(data stored in SCRATCH3701 zone)

EMBL: AM942759

ID   AM942759; SV 1; circular; genomic DNA; STD; PRO; 4063606 BP.
XX
AC   AM942759;
XX
PR   Project:PRJNA12624;
XX
DT   02-APR-2008 (Rel. 95, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 7)
XX
DE   Proteus mirabilis strain HI4320, complete genome
XX
KW   complete genome.
XX
OS   Proteus mirabilis
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Morganellaceae; Proteus.
XX
RN   [1]
RP   1-4063606
RA   Sebaihia M.;
RT   ;
RL   Submitted (18-FEB-2008) to the INSDC.
RL   Sebaihia M., Sulston Laboratories, Wellcome Trust Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1128/JB.01981-07.
RX   PUBMED; 18375554.
RA   Pearson M.M., Sebaihia M., Churcher C., Quail M.A., Seshasayee A.S.,
RA   Luscombe N.M., Abdellah Z., Arrosmith C., Atkin B., Chillingworth T.,
RA   Hauser H., Jagels K., Moule S., Mungall K., Norbertczak H.,
RA   Rabbinowitsch E., Walker D., Whithead S., Thomson N.R., Rather P.N.,
RA   Parkhill J., Mobley H.L.;
RT   "Complete genome sequence of uropathogenic Proteus mirabilis, a master of
RT   both adherence and motility";
RL   J. Bacteriol. 190(11):4027-4037(2008).
XX
DR   MD5; 4608ed365fc79c17a40f8db8ab407888.
DR   BioSample; SAMEA1705945.
DR   EnsemblGenomes-Gn; EBG00000237733.
DR   EnsemblGenomes-Gn; EBG00000237735.
DR   EnsemblGenomes-Gn; EBG00000237737.
DR   EnsemblGenomes-Gn; EBG00000237739.
DR   EnsemblGenomes-Gn; EBG00000237742.
DR   EnsemblGenomes-Gn; EBG00000237745.
DR   EnsemblGenomes-Gn; EBG00000237746.
DR   EnsemblGenomes-Gn; EBG00000237748.
DR   EnsemblGenomes-Gn; EBG00000237752.
DR   EnsemblGenomes-Gn; EBG00000237753.
DR   EnsemblGenomes-Gn; EBG00000237758.
DR   EnsemblGenomes-Gn; EBG00000237761.
DR   EnsemblGenomes-Gn; EBG00000237772.
DR   EnsemblGenomes-Gn; EBG00000237775.
DR   EnsemblGenomes-Gn; EBG00000237777.
DR   EnsemblGenomes-Gn; EBG00000237779.
DR   EnsemblGenomes-Gn; EBG00000237784.
DR   EnsemblGenomes-Gn; EBG00000237787.
DR   EnsemblGenomes-Gn; EBG00000237792.
DR   EnsemblGenomes-Gn; EBG00000237794.
DR   EnsemblGenomes-Gn; EBG00000237798.
DR   EnsemblGenomes-Gn; EBG00000237803.
DR   EnsemblGenomes-Gn; EBG00000237805.
DR   EnsemblGenomes-Gn; EBG00000237806.
DR   EnsemblGenomes-Gn; EBG00000237808.
DR   EnsemblGenomes-Gn; EBG00000237810.
DR   EnsemblGenomes-Gn; EBG00000237813.
DR   EnsemblGenomes-Gn; EBG00000237815.
DR   EnsemblGenomes-Gn; EBG00000237817.
DR   EnsemblGenomes-Gn; EBG00000237820.
DR   EnsemblGenomes-Gn; EBG00000237823.
DR   EnsemblGenomes-Gn; EBG00000237825.
DR   EnsemblGenomes-Gn; EBG00000237826.
DR   EnsemblGenomes-Gn; EBG00000237827.
DR   EnsemblGenomes-Gn; EBG00000237830.
DR   EnsemblGenomes-Gn; EBG00000237832.
DR   EnsemblGenomes-Gn; EBG00000237833.
DR   EnsemblGenomes-Gn; EBG00000237834.
DR   EnsemblGenomes-Gn; EBG00000237835.
DR   EnsemblGenomes-Gn; EBG00000237836.
DR   EnsemblGenomes-Gn; EBG00000237839.
DR   EnsemblGenomes-Gn; EBG00000237840.
DR   EnsemblGenomes-Gn; EBG00000237842.
DR   EnsemblGenomes-Gn; EBG00000237844.
DR   EnsemblGenomes-Gn; EBG00000237845.
DR   EnsemblGenomes-Gn; EBG00000237846.
DR   EnsemblGenomes-Gn; EBG00000237848.
DR   EnsemblGenomes-Gn; EBG00000237849.
DR   EnsemblGenomes-Gn; EBG00000237856.
DR   EnsemblGenomes-Gn; EBG00000237857.
DR   EnsemblGenomes-Gn; EBG00000237860.
DR   EnsemblGenomes-Gn; EBG00000237863.
DR   EnsemblGenomes-Gn; EBG00000237866.
DR   EnsemblGenomes-Gn; EBG00000237868.
DR   EnsemblGenomes-Gn; EBG00000237869.
DR   EnsemblGenomes-Gn; EBG00000237871.
DR   EnsemblGenomes-Gn; EBG00000237873.
DR   EnsemblGenomes-Gn; EBG00000237874.
DR   EnsemblGenomes-Gn; EBG00000237875.
DR   EnsemblGenomes-Gn; EBG00000237879.
DR   EnsemblGenomes-Gn; EBG00000237880.
DR   EnsemblGenomes-Gn; EBG00000237885.
DR   EnsemblGenomes-Gn; EBG00000237891.
DR   EnsemblGenomes-Gn; EBG00000237892.
DR   EnsemblGenomes-Gn; EBG00000237893.
DR   EnsemblGenomes-Gn; EBG00000237894.
DR   EnsemblGenomes-Gn; EBG00000237897.
DR   EnsemblGenomes-Gn; EBG00000237900.
DR   EnsemblGenomes-Gn; EBG00000237901.
DR   EnsemblGenomes-Gn; EBG00000237903.
DR   EnsemblGenomes-Gn; EBG00000237904.
DR   EnsemblGenomes-Gn; EBG00000237905.
DR   EnsemblGenomes-Gn; EBG00000237906.
DR   EnsemblGenomes-Gn; EBG00000237908.
DR   EnsemblGenomes-Gn; EBG00000237910.
DR   EnsemblGenomes-Gn; EBG00000237911.
DR   EnsemblGenomes-Gn; EBG00000237915.
DR   EnsemblGenomes-Gn; EBG00000237919.
DR   EnsemblGenomes-Gn; EBG00000237922.
DR   EnsemblGenomes-Gn; EBG00000237924.
DR   EnsemblGenomes-Gn; EBG00000237927.
DR   EnsemblGenomes-Gn; EBG00000237929.
DR   EnsemblGenomes-Gn; EBG00000237931.
DR   EnsemblGenomes-Gn; EBG00000237933.
DR   EnsemblGenomes-Gn; EBG00000237934.
DR   EnsemblGenomes-Gn; EBG00000237936.
DR   EnsemblGenomes-Gn; EBG00000237938.
DR   EnsemblGenomes-Gn; EBG00000237939.
DR   EnsemblGenomes-Gn; EBG00000237940.
DR   EnsemblGenomes-Gn; EBG00000237942.
DR   EnsemblGenomes-Gn; EBG00000237943.
DR   EnsemblGenomes-Gn; EBG00000237944.
DR   EnsemblGenomes-Gn; EBG00000237949.
DR   EnsemblGenomes-Gn; EBG00000237950.
DR   EnsemblGenomes-Gn; EBG00000237951.
DR   EnsemblGenomes-Gn; EBG00000237952.
DR   EnsemblGenomes-Gn; EBG00000237953.
DR   EnsemblGenomes-Gn; EBG00000237954.
DR   EnsemblGenomes-Gn; EBG00000237955.
DR   EnsemblGenomes-Gn; EBG00000237956.
DR   EnsemblGenomes-Gn; EBG00000237959.
DR   EnsemblGenomes-Gn; EBG00000237960.
DR   EnsemblGenomes-Gn; EBG00000237962.
DR   EnsemblGenomes-Gn; EBG00000237963.
DR   EnsemblGenomes-Gn; EBG00000237966.
DR   EnsemblGenomes-Gn; EBG00001181563.
DR   EnsemblGenomes-Gn; EBG00001181564.
DR   EnsemblGenomes-Gn; EBG00001181565.
DR   EnsemblGenomes-Gn; EBG00001181566.
DR   EnsemblGenomes-Gn; EBG00001181567.
DR   EnsemblGenomes-Gn; EBG00001181568.
DR   EnsemblGenomes-Gn; EBG00001181569.
DR   EnsemblGenomes-Gn; EBG00001181570.
DR   EnsemblGenomes-Gn; EBG00001181571.
DR   EnsemblGenomes-Gn; EBG00001181572.
DR   EnsemblGenomes-Gn; EBG00001181573.
DR   EnsemblGenomes-Gn; EBG00001181574.
DR   EnsemblGenomes-Gn; EBG00001181575.
DR   EnsemblGenomes-Gn; EBG00001181576.
DR   EnsemblGenomes-Gn; EBG00001181577.
DR   EnsemblGenomes-Gn; EBG00001181578.
DR   EnsemblGenomes-Gn; EBG00001181579.
DR   EnsemblGenomes-Gn; EBG00001181580.
DR   EnsemblGenomes-Gn; EBG00001181581.
DR   EnsemblGenomes-Gn; EBG00001181582.
DR   EnsemblGenomes-Gn; EBG00001181583.
DR   EnsemblGenomes-Gn; EBG00001181584.
DR   EnsemblGenomes-Gn; EBG00001181585.
DR   EnsemblGenomes-Gn; EBG00001181586.
DR   EnsemblGenomes-Gn; EBG00001181587.
DR   EnsemblGenomes-Gn; EBG00001181588.
DR   EnsemblGenomes-Gn; EBG00001181589.
DR   EnsemblGenomes-Gn; EBG00001181590.
DR   EnsemblGenomes-Gn; EBG00001181591.
DR   EnsemblGenomes-Gn; EBG00001181592.
DR   EnsemblGenomes-Gn; EBG00001181593.
DR   EnsemblGenomes-Gn; EBG00001181594.
DR   EnsemblGenomes-Gn; EBG00001181595.
DR   EnsemblGenomes-Gn; EBG00001181596.
DR   EnsemblGenomes-Gn; EBG00001181597.
DR   EnsemblGenomes-Gn; EBG00001181598.
DR   EnsemblGenomes-Gn; EBG00001181599.
DR   EnsemblGenomes-Gn; EBG00001181600.
DR   EnsemblGenomes-Gn; EBG00001181601.
DR   EnsemblGenomes-Gn; EBG00001181602.
DR   EnsemblGenomes-Gn; EBG00001181603.
DR   EnsemblGenomes-Gn; EBG00001181604.
DR   EnsemblGenomes-Gn; EBG00001181605.
DR   EnsemblGenomes-Gn; EBG00001181606.
DR   EnsemblGenomes-Gn; EBG00001181607.
DR   EnsemblGenomes-Gn; EBG00001181608.
DR   EnsemblGenomes-Gn; EBG00001181609.
DR   EnsemblGenomes-Gn; EBG00001181610.
DR   EnsemblGenomes-Gn; EBG00001181611.
DR   EnsemblGenomes-Gn; EBG00001181612.
DR   EnsemblGenomes-Gn; EBG00001181613.
DR   EnsemblGenomes-Gn; EBG00001181614.
DR   EnsemblGenomes-Gn; EBG00001181615.
DR   EnsemblGenomes-Gn; EBG00001181616.
DR   EnsemblGenomes-Gn; EBG00001181617.
DR   EnsemblGenomes-Gn; EBG00001181618.
DR   EnsemblGenomes-Gn; EBG00001181619.
DR   EnsemblGenomes-Gn; EBG00001181620.
DR   EnsemblGenomes-Gn; EBG00001181621.
DR   EnsemblGenomes-Gn; EBG00001181622.
DR   EnsemblGenomes-Gn; EBG00001181623.
DR   EnsemblGenomes-Gn; EBG00001181624.
DR   EnsemblGenomes-Gn; EBG00001181625.
DR   EnsemblGenomes-Gn; EBG00001181626.
DR   EnsemblGenomes-Gn; EBG00001181627.
DR   EnsemblGenomes-Gn; EBG00001181628.
DR   EnsemblGenomes-Gn; EBG00001181629.
DR   EnsemblGenomes-Gn; EBG00001181630.
DR   EnsemblGenomes-Gn; EBG00001181631.
DR   EnsemblGenomes-Gn; EBG00001181632.
DR   EnsemblGenomes-Gn; EBG00001181633.
DR   EnsemblGenomes-Gn; EBG00001181634.
DR   EnsemblGenomes-Gn; EBG00001181635.
DR   EnsemblGenomes-Gn; EBG00001181636.
DR   EnsemblGenomes-Gn; EBG00001181637.
DR   EnsemblGenomes-Gn; EBG00001181638.
DR   EnsemblGenomes-Gn; EBG00001181639.
DR   EnsemblGenomes-Gn; EBG00001181640.
DR   EnsemblGenomes-Gn; EBG00001181641.
DR   EnsemblGenomes-Gn; EBG00001181642.
DR   EnsemblGenomes-Gn; EBG00001181643.
DR   EnsemblGenomes-Gn; EBG00001181644.
DR   EnsemblGenomes-Gn; EBG00001181645.
DR   EnsemblGenomes-Gn; EBG00001181646.
DR   EnsemblGenomes-Gn; EBG00001181647.
DR   EnsemblGenomes-Gn; EBG00001181648.
DR   EnsemblGenomes-Gn; EBG00001181649.
DR   EnsemblGenomes-Gn; EBG00001181650.
DR   EnsemblGenomes-Gn; EBG00001181651.
DR   EnsemblGenomes-Gn; EBG00001181652.
DR   EnsemblGenomes-Gn; EBG00001181653.
DR   EnsemblGenomes-Gn; EBG00001181654.
DR   EnsemblGenomes-Gn; EBG00001181655.
DR   EnsemblGenomes-Gn; EBG00001181656.
DR   EnsemblGenomes-Gn; EBG00001181657.
DR   EnsemblGenomes-Gn; EBG00001181658.
DR   EnsemblGenomes-Gn; EBG00001181659.
DR   EnsemblGenomes-Gn; EBG00001181660.
DR   EnsemblGenomes-Gn; EBG00001181661.
DR   EnsemblGenomes-Gn; EBG00001181662.
DR   EnsemblGenomes-Gn; EBG00001181663.
DR   EnsemblGenomes-Gn; EBG00001181664.
DR   EnsemblGenomes-Gn; EBG00001181665.
DR   EnsemblGenomes-Gn; EBG00001181666.
DR   EnsemblGenomes-Gn; EBG00001181667.
DR   EnsemblGenomes-Gn; EBG00001181668.
DR   EnsemblGenomes-Gn; EBG00001181669.
DR   EnsemblGenomes-Gn; EBG00001181670.
DR   EnsemblGenomes-Gn; EBG00001181671.
DR   EnsemblGenomes-Gn; EBG00001181672.
DR   EnsemblGenomes-Gn; EBG00001181673.
DR   EnsemblGenomes-Gn; EBG00001181674.
DR   EnsemblGenomes-Gn; EBG00001181675.
DR   EnsemblGenomes-Gn; EBG00001181676.
DR   EnsemblGenomes-Gn; EBG00001181677.
DR   EnsemblGenomes-Gn; EBG00001181678.
DR   EnsemblGenomes-Gn; EBG00001181679.
DR   EnsemblGenomes-Gn; EBG00001181680.
DR   EnsemblGenomes-Gn; EBG00001181681.
DR   EnsemblGenomes-Gn; EBG00001181682.
