELTRHHTVQKTGLAEQERARQELID
FT                   SQRKANSKPETEA"
FT   exon            complement(785678..786905)
FT                   /gene="Pc20g03430"
FT                   /locus_tag="PCH_Pc20g03430"
FT                   /number=1
FT   intron          complement(786906..786955)
FT                   /gene="Pc20g03430"
FT                   /locus_tag="PCH_Pc20g03430"
FT                   /number=1
FT   exon            complement(786956..787266)
FT                   /gene="Pc20g03430"
FT                   /locus_tag="PCH_Pc20g03430"
FT                   /number=2
FT   intron          complement(787267..787420)
FT                   /gene="Pc20g03430"
FT                   /locus_tag="PCH_Pc20g03430"
FT                   /number=2
FT   exon            complement(787421..787651)
FT                   /gene="Pc20g03430"
FT                   /locus_tag="PCH_Pc20g03430"
FT                   /number=3
FT   mRNA            join(<788016..788104,788308..788547,788606..788729,
FT                   788784..>788885)
FT                   /gene="Pc20g03440"
FT                   /locus_tag="PCH_Pc20g03440"
FT   CDS_pept        join(788016..788104,788308..788547,788606..788729,
FT                   788784..788885)
FT                   /gene="Pc20g03440"
FT                   /locus_tag="PCH_Pc20g03440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85673"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG31"
FT                   /protein_id="CAP85673.1"
FT                   /translation="MARAQYLGSYQPPLTSTLPTILSTQVAISPAWSSSSSREVRAAPL
FT                   VGFSSVVQLPLLRGLDSLAAGEVGGLLTAELLDCGSGGLQAKRGVAGELPQGLAYHHGT
FT                   ESTYHGGAHVRGAGEIGVETLCFALADKIYQYLPANEGLIGAKVDGNANVPQRANLHSS
FT                   REYAPFENKTFNGGAGSDANC"
FT   sig_peptide     join(788016..788104,788308..788317)
FT                   /gene="Pc20g03440"
FT                   /locus_tag="PCH_Pc20g03440"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            788016..788104
FT                   /gene="Pc20g03440"
FT                   /locus_tag="PCH_Pc20g03440"
FT                   /number=1
FT   intron          788105..788307
FT                   /gene="Pc20g03440"
FT                   /locus_tag="PCH_Pc20g03440"
FT                   /number=1
FT   exon            788308..788547
FT                   /gene="Pc20g03440"
FT                   /locus_tag="PCH_Pc20g03440"
FT                   /number=2
FT   mat_peptide     join(788318..788547,788606..788729,788784..788882)
FT                   /gene="Pc20g03440"
FT                   /locus_tag="PCH_Pc20g03440"
FT   intron          788548..788605
FT                   /gene="Pc20g03440"
FT                   /locus_tag="PCH_Pc20g03440"
FT                   /number=2
FT   exon            788606..788729
FT                   /gene="Pc20g03440"
FT                   /locus_tag="PCH_Pc20g03440"
FT                   /number=3
FT   intron          788730..788783
FT                   /gene="Pc20g03440"
FT                   /locus_tag="PCH_Pc20g03440"
FT                   /number=3
FT   exon            788784..788885
FT                   /gene="Pc20g03440"
FT                   /locus_tag="PCH_Pc20g03440"
FT                   /number=4
FT   mRNA            <789927..>791600
FT                   /gene="Pc20g03450"
FT                   /locus_tag="PCH_Pc20g03450"
FT   CDS_pept        789927..791600
FT                   /gene="Pc20g03450"
FT                   /locus_tag="PCH_Pc20g03450"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An14g07160 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85674"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG32"
FT                   /protein_id="CAP85674.1"