DR   EnsemblGenomes-Gn; EBG00001181683.
DR   EnsemblGenomes-Gn; EBG00001181684.
DR   EnsemblGenomes-Gn; EBG00001181685.
DR   EnsemblGenomes-Gn; EBG00001181686.
DR   EnsemblGenomes-Gn; EBG00001181687.
DR   EnsemblGenomes-Gn; EBG00001181688.
DR   EnsemblGenomes-Gn; EBG00001181689.
DR   EnsemblGenomes-Gn; EBG00001181690.
DR   EnsemblGenomes-Gn; EBG00001181691.
DR   EnsemblGenomes-Gn; EBG00001181692.
DR   EnsemblGenomes-Gn; EBG00001181693.
DR   EnsemblGenomes-Gn; EBG00001181694.
DR   EnsemblGenomes-Gn; EBG00001181695.
DR   EnsemblGenomes-Gn; EBG00001181696.
DR   EnsemblGenomes-Gn; EBG00001181697.
DR   EnsemblGenomes-Gn; EBG00001181698.
DR   EnsemblGenomes-Gn; EBG00001181699.
DR   EnsemblGenomes-Gn; EBG00001181700.
DR   EnsemblGenomes-Gn; EBG00001181701.
DR   EnsemblGenomes-Gn; EBG00001181702.
DR   EnsemblGenomes-Gn; EBG00001181703.
DR   EnsemblGenomes-Gn; EBG00001181704.
DR   EnsemblGenomes-Gn; EBG00001181705.
DR   EnsemblGenomes-Gn; EBG00001181706.
DR   EnsemblGenomes-Gn; EBG00001181707.
DR   EnsemblGenomes-Gn; EBG00001181708.
DR   EnsemblGenomes-Gn; EBG00001181709.
DR   EnsemblGenomes-Gn; EBG00001181710.
DR   EnsemblGenomes-Gn; EBG00001181711.
DR   EnsemblGenomes-Gn; EBG00001181712.
DR   EnsemblGenomes-Gn; EBG00001181713.
DR   EnsemblGenomes-Gn; EBG00001181714.
DR   EnsemblGenomes-Gn; EBG00001181715.
DR   EnsemblGenomes-Gn; EBG00001181716.
DR   EnsemblGenomes-Gn; EBG00001181717.
DR   EnsemblGenomes-Gn; EBG00001181718.
DR   EnsemblGenomes-Gn; EBG00001181719.
DR   EnsemblGenomes-Gn; EBG00001181720.
DR   EnsemblGenomes-Gn; PMI0058.
DR   EnsemblGenomes-Gn; PMI0086.
DR   EnsemblGenomes-Gn; PMI0098.
DR   EnsemblGenomes-Gn; PMI0177.
DR   EnsemblGenomes-Gn; PMI0256.
DR   EnsemblGenomes-Gn; PMI0309.
DR   EnsemblGenomes-Gn; PMI0313.
DR   EnsemblGenomes-Gn; PMI0323.
DR   EnsemblGenomes-Gn; PMI0465.
DR   EnsemblGenomes-Gn; PMI0502.
DR   EnsemblGenomes-Gn; PMI0531.
DR   EnsemblGenomes-Gn; PMI0654.
DR   EnsemblGenomes-Gn; PMI0763.
DR   EnsemblGenomes-Gn; PMI0779.
DR   EnsemblGenomes-Gn; PMI0815.
DR   EnsemblGenomes-Gn; PMI0816.
DR   EnsemblGenomes-Gn; PMI0819.
DR   EnsemblGenomes-Gn; PMI0820.
DR   EnsemblGenomes-Gn; PMI0821.
DR   EnsemblGenomes-Gn; PMI0942.
DR   EnsemblGenomes-Gn; PMI0947.
DR   EnsemblGenomes-Gn; PMI0948.
DR   EnsemblGenomes-Gn; PMI0952.
DR   EnsemblGenomes-Gn; PMI0968.
DR   EnsemblGenomes-Gn; PMI0969.
DR   EnsemblGenomes-Gn; PMI0990.
DR   EnsemblGenomes-Gn; PMI1069.
DR   EnsemblGenomes-Gn; PMI1072.
DR   EnsemblGenomes-Gn; PMI1074.
DR   EnsemblGenomes-Gn; PMI1128.
DR   EnsemblGenomes-Gn; PMI1131.
DR   EnsemblGenomes-Gn; PMI1133.
DR   EnsemblGenomes-Gn; PMI1137.
DR   EnsemblGenomes-Gn; PMI1140.
DR   EnsemblGenomes-Gn; PMI1142.
DR   EnsemblGenomes-Gn; PMI1143.
DR   EnsemblGenomes-Gn; PMI1149.
DR   EnsemblGenomes-Gn; PMI1189.
DR   EnsemblGenomes-Gn; PMI1228.
DR   EnsemblGenomes-Gn; PMI1749.
DR   EnsemblGenomes-Gn; PMI1815.
DR   EnsemblGenomes-Gn; PMI1913.
DR   EnsemblGenomes-Gn; PMI1914.
DR   EnsemblGenomes-Gn; PMI1918.
DR   EnsemblGenomes-Gn; PMI2041.
DR   EnsemblGenomes-Gn; PMI2058.
DR   EnsemblGenomes-Gn; PMI2491A.
DR   EnsemblGenomes-Gn; PMI2595.
DR   EnsemblGenomes-Gn; PMI2606.
DR   EnsemblGenomes-Gn; PMI2607.
DR   EnsemblGenomes-Gn; PMI2609.
DR   EnsemblGenomes-Gn; PMI2611.
DR   EnsemblGenomes-Gn; PMI2614.
DR   EnsemblGenomes-Gn; PMI2615.
DR   EnsemblGenomes-Gn; PMI2620.
DR   EnsemblGenomes-Gn; PMI2621.
DR   EnsemblGenomes-Gn; PMI2622.
DR   EnsemblGenomes-Gn; PMI2623.
DR   EnsemblGenomes-Gn; PMI2624.
DR   EnsemblGenomes-Gn; PMI2625.
DR   EnsemblGenomes-Gn; PMI2626.
DR   EnsemblGenomes-Gn; PMI2643.
DR   EnsemblGenomes-Gn; PMI2999.
DR   EnsemblGenomes-Gn; PMI3041.
DR   EnsemblGenomes-Gn; PMI3068.
DR   EnsemblGenomes-Gn; PMI3076.
DR   EnsemblGenomes-Gn; PMI3077.
DR   EnsemblGenomes-Gn; PMI3087.
DR   EnsemblGenomes-Gn; PMI3139.
DR   EnsemblGenomes-Gn; PMI3147.
DR   EnsemblGenomes-Gn; PMI3148.
DR   EnsemblGenomes-Gn; PMI3221.
DR   EnsemblGenomes-Gn; PMI3469.
DR   EnsemblGenomes-Gn; PMI3477B.
DR   EnsemblGenomes-Gn; PMI3494.
DR   EnsemblGenomes-Gn; PMI3498.
DR   EnsemblGenomes-Gn; PMI3502.
DR   EnsemblGenomes-Gn; PMI3503.
DR   EnsemblGenomes-Tr; EBG00000237733-1.
DR   EnsemblGenomes-Tr; EBG00000237735-1.
DR   EnsemblGenomes-Tr; EBG00000237737-1.
DR   EnsemblGenomes-Tr; EBG00000237739-1.
DR   EnsemblGenomes-Tr; EBG00000237742-1.
DR   EnsemblGenomes-Tr; EBG00000237745-1.
DR   EnsemblGenomes-Tr; EBG00000237746-1.
DR   EnsemblGenomes-Tr; EBG00000237748-1.
DR   EnsemblGenomes-Tr; EBG00000237752-1.
DR   EnsemblGenomes-Tr; EBG00000237753-1.
DR   EnsemblGenomes-Tr; EBG00000237758-1.
DR   EnsemblGenomes-Tr; EBG00000237761-1.
DR   EnsemblGenomes-Tr; EBG00000237772-1.
DR   EnsemblGenomes-Tr; EBG00000237775-1.
DR   EnsemblGenomes-Tr; EBG00000237777-1.
DR   EnsemblGenomes-Tr; EBG00000237779-1.
DR   EnsemblGenomes-Tr; EBG00000237784-1.
DR   EnsemblGenomes-Tr; EBG00000237787-1.
DR   EnsemblGenomes-Tr; EBG00000237792-1.
DR   EnsemblGenomes-Tr; EBG00000237794-1.
DR   EnsemblGenomes-Tr; EBG00000237798-1.
DR   EnsemblGenomes-Tr; EBG00000237803-1.
DR   EnsemblGenomes-Tr; EBG00000237805-1.
DR   EnsemblGenomes-Tr; EBG00000237806-1.
DR   EnsemblGenomes-Tr; EBG00000237808-1.
DR   EnsemblGenomes-Tr; EBG00000237810-1.
DR   EnsemblGenomes-Tr; EBG00000237813-1.
DR   EnsemblGenomes-Tr; EBG00000237815-1.
DR   EnsemblGenomes-Tr; EBG00000237817-1.
DR   EnsemblGenomes-Tr; EBG00000237820-1.
DR   EnsemblGenomes-Tr; EBG00000237823-1.
DR   EnsemblGenomes-Tr; EBG00000237825-1.
DR   EnsemblGenomes-Tr; EBG00000237826-1.
DR   EnsemblGenomes-Tr; EBG00000237827-1.
DR   EnsemblGenomes-Tr; EBG00000237830-1.
DR   EnsemblGenomes-Tr; EBG00000237832-1.
DR   EnsemblGenomes-Tr; EBG00000237833-1.
DR   EnsemblGenomes-Tr; EBG00000237834-1.
DR   EnsemblGenomes-Tr; EBG00000237835-1.
DR   EnsemblGenomes-Tr; EBG00000237836-1.
DR   EnsemblGenomes-Tr; EBG00000237839-1.
DR   EnsemblGenomes-Tr; EBG00000237840-1.
DR   EnsemblGenomes-Tr; EBG00000237842-1.
DR   EnsemblGenomes-Tr; EBG00000237844-1.
DR   EnsemblGenomes-Tr; EBG00000237845-1.
DR   EnsemblGenomes-Tr; EBG00000237846-1.
DR   EnsemblGenomes-Tr; EBG00000237848-1.
DR   EnsemblGenomes-Tr; EBG00000237849-1.
DR   EnsemblGenomes-Tr; EBG00000237856-1.
DR   EnsemblGenomes-Tr; EBG00000237857-1.
DR   EnsemblGenomes-Tr; EBG00000237860-1.
DR   EnsemblGenomes-Tr; EBG00000237863-1.
DR   EnsemblGenomes-Tr; EBG00000237866-1.
DR   EnsemblGenomes-Tr; EBG00000237868-1.
DR   EnsemblGenomes-Tr; EBG00000237869-1.
DR   EnsemblGenomes-Tr; EBG00000237871-1.
DR   EnsemblGenomes-Tr; EBG00000237873-1.
DR   EnsemblGenomes-Tr; EBG00000237874-1.
DR   EnsemblGenomes-Tr; EBG00000237875-1.
DR   EnsemblGenomes-Tr; EBG00000237879-1.
DR   EnsemblGenomes-Tr; EBG00000237880-1.
DR   EnsemblGenomes-Tr; EBG00000237885-1.
DR   EnsemblGenomes-Tr; EBG00000237891-1.
DR   EnsemblGenomes-Tr; EBG00000237892-1.
DR   EnsemblGenomes-Tr; EBG00000237893-1.
DR   EnsemblGenomes-Tr; EBG00000237894-1.
DR   EnsemblGenomes-Tr; EBG00000237897-1.
DR   EnsemblGenomes-Tr; EBG00000237900-1.
DR   EnsemblGenomes-Tr; EBG00000237901-1.
DR   EnsemblGenomes-Tr; EBG00000237903-1.
DR   EnsemblGenomes-Tr; EBG00000237904-1.
DR   EnsemblGenomes-Tr; EBG00000237905-1.
DR   EnsemblGenomes-Tr; EBG00000237906-1.
DR   EnsemblGenomes-Tr; EBG00000237908-1.
DR   EnsemblGenomes-Tr; EBG00000237910-1.
DR   EnsemblGenomes-Tr; EBG00000237911-1.
DR   EnsemblGenomes-Tr; EBG00000237915-1.
DR   EnsemblGenomes-Tr; EBG00000237919-1.
DR   EnsemblGenomes-Tr; EBG00000237922-1.
DR   EnsemblGenomes-Tr; EBG00000237924-1.
DR   EnsemblGenomes-Tr; EBG00000237927-1.
DR   EnsemblGenomes-Tr; EBG00000237929-1.
DR   EnsemblGenomes-Tr; EBG00000237931-1.
DR   EnsemblGenomes-Tr; EBG00000237933-1.
DR   EnsemblGenomes-Tr; EBG00000237934-1.
DR   EnsemblGenomes-Tr; EBG00000237936-1.
DR   EnsemblGenomes-Tr; EBG00000237938-1.
DR   EnsemblGenomes-Tr; EBG00000237939-1.
DR   EnsemblGenomes-Tr; EBG00000237940-1.
DR   EnsemblGenomes-Tr; EBG00000237942-1.
DR   EnsemblGenomes-Tr; EBG00000237943-1.
DR   EnsemblGenomes-Tr; EBG00000237944-1.
DR   EnsemblGenomes-Tr; EBG00000237949-1.
DR   EnsemblGenomes-Tr; EBG00000237950-1.
DR   EnsemblGenomes-Tr; EBG00000237951-1.
DR   EnsemblGenomes-Tr; EBG00000237952-1.
DR   EnsemblGenomes-Tr; EBG00000237953-1.
DR   EnsemblGenomes-Tr; EBG00000237954-1.
DR   EnsemblGenomes-Tr; EBG00000237955-1.
DR   EnsemblGenomes-Tr; EBG00000237956-1.
DR   EnsemblGenomes-Tr; EBG00000237959-1.
DR   EnsemblGenomes-Tr; EBG00000237960-1.
DR   EnsemblGenomes-Tr; EBG00000237962-1.
DR   EnsemblGenomes-Tr; EBG00000237963-1.
DR   EnsemblGenomes-Tr; EBG00000237966-1.
DR   EnsemblGenomes-Tr; EBT00001759857.
DR   EnsemblGenomes-Tr; EBT00001759858.
DR   EnsemblGenomes-Tr; EBT00001759859.
DR   EnsemblGenomes-Tr; EBT00001759860.
DR   EnsemblGenomes-Tr; EBT00001759861.
DR   EnsemblGenomes-Tr; EBT00001759862.
DR   EnsemblGenomes-Tr; EBT00001759863.
DR   EnsemblGenomes-Tr; EBT00001759864.
DR   EnsemblGenomes-Tr; EBT00001759865.
DR   EnsemblGenomes-Tr; EBT00001759866.
DR   EnsemblGenomes-Tr; EBT00001759867.
DR   EnsemblGenomes-Tr; EBT00001759868.
DR   EnsemblGenomes-Tr; EBT00001759869.
DR   EnsemblGenomes-Tr; EBT00001759870.
DR   EnsemblGenomes-Tr; EBT00001759871.
DR   EnsemblGenomes-Tr; EBT00001759872.
DR   EnsemblGenomes-Tr; EBT00001759873.
DR   EnsemblGenomes-Tr; EBT00001759874.
DR   EnsemblGenomes-Tr; EBT00001759875.
DR   EnsemblGenomes-Tr; EBT00001759876.
DR   EnsemblGenomes-Tr; EBT00001759877.
DR   EnsemblGenomes-Tr; EBT00001759878.
DR   EnsemblGenomes-Tr; EBT00001759879.
DR   EnsemblGenomes-Tr; EBT00001759880.
DR   EnsemblGenomes-Tr; EBT00001759881.
DR   EnsemblGenomes-Tr; EBT00001759882.