FT                   /translation="MVHIHDLPIELLHLILSFFVSPDELELLSGDQARKAKDGKAHQLD
FT                   DEEYDDDEPDGIETLYNTCLVSRKFREVAQPLLFRELFDDGLTGGLTPTVPFIRTIYRR
FT                   PDLGKHVHQISILPFPFVSGDRKHLSADDSEPFKGGIKDLGLGDQEEAWTSALEESDLG
FT                   ILAALLANKAPNLRGLHLPVRYFWIEPFIQLFHLNPQFLSNLESIWIESDDEMSGFDIA
FT                   FYEKFLTLPKVRFSTFEYGDLFDESFPSTWLPGTLETQELAFHHCHIDAGAIKKLMQAC
FT                   KKLRTFTYNNFSLDPNDRRIMRAGTVPEFDANQAHEAALVQKDTLELFHLEYAMELPDV
FT                   EHIEQLVSSHVKVGSFRDFSVLHTILIPHAALPVHPQLPSSLRRLHITDCNSSIRELTQ
FT                   NIAADCKNGLYPKLTHIKVFAIDITQPIKLPGQRIPEGKTPEQCFLALQDMFKGTKVNF
FT                   RILPYELPDFDDYDDLDLDYDEDLGFEEDFLEPGFEEHPPGADPGSGPIPPRLLDLLMQ
FT                   RAMMDPEFAHLRPDEGGDGDSWETDDDDDSWESDDSDSGN"
FT   exon            789927..791600
FT                   /gene="Pc20g03450"
FT                   /locus_tag="PCH_Pc20g03450"
FT                   /number=1
FT   mRNA            complement(join(<791981..792988,793042..793060,
FT                   793126..>793166))
FT                   /gene="Pc20g03460"
FT                   /locus_tag="PCH_Pc20g03460"
FT   CDS_pept        complement(join(791981..792988,793042..793060,
FT                   793126..793166))
FT                   /gene="Pc20g03460"
FT                   /locus_tag="PCH_Pc20g03460"
FT                   /note="Title: strong similarity to calcium-binding protein
FT                   like protein An02g12230 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85675"
FT                   /db_xref="GOA:B6HGE4"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE4"
FT                   /inference="protein motif:PFAM:PF00036"
FT                   /inference="protein motif:COGS:COG5126"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP85675.1"
FT                   /translation="MAYNKSYNPDALPAHAEPEQVAQMLGNMNVSGQSHTSSHAPSHNQ
FT                   KPLPSRPPPQTSHSSGVPPRVPVSSAPPQHAYAAAPPRLDPQPHHSHSHSHSYGGRSSS
FT                   AHAPPPSQAPVHSQARPHPLHPSPPPQNYGFGPPPVHPQRNRPPPSSRPPQSPVPPPLT
FT                   APSDDPQQLFPLFRAANASHSGALTEGELGSALVNGDYTSFHPRTVRLMIRMFDRDGSG
FT                   TISFDEFVSLWRYLAAWRELFDRFDEDRSGRVSQPEFEKALVAFGYRLSGKFISVIFGV
FT                   FEGKAKQMSNAPKDARPPGMSFDLFVQACISLKRMTDVFKRYDEDRDGYITLSFEEALT
FT                   GKSCCSLCCCWGVSR"
FT   exon            complement(791981..792988)
FT                   /gene="Pc20g03460"
FT                   /locus_tag="PCH_Pc20g03460"
FT                   /number=1
FT   intron          complement(792989..793041)
FT                   /gene="Pc20g03460"
FT                   /locus_tag="PCH_Pc20g03460"
FT                   /number=1
FT   exon            complement(793042..793060)
FT                   /gene="Pc20g03460"
FT                   /locus_tag="PCH_Pc20g03460"
FT                   /number=2
FT   intron          complement(793061..793125)
FT                   /gene="Pc20g03460"
FT                   /locus_tag="PCH_Pc20g03460"
FT                   /number=2
FT   exon            complement(793126..793166)
FT                   /gene="Pc20g03460"
FT                   /locus_tag="PCH_Pc20g03460"
FT                   /number=3
FT   mRNA            join(<793877..795150,795203..>797138)
FT                   /gene="Pc20g03470"
FT                   /locus_tag="PCH_Pc20g03470"
FT   CDS_pept        join(793877..795150,795203..797138)
FT                   /gene="Pc20g03470"
FT                   /locus_tag="PCH_Pc20g03470"
FT                   /note="Title: weak similarity to erythrocyte splice form 1
FT                   of ankyrin ANK1 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85676"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031348"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE5"