DR   EnsemblGenomes-Tr; EBT00001759883.
DR   EnsemblGenomes-Tr; EBT00001759884.
DR   EnsemblGenomes-Tr; EBT00001759885.
DR   EnsemblGenomes-Tr; EBT00001759886.
DR   EnsemblGenomes-Tr; EBT00001759887.
DR   EnsemblGenomes-Tr; EBT00001759888.
DR   EnsemblGenomes-Tr; EBT00001759889.
DR   EnsemblGenomes-Tr; EBT00001759890.
DR   EnsemblGenomes-Tr; EBT00001759891.
DR   EnsemblGenomes-Tr; EBT00001759892.
DR   EnsemblGenomes-Tr; EBT00001759893.
DR   EnsemblGenomes-Tr; EBT00001759894.
DR   EnsemblGenomes-Tr; EBT00001759895.
DR   EnsemblGenomes-Tr; EBT00001759896.
DR   EnsemblGenomes-Tr; EBT00001759897.
DR   EnsemblGenomes-Tr; EBT00001759898.
DR   EnsemblGenomes-Tr; EBT00001759899.
DR   EnsemblGenomes-Tr; EBT00001759900.
DR   EnsemblGenomes-Tr; EBT00001759901.
DR   EnsemblGenomes-Tr; EBT00001759902.
DR   EnsemblGenomes-Tr; EBT00001759903.
DR   EnsemblGenomes-Tr; EBT00001759904.
DR   EnsemblGenomes-Tr; EBT00001759905.
DR   EnsemblGenomes-Tr; EBT00001759906.
DR   EnsemblGenomes-Tr; EBT00001759907.
DR   EnsemblGenomes-Tr; EBT00001759908.
DR   EnsemblGenomes-Tr; EBT00001759909.
DR   EnsemblGenomes-Tr; EBT00001759910.
DR   EnsemblGenomes-Tr; EBT00001759911.
DR   EnsemblGenomes-Tr; EBT00001759912.
DR   EnsemblGenomes-Tr; EBT00001759913.
DR   EnsemblGenomes-Tr; EBT00001759914.
DR   EnsemblGenomes-Tr; EBT00001759915.
DR   EnsemblGenomes-Tr; EBT00001759916.
DR   EnsemblGenomes-Tr; EBT00001759917.
DR   EnsemblGenomes-Tr; EBT00001759918.
DR   EnsemblGenomes-Tr; EBT00001759919.
DR   EnsemblGenomes-Tr; EBT00001759920.
DR   EnsemblGenomes-Tr; EBT00001759921.
DR   EnsemblGenomes-Tr; EBT00001759922.
DR   EnsemblGenomes-Tr; EBT00001759923.
DR   EnsemblGenomes-Tr; EBT00001759924.
DR   EnsemblGenomes-Tr; EBT00001759925.
DR   EnsemblGenomes-Tr; EBT00001759926.
DR   EnsemblGenomes-Tr; EBT00001759927.
DR   EnsemblGenomes-Tr; EBT00001759928.
DR   EnsemblGenomes-Tr; EBT00001759929.
DR   EnsemblGenomes-Tr; EBT00001759930.
DR   EnsemblGenomes-Tr; EBT00001759931.
DR   EnsemblGenomes-Tr; EBT00001759932.
DR   EnsemblGenomes-Tr; EBT00001759933.
DR   EnsemblGenomes-Tr; EBT00001759934.
DR   EnsemblGenomes-Tr; EBT00001759935.
DR   EnsemblGenomes-Tr; EBT00001759936.
DR   EnsemblGenomes-Tr; EBT00001759937.
DR   EnsemblGenomes-Tr; EBT00001759938.
DR   EnsemblGenomes-Tr; EBT00001759939.
DR   EnsemblGenomes-Tr; EBT00001759940.
DR   EnsemblGenomes-Tr; EBT00001759941.
DR   EnsemblGenomes-Tr; EBT00001759943.
DR   EnsemblGenomes-Tr; EBT00001759944.
DR   EnsemblGenomes-Tr; EBT00001759947.
DR   EnsemblGenomes-Tr; EBT00001759949.
DR   EnsemblGenomes-Tr; EBT00001759953.
DR   EnsemblGenomes-Tr; EBT00001759954.
DR   EnsemblGenomes-Tr; EBT00001759955.
DR   EnsemblGenomes-Tr; EBT00001759957.
DR   EnsemblGenomes-Tr; EBT00001759960.
DR   EnsemblGenomes-Tr; EBT00001759961.
DR   EnsemblGenomes-Tr; EBT00001759964.
DR   EnsemblGenomes-Tr; EBT00001759967.
DR   EnsemblGenomes-Tr; EBT00001759969.
DR   EnsemblGenomes-Tr; EBT00001759977.
DR   EnsemblGenomes-Tr; EBT00001759980.
DR   EnsemblGenomes-Tr; EBT00001759983.
DR   EnsemblGenomes-Tr; EBT00001759985.
DR   EnsemblGenomes-Tr; EBT00001759987.
DR   EnsemblGenomes-Tr; EBT00001759990.
DR   EnsemblGenomes-Tr; EBT00001759994.
DR   EnsemblGenomes-Tr; EBT00001759996.
DR   EnsemblGenomes-Tr; EBT00001759999.
DR   EnsemblGenomes-Tr; EBT00001760001.
DR   EnsemblGenomes-Tr; EBT00001760003.
DR   EnsemblGenomes-Tr; EBT00001760005.
DR   EnsemblGenomes-Tr; EBT00001760007.
DR   EnsemblGenomes-Tr; EBT00001760009.
DR   EnsemblGenomes-Tr; EBT00001760012.
DR   EnsemblGenomes-Tr; EBT00001760015.
DR   EnsemblGenomes-Tr; EBT00001760017.
DR   EnsemblGenomes-Tr; EBT00001760020.
DR   EnsemblGenomes-Tr; EBT00001760026.
DR   EnsemblGenomes-Tr; EBT00001760030.
DR   EnsemblGenomes-Tr; EBT00001760033.
DR   EnsemblGenomes-Tr; EBT00001760034.
DR   EnsemblGenomes-Tr; EBT00001760036.
DR   EnsemblGenomes-Tr; EBT00001760039.
DR   EnsemblGenomes-Tr; EBT00001760040.
DR   EnsemblGenomes-Tr; EBT00001760042.
DR   EnsemblGenomes-Tr; EBT00001760044.
DR   EnsemblGenomes-Tr; EBT00001760045.
DR   EnsemblGenomes-Tr; EBT00001760047.
DR   EnsemblGenomes-Tr; EBT00001760049.
DR   EnsemblGenomes-Tr; EBT00001760051.
DR   EnsemblGenomes-Tr; EBT00001760052.
DR   EnsemblGenomes-Tr; EBT00001760056.
DR   EnsemblGenomes-Tr; EBT00001760058.
DR   EnsemblGenomes-Tr; EBT00001760063.
DR   EnsemblGenomes-Tr; EBT00001760066.
DR   EnsemblGenomes-Tr; EBT00001760068.
DR   EnsemblGenomes-Tr; EBT00001760070.
DR   EnsemblGenomes-Tr; EBT00001760073.
DR   EnsemblGenomes-Tr; EBT00001760076.
DR   EnsemblGenomes-Tr; EBT00001760079.
DR   EnsemblGenomes-Tr; EBT00001760087.
DR   EnsemblGenomes-Tr; EBT00001760090.
DR   EnsemblGenomes-Tr; EBT00001760092.
DR   EnsemblGenomes-Tr; EBT00001760094.
DR   EnsemblGenomes-Tr; EBT00001760097.
DR   EnsemblGenomes-Tr; EBT00001760102.
DR   EnsemblGenomes-Tr; EBT00001760104.
DR   EnsemblGenomes-Tr; EBT00001760112.
DR   EnsemblGenomes-Tr; EBT00001760115.
DR   EnsemblGenomes-Tr; EBT00001760117.
DR   EnsemblGenomes-Tr; EBT00001760118.
DR   EnsemblGenomes-Tr; EBT00001760120.
DR   EnsemblGenomes-Tr; EBT00001760122.
DR   EnsemblGenomes-Tr; EBT00001760124.
DR   EnsemblGenomes-Tr; EBT00001760126.
DR   EnsemblGenomes-Tr; EBT00001760127.
DR   EnsemblGenomes-Tr; EBT00001760128.
DR   EnsemblGenomes-Tr; EBT00001760129.
DR   EnsemblGenomes-Tr; EBT00001760130.
DR   EnsemblGenomes-Tr; PMI0058.
DR   EnsemblGenomes-Tr; PMI0086.
DR   EnsemblGenomes-Tr; PMI0098.
DR   EnsemblGenomes-Tr; PMI0177.
DR   EnsemblGenomes-Tr; PMI0256.
DR   EnsemblGenomes-Tr; PMI0309.
DR   EnsemblGenomes-Tr; PMI0313.
DR   EnsemblGenomes-Tr; PMI0323.
DR   EnsemblGenomes-Tr; PMI0465.
DR   EnsemblGenomes-Tr; PMI0502.
DR   EnsemblGenomes-Tr; PMI0531.
DR   EnsemblGenomes-Tr; PMI0654.
DR   EnsemblGenomes-Tr; PMI0763.
DR   EnsemblGenomes-Tr; PMI0779.
DR   EnsemblGenomes-Tr; PMI0815.
DR   EnsemblGenomes-Tr; PMI0816.
DR   EnsemblGenomes-Tr; PMI0819.
DR   EnsemblGenomes-Tr; PMI0820.
DR   EnsemblGenomes-Tr; PMI0821.
DR   EnsemblGenomes-Tr; PMI0942.
DR   EnsemblGenomes-Tr; PMI0947.
DR   EnsemblGenomes-Tr; PMI0948.
DR   EnsemblGenomes-Tr; PMI0952.
DR   EnsemblGenomes-Tr; PMI0968.
DR   EnsemblGenomes-Tr; PMI0969.
DR   EnsemblGenomes-Tr; PMI0990.
DR   EnsemblGenomes-Tr; PMI1069.
DR   EnsemblGenomes-Tr; PMI1072.
DR   EnsemblGenomes-Tr; PMI1074.
DR   EnsemblGenomes-Tr; PMI1128.
DR   EnsemblGenomes-Tr; PMI1131.
DR   EnsemblGenomes-Tr; PMI1133.
DR   EnsemblGenomes-Tr; PMI1137.
DR   EnsemblGenomes-Tr; PMI1140.
DR   EnsemblGenomes-Tr; PMI1142.
DR   EnsemblGenomes-Tr; PMI1143.
DR   EnsemblGenomes-Tr; PMI1149.
DR   EnsemblGenomes-Tr; PMI1189.
DR   EnsemblGenomes-Tr; PMI1228.
DR   EnsemblGenomes-Tr; PMI1749.
DR   EnsemblGenomes-Tr; PMI1815.
DR   EnsemblGenomes-Tr; PMI1913.
DR   EnsemblGenomes-Tr; PMI1914.
DR   EnsemblGenomes-Tr; PMI1918.
DR   EnsemblGenomes-Tr; PMI2041.
DR   EnsemblGenomes-Tr; PMI2058.
DR   EnsemblGenomes-Tr; PMI2491A.
DR   EnsemblGenomes-Tr; PMI2595.
DR   EnsemblGenomes-Tr; PMI2606.
DR   EnsemblGenomes-Tr; PMI2607.
DR   EnsemblGenomes-Tr; PMI2609.
DR   EnsemblGenomes-Tr; PMI2611.
DR   EnsemblGenomes-Tr; PMI2614.
DR   EnsemblGenomes-Tr; PMI2615.
DR   EnsemblGenomes-Tr; PMI2620.
DR   EnsemblGenomes-Tr; PMI2621.
DR   EnsemblGenomes-Tr; PMI2622.
DR   EnsemblGenomes-Tr; PMI2623.
DR   EnsemblGenomes-Tr; PMI2624.
DR   EnsemblGenomes-Tr; PMI2625.
DR   EnsemblGenomes-Tr; PMI2626.
DR   EnsemblGenomes-Tr; PMI2643.
DR   EnsemblGenomes-Tr; PMI2999.
DR   EnsemblGenomes-Tr; PMI3041.
DR   EnsemblGenomes-Tr; PMI3068.
DR   EnsemblGenomes-Tr; PMI3076.
DR   EnsemblGenomes-Tr; PMI3077.
DR   EnsemblGenomes-Tr; PMI3087.
DR   EnsemblGenomes-Tr; PMI3139.
DR   EnsemblGenomes-Tr; PMI3147.
DR   EnsemblGenomes-Tr; PMI3148.
DR   EnsemblGenomes-Tr; PMI3221.
DR   EnsemblGenomes-Tr; PMI3469.
DR   EnsemblGenomes-Tr; PMI3477B.
DR   EnsemblGenomes-Tr; PMI3494.
DR   EnsemblGenomes-Tr; PMI3498.
DR   EnsemblGenomes-Tr; PMI3502.
DR   EnsemblGenomes-Tr; PMI3503.
DR   EuropePMC; PMC2395036; 18375554.
DR   EuropePMC; PMC2493277; 18539733.
DR   EuropePMC; PMC2708467; 19403758.
DR   EuropePMC; PMC2724383; 19619300.
DR   EuropePMC; PMC2849355; 20123999.
DR   EuropePMC; PMC2935791; 19968874.
DR   EuropePMC; PMC3101460; 21402851.
DR   EuropePMC; PMC3264238; 22106217.
DR   EuropePMC; PMC3318424; 22252871.
DR   EuropePMC; PMC3850215; 24074349.
DR   EuropePMC; PMC4267768; 25106491.
DR   EuropePMC; PMC4333446; 25547796.
DR   EuropePMC; PMC4539999; 26301055.
DR   EuropePMC; PMC4710684; 26865983.
DR   EuropePMC; PMC4783696; 26956038.
DR   EuropePMC; PMC5038311; 27480855.
DR   EuropePMC; PMC5124997; 27892525.
DR   EuropePMC; PMC5544767; 28779108.
DR   EuropePMC; PMC5701452; 29204271.
DR   EuropePMC; PMC6007103; 29654185.
DR   EuropePMC; PMC6373192; 30448962.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01808; MicX.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; AM942759.
DR   SILVA-SSU; AM942759.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4063606
FT                   /organism="Proteus mirabilis"
FT                   /strain="HI4320"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:584"
FT   CDS_pept        337..2796
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="PMI0001"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ05993"
FT                   /db_xref="GOA:B1VJ39"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:B1VJ39"
FT                   /protein_id="CAQ05993.1"
FT                   /translation="MRVLKFGGTSVANAERVLNVADIAEKKREQGQVALVLSAPAKITN
FT                   YLVAMIEKTAEGEEPLTQVREAEQIFANLLQGLRENQPGFDYQGLKDKVEREFAEIKHI
FT                   LHGISLLGQCPDSINAAMICRGEKLSIAIMESVLQARGYNVTVIDPVKNLLAQGHYLES
FT                   TVDIPESTRRISALNIPKDHMILMAGFTAGNEKNELVVLGRNGSDYSAAVLAACLRAQC
FT                   CEIWTDVDGVYTCDPRLVPDAHLLKGMSYQEAMELSYFGAKVLHPRTIAPIAQFQIPCL
FT                   IKNTGNPEAPGTLIGDGQKDDSTPVKGITNLNNMAMINVSGPGMKGMVGMAARVFSVMS
FT                   RAGISVVLITQSSSEYSISFCVPQKELIRAQKALSEEFYLELKDGVLDPLDIMNNVAII
FT                   SVVGDGMRTLKGISARFFSALTRGNINIVAIAQGSSERSISAVITNDAATNAVRLCHQM
FT                   LFNTNQIVEVFIVGVGGVGSALIEQIHRQQAWLKNKHIDLRVCGIANSRAMLTNMQGID
FT                   LDNWQQALQAAKEPFSFSQLIRLEKEYHFLNPVIVDCTSNEMIAQQYANFLQNGFNVVT
FT                   PNKKANTMSMDYYHQIRQSAEASRRKFLYDTNVGAGLPVIENLQNLLNAGDELVQFNGI
FT                   LSGSLSYIFGQLDEGKSLSEATLSAKEKGFTEPDPRDDLSGMDVARKLLILAREAGYQL
FT                   ELSDIDVEPVLPSSFDSTGDVESFLNRLPQVDVEFDAKVEEAQKSAKVLRYVGIINEGK
FT                   CQVKIMAVDANDPLFKVKNGENALAFYTRYYQPIPLVLRGYGAGNDVTAAGVFADVLRT
FT                   LSWKLGV"
FT   misc_feature    337..1188
FT                   /note="HMMPfam hit to PF00696, amino acid kinase family,
FT                   score 1.3e-58"
FT   misc_feature    343..369
FT                   /note="PS00324 aspartokinase signature."