FT                   /inference="protein motif:COGS:COG0666"
FT                   /protein_id="CAP85676.1"
FT                   /translation="MADPLSIASGVAGLLSLGVQVTKSLVDFYSAYKDQTPALAKITLN
FT                   LENLLGILQALDDARQHGQPQMDALVQEIDKAAVGCREIIEELSEECKKFQKDTALGLK
FT                   ARLQFVGRRATYPFRESTLKKLEEDIGEIRENLSLALNVLQLRNQTGLEYGISELKLLV
FT                   ERMNTIQISTTIRDWLRAPDATIDHNAACEKRHTSTGLWLVNGQKFQNWLVERNSFLWV
FT                   NGFAGCGKSVLCSTAIQYTVRERQHQPSVGIGFFYFSFNDESKRDCSGMLRALLLQLSA
FT                   QLQGAEGDIQELFKLYSSGTPPVKALLSSLRKTICRFNDTYILLDALDESPRGNKREGV
FT                   LDAVQTIRQWGLPTLHLLVTSRNEMDIRLTLEPPSSQDISMKNSDTDTDIQNFISYQLR
FT                   NDSKLRQWKSRHEEIQEKLTSKAQGVFRYVECQLLALKRARIRNHIDGCLRSLPRDLDE
FT                   TYERMLCSIDEQDAPEARLALTLLCVSDRPLTVEELIGALAIDVSKWQLDREGRSFSQD
FT                   HLLDICLGLIELAVVENEYSGEVSTIARIAHFSVQEYLKSDRISQQGAAKFAVQEELAE
FT                   TEMARVCLVYLLDPTLSDVESNEAMLEMFPLADFAAMEWSYFYKNSGKGKSDIKPLVLR
FT                   LFMDQPESFVTWVRVHDIDIGSPPMDLKRENIPPPLYYAIFLRLEFVFTAIIASFTEKI
FT                   TIDATLNTQEVVHEDVAQTMLDCRVGVNAQGGYYGNALQAASCGLFGDSVEEEDRQWEA
FT                   VEKMMQTLLDHGADVNAQGGIYGNALQAASYAGRERAVQTLLDHGADVNAYGGVYQTAL
FT                   QAASNPGHEALVRILLDRGADVNAREGTDASALEVASYYGHEKVVQILLDRGANINRDD
FT                   EYANALVFASYGGREKVVQMLLDRGSDVYVQEDLCKALEAASREGKEQVVQILLDRGAD
FT                   IDAQADGEYGNALQAASYAGQDKVVRMLLDRGADINTQGGDYGNALQAASWDGQEKVVQ
FT                   ILLDRGADVNAQGGGKYGNALQVASYMGHEKVVQILLHHGADVSAEGGENGNALRAALQ
FT                   EGHEKLVQILLDNGAKPEPIV"
FT   sig_peptide     793877..793948
FT                   /gene="Pc20g03470"
FT                   /locus_tag="PCH_Pc20g03470"
FT                   /inference="protein motif:SignalP:2.0"
FT   exon            793877..795150
FT                   /gene="Pc20g03470"
FT                   /locus_tag="PCH_Pc20g03470"
FT                   /number=1
FT   mat_peptide     join(793949..795150,795203..797135)
FT                   /gene="Pc20g03470"
FT                   /locus_tag="PCH_Pc20g03470"
FT   intron          795151..795202
FT                   /gene="Pc20g03470"
FT                   /locus_tag="PCH_Pc20g03470"
FT                   /number=1
FT   exon            795203..797138
FT                   /gene="Pc20g03470"
FT                   /locus_tag="PCH_Pc20g03470"
FT                   /number=2
FT   mRNA            complement(join(<797383..797518,797572..>798452))
FT                   /gene="Pc20g03480"
FT                   /locus_tag="PCH_Pc20g03480"
FT   CDS_pept        complement(join(797383..797518,797572..798452))
FT                   /gene="Pc20g03480"
FT                   /locus_tag="PCH_Pc20g03480"
FT                   /note="Title: similarity to alcohol dehydrogenase pan2 -Mus
FT                   musculus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85677"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE6"
FT                   /inference="similar to AA sequence:TREMBLNEW:BC020094.1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /inference="protein motif:COGS:COG1028"
FT                   /protein_id="CAP85677.1"
FT                   /translation="MAGLLRLLKMQYTPPIDPKNVSFAGKIVILTGATSGLGFEAAIKI
FT                   LNLGVESLIIGSRSVEKGNKAKADLEKTTNRRNVVKVWELEMNSFQSVKGFAERVNRDL
FT                   DRVDIALLNAGLWNREYNQSPEGWEETLQVNTLSTSMLALLLLPKLKKSSYAENPAHLT
FT                   VVSSQQFVRVKPESVRTDDALLAHVNDPENFKGPKQYGISKLLLEYMMKHIANMVRDDD
FT                   GTHTLIVNTVSPGLCISALGRQYTHWWEKCCVWVLHRLFARSTEQGSRSLVSATLLGIE
FT                   SQGKCWRSEGYLDESAALTTGLEGEELQEKAWEEIISVLEVQAPEVSLISRGLYQGV"
FT   exon            complement(797383..797518)
FT                   /gene="Pc20g03480"
FT                   /locus_tag="PCH_Pc20g03480"
FT                   /number=1
FT   intron          complement(797519..797571)
FT                   /gene="Pc20g03480"
FT                   /locus_tag="PCH_Pc20g03480"
FT                   /number=1
FT   exon            complement(797572..798452)
FT                   /gene="Pc20g03480"
FT                   /locus_tag="PCH_Pc20g03480"
FT                   /number=2
FT   mRNA            complement(<798923..>801571)
FT                   /gene="Pc20g03490"
FT                   /locus_tag="PCH_Pc20g03490"
FT   CDS_pept        complement(798923..801571)
FT                   /gene="Pc20g03490"
FT                   /locus_tag="PCH_Pc20g03490"
FT                   /note="Title: similarity to hypothetical protein An13g01490
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85678"
FT                   /db_xref="GOA:B6HGE7"
FT                   /db_xref="InterPro:IPR021840"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE7"
FT                   /protein_id="CAP85678.1"
FT                   /translation="MSIKIPSLSKLINLSCKRGDTPSQLQQIEPDIPGWQPSYLRRRVL
FT                   IIFVITFCGVIAALEALNHVSQVRNGLASSDESRHYLWTYGPTAIFTIIATLWSRVEFQ
FT                   VKQRAPWKSMAEKPGEAGESVLLDYLSEMQVISMAKAIRNRHFDVAAGIACSMLLRLLV
FT                   IFSTALFSLKKAQIHQSSATGQAIVDGNRIVMAQVSLRVIEVCLILGILLAVAMIFLGP
FT                   RTTIAPWNPTSILSVATIMAKSNEICRSLRGRGASPLDALHHSLKERRYYSQHTPKGFL
FT                   IETEGVDTRKFDTQENHILPWAPFPGLIARSVIFGAVALLIAALEIALRVSQKNDGLTN
FT                   VSSNVHQHCLFTIISSLVMLSIGLLFERVDFNTRTLAPYAQLKRPTGALFEESMAVNYL
FT                   DSIPTTNIIRSIRARHFAVLATTSATLITSFLVITASGLYSAMEVPYQISVNFTQESTF
FT                   FRANSADAGQIPSMAVAKHILRKNMTFPRWTYDELAFPKLSMDMPLSNNERESLFVDIR
FT                   TPALRAAPACYFQTGSELRWNFTKVSYGDEPTYQLRVLAPNMPCSLAYQDMGSTSLTPS
FT                   LAVLNSQGLFGQSSRLPCGNIYNTKPATLYIWGNIQNDSAENISAMTCVEAAETVDTLT
FT                   RFYLPGFDIIDEHPPIPDESSTRSAPDIDIPWISWNNFNTKDATAKRSNLDAFFTALIM
FT                   GKYAISAEHLLDPDSSDMVIKAINHQDRILKAQAFNTYFRSAADGTLDHAPLPGNITMS
FT                   NRLRLLQDAASTRILQALLTSILVLGVVGSIVMNTDHILPKNPSSIGAVGSLLADSNLL
FT                   ARYEKGMGDPNEQSLGPASFSRCRFYLGFQGNASHQEIRGSCRKTTVVRSTVYTIRSEV
FT                   VRRCWATGRCG"
FT   exon            complement(798923..801571)
FT                   /gene="Pc20g03490"
FT                   /locus_tag="PCH_Pc20g03490"
FT                   /number=1
FT   mRNA            join(<802415..802509,802588..802619,802726..802775,
FT                   802866..802870,802948..803032,803086..>803613)
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT   CDS_pept        join(802415..802509,802588..802619,802726..802775,
FT                   802866..802870,802948..803032,803086..803613)
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPBC31F10.03 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85679"
FT                   /db_xref="GOA:B6HGE8"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE8"
FT                   /inference="similar to AA sequence:PIR:T40206"
FT                   /inference="protein motif:PFAM:PF04752"
FT                   /inference="protein motif:COGS:COG3703"
FT                   /protein_id="CAP85679.1"
FT                   /translation="MAAIAQGHKVHPDGRTWKSHFPKGDLWVFGYGSLIWKPPPHYDQR
FT                   IPGYISGYVRRFWQASTDHRGTPEQPGRVVTVIERTFWETLDDPIAHLESELSSTGKVW
FT                   GAAYHIPASHAEEVHDYLDEREIDGYSAHYTPFHPTVDVEGAGDSTGSSPIICMVYIGQ
FT                   PTNPQFLRDAAHREPQHVAQVISAGHGLSGKGSEYLFMLEKGLEGLGLGTADVHVTDLV
FT                   KRVKAIEAELAEAEEEEAEIKVTRSLEIPAEEVDRDGRETIE"
FT   exon            802415..802509