FT   misc_feature    1282..1491
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 3.8e-10"
FT   misc_feature    1525..1740
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 0.0001"
FT   misc_feature    1771..2172
FT                   /note="HMMPfam hit to PF03447, homoserine dehydrogenase,
FT                   NAD binding d, score 7.5e-51"
FT   misc_feature    2176..2766
FT                   /note="HMMPfam hit to PF00742, homoserine dehydrogenase,
FT                   score 8.9e-93"
FT   misc_feature    2269..2292
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    2314..2382
FT                   /note="PS01042 homoserine dehydrogenase signature."
FT   CDS_pept        2778..3728
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="PMI0002"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40242"
FT                   /db_xref="GOA:B4F2V7"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2V7"
FT                   /protein_id="CAR40242.1"
FT                   /translation="MEIRSLKVVKVYAPASIGNVSVGFDVLGAAVSPIDGQLLGDCVTV
FT                   EAAQEFQLHSKGRFVSKLPSDAKQNIVYQCWELFCEKLGKQLPVSMTLEKNMPIGSGLG
FT                   SSACSVVAALVALNEFAHKPFSESHLLLMMGELEGRISGSVHYDNVAPCYLGGLQLILE
FT                   QNDIICQPVPAFDDWYWVMAYPGIKVSTAQARAILPKQYDKADIINHGRYLSGFIHACH
FT                   TQQPKLAASLMKDVIAEPYRTQLLPGFDKAREAALQKGALACGISGSGPTLFSITDSLA
FT                   IAQDVAQWLQQHYVQNDEGFVHICRLDTRGAREIG"
FT   misc_feature    3039..3620
FT                   /note="HMMPfam hit to PF00288, GHMP kinases putative
FT                   ATP-binding protei, score 2.5e-36"
FT   misc_feature    3066..3101
FT                   /note="PS00627 GHMP kinases putative ATP-binding domain."
FT   misc_feature    3069..3101
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        3732..5024
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="PMI0003"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40243"
FT                   /db_xref="GOA:B4F2U9"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2U9"
FT                   /protein_id="CAR40243.1"
FT                   /translation="MKLYNLKDNQEQVSFAQAVKQGLGKQQGLFFPKDLPSFSQAEIDA
FT                   LLKLDFATRSSRILSAFIGDEIPADVLAKRVNTAFAFPAPVTQVEEDISCLELFHGPTL
FT                   AFKDFGGRFMAQMLSEVAGDQPVTILTATSGDTGAAVAHAFYKLDNVQVVILYPQGKIS
FT                   PLQEKLFCTLGENIHTVAIQDDFDACQALVKQAFDDEYLKNTMHLNSANSINISRLLAQ
FT                   ICYYFEAVAQIPAEKRQQLVISVPSGNFGDLTAGLLAKSMGLPVKRFIAATNVNDTVPR
FT                   YLDSGKWEPHRTIATLSNAMDVSQPNNWPRIEELYRRKGWLLSDLSHGAVSDETTEKTV
FT                   RELAQKGYISEPHAAVAYRLLRDELQEGEYGVFLGTAHPAKFKENVERILGDTLPLPKE
FT                   LAERADKKLLSHLLPADFSQLRAFLLERAPK"
FT   misc_feature    3960..4865
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme, score 5.7e-30"
FT   misc_feature    4020..4064
FT                   /note="PS00165 Serine/threonine dehydratases
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        5204..13534
FT                   /transl_table=11
FT                   /locus_tag="PMI0004"
FT                   /product="RTX-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40244"
FT                   /db_xref="GOA:B4F2V0"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2V0"
FT                   /protein_id="CAR40244.1"
FT                   /translation="MGRFKKININDDIERITLEIVKYIKEHSVELPFNIDSVRRVLIEN
FT                   YIYILTYKNEYAANDFLIKIESNLSLYNRDKFTKAIDFIVKEINASIENLFVNNSYLTN
FT                   KNYQKLNKTRINSVFQHYPSGFFHLKIENKNLFIQIDNTNQLFKIIDFEGTVEFFSKKD
FT                   DLIHTINQMVKNSVADNSISYRFYAKNEYFNFFTLDKYWQVTPKDIYAEVINDIKAKKQ
FT                   VHIDSHLTIELIDSYSYKNIFIVRDSNENSEKILHIYLNNIDEAFLIAVAKHRQLKENG
FT                   EHLLYKLNKDWFFTKMKDKSVKYFSQTSDLLIPLEKIMGRINLVASAENNYNFSHFDPL
FT                   SGVCYGISLKYLLEVRNNGIEGGNKYLHWLKENINLYKDKKEKISDKLEKIIFDSVQEY
FT                   EVLKLIKEIKEIKFAQIFQMERIYEKINYTIFDLTKATEYRKILAENGLKASNANRLES
FT                   SLSQINYHLEYIMQYYNEYYAIIAFKTHAIALAYKRYSNNHYKFTLFDSNSELTEFSNI
FT                   ESIKDALIKIMGSYTLNKADGKEYFIIDEYKRNPTTKYRSLWDQNEIELHKGIAENIKK
FT                   IGFSLPFKDGVVGRVIHYSEQRDLILELKINSKLVEVVVKNVFVDEGIFLVKNNLDKIL
FT                   ENNKSSKVIIMSNSDGIDIQFTEFNAHQKMSKPKGYLEFNDVYYRDLIKINSYLLNGKK
FT                   SFSLNKIVSLIDTLRGNIYFDKITASFSIIDEIILFNQNNENISLVDILNQVKQKIEDK
FT                   LFYGDLLYGKEKLIALAQKNSLVAAIFYRMMVNEINEGYTGISNFIYEQIIDNPFLILD
FT                   KNRNVGVVGYDYTINFKNNYKALKEIIDGIDISEIKNIFLLDDENRLHLKVTYQRLSEY
FT                   RNNKYVNKLLHLIEDEIDSIKKIDNTGVYRDLYLEFFSNHQFNNRVIIHEIAQLESYFN
FT                   NNYQERNHGYHPSNFYINENDPLTLLEKSFNQNKNEIDGSYLLFNESKENFDFLFVDNN
FT                   FITRDFVDNIIIESISGVYQDDIVIYFYNGVKSEQLTQYLKDKPEIGRFLDYCLKHEIR
FT                   VIAAGNEEYFPATNALVKQKSRVESLQNVILQHQFVGERTIVFANKETLFSYQSGHLFI
FT                   EGIAQRLNMPIYTVTDNNLILENEYIMVKPTTESQFIGHPLLADTGASNTLLTETVPNE
FT                   PNTMSNRQRVDIENKNYAAEIYQFVSHNYTNYRDNQEFKLGYQNEISTIFSGYSDNMTI
FT                   ADILNYIQLNRYQINYTQLGTIIRKVDQINLKYHKEKLTELSDKIINHDLLIDNAIEKY
FT                   LVELSAVFNTSDNSLIKRNLIQSLYDPSVNKEFNQFLMDGMNFEQWQEITNKDYGNYNL
FT                   TERTYQVIEIIHAIYDTPHLIDNLSELSKNRLNAFFDEGNKGILSRVLLSKISSFELYK
FT                   ETINNLKKLAVISQSDEEISALSPTEALNKLNEFKGEVNLATSEDSSTISSKVEINNLV
FT                   IDKRLLCYLGAKINGESIDAIDLNQIENWDKKITFDPQHLNDYFLSVTGNEKDKEVIAL
FT                   LRYLLNNKQDKIKYFLSHMSSRADYVAAHERLMKIIALGSKQYNQQDWENLRIPSLKIP
FT                   RHMRVISKIGYANISFGIWQSINSTFMLAEQLNNPLLTPQEHREIINNLAITWSEMAYN
FT                   GLSELIEIALAKGLLKYRNNPLEYISKTSTRIGIGLNILSIGFDIYNIYDNFSRISVEK
FT                   NEKRRIDYIVNGSLAIVSGLVTLGVSIAMLAGSTVAGPIGIVAGAVIALAISIYNAARL
FT                   IEEAKEKIGFTPLEELNNGFYAFLMGDILPSKKNEIVYLETISQLETMIDQNAQEHLKE
FT                   IKKQEPHSYYFYTNEKQFYEEHHYYKVIPRILGKTLDNILNPFGEIVVQRVAKNLSKEE
FT                   AEKIAALSHYLSVERTEYKYYVPKEAIATDEILIFDMDFYVNQLNRYTINFAFEDDNPV
FT                   FEDEVDISFFDKIRTTKEKTWQNLSSGELTDDLIKSTAEKQYFEPSWRENELFYFNTYN
FT                   GDDIIAAPLITQNIFDVHNGTKRLSGGEKDDTFNVFTSESPRYASRFYGREGNDTLRII
FT                   QTEKKYIGYEVNLSKNYIKFIGGENKSNSQSFHARLFIFQEQGQIYTHKLADTMPNITL
FT                   QRQPVIAYLESIENVVGSEIGNDIIYGDQKNNYLNGMGGVDSLYGLAGDDTLVLREGYA
FT                   QGGAGNDSYTILRASNTDNNVKQLETIIDEETHTEASLIQLNYTFDEIAAISRRETDIV
FT                   FTLKVGNDKDPDQFIEHLIALSHVYQDKNSQLLAHRYTIVTMDGFILTINENNNQPREV
FT                   SYNFSYLEKYNQQEKLQQLSVNDDKHTLSIQSENKTKLIQLLPELQYSGFSSGEHLKLN
FT                   LQGNSENNHYAGIAAHSSIKLSRGYDNYQISSLLAKNRNEKIIISLSDNDKQLTSDCTS
FT                   HFFLSDVSGFDLMFSDGVLSHRYNPDAHIKLVFDTESVSAIFNSGMTLQFIDKDNRVFH
FT                   LPKPDSGQRLLIPTITLDVRLSHQSDVLMIPPSLRLNKEALSLYPQYFHREEPSSRSTQ
FT                   LQRIISTQTLEPYPLKVTELLRDDIAVNDNQPVNSILSLNKLFSNRSQDIFSQAIDLLP
FT                   MIELMDGDDIVVNHNQSSSVIDGGKGDDHIVVNEGHHILIAGEGNDNLNGGSGHDLFIS
FT                   TSGNDYLGGGSGNNVYVVQKRHGEVTVYDEGEMSHIFVSGLSEHEKLISSQAGKDKQYR
FT                   TADNQFVLTVKTNRVEKIETDPVKVIEKEQTLSMGSLATIIQQMAQFNQQQLSTMQGSD
FT                   VIPSSNWSPLAVVVKHL"
FT   misc_feature    8645..8680
FT                   /note="PS00141 Eukaryotic and viral aspartyl proteases
FT                   active site."
FT   misc_feature    join(10316..10384,10397..10465)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0004 by TMHMM2.0 at aa 1705-1727 and 1732-1754"
FT   misc_feature    11225..11278
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 5.6"
FT   misc_feature    11582..11635
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 6.2"
FT   misc_feature    11636..11689
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.072"
FT   misc_feature    13013..13066
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 2.4"
FT   misc_feature    13067..13120
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.011"
FT   misc_feature    13121..13174
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.48"
FT   CDS_pept        complement(13618..14403)
FT                   /transl_table=11
FT                   /locus_tag="PMI0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40245"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4F2V1"
FT                   /protein_id="CAR40245.1"
FT                   /translation="MLITISPAKTLDFESPLATTQFTQPELLKYSQQLITECRKLSSSD
FT                   IASLMKISDKLAGLNAARFGEWQPDFTPDNARQAILAFKGDVYTGMQAAELFTDDDFQF
FT                   AQQHLRILSGLYGVLRPLDLMQPYRLEMGIKLNNKKGSDLYQFWGNIITETLNNALEAQ
FT                   GDNILVNLASDEYFKSVNPKKLNAEIIKPVFLDEKNGKYKVISFYAKKARGLMSRFIIQ
FT                   ERLSDKAQLKEFNLEGYQFNAAESEGNTLVFKRAEHLAK"
FT   misc_feature    complement(13633..14403)
FT                   /note="HMMPfam hit to PF03883, Protein of unknown function
FT                   (DUF328), score 3.4e-167"
FT   CDS_pept        14706..15659
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="PMI0006"
FT                   /product="transaldolase B"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40246"
FT                   /db_xref="GOA:B4F2V2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4F2V2"
FT                   /protein_id="CAR40246.1"
FT                   /translation="MTNKLTSLRKLTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDEAIEWARSQSDSREQQIVDACDKLAVNIGLEILKLIPGRISTEVDARLSYD
FT                   TEACIVKARRLIKLYNEAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVYLISPFVGRIMDWYKANTDKKEFAPAEDPGVISVTEIYNYYKEHGYNTVV
FT                   MGASFRNIGEILELAGCDRLTISPALLKELSEAQGEVEHKLSFNGEVKSRPAPITEAEF
FT                   YWQHNADPMAVDKLSDGIRKFAVDQEKLEKMIADLL"
FT   misc_feature    14742..15644
FT                   /note="HMMPfam hit to PF00923, Transaldolase, score
FT                   2.5e-174"
FT   misc_feature    14796..14822
FT                   /note="PS01054 Transaldolase signature 1."
FT   misc_feature    15090..15143
FT                   /note="PS00958 Transaldolase active site."
FT   CDS_pept        15844..16827
FT                   /transl_table=11
FT                   /locus_tag="PMI0007"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40247"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2V3"
FT                   /protein_id="CAR40247.1"
FT                   /translation="MKKMVLATVLASLFFSSVAMSEDKTAFSLPAIEKSAEEGNAASQY
FT                   QLGVKYEGGEGVEQNTQKALEWYTKAAEQGHAEAQLNLALMYDMNDDIERDAEKAVYWY
FT                   NKAAVQGLSLAQYNLAVSFDEGDGVEQDHEKAVYWYTKAGEQGDSDAQYNLAISYDEGI
FT                   GIEQDHEKAVTWYTKAAEQGHADAQYNLAVSYDEGEGVERDGSKAVFWYTKAANQGNRD
FT                   AQNNLGVMYDEGDGVAKDQRKANEWYKKAALQGNGLAQNNLAINYYYGKGVKRNLKEAY
FT                   AWFAVAVENGEGDEAMLKRTARALNAAQLAEAKLLAASYIAKYLDD"
FT   misc_feature    15844..15906
FT                   /note="Signal peptide predicted for PMI0007 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.975 between residues 21 and 22"
FT   CDS_pept        16989..17576
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="PMI0008"
FT                   /product="molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40248"
FT                   /db_xref="GOA:B4F2V4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2V4"
FT                   /protein_id="CAR40248.1"
FT                   /translation="MNELRIGLVSVSDRASSGVYEDKGLPALEAWLKKAITTPFHIESR
FT                   LIPDEQLMIEQTLCELVDEAGCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMR
FT                   QISLKFVPTAILSRQVGVIRNQALILNLPGQPKAIAETLEGLKDSEGQVIVSGIFASIP
FT                   YCIQLLDGPYIETNEEIVVAFRPKSARRSTSA"
FT   misc_feature    16998..17426
FT                   /note="HMMPfam hit to PF00994, Probable molybdopterin
FT                   binding domain, score 4.5e-41"
FT   misc_feature    17193..17234
FT                   /note="PS01078 Molybdenum cofactor biosynthesis proteins
FT                   signature 1."