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT                   /number=1
FT   intron          802510..802587
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT                   /number=1
FT   exon            802588..802619
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT                   /number=2
FT   intron          802620..802725
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT                   /number=2
FT   exon            802726..802775
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT                   /number=3
FT   intron          802776..802865
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT                   /number=3
FT   exon            802866..802870
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT                   /number=4
FT   intron          802871..802947
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT                   /number=4
FT   exon            802948..803032
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT                   /number=5
FT   intron          803033..803085
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT                   /number=5
FT   exon            803086..803613
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT                   /number=6
FT   mRNA            complement(join(<804799..805063,805122..805228,
FT                   805295..>805378))
FT                   /gene="Pc20g03510"
FT                   /locus_tag="PCH_Pc20g03510"
FT   CDS_pept        complement(join(804799..805063,805122..805228,
FT                   805295..805378))
FT                   /gene="Pc20g03510"
FT                   /locus_tag="PCH_Pc20g03510"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_51_scaffold_3.tfa_1450cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85680"
FT                   /db_xref="GOA:B6HGE9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE9"
FT                   /inference="protein motif:PFAM:PF00076"
FT                   /inference="protein motif:COGS:COG0724"
FT                   /protein_id="CAP85680.1"
FT                   /translation="MDFSGLSWHTSDDTLREGFQQFGEIQEAIVVKDRATQRSRGFGFV
FT                   RFATDAEADAALGAMNNQEFDGRVIRVDKAFDRPQRSEGGFQGRGGYNSQPQSSYQGGA
FT                   GGYAGYNNGGYNNGAAGGYGGGYNRGYNNYAPSGPAGYGAGGPGGYG"
FT   exon            complement(804799..805063)
FT                   /gene="Pc20g03510"
FT                   /locus_tag="PCH_Pc20g03510"
FT                   /number=1
FT   intron          complement(805064..805121)
FT                   /gene="Pc20g03510"
FT                   /locus_tag="PCH_Pc20g03510"
FT                   /number=1
FT   exon            complement(805122..805228)
FT                   /gene="Pc20g03510"
FT                   /locus_tag="PCH_Pc20g03510"
FT                   /number=2
FT   intron          complement(805229..805294)
FT                   /gene="Pc20g03510"
FT                   /locus_tag="PCH_Pc20g03510"
FT                   /number=2
FT   exon            complement(805295..805378)
FT                   /gene="Pc20g03510"
FT                   /locus_tag="PCH_Pc20g03510"
FT                   /number=3
FT   mRNA            join(<806736..806768,806830..807354,807404..>808984)
FT                   /gene="Pc20g03520"
FT                   /locus_tag="PCH_Pc20g03520"
FT   CDS_pept        join(806736..806768,806830..807354,807404..808984)
FT                   /gene="Pc20g03520"
FT                   /locus_tag="PCH_Pc20g03520"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An02g12290 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85681"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF0"
FT                   /protein_id="CAP85681.1"