FT   CDS_pept        18101..20026
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="PMI0009"
FT                   /product="chaperone protein DnaK (heat shock protein 70)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40249"
FT                   /db_xref="GOA:B4F2V5"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4F2V5"
FT                   /protein_id="CAR40249.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVMDGKNARVIENGEGDRTTPSIVAYAQD
FT                   GEILVGQPAKRQAVTNSQNTLFAIKRLIGRRFEDAEVQRDVSIMPYKIIKADNGDAWVE
FT                   ARNEKMAPPQVSAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   DVKRIINEPTAAALAYGLDREVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTYEVLSTN
FT                   GDTHLGGEDFDSRLINYLVDEFKKEQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYVTADATGPKHLNIKVTRAKLESLVEDLVKRSMDPVKVALEDAGLKVSEVNDVILV
FT                   GGQTRMPMVQKTVAEFFGKEPRKDVNPDEAVAMGAAVQGGVLAGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTSLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFN
FT                   LDGIQPAPRGMPQIEVTFDIDADGILHVSAKDKNSGREQNITIKASSGLNEEEIQKMVR
FT                   DAEANAEADRKFEELVQTRNQADQLVHGTRKQIEEAGDKLAANDKEAIEKALSELEIAS
FT                   KGEDKAAIEAKLQALVEASKPLLEIAQQQAQAGAGNTADATDAGAKKDDDVVDAEFEEV
FT                   DGKDKK"
FT   misc_feature    18110..19912
FT                   /note="HMMPfam hit to PF00012, Hsp70 protein, score 0"
FT   misc_feature    18119..18142
FT                   /note="PS00297 Heat shock hsp70 proteins family signature
FT                   1."
FT   misc_feature    18674..18715
FT                   /note="PS00329 Heat shock hsp70 proteins family signature
FT                   2."
FT   misc_feature    19109..19153
FT                   /note="PS01036 Heat shock hsp70 proteins family signature
FT                   3."
FT   CDS_pept        20133..21269
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="PMI0010"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40250"
FT                   /db_xref="GOA:B4F2V6"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4F2V6"
FT                   /protein_id="CAR40250.1"
FT                   /translation="MAKRDFYEVLGLSKTADEKEIKRAYKRLAMKYHPDRNQGDKDSES
FT                   KFKEIKEAYEVLSDPQKRAAYDQYGHAAFEQGGFGGQGGGGFGGADFSDIFGDVFGDIF
FT                   GGGRRQQRAARGSDLQYNMDLTLEEAVRGITKEIRIPTLETCDKCHGSGAKEGTSAETC
FT                   STCHGAGQVHLRQGFFTVQQPCPTCHGRGKVIKEPCSKCHGDGRVERYKTLSVKIPAGV
FT                   DTGDRIRLSGEGEAGEQGAPAGDLYVQVHVRQHHIFERDGNNLYCEVPINFAVAALGGE
FT                   IEVPTLDGRVKLKIPAETQTGKMFRMKGKGVKSVRSHGVGDLMCRVVVETPVKLNEKQK
FT                   QLMEQLGESFGGKGGEKNTPRSKSFLDGVKKFFDDLTK"
FT   misc_feature    20145..20342
FT                   /note="HMMPfam hit to PF00226, DnaJ domain, score 7.5e-41"
FT   misc_feature    20271..20330
FT                   /note="PS00636 Nt-dnaJ domain signature."
FT   misc_feature    20529..20771
FT                   /note="HMMPfam hit to PF00684, DnaJ central domain (4
FT                   repeats), score 1.4e-41"
FT   misc_feature    20568..20642
FT                   /note="PS00637 CXXCXGXG dnaJ domain signature."
FT   misc_feature    20568..20585
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    20619..20636
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    20727..20744
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    20808..21173
FT                   /note="HMMPfam hit to PF01556, DnaJ C terminal region,
FT                   score 1.2e-77"
FT   CDS_pept        21812..22990
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="PMI0011"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40251"
FT                   /db_xref="GOA:B4F2T1"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4F2T1"
FT                   /protein_id="CAR40251.1"
FT                   /translation="MTAIIRQFLRLEASGGILLIVAAIIALIMANTPLSALYNEFLSIP
FT                   IMIKFGALELDKPLILWVNDALMAIFFLVVGLEVKRELKEGSLAQRDRAIFPAIAAVGG
FT                   MLAPALIYLFFNHGDAIGQQGWAIPAATDIAFALGVMALLGRRVPVELKVFLLALAIID
FT                   DLGVIVIIALFYSKSVALVPLLLAALITIMLFILNWRKVSNTAVYLVLGFILWVCILKS
FT                   GIHATIAGVIVGFLIPLRDKEGASPSEELEHVLHPWVAYLILPLFAFSNAGVSLNGVTL
FT                   DGMLSTLPVGIALGLFLGKPIGIFLFSWVSVKLGIAKLPDAINLKQIFAVSVLCGIGFT
FT                   MSIFIAGLAFEGAIEAYNTYSKLGILVGSTMAAVVGYLLLNSVLPKLKQKQK"
FT   misc_feature    21812..21901
FT                   /note="Signal peptide predicted for PMI0011 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.952) with cleavage site
FT                   probability 0.719 between residues 30 and 31"
FT   misc_feature    21824..22951
FT                   /note="HMMPfam hit to PF06965, Na+/H+ antiporter, score
FT                   3.9e-234"
FT   misc_feature    join(21857..21925,21983..22042,22091..22159,22187..22246,
FT                   22265..22333,22346..22408,22427..22522,22580..22648,
FT                   22667..22735,22793..22861,22898..22966)
FT                   /note="11 probable transmembrane helices predicted for
FT                   PMI0011 by TMHMM2.0 at aa 16-38, 58-77, 94-116, 126-145,
FT                   152-174, 179-199, 206-237, 257-279, 286-308, 328-350 and
FT                   363-385"
FT   CDS_pept        23179..24075
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="PMI0012"
FT                   /product="transcriptional activator protein NhaR"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40252"
FT                   /db_xref="GOA:B4F2T2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2T2"
FT                   /protein_id="CAR40252.1"
FT                   /translation="MRVSHLNFNHLYYFWHVCKEGSVVGAAEALYLTPQTITGQIKALE
FT                   ERLGGKLFKRQGRGLVPSELGQLIFRYADKMFMLSQEMLDIVNYSRESNLLFDVGVADA
FT                   LSKQLVSRVLETAVIDHEQIHLRCFESTHELLLEQLSQHKLDMILSDCPVDSSQQEGLF
FT                   SVKLGECSVSFFCSQPIPEKPFPECLEDRKLLIPGRRSMLGRHLLTWIRNKNLQVEILG
FT                   EFDDAALMKAFGLNHNAIFVAPSIYTNETFVQSNIEEIGTLDSVKEEYYVIFAERMIQH
FT                   PAVQRVCNTDFSALFSG"
FT   misc_feature    23200..23379
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protei, score 5.7e-19"
FT   misc_feature    23242..23334
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   CDS_pept        complement(24170..24430)
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="PMI0013"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40253"
FT                   /db_xref="GOA:B4F2T3"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4F2T3"
FT                   /protein_id="CAR40253.1"
FT                   /translation="MANIKSAKKRAVQSEKRRQHNASRRSMMRTYIKKVYAAVASGDKE
FT                   AAQKAFNDMQPIVDRQATKGLIHKNKAARHKANLQAQIKAM"
FT   misc_feature    complement(24176..24427)
FT                   /note="HMMPfam hit to PF01649, Ribosomal protein S20, score
FT                   4.7e-44"
FT   CDS_pept        24861..25802
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="PMI0014"
FT                   /product="riboflavin biosynthesis protein (includes:
FT                   riboflavin kinase and FMN adenyltransferase)"
FT                   /EC_number="2.7.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40254"
FT                   /db_xref="GOA:B4F2T4"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2T4"
FT                   /protein_id="CAR40254.1"
FT                   /translation="MELIRGIQNIRAQHHGCVLTIGNFDGVHRGHQALLKHLKQEASRR
FT                   GLPTVVMTFEPQPLEFFLPEKAPARLTRLRDKIKYLAECGIDYLLCVKFDKQFAAQTPE
FT                   EFVSSLLVDKLGVKFLAIGDDFRFGKNRAGDFHFLQQAGARYGFEVANTESYCDKGLRI
FT                   SSTAVREALFNDDLALAESLLGHPYSVCGRVVHGNQLGRTIGFPTANIPMKRLVAPVAG
FT                   VYAVDVYLADHQSPLAGVANIGSRPTVKGKGVQLEVHLIDVNMDLYGRRIDVVLRKKLR
FT                   NEQRFASLDALKQQIANDVAAARDFLLQRSES"
FT   misc_feature    24903..25361
FT                   /note="HMMPfam hit to PF06574, Riboflavin kinase
FT                   (Flavokinase), score 3.3e-92"
FT   misc_feature    25407..25784
FT                   /note="HMMPfam hit to PF01687, Riboflavin kinase / FAD
FT                   synthetase, score 2.7e-60"
FT   CDS_pept        25832..28642
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="PMI0015"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40255"
FT                   /db_xref="GOA:B4F2T5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4F2T5"
FT                   /protein_id="CAR40255.1"
FT                   /translation="MSDYKNTLNLPETGFPMRGDLAKREPEMLSRWYKEGLYQAIRQAK
FT                   SGKKTFILHDGPPYANGNIHIGHSVNKILKDIIIKSKGLSGFDSPYIPGWDCHGLPIEL
FT                   KVEQIVGKPGEKVSAAQFREECRKYAYEQIEAQKKDFIRLGVLGDWDKPYLTMDYKTEA
FT                   NTIRALARIIANGHLLKGAKPVHWCTACGSSLAEAEVEYYDKTSPSIDVRFRAVDSNAV
FT                   AAKFGVVTDKPISLVIWTTTPWTLPANRAIALNGEFNYALVSFDDECVILAADLVEHVM
FT                   KRIGVTDWAVLGECKGSDLELLRFNHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGPD
FT                   DFVIGQKYGLEVANPVGPNGCYLPNTYPTLDGVFVFKANDVIVELLKEKGALLHHEAMQ
FT                   HSYPCCWRHKTPVIFRATPQWFIGMDKNGLRQQSLKEIKGVKWIPDWGQARIESMVENR
FT                   PDWCISRQRTWGTPMSLFVHKETQEPHPRTLELMEEVAKRVEVSGIQAWWDLDIRELLG
FT                   DEADDYMKTPDTLDVWFDSGSTHSTVVDARPEFHGNSADLYLEGSDQHRGWFMSSLMIS
FT                   TAIKGKAPYREVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLGADILRLWVASTDYTG
FT                   EIAVSDEILKRSADTYRRIRNTARFFLANLNGFDPAKHQVKPEEMVILDRWAVGRAKAA
FT                   QEDILKHYENYDFHNVIQRLMQFCSVEMGSFYLDIIKDRQYTAKSDSVARRSCQTALYH
FT                   IIEALVRWMAPIMSFTADEIWAQLPGERAKFVFTQEWYTDLFGLEASETLNDEYWAELL
FT                   AVRSEVNKVLEQARTDKQLRGSLEAAVTLYADKALAEKLNALGNELRFVLLTSQATVAD
FT                   IHDAPENALASDMAGLKIVLSKAQGEKCPRCWHYATDIGQVAEHADLCGRCVTNVAGNG
FT                   EERKFA"
FT   misc_feature    25910..27751
FT                   /note="HMMPfam hit to PF00133, tRNA synthetases class I (I,
FT                   L, M and V), score 0"
FT   misc_feature    26003..26038
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   misc_feature    28517..28606
FT                   /note="HMMPfam hit to PF06827, Zinc finger found in FPG and
FT                   IleRS, score 1.6e-13"
FT   CDS_pept        28643..29161
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="PMI0016"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40256"
FT                   /db_xref="GOA:B4F2T6"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2T6"
FT                   /protein_id="CAR40256.1"
FT                   /translation="MMKKTLCSTGLRWLWLAIAVVVLDLGTKQYFMQTFRLYESVAVMP
FT                   FFNFTYAHNYGAAFSFLADKGGWQRWFFALIALAICIVLVVMMYKNKASTKLSNIAYAL
FT                   IIGGALGNLSDRLIHGFVIDFLDFYVGDWHWPTFNIADVSICLGAGLIIIESFFPDKNA
FT                   SPQEANKQK"
FT   misc_feature    28673..29131
FT                   /note="HMMPfam hit to PF01252, Signal peptidase (SPase) II,
FT                   score 2.7e-75"
FT   misc_feature    join(28679..28747,28844..28903,28940..29008,29051..29119)
FT                   /note="4 probable transmembrane helices predicted for
FT                   PMI0016 by TMHMM2.0 at aa 13-35, 68-87, 100-122 and
FT                   137-159"
FT   misc_feature    28700..28735
FT                   /note="PS00327 Bacterial rhodopsins retinal binding site."
FT   CDS_pept        29232..29702
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="PMI0017"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40257"
FT                   /db_xref="GOA:B4F2T7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2T7"
FT                   /protein_id="CAR40257.1"
FT                   /translation="MSMQILNNSAVLLNFTLKLADGSVAESTQAHGKPALFRLGDESLS
FT                   PALEAELVGLKEGEKKTFTLAGEHIFGKYNPDLIQYFMPSDFAQSGIPETGTIMLFTAM
FT                   NGNEMPGIVQEVTEDSVTVDFNHPLALQDVTFDIEVVSIDPQEETTNANIAG"
FT   misc_feature    29232..29654
FT                   /note="HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl
FT                   cis-trans isomeras, score 9.4e-05"
FT   misc_feature    29268..29315
FT                   /note="PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1."
FT   CDS_pept        29683..30636
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="PMI0018"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40258"
FT                   /db_xref="GOA:B4F2T8"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4F2T8"
FT                   /protein_id="CAR40258.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVERALEIYGAPIYVRHEVVHNRYV
FT                   VNDLRERGAIFIEEISEVPDNAILIFSAHGVSQAIRQEARSRNLTMLFDATCPLVTKVH
FT                   MEVARASRKGKEAILIGHAGHPEVEGTMGQYNNPEGGMYLVESPDDVWKLKVKDEDNLC
FT                   FMTQTTLSVDDTSEVIDALNKRFPKIIGPRKDDICYATTNRQEAARELAERADVVFVVG
FT                   SKNSSNSNRLAELAQRAGKPSYLIDSAEDIDEIWVSHANIVGVTAGASAPDILVQQVLA
FT                   RLKAFGAEEVIELSGREENIVFEVPKELRLDYKVVE"
FT   misc_feature    29689..30540
FT                   /note="HMMPfam hit to PF02401, LytB protein, score 1e-177"
FT   CDS_pept        30879..31700
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="PMI0019"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.3.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40259"
FT                   /db_xref="GOA:B4F2T9"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4F2T9"
FT                   /protein_id="CAR40259.1"
FT                   /translation="MSATELRLAVVGAGGRMGRQLIQAINQQQGVVLGAAFERTNSSLI
FT                   GADAGELAGIGHIGITVTDNLLAQVGQFDILIDFTRPEGTLSHLAFCVEHHKGMIIGTT
FT                   GFDEEGKKAINCAAQTIPIVFAANFSVGVNLVLKLLEKAAKVMGSYSDIEIVEAHHRHK
FT                   VDAPSGTALAMGESIAETLGRDLKDCAVYQRVGHTGERDPRSIGFATIRAGDIVGEHTA
FT                   IFADIGERVEISHKASSRMTFANGAVKSAIWLSEKKSGLYNMKDVLSLEEL"
FT   misc_feature    30894..31265
FT                   /note="HMMPfam hit to PF01113, Dihydrodipicolinate
FT                   reductase, N-terminus, score 2.8e-58"
FT   misc_feature    31272..31685
FT                   /note="HMMPfam hit to PF05173, Dihydrodipicolinate
FT                   reductase, C-terminus, score 2e-77"
FT   misc_feature    31338..31391
FT                   /note="PS01298 Dihydrodipicolinate reductase signature."
FT   CDS_pept        32136..33299
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="PMI0020"
FT                   /product="carbamoyl-phosphate synthase small chain"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40260"
FT                   /db_xref="GOA:B4F2U0"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2U0"
FT                   /protein_id="CAR40260.1"
FT                   /translation="MIKSAILVLEDGTEFHGRSIGAEGAAIGEVVFNTSMTGYQEILTD
FT                   PSYSQQIVTLTYPHIGNTGVNSSDEESATIHAQGLIIRDLPLVMSNYRAEESLADYLKR
FT                   HQIVAIADIDTRKLTRLLREKGAQNGCIIAGTHLDAKQALEKAKAFPGLKGMDLAKTVT
FT                   VEQPYQWTQGSWTLKGELPATQSPQDLPLHVVAYDFGVKRNILRMLVDRGCRVTVVPAQ
FT                   TSAQEVLALSPDGIFLSNGPGDPEPCDYAIDAIQTFLTTDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDLDNNSVMITAQNHGFAVDEASLPDCLRVTHKSLFDGSLQGI
FT                   HRTDKAAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRQNLQSVTNK"
FT   misc_feature    32145..32588
FT                   /note="HMMPfam hit to PF00988, Carbamoyl-phosphate synthase
FT                   small ch, score 1.1e-91"
FT   misc_feature    32718..33254
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 1.8e-75"
FT   misc_feature    32925..32960
FT                   /note="PS00442 Glutamine amidotransferases class-I active
FT                   site."
FT   CDS_pept        33316..36543
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="PMI0021"
FT                   /product="carbamoyl-phosphate synthase large chain"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40261"
FT                   /db_xref="GOA:B4F2U1"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2U1"
FT                   /protein_id="CAR40261.1"
FT                   /translation="MAKRTDIKTILILGAGPIVIGQACEFDYSGAQACKALREEGYRVV
FT                   LVNSNPATIMTDPEMADATYIEPIHWQVVRKIIEKERPDAILPTMGGQTALNCALELER
FT                   QGVLAEFGVTMIGATADAIDKAEDRQRFDKAMKKIGLDTARSGIAHTMDEAFAVAEQVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICTRGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVDPKTGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGTNDRLTTQMKSVGEVMAIGRTQQESMQKAL
FT                   RGLEVGATGFDPKVNLDDPEALTKIRRELKEAGSDRIWYIADAFRAGMSVDGVFNLTNI
FT                   DRWFLVQIEEIVRLEEQVAQLGLAGLNADFLRQLKRKGFADARLANILNVKEQAIRQLR
FT                   EQYQLHPVYKRVDTCAAEFATDTAYMYSTYEEECESDPNQDKPKVMVLGGGPNRIGQGI
FT                   EFDYCCVHAALALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   QGVIVQYGGQTPLKLARALEAEGVPVIGTSPDAIDKAEDRERFQKAVDKLGLKQPENAT
FT                   VTTLEEAVDKAKSIGYPLVVRPSYVLGGRAMEIVYDEIDLRRYFQTAVSVSNDAPVLLD
FT                   RFLDDAIEVDVDAICDGQQVVIGGIMEHIEQAGVHSGDSACSLPAYTLSQDIQDIMRKQ
FT                   VRELAFELGVKGLMNVQFAVKGNDVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMIG
FT                   QSLEQQGVTKEVIPPYYSVKEVVLPFNKFSGVDPILGPEMRSTGEVMGVGATFAQAFAK
FT                   AMLGSNSTMKKKGRALLSVREGDKKRVVDLATKLLKNGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYDYIVNTTAGRQAIEDSKLIRRSALQYKVHYDTTLNGGF
FT                   ATTLSLSADPTIDVISVQEMHAKIKKS"
FT   misc_feature    33316..33384
FT                   /note="Signal peptide predicted for PMI0021 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.936) with cleavage site
FT                   probability 0.838 between residues 26 and 27"
FT   misc_feature    33331..33693
FT                   /note="HMMPfam hit to PF00289, Carbamoyl-phosphate synthase
FT                   L chain,, score 4e-63"
FT   misc_feature    33355..33387
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    33697..34407
FT                   /note="HMMPfam hit to PF02786, Carbamoyl-phosphate synthase
FT                   L chain,, score 7.5e-135"
FT   misc_feature    33805..33849
FT                   /note="PS00866 Carbamoyl-phosphate synthase subdomain
FT                   signature 1."
FT   misc_feature    34204..34227
FT                   /note="PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2."
FT   misc_feature    34585..34956
FT                   /note="HMMPfam hit to PF02787, Carbamoyl-phosphate
FT                   synthetase large c, score 9.9e-68"
FT   misc_feature    34987..35331
FT                   /note="HMMPfam hit to PF00289, Carbamoyl-phosphate synthase
FT                   L chain,, score 1.1e-26"
FT   misc_feature    35335..36000
FT                   /note="HMMPfam hit to PF02786, Carbamoyl-phosphate synthase
FT                   L chain,, score 9.3e-29"
FT   misc_feature    35443..35487
FT                   /note="PS00866 Carbamoyl-phosphate synthase subdomain
FT                   signature 1."
FT   misc_feature    35830..35853
FT                   /note="PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2."
FT   misc_feature    36181..36441
FT                   /note="HMMPfam hit to PF02142, MGS-like domain, score
FT                   1.6e-32"
FT   CDS_pept        37025..37168
FT                   /transl_table=11
FT                   /locus_tag="PMI0022"
FT                   /product="putative cell killing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40262"
FT                   /db_xref="GOA:B4F2Y9"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Y9"
FT                   /protein_id="CAR40262.1"
FT                   /translation="MTKITLFGITVVCVTVLMFALIVGERLCSLNISNGNMVVQAILMC
FT                   HQ"
FT   misc_feature    37025..37165
FT                   /note="HMMPfam hit to PF01848, Hok/gef family, score
FT                   2.3e-07"
FT   misc_feature    37034..37093
FT                   /note="1 probable transmembrane helix predicted for PMI0022
FT                   by TMHMM2.0 at aa 4-23"
FT   CDS_pept        complement(37240..44316)
FT                   /transl_table=11
FT                   /locus_tag="PMI0023"
FT                   /product="putative intimin/invasin"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40263"
FT                   /db_xref="GOA:B4F2Z0"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015217"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Z0"
FT                   /protein_id="CAR40263.1"
FT                   /translation="MTTLNNVPSPRPSSITRKVAWLNIFIQLAFPIVTTMPTQTFANEN
FT                   NFKKHNISDINQQNTYQVKAGDTPESIAKKFNIKLFKLIEANPQHVSLTGELKINDGTI
FT                   LNIPNEYLLKKKWLNNQDEAIPSTEGEELAKIIVDNSFLLNKDIDVTQYAISQISSKSN
FT                   QKIEQWLNQFGHARVSLSADKNLTLKNSSAELLIPLYEQKEKLIFAQTNYHRKDLRSQF
FT                   NYGIGYRYFTEKFMVGINGFYDHDLTHHHNRLGIGAEIWRDYFKLSSNHYHRLSSWRAS
FT                   NNILDYSERPANGWDIRTEGYFPAYPQLGTKLIFEQYYGKEVGLFGKDKRDKNPHTYTL
FT                   GINYTPIPLVTLNAERRIGLHDRADNNLNINLSYRIGESLASQLNPDNVKAIRTLAGSR
FT                   YDFVNRNNDMILEYKKETLVFLSMVDSINGYAKEERDLQVQVKTKYPLANIEWSASKLN
FT                   AQGGQIKHHGGTHYTVILPQYQIGAIEKNSYIISAVAIDTHGNRSAPVQTTVIVDKSLI
FT                   NTRNSLFSPKQSQLFANGEATQKLILSIVDNDNLPVDIDSKEITLQQQSDTEKGNSRIS
FT                   TFSRLAAGKYQLTVTAGSIPEKLTLTPVFRDNTFNSATVTLIADNQTAHIAKGNLTVTK
FT                   DNEPADGKSQNKIKVRVTDSNHNPLAHYPVNFTASNGANVISSRKTDEQGEIIASVTNT
FT                   QVGSSQIGVQVKGITYSTEVHFSVDNDSAYIPQQNFTITPPLSLADGKTEKTISLQVVD
FT                   KQNNPIPATHVTLSADNQAQLKQTILTTDEQGKATTTMISKVAGTVTVRAKINDKMTHA
FT                   TTQFIANQAKGVIVSITPSSTTHVADGQTPVFLTALVQDQFGKPLPHAQISWETEHDKS
FT                   IVNIEHTTMTNEQGITTNKLTSTQALSVRVTARINNNAFTAEPITFIANGQQALISELL
FT                   VNKNQIVADKQDPAELTAIVTDKLGNQLPDTIVNWQGSAGTQFAQQQTKTDAQGIAKNT
FT                   LTTSQSGITTITARLNNGQHAQTNLVAVADLKSATLTLTTLNNKQSAIADNQDSITVVA
FT                   NLTDAYHNPLKNIPVYWQSSINHIDETTTQTDEKGRTQVVISGTKAQPTTITAYLSNKE
FT                   KKSIQVTFVAGAPVQQNSYLTIEPQSIIADGNAFAVGKIDLRDKFDNPVIGRSNDIALI
FT                   GDNSTIQFSKITETANGNYQAHIRGTKAGLSQITATIDSITVTQSLGFLTDNKTVKIHS
FT                   VKVMAPYTVTANGKDKVIIQAQITDKHNNPVSKGVTVGWISDLGKLAAPLSMTNKQGIA
FT                   EITLSSTQAGKAKVTAVLNNQQSVNADHIVTFTEGDISASLSTVAIFPDTIVAGANKAT
FT                   VTITLKDKEGNLLPNLANKITLTPQTNLQTTITPFKEKQKGIYQAQVSALKTGKTSLSA
FT                   HVAPLAIKQSVSLTVLPNNTTAKVKNFTISNIQPHAGESITYKAYLVDNHDNPVGMGVP
FT                   VAWSTNEGSQLETPLTFTDDNGVAIVGLSRRSVGVAKVSAILETGTYIADDVHFLTGHI
FT                   DETMSELSLNPSQIIANGKDKALLTFVIKDKNGNIIPNQQVSGFSKNPTIKFSQAQQIS
FT                   PGRYEIEITGTQSGTAQIGVMVNGTHFKKQKILQLNADVTTWKIRAVEVDRTTITAGDK
FT                   GVNYQATVVDANNNVLPNVIVSWKLLGSADDYHYSTYTNDKGIATNRVTSHVAGRLKMS
FT                   AYLDSNNYKSTQDITVIPAEIDIHKSTFNSHRRSINADNKDSTLLSVKLMDKYGNTIDG
FT                   KNVEIKTISGKPNFSDNPLKSVGNGEYQTNVTANTMSDIILTAQAETITIAEPLTIKVA
FT                   IPKSEITFEKPIQQEIYKSTVIDALSYKGVPQNMQVIWSSSDPTVASIDTTSGQISMKK
FT                   AGTTIITLQTLGNEQYPSAKNSYPLVIEKAPPKLKVTSPHTIQSIWNDGITHQITAEFD
FT                   NPEVKNTPIHFSSSDTLVATIDSKGNLTAIKPGKTKIVIQSDATDKFLADSQTVDYQQE
FT                   KAALSYYFKKNYIVLTTDSAADKLLMAQSPTPDVPVEANATWYSSQPNIVEITPDGIIK
FT                   NLNIGQTTLTLEVKNNNYFQDHEQSYNVIIQASPRITINSFEFLSAGESKSNTHLDDLT
FT                   WQPLYTSDDQFIVKWSSSDTPKAINFELFDENGTSIALEERQNYAPKHNIHDPVKIQVP
FT                   KQYLTSPKQLTLEVTTFDSNNQPYVDPKKYKINIDYFPANNAYKIISLDYNSKFIYTDT
FT                   GALASSCQNGWSTTTTHLILTPRLVFKGEPKNLLYPIYITTELYDVTLNPSDKLIGHIN
FT                   EKLTYPDKIIFSEHSKKIAEISPTSAHYALDEECRINDSGHGTLKANITIGNRSSYLKK
FT                   EFHWDGQIGGYF"
FT   misc_feature    complement(39769..40044)
FT                   /note="HMMPfam hit to PF02369, Bacterial Ig-like domain
FT                   (group 1), score 0.00024"
FT   misc_feature    complement(40375..40659)
FT                   /note="HMMPfam hit to PF02369, Bacterial Ig-like domain
FT                   (group 1), score 2.6e-07"
FT   misc_feature    complement(40972..41250)
FT                   /note="HMMPfam hit to PF02369, Bacterial Ig-like domain
FT                   (group 1), score 4.2e-07"
FT   misc_feature    complement(41272..41559)
FT                   /note="HMMPfam hit to PF02369, Bacterial Ig-like domain
FT                   (group 1), score 2.8e-07"
FT   misc_feature    complement(41566..41868)
FT                   /note="HMMPfam hit to PF02369, Bacterial Ig-like domain
FT                   (group 1), score 1.4e-08"
FT   misc_feature    complement(41869..42147)
FT                   /note="HMMPfam hit to PF02369, Bacterial Ig-like domain
FT                   (group 1), score 1.9e-09"
FT   misc_feature    complement(42169..42465)
FT                   /note="HMMPfam hit to PF02369, Bacterial Ig-like domain
FT                   (group 1), score 1.1e-07"
FT   misc_feature    complement(43804..43869)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1048.000, SD 2.76 at aa 154-175, sequence
FT                   VTQYAISQISSKSNQKIEQWLN"
FT   misc_feature    complement(43993..44136)
FT                   /note="HMMPfam hit to PF01476, LysM domain, score 0.00023"
FT   misc_feature    complement(44191..44316)
FT                   /note="Signal peptide predicted for PMI0023 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.947) with cleavage site
FT                   probability 0.946 between residues 46 and 47"
FT   CDS_pept        complement(44615..45445)
FT                   /transl_table=11
FT                   /gene="dkgA"
FT                   /locus_tag="PMI0024"
FT                   /product="2,5-diketo-D-gluconic acid reductase A"
FT                   /EC_number="1.1.1.274"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40264"
FT                   /db_xref="GOA:B4F2Z2"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Z2"
FT                   /protein_id="CAR40264.1"
FT                   /translation="MSNPKLIQLSDGNTIPQLGLGVWQADNDQVIKAVHHALDTGYRLI
FT                   DTAAIYHNEEGVGKALKQSTIPRDELFITTKLWNNDQSHARGALLESLERLQLDYVDLY
FT                   LMHWPVPSRELYLDAWKQMIVLQKEGLVKSIGVCNFKEEHLERIITETGVSPVINQIEI
FT                   HPLMQQASLRAWNTTHNIVTESWSPLAQGGEGVFDQPIIQKLAEKYQKTPAQIVLRWHL
FT                   DSGLVVIPKSVTPSRIEENFHIFDFKLEKEEVAEIKQLDKGKRLGPDPDTFVDI"
FT   misc_feature    complement(44660..45421)
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family,
FT                   score 2.6e-127"
FT   misc_feature    complement(44714..44761)
FT                   /note="PS00063 Aldo/keto reductase family putative active
FT                   site signature."