FT                   /translation="MVAPSLAVTEFERPSRRVQGTFLMESNNPIYQWLSTVEDQRQSML
FT                   SKRLRSLRANRALAENQEQVKDTALATGIPRIHIPLETSDDLRANGHSASRKRDSRHLK
FT                   ETKASSTHDTIPGSEGHKRSRNCYELRPRYKTREDRYEYKGPSSAVETQSQSRKGRAKK
FT                   PRGRRHTMNDDFRAINVTGNRLTLRSNTNLGIFNKGRSSSVANQRGNTPTGLAKPASVT
FT                   RSQMYVTESDLAFSEMNFLSRRNNLNHPISTVRETLDGQHEREYHPQVQFDDPAHDCNL
FT                   GTSHSIHKLVDVKCKLDDSAMPLFAFEEAPASEISPVFGHSRSASPMPPNKRRKISKQS
FT                   SSIPYTWTETEIDDTEQSDALEQHLLNLLHVGVYPQALCSEIKNTVLTGQYWSLAELWE
FT                   LLKERKASWSNEAGRQIRASPEASTGQLAAVDASLQEVREVIAPGHSDVPSAGSVQNEM
FT                   SKQSADSNVACETACSVNSPPKQSSGLEQQQDRPHEASDKPGPPSLQAARTSNSPDRFI
FT                   DTLNEDQGEPSHQESAEDAVHFPASVPDVEHPHMSDIEFYELGRVDDDDVFYRTLDAAY
FT                   CAIVSPEVAAEVASDLQELLESPELNGNDLPNTPESTNIREPDIPTGQAEVAEPEYLVK
FT                   VSQDIIQNRYDGRPSEPSCQRKLSTSHLNDPCVDQNNELPWVATGYGQTQPRASTGIDA
FT                   GQAKPPGLSGFWRQNRLY"
FT   exon            806736..806768
FT                   /gene="Pc20g03520"
FT                   /locus_tag="PCH_Pc20g03520"
FT                   /number=1
FT   intron          806769..806829
FT                   /gene="Pc20g03520"
FT                   /locus_tag="PCH_Pc20g03520"
FT                   /number=1
FT   exon            806830..807354
FT                   /gene="Pc20g03520"
FT                   /locus_tag="PCH_Pc20g03520"
FT                   /number=2
FT   intron          807355..807403
FT                   /gene="Pc20g03520"
FT                   /locus_tag="PCH_Pc20g03520"
FT                   /number=2
FT   exon            807404..808984
FT                   /gene="Pc20g03520"
FT                   /locus_tag="PCH_Pc20g03520"
FT                   /number=3
FT   mRNA            complement(join(<809751..809803,809925..>810198))
FT                   /gene="Pc20g03530"
FT                   /locus_tag="PCH_Pc20g03530"
FT   CDS_pept        complement(join(809751..809803,809925..810198))
FT                   /gene="Pc20g03530"
FT                   /locus_tag="PCH_Pc20g03530"
FT                   /note="Title: similarity to hypothetical protein
FT                   1413_scaffold_7.tfa_40wg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85682"
FT                   /db_xref="InterPro:IPR037652"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF1"
FT                   /protein_id="CAP85682.1"
FT                   /translation="MSFPSPDSSNPSFSMSAYMVPSRQNSYSESDDELASLPSESTNDS
FT                   DLETLSEYSSDAEAEWQESIEQLELLLTMVLVPFIGKYLGRRCAYWNPAAFKAAGVVEA
FT                   AASL"
FT   exon            complement(809751..809803)
FT                   /gene="Pc20g03530"
FT                   /locus_tag="PCH_Pc20g03530"
FT                   /number=1
FT   intron          complement(809804..809924)
FT                   /gene="Pc20g03530"
FT                   /locus_tag="PCH_Pc20g03530"
FT                   /number=1
FT   exon            complement(809925..810198)
FT                   /gene="Pc20g03530"
FT                   /locus_tag="PCH_Pc20g03530"
FT                   /number=2
FT   mRNA            join(<810839..811464,811529..>811826)
FT                   /gene="Pc20g03540"
FT                   /locus_tag="PCH_Pc20g03540"
FT   CDS_pept        join(810839..811464,811529..811826)
FT                   /gene="Pc20g03540"
FT                   /locus_tag="PCH_Pc20g03540"
FT                   /note="Title: strong similarity to translation initiation
FT                   factor eIF-2 beta chain Sui3 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85683"
FT                   /db_xref="GOA:B6HGF2"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF2"