FT   misc_feature    complement(45026..45079)
FT                   /note="PS00062 Aldo/keto reductase family signature 2."
FT   misc_feature    complement(45272..45325)
FT                   /note="PS00798 Aldo/keto reductase family signature 1."
FT   CDS_pept        complement(45473..46630)
FT                   /transl_table=11
FT                   /locus_tag="PMI0025"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40265"
FT                   /db_xref="GOA:B4F2Z3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Z3"
FT                   /protein_id="CAR40265.1"
FT                   /translation="MQNFTYYSPTRIHFGQGQIAKLRSEIGKNERILLTYGGGSIKRNG
FT                   ILDQVHAALPGYQIHEFGGIEPNPSYETLMKAVAYARYHGITHLLAVGGGSVVDGTKFI
FT                   AAAIPYQGEPWEIVTSRGQAIEKALPLSCVLTLPATGSETNCFSVISKKQTMDKQSFAS
FT                   PHVYPHCAILDPTATFSLPPRQTANGVVDAFIHILEQYLTYPVNALVQDEYAEGLLRIL
FT                   IEEGPKALTSPQDYDIRANIMWTASQALNGILGVGVPQDWATHALGHEITALHGLDHAQ
FT                   TLAIVLPALLNEKRQEKYAKLIQYAQKVWGIHQGSDAFKIDSAINETRKFFERMGLKTR
FT                   LSDFNISEADIPALVQKLQQHGQTALGEHQDITLEVSQRIYMAAL"
FT   misc_feature    complement(45515..46606)
FT                   /note="HMMPfam hit to PF00465, Iron-containing alcohol
FT                   dehydrogenase, score 2.7e-35"
FT   misc_feature    complement(45785..45847)
FT                   /note="PS00060 Iron-containing alcohol dehydrogenases
FT                   signature 2."
FT   misc_feature    complement(46034..46120)
FT                   /note="PS00913 Iron-containing alcohol dehydrogenases
FT                   signature 1."
FT   misc_feature    complement(46205..46222)
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT   CDS_pept        46818..47600
FT                   /transl_table=11
FT                   /locus_tag="PMI0026"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40266"
FT                   /db_xref="GOA:B4F2Z4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Z4"
FT                   /protein_id="CAR40266.1"
FT                   /translation="MKSHYLTLNQAHWDKQAAMQNQWSKPVDDKEIIEAKKGNWKVHLT
FT                   PNPVKKEWLADIKGKNILCLASAGGQQAPILAAAGGIVTVFDLSEGQLSKDSQLAQKHQ
FT                   LALTTQQGDMADLSVFSDESFDIVFHPISNLYVPDVNPVWQECYRVLRKNGVLMASFYN
FT                   PVVFVDDRNQALRAQGLMRPTYRLPYSDQNSLPSDILQEKIAKGDGLVFGHSLTDLIGG
FT                   QLRAGFLLQDFVEDFAPQARFLIDSYIPTFLASKAIKI"
FT   CDS_pept        complement(47778..48449)
FT                   /transl_table=11
FT                   /locus_tag="PMI0027"
FT                   /product="DedA-family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40267"
FT                   /db_xref="GOA:B4F2Z5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Z5"
FT                   /protein_id="CAR40267.1"
FT                   /translation="MGTLKEIIHALLQHDYMVLADPNILWIIYIVLFVIIMLENGVLPA
FT                   AFLPGDTLLILCGALIAKDVLHFLPTIIVLGTAASIGSWLGFLQGRWLSDTKVVKRWMA
FT                   QLPEQYHHKANDLFHRRGLYALLIGRFIGFVRTLLPTLAGLSELQQRRFQLFNWISGFL
FT                   WVGLIVSLGYILNLIPFIQKHETLVMNILMTLPVLLLTAGLIGSIVMYIRHRKSSNNSA
FT                   K"
FT   misc_feature    complement(join(47814..47882,47919..47987,48015..48083,
FT                   48186..48254,48312..48380))
FT                   /note="5 probable transmembrane helices predicted for
FT                   PMI0027 by TMHMM2.0 at aa 30-52, 72-94, 129-151, 161-183
FT                   and 196-218"
FT   misc_feature    complement(47877..48362)
FT                   /note="HMMPfam hit to PF00597, DedA family, score 5.9e-42"
FT   CDS_pept        complement(48574..49767)
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="PMI0028"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40268"
FT                   /db_xref="GOA:B4F2Y6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Y6"
FT                   /protein_id="CAR40268.1"
FT                   /translation="MTQKKPETSLLLSGRSKKYSQGAVNPIIQRTSSVIFDTVAQKREA
FT                   TQKRAEGALFYGRRGTTTHFALQEALTELEQGTGCALFPSGAAAITQSILAFIEQGCHI
FT                   LVTGSAYDPTQNFCDQILSKFSVTTTYFDPLIGTEISQLLRPETKIVFLESPGSITMEV
FT                   QDLQGIITAVRHYNPNIIIMIDNTWAAGLLLKPLTLGADISIQSATKYIIGHSDGMLGF
FT                   AVANQRCWPQLRENTYLLGQCADPDTAYMAARGLRTLAVRMKQHEQSGLEIARWLKQHP
FT                   LVDNVYHPALSSCPGHTYFQRDFTGSNGLFSFSLKKILTTEEFSRFLDNLSLFKMAFSW
FT                   GGFESLILGYHPNDIKAMRQYDTQPTLAGTLFRVHIGLENIDDLIEDLEQAFLRISN"
FT   misc_feature    complement(48589..49749)
FT                   /note="HMMPfam hit to PF01053, Cys/Met metabolism
FT                   PLP-dependent enzy, score 2.7e-134"
FT   misc_feature    complement(49120..49164)
FT                   /note="PS00868 Cys/Met metabolism enzymes
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        50098..51108
FT                   /transl_table=11
FT                   /gene="exbB"
FT                   /locus_tag="PMI0029"
FT                   /product="biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40269"
FT                   /db_xref="GOA:B4F2Y7"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014164"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Y7"
FT                   /protein_id="CAR40269.1"
FT                   /translation="MRNLTASIILAIGLTGSAFADTTPAKQTEQPATTATSSTASTQGT
FT                   ATTTIAPTAENTATPTGEAAKTATSETPVAEENTSTSTGDAAQTALEPENATQGATPEI
FT                   VTGGGFAEDLSVMGMYRNADLVVKSVMIGLLLASIVTWALFFAKGSYLLALRRRLRNES
FT                   AQLVEAKSLKEALAISQKFGNKSATADFFNDAELERTYSQDSHVASGIKERVEMRMERR
FT                   VAAIIRELGRGNGYLATIGAISPFIGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEA
FT                   LLATAIGLIAAIPAVIIYNIFARMISGYRGEIGDIATGVVTLVSRDLDIENSKSR"
FT   misc_feature    50098..50157
FT                   /note="Signal peptide predicted for PMI0029 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 20 and 21"
FT   misc_feature    join(50485..50553,50800..50868,50938..51006)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PMI0029 by TMHMM2.0 at aa 130-152, 235-257 and 281-303"
FT   misc_feature    50635..51051
FT                   /note="HMMPfam hit to PF01618, MotA/TolQ/ExbB proton
FT                   channel family, score 7.7e-50"
FT   CDS_pept        51115..51543
FT                   /transl_table=11
FT                   /gene="exbD"
FT                   /locus_tag="PMI0030"
FT                   /product="biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40270"
FT                   /db_xref="GOA:B4F2Y8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014170"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Y8"
FT                   /protein_id="CAR40270.1"
FT                   /translation="MAMNLGNDSGEDNELHDINVTPFIDVMLVLLIIFMVAAPLATVDI
FT                   KVNLPASSAKPQPRPEKPVYLTIKSDKQIFIGEEMVTHETMASVLDSMTQSNKETTIFF
FT                   QADKTVDYETLMGAMDSLRKAGYLKVGLVGMETVSSGN"
FT   misc_feature    51145..51525
FT                   /note="HMMPfam hit to PF02472, Biopolymer transport protein
FT                   ExbD/TolR, score 2.4e-20"
FT   misc_feature    51172..51240
FT                   /note="1 probable transmembrane helix predicted for PMI0030
FT                   by TMHMM2.0 at aa 20-42"
FT   CDS_pept        53376..54500
FT                   /transl_table=11
FT                   /gene="hyb0"
FT                   /locus_tag="PMI0031"
FT                   /product="hydrogenase-2 small chain precursor"
FT                   /EC_number="1.12.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40271"
FT                   /db_xref="GOA:B4F2Z1"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Z1"
FT                   /protein_id="CAR40271.1"
FT                   /translation="MALGNNVFSQHGINRRDFMKLCAALSATMGLSGKAAAQMSQAMTS
FT                   PERPPVIWIGAQECTGCTESLLRATHPTLENLVLDVIALEYHEVLSSAFGYQAEENKHN
FT                   AMEKYKGKYVLVVDGSIPDKDGGIYCMVAGKPILEHIKEAAEGAAAIIAIGSCSAWGGV
FT                   PASGGNPTGAKSLEAILPGKTVINIPGCPPNPHNFLATVAHIITFNSLPKLDSKNRPLF
FT                   AYERLIHENCERRPHFDAGRFAKEFGDEGHRQGWCLYHLGCKGPETYGNCPTLEFCDIG
FT                   GGIWPVGIGHPCYGCNEEGVGFTKGIFQLANVYQPTPKAQVPDVNAKEGGGVSYGAAGL
FT                   LGAVVGAVAGVSVMAVRQLGRDKNTTGASQEDKR"
FT   misc_feature    53376..53486
FT                   /note="Signal peptide predicted for PMI0031 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.994) with cleavage site
FT                   probability 0.832 between residues 37 and 38"
FT   misc_feature    53691..53993
FT                   /note="HMMPfam hit to PF01058, NADH ubiquinone
FT                   oxidoreductase, 20 Kd sub, score 1.8e-05"
FT   misc_feature    53814..53846
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    54375..54443
FT                   /note="1 probable transmembrane helix predicted for PMI0031
FT                   by TMHMM2.0 at aa 334-356"
FT   CDS_pept        54497..55510
FT                   /transl_table=11
FT                   /gene="hybA"
FT                   /locus_tag="PMI0032"
FT                   /product="hydrogenase-2 4fe-4s subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40272"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2W8"
FT                   /protein_id="CAR40272.1"
FT                   /translation="MNRRHFFKLASGGVLLAGMAPTASHAAAQNRPPIPGALGMLYDST
FT                   LCVGCQACVTKCQEINHPEPMERGDTYANGDPIWSNNDKLSPYTNNIIQIWRDGTGENK
FT                   DQLENGYAFIKKQCMHCVDANCVSVCPVSALTKDPKTGIVHYHADICTGCRYCMVGCPY
FT                   NIPKYDYDDPFGKLYKCELCNQKGVERLDKGLLPGCVEVCPTGAVIFGTREELLEEAKR
FT                   RLAKKAGEEYHYPRQTINGGDTYLHKIPEYQDHIYGEFEGGGTQVMVLSAVPFENLGMP
FT                   EVAPLSTGARSEHIQHTLYKGMVLPIAALAGITYLVNRNSKKQEQEHHKEDNDVES"
FT   misc_feature    54497..54574
FT                   /note="Signal peptide predicted for PMI0032 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.983 between residues 26 and 27"
FT   misc_feature    54827..54904
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain, score
FT                   0.008"
FT   misc_feature    54926..54997
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain, score
FT                   9.3e-05"
FT   misc_feature    54947..54982
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT   CDS_pept        55497..56678
FT                   /transl_table=11
FT                   /gene="hybB"
FT                   /locus_tag="PMI0033"
FT                   /product="hydrogenase-2 cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40273"
FT                   /db_xref="GOA:B4F2W9"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2W9"
FT                   /protein_id="CAR40273.1"
FT                   /translation="MSSHDPRPLGGKLFTLAVRVFLPLAVLGFILIGKRLVLGLGDVSD
FT                   LNGGYPWGIWIAFDLLIGTGFACGGWALAWAVYVCNKGEFHPLVRPALLASLFGYSLGG
FT                   LSIAIDIGRYWNMPHFFMPQYFNVNSVLFETATCMTIYIMVMALEFLPALLERLGWKVS
FT                   LRRLNKAMFFIIGLGALLPTMHQSSMGSLMISAGWKVHPLWQSYEMLPLFSLLTAFILG
FT                   FTIVIFEGSLLKASRTINDDETPLFTKLTKIIEVLLITFLVLRWGEVIWNGKLSYIAKG
FT                   DMFSWLFLAESALLFIPLVLMHLKNNRRSPRMLFVCALFMLVGAAMWRMNYSLVAYNPG
FT                   NGYHYFPTASELLISIGFVAFEVTAYILIIRLLPVLPAQTESNIQLKKAEVKS"
FT   misc_feature    join(55533..55592,55650..55718,55755..55823,55887..55955,
FT                   56016..56084,56127..56195,56232..56300,56343..56402,
FT                   56439..56507,56550..56618)
FT                   /note="10 probable transmembrane helices predicted for
FT                   PMI0033 by TMHMM2.0 at aa 13-32, 52-74, 87-109, 131-153,
FT                   174-196, 211-233, 246-268, 283-302, 315-337 and 352-374"
FT   CDS_pept        56675..58378
FT                   /transl_table=11
FT                   /gene="hybC"
FT                   /locus_tag="PMI0034"
FT                   /product="hydrogenase-2 large subunit"
FT                   /EC_number="1.12.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40274"
FT                   /db_xref="GOA:B4F2X0"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2X0"
FT                   /protein_id="CAR40274.1"
FT                   /translation="MSQRITIDPITRIEGHLRVDCEIDNGKVVKAWSSGTMWRGMEEIL
FT                   KGSDPRDAWIIVQRICGVCTTVHAIASVRAVEDALGMDIPVNAQYIRNLILASHIIHDH
FT                   IVHFYQLSAMDWVDITAALQADPEKASAMLKGVSQWQLNSAEEFRKVQKKIQDLVDSGQ
FT                   LGIFANGYWGHSAMKLPPEVNLIAVAHYLQALECQRDANRIVAVLGGKTPHIQNLAVGG
FT                   VANPINLDAPNVLNLERLMYVKHFIDNLGDFIEQVYKVDTAIFAAYYPEWLKIGKGANY
FT                   YLSVPELPINGNNTEFLLSGGYMEGVDFSTYRPIKDWKDQNLKDGIEESGKHAWYEDDE
FT                   PLKPWEGLTRPKYTGWDENNKYSWVKSPTFYGKPVEVGTLAWLVCGLAGKHEGTVKHYN
FT                   EVNQIYTKLTGQTLVTEQLESTWGRIIGRTVHACVLQDSLNFLWQSLVDNIGRGDTASF
FT                   IKPEFEPGKEYRGVGFEEASRGMLSHWIVFKDGKITNYQAVVPSTWNAGPRNFNDEPGP
FT                   YELSLVGTPVADPNKPLEVVRTIHSFDPCMACAVHMVDLTGKELSKVKVL"
FT   misc_feature    56789..58330
FT                   /note="HMMPfam hit to PF00374, Nickel-dependent
FT                   hydrogenase, score 1e-263"
FT   misc_feature    56789..56866
FT                   /note="PS00507 Nickel-dependent hydrogenases large subunit
FT                   signature 1."
FT   misc_feature    58301..58330
FT                   /note="PS00508 Nickel-dependent hydrogenases large subunit
FT                   signature 2."