FT                   /inference="similar to AA sequence:PIR:S29368"
FT                   /inference="protein motif:PFAM:PF01873"
FT                   /inference="protein motif:COGS:COG1601"
FT                   /inference="protein motif:COGS:COG1326"
FT                   /protein_id="CAP85683.1"
FT                   /translation="MDTNGQVTDAPPAEKPTGGMQYLSDPSLNPPVAFATAPLTMSEYT
FT                   EKEVDEVTEMFKGLSKKKKPSKKSKTADAGDDEEAPAADGEFDPSALKKKKKSSSKSKK
FT                   ADATDFDAKLAEAGIAEEAGEEKPEEIPEGDLEAGTGIWAHDATQTIPYSLLVSRFFSL
FT                   IESHHPDLLATGAKSYKIPPPQCLREGNRRTIFANIADICKRMKRSEEHCTQFLFAELG
FT                   TSGSVDGSRRLVIKGRFQQKGIESVLRRYIVEYVTCKTCRSPDTELNKGENRLYFVTCN
FT                   SCGSRRSVAAIKTGFRSQIGRRKRVG"
FT   exon            810839..811464
FT                   /gene="Pc20g03540"
FT                   /locus_tag="PCH_Pc20g03540"
FT                   /number=1
FT   intron          811465..811528
FT                   /gene="Pc20g03540"
FT                   /locus_tag="PCH_Pc20g03540"
FT                   /number=1
FT   exon            811529..811826
FT                   /gene="Pc20g03540"
FT                   /locus_tag="PCH_Pc20g03540"
FT                   /number=2
FT   mRNA            complement(join(<812361..812579,812642..812991,
FT                   813078..813597,813652..>813678))
FT                   /gene="Pc20g03550"
FT                   /locus_tag="PCH_Pc20g03550"
FT   CDS_pept        complement(join(812361..812579,812642..812991,
FT                   813078..813597,813652..813678))
FT                   /gene="Pc20g03550"
FT                   /locus_tag="PCH_Pc20g03550"
FT                   /note="Title: strong similarity to hypothetical conserved
FT                   protein TM0367 - Thermotoga maritima"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03550"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85684"
FT                   /db_xref="GOA:B6HGF3"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF3"
FT                   /inference="similar to AA sequence:PIR:G72387"
FT                   /inference="protein motif:PFAM:PF01987"
FT                   /inference="protein motif:COGS:COG2013"
FT                   /protein_id="CAP85684.1"
FT                   /translation="MNIPLRLCLLRRLRHVVTIPSIGSKAILMRRVAFSPPHQPYFAPP
FT                   PRQTPPSNGDHPVPQSSISPPAMSPPTNKQGYAMAEYPAPTTASPPPPDQIAEQNQAAF
FT                   LQNQALSRLSISSRPPQTVTMEKMPGGAPAYGQFVGTHSTYQDDVGVFNGGSYRISHRD
FT                   TNSLLTLQLAVGCPLTVRPGAMIAMSPTITLRGHVSFSFKKLIIGGSMTTSQYTGPGEV
FT                   LLAPPMLGDIVVLPIDTGEAWNAGRDSFLAHTSGVHHLYQSQGLSKGFFSGEGFFVYEF
FT                   TGHGLLWLQSFGAIVKKDLREGESYFVDNGHLVAWKCAYEIERPASGGLLSSFSSGEGL
FT                   ACRFKGPGTVYLQTRNLKAFATQMKVTSSYL"
FT   exon            complement(812361..812579)
FT                   /gene="Pc20g03550"
FT                   /locus_tag="PCH_Pc20g03550"
FT                   /number=1
FT   intron          complement(812580..812641)
FT                   /gene="Pc20g03550"
FT                   /locus_tag="PCH_Pc20g03550"
FT                   /number=1
FT   exon            complement(812642..812991)
FT                   /gene="Pc20g03550"
FT                   /locus_tag="PCH_Pc20g03550"
FT                   /number=2
FT   intron          complement(812992..813077)
FT                   /gene="Pc20g03550"
FT                   /locus_tag="PCH_Pc20g03550"
FT                   /number=2
FT   exon            complement(813078..813597)
FT                   /gene="Pc20g03550"
FT                   /locus_tag="PCH_Pc20g03550"
FT                   /number=3
FT   intron          complement(813598..813651)
FT                   /gene="Pc20g03550"
FT                   /locus_tag="PCH_Pc20g03550"
FT                   /number=3
FT   exon            complement(813652..813678)
FT                   /gene="Pc20g03550"
FT                   /locus_tag="PCH_Pc20g03550"
FT                   /number=4
FT   mRNA            complement(join(<814603..817419,817454..818032,
FT                   818097..>818189))
FT                   /gene="Pc20g03560"
FT                   /locus_tag="PCH_Pc20g03560"
FT   CDS_pept        complement(join(814603..817419,817454..818032,
FT                   818097..818189))
FT                   /gene="Pc20g03560"
FT                   /locus_tag="PCH_Pc20g03560"
FT                   /note="Title: strong similarity to neuronal long splice
FT                   form of ankyrin like protein An02g12350 - Aspergillus
FT                   niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03560"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85685"
FT                   /db_xref="GOA:B6HGF4"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF4"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /inference="protein motif:COGS:COG0666"
FT                   /protein_id="CAP85685.1"
FT                   /translation="MLSILFFISLFPFVKADDDWDDFTNNLATDLAPLITLFGERLTKQ
FT                   FLSESISILDNVIFALSPLGVLTAVVSVIRICGSSSLRAFVGRAQEGPAEAESELLPCV
FT                   SESTAELFNDGGITRVFGRPKIVEIVAWQDVNHKTGEKETKIGTLKDALEEKAWSCNNK
FT                   VLPTELPELDIPNLSLNKGIKRRDQFWFHCAAILGGVLQTGRCFSSFEPEITLTIHLRY
FT                   HYHFKKDDKAVASYAFPLYLIGTTLLFLGMFFCAFIMERSSKEFYLKAEKPSKIYWLQP
FT                   GNQDVGDQVFNAFLAVNEGPESSMTKKLRYTKSIRDRRFDRKYLEIYSTLTSTVLGFIF
FT                   QFIGLRGLHASVILAQLGSTFIMSIIRTCLRTERMAPDENKMKDDRDLMGHKQQELDAF
FT                   AFYLENVEYFNMVLLPDRPATIPSPRFVPHVDAPLARQLIRTRTQLANLTSNPNQSSSA
FT                   TWDDMPIRRMAHNLAQTIESTMDLISGWGVDLGKTFEFRLGFECRGASPGSVTQSPGTY
FT                   SIGLMRCGDALRWKMEASEIEAILGLWTWSLYKSGDDCKSSRLFRLVGLSEEEASKKET
FT                   YLYFHKWIFRQTEARLVPSDLIDDSRRLFGFEPKEGLPLGNLLVIKTENEVETMAAQDI
FT                   FIQFLKEVCLNVKELGGEVDVVSGIQNSLLGSCTRIDELVSCFEAHSLGSREDALLCIV
FT                   PVLRNRNLLPDLAADCAKVRARREQLISQGKWKNAFDLLRWLCERSEGPQFQRSVYELG
FT                   YLCLRALLNNSETVRKEGFAQVCKLLNSDIREEFLQTQKILLPSDWSMSQDRIEWWRSF
FT                   SSELGWTAWSISEEVPGMSFMEPALKSLNVPQSLPGVIGTGQDLQATEDAMRSMQDWLT
FT                   LRDLVNAGFRRLREEEDNRLCFEWAVENNYHCLLYFLLLKWVELNDRIPFLITIAYTLA
FT                   ATKHSHLATQTLLRQGTNIDATDVQGHTALFNQAAVGHVEGIVMLLDNGADPNGSNEAP
FT                   NARPLIAAVYGGHLMAVALLLQYGADANMTDQHGMSALLWAMASDYIDIVELLLSSGAE
FT                   TESVMSDGSTALIWASTDKSLPILELLIKHGADINAQDTDGKTALMRAVSRERSLPVLR
FT                   VLLDKGADVHMEDDKGRTALDMARKANFHEAVAILKSSDRNSLASWLPDLTSRSP"
FT   exon            complement(814603..817419)
FT                   /gene="Pc20g03560"
FT                   /locus_tag="PCH_Pc20g03560"
FT                   /number=1
FT   mat_peptide     complement(join(814606..817419,817454..818032,
FT                   818097..818141))
FT                   /gene="Pc20g03560"
FT                   /locus_tag="PCH_Pc20g03560"
FT   intron          complement(817420..817453)
FT                   /gene="Pc20g03560"
FT                   /locus_tag="PCH_Pc20g03560"
FT                   /number=1
FT   exon            complement(817454..818032)
FT                   /gene="Pc20g03560"
FT                   /locus_tag="PCH_Pc20g03560"
FT                   /number=2
FT   intron          complement(818033..818096)
FT                   /gene="Pc20g03560"
FT                   /locus_tag="PCH_Pc20g03560"
FT                   /number=2
FT   exon            complement(818097..818189)
FT