FT   CDS_pept        58378..58866
FT                   /transl_table=11
FT                   /gene="hybD"
FT                   /locus_tag="PMI0035"
FT                   /product="hydrogenase 2 maturation protease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40275"
FT                   /db_xref="GOA:B4F2X1"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004419"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2X1"
FT                   /protein_id="CAR40275.1"
FT                   /translation="MRTLVLGIGNLLLSDEGIGVRIVEALEERFSLPENVDVIDGGTSG
FT                   MEILQDIAARDLLIVADAVRSQHEPGSIFVLHDDDVPALFTQKISPHQLGLSDVLMALR
FT                   MTDEFPRKLILVGIEPASLAPSMSLSDIGQQSMEIALEQVVNILREHGITVTPKEVTA"
FT   misc_feature    58435..58818
FT                   /note="HMMPfam hit to PF01750, Hydrogenase maturation
FT                   protease, score 5.1e-36"
FT   CDS_pept        58863..59357
FT                   /transl_table=11
FT                   /gene="hybE"
FT                   /locus_tag="PMI0036"
FT                   /product="hydrogenase-2 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40276"
FT                   /db_xref="InterPro:IPR023994"
FT                   /db_xref="InterPro:IPR038530"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2X2"
FT                   /protein_id="CAR40276.1"
FT                   /translation="MSELNWDITGYDEPPIELLESSFREIAKKEMQALPFYRENIPVKA
FT                   GGFTLFEKQWIGTILTPWMLELIVLPGPSQEWPRRKIGERIALALPCGQVKFVVGELAN
FT                   GAQYLACSLMSPLDRHLQGEQAVELAENSAKMALSLPVQTQSVTEVDLSRRSLFRGQLR
FT                   S"
FT   CDS_pept        59419..60615
FT                   /transl_table=11
FT                   /gene="hypB"
FT                   /locus_tag="PMI0037"
FT                   /product="hydrogenase nickel incorporation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40277"
FT                   /db_xref="GOA:B4F2X3"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2X3"
FT                   /protein_id="CAR40277.1"
FT                   /translation="MCSTCGCGEGNVSIEGVAPHSHDHHHHSHDHDHHDHGHHHHGHHH
FT                   HHGHHHGHDHHHEHNATPANTVHKYIDKSEQKHKHNYETHGQPIIIHHHHYHNSGDVHL
FT                   HFYHDAQQNEAQVFHEHHHGHDDHHAHSHEHTHSHEHEHSHDHEHSHEHEEQFSPVIDN
FT                   DNMHYGQGEAGTHAPGISQKRMLKIEMDVLDKNNRIAVHNREHFAQQNVLALNLVSSPG
FT                   SGKTTLLTQTLKQLTQRVPCAVIEGDQQTTNDADRIRETGVAAIQVNTGKGCHLDAQMV
FT                   HDATHQLGLKDNSILFIENVGNLVCPASFDLGEKHKVAILSVTEGEDKPLKYPHMFAAA
FT                   DLMIINKIDLVPHLNIDVQACIESARRVNPNIEIIALSATTGEGMEEWLAWLESRLCA"
FT   misc_feature    60055..60546
FT                   /note="HMMPfam hit to PF02492, CobW/HypB/UreG,
FT                   nucleotide-binding domain, score 1.3e-71"
FT   CDS_pept        60606..60872
FT                   /transl_table=11
FT                   /gene="hybG"
FT                   /locus_tag="PMI0038"
FT                   /product="hydrogenase-2 maturation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40278"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2X4"
FT                   /protein_id="CAR40278.1"
FT                   /translation="MCLGVPAKIVEVGDDVHQLAYAEVSGVKRAVNISMVCEGDPSELL
FT                   DKWVLIHVGFAMSILDEQEAQDTLDALQHVYGVTLEEADDAIR"
FT   misc_feature    60606..60866
FT                   /note="HMMPfam hit to PF01455, HupF/HypC family, score
FT                   2.3e-28"
FT   misc_feature    60606..60632
FT                   /note="PS01097 Hydrogenases expression/synthesis hupF/hypC
FT                   family signature."
FT   CDS_pept        60856..61995
FT                   /transl_table=11
FT                   /gene="hypD"
FT                   /locus_tag="PMI0039"
FT                   /product="hydrogenase formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40279"
FT                   /db_xref="GOA:B4F2X5"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2X5"
FT                   /protein_id="CAR40279.1"
FT                   /translation="MMQYVDEFRDPELAKALLAQIRETISQWPHPITRPLQIMEVCGGH
FT                   THAIFKFGLDRLLPQEIEFVHGPGCPVCVLPMGRIDACLEIAARPEVIFCTFGDAMRVP
FT                   GRHGSMLDARRRGSDIRIVYSPLDSLKIAQDNPDKQVVFFGLGFETTMPSTAMTLQQAK
FT                   LRGLKNFSLFCQHITIVPTLRCLLEQEDVRIDGFIAPGHVSMVIGCTPYQPLCDEFEKP
FT                   FVVTGFEPLDLLQAILMVVKQLKAKAENADYVLSIENQYSRIVPNEGNKLAQKALKDVF
FT                   MLKESSEWRGLGEIPMSGIQLTPAYAEFDAERRFTPAPQQVADNPQSRCGDVLTGRCKP
FT                   SDCPLFGKSCTPETALGALMVSSEGACAAYYQYRREGNI"
FT   misc_feature    60883..61983
FT                   /note="HMMPfam hit to PF01924, Hydrogenase formation hypA
FT                   family, score 2.1e-224"
FT   misc_feature    61450..61482
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        61992..63011
FT                   /transl_table=11
FT                   /gene="hypE"
FT                   /locus_tag="PMI0040"
FT                   /product="hydrogenase formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40280"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2X6"
FT                   /protein_id="CAR40280.1"
FT                   /translation="MKQPDEITLAQGNGGQGMQQLIEGLFLKAFDNPLLNEKEDQARIA
FT                   LADLTAQGDRLAFSTDSYVIDPIIFPGGNIGKLSVCGTANDLSVGGAVPRYLSCGFILE
FT                   EGLAFETLETLVMAMAKAAQQAGIQIVTGDTKVVPRGAADKIFINTAGIGVIPSKIDWA
FT                   ASHIKAGDKIIVSGTIGDHGATILNLRENLGLEADLQSDCAVLEPMIAPLRQIDGIRAL
FT                   RDATRGGVTAILHEFSQACGCGMNVYENKLPMKQSVRGVCELLGLEALNFANEGKIVLV
FT                   VSPQAEKQVLEALHQHTLGQDACTIGEVTEERYIRLTGIFGTSRILDLPYNEPLPRIC"
FT   misc_feature    61992..62462
FT                   /note="HMMPfam hit to PF00586, AIR synthase related
FT                   protein, N-terminal dom, score 7e-40"
FT   misc_feature    62493..62951
FT                   /note="HMMPfam hit to PF02769, AIR synthase related
FT                   protein, C-terminal dom, score 7.6e-35"
FT   CDS_pept        63205..64431
FT                   /transl_table=11
FT                   /locus_tag="PMI0041"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40281"
FT                   /db_xref="GOA:B4F2X7"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2X7"
FT                   /protein_id="CAR40281.1"
FT                   /translation="MSWSEFKSQYLIRFWKPLPAVIAAGILSTYYFGLTGTFWAVTGEF
FT                   TRWGGHVMQWFGAHPEEWGYFKIIGLEGTPLTRIDGVMIIGMFGGCIMAALWANNVKLR
FT                   HPQHKVRILQAVLGGIIAGFGARLAMGCNLAAFFTGIPQFSLHAWFFAVATAIGSYFGA
FT                   KLSLMPLFRIPVKLQKVSKASPITQDKQRAKRRFRLGMVIFFAMIAWSLIILFDSPKLG
FT                   FAMLGGIGFGILIERAQICFTSAFRDLWITGRTHMAKAIIIGMAVSAVGIFSYVQLGAA
FT                   PKIMWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQIHFWWVGLGNVIGSTILAYY
FT                   WDDFSAVLATDYDKINLLDTFGPVGGLAITYLLLGLSFILLLWWEKHFFRKRAQQAQAL
FT                   STQINKEIA"
FT   misc_feature    63205..63303
FT                   /note="Signal peptide predicted for PMI0041 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.898) with cleavage site
FT                   probability 0.446 between residues 33 and 34"
FT   misc_feature    join(63265..63333,63445..63513,63550..63618,63646..63714,
FT                   63793..63852,63865..63918,63979..64047,64060..64128,
FT                   64165..64227,64285..64353)
FT                   /note="10 probable transmembrane helices predicted for
FT                   PMI0041 by TMHMM2.0 at aa 21-43, 81-103, 116-138, 148-170,
FT                   197-216, 221-238, 259-281, 286-308, 321-341 and 361-383"
FT   misc_feature    63520..63714
FT                   /note="HMMPfam hit to PF04143, YeeE/YedE family (DUF395),
FT                   score 9.7e-20"
FT   misc_feature    64048..64239
FT                   /note="HMMPfam hit to PF04143, YeeE/YedE family (DUF395),
FT                   score 3.9e-22"
FT   CDS_pept        64428..64670
FT                   /transl_table=11
FT                   /locus_tag="PMI0042"
FT                   /product="SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40282"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2X8"
FT                   /protein_id="CAR40282.1"
FT                   /translation="MNEKKTIVPDYRLDMVGEPCPYPAVATLEAMPSLKKGEILEVVSD
FT                   CPQSINNIPLDAKNYGYTVLDIQQDGPTIRYLIQK"
FT   misc_feature    64446..64667
FT                   /note="HMMPfam hit to PF01206, SirA-like protein, score
FT                   5.2e-41"
FT   misc_feature    64464..64502
FT                   /note="PS01148 Uncharacterized protein family UPF0033
FT                   signature."
FT   CDS_pept        complement(64753..65661)
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="PMI0043"
FT                   /product="recombination associated protein RdgC"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40283"
FT                   /db_xref="GOA:B4F2X9"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4F2X9"
FT                   /protein_id="CAR40283.1"
FT                   /translation="MLWFKNILVYRLNKEIALSMDELEQQLASLAFTPCSSQDMTKTGW
FT                   VSPMGDRGEALIHVAGKQVMMCARKEDKILPATVIKQALQDKVEKLEGEQGRKLKKTEK
FT                   ATLKDEVVHTLLPRAFSKFSQTFIWLDLDKQLVIVDSGSAKRAEDNLALLRKTLGSLPV
FT                   VPLNFNESVESKMTQWVRSGELPAGFTLMDEAELKAVLEEGGVIRCKKQELVSDEIATH
FT                   IEAGKFVTKLSLDWEDRLQFMLCDDGSIKRIKFSDTLREQNDDIDKADFAQRFDADFVL
FT                   MTGELSALIERVIEVLGGEAE"
FT   misc_feature    complement(64756..65658)
FT                   /note="HMMPfam hit to PF04381, Putative exonuclease, RdgC,
FT                   score 4.7e-187"
FT   CDS_pept        66979..68184
FT                   /transl_table=11
FT                   /locus_tag="PMI0044"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40284"
FT                   /db_xref="GOA:B4F2Y0"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Y0"
FT                   /protein_id="CAR40284.1"
FT                   /translation="MGILIMKSLKPLAALVGLLVLSGSANAVNVYNDKGTRFDVNGQFR
FT                   LKTQVTSKDHEMRMRDDGSRIGFFGSHELTNDIKVFGKLEWGSDTQKTNSDNEKTNFDL
FT                   YNRVGYVGFSHRDYGQIQFGRTYIPIDWVKKSSYGYGNTGVFYFSDVLGRAVGYSSKGV
FT                   GKNNFMTRLPQTIFIETNRYEGFKLAATLTGKDGKDNDGDGKNGDRRTGDIRHAYSVVG
FT                   FYKSTFGLEFDAGYSAAVGEPNLYPDSVVGNKKPENSILAFGAEYFFPGREFSIGIDYG
FT                   QSRGKNTGLTLREGATEKDYKWNSVKGDWKANLYGVGVKWHWDRIESGMYAGYYLRDGD
FT                   ANTFNYKKETYTVGVDKRFAVSKYNNLRLFAEMAYDDARSENPAYEDKKQYIFETGMRL
FT                   YF"
FT   misc_feature    66979..67059
FT                   /note="Signal peptide predicted for PMI0044 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 27 and 28"
FT   CDS_pept        68271..70226
FT                   /transl_table=11
FT                   /gene="cpdB"
FT                   /locus_tag="PMI0045"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase
FT                   precursor"
FT                   /EC_number="3.1.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40285"
FT                   /db_xref="GOA:B4F2Y1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006294"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Y1"
FT                   /protein_id="CAR40285.1"
FT                   /translation="MVKNVLKISTLAMLVAFNVNAATVDLRIMETSDVHSNLIDFDYFK
FT                   DKPTEQFGYVRTANLIKAAKAEATNAILVDNGDLIQGSPLADYQAAKGLEKGEAHPAHQ
FT                   LMNTMGYTVGNFGNHEFNYGLDYLKKAIAGAEFPYINANIMDAKTGKNYFTPYIIVDTP
FT                   VKDRDGKEHTIKIGYIGFVPPQILIWDKANLDGKVVVNDITETAKKFVPQMKKEGADLI
FT                   VAIPHSGFSSEPYKAMAENSVYYLSEVDGINAIMFGHAHGVFPSKEFEGIKGVDVAKGT
FT                   VNGVPAVMPGQWGDHLGVVDMVINNDSGKWVMTQATGEARPIFDKANKKALVERDAELA
FT                   QIIEKAHQGTRDFVGKHIGKASANMYSFLALVQSDPTVQIVNDAQVDYTKHFIQGDPNL
FT                   DGLPVLGAAAPFKAGGRKNAPADFVEVEKGDLTFRNAADLYLYPNTLVVVKATGADVVE
FT                   WLECSAGMWNQVDPNSTKPQYLINWDGFRTYNFDTISGVEYKVDLTQPAKYDVDCQVVN
FT                   KDANRIKNVTYQGKPIDPKATFLIATNNYRGYGGKFAGTGESNIAFASPDENRAILASY
FT                   IAKQTKENGEVATKAANNWSFLPIKTDKQLDVRFETSPSEKAANFIKDFAQYPMTFVEN
FT                   DDIGFAIYKIDLTEKK"
FT   misc_feature    68271..68333
FT                   /note="Signal peptide predicted for PMI0045 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.990 between residues 21 and 22"
FT   misc_feature    68346..69059
FT                   /note="HMMPfam hit to PF00149, Calcineurin-like
FT                   phosphoesterase, score 8.4e-18"
FT   misc_feature    68346..68384
FT                   /note="PS00785 5'-nucleotidase signature 1."
FT   misc_feature    69339..69944
FT                   /note="HMMPfam hit to PF02872, 5'-nucleotidase, C-terminal
FT                   domain, score 1.5e-56"
FT   CDS_pept        70309..71085
FT                   /transl_table=11
FT                   /locus_tag="PMI0046"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40286"
FT                   /db_xref="GOA:B4F2Y2"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR033130"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Y2"
FT                   /protein_id="CAR40286.1"
FT                   /translation="MRFIKLLPAILAVILAGCVTQAPEVKQPLKPQAKLVEGVSCILPD
FT                   VPTANYDYIATNDRYGQNSKASTDYFKLAINYSPAFCDYKKNNIKRLNNDNEKERAKRE
FT                   FDKFEIQCFSDNKFGWIVHGLWAETCDGKSWDECRDWKDIRKHPRLCKGDLPPLEYSAI
FT                   KPYLCSSPGIDLLQGEWEKHGVCAFDTPEAFFGQQQALFDALVLPEGRPSNSELIKFLK
FT                   ENNPSLKDKEIQINRDEFYICYSKDFEVIDCPKREY"
FT   misc_feature    70309..70371
FT                   /note="Signal peptide predicted for PMI0046 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.596 between residues 21 and 22"
FT   misc_feature    70330..70362
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    70687..70710
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    70831..70866
FT                   /note="PS00531 Ribonuclease T2 family histidine active site
FT                   2."
FT   CDS_pept        71104..72726
FT                   /transl_table=11
FT                   /locus_tag="PMI0047"
FT                   /product="putative secreted 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40287"
FT                   /db_xref="GOA:B4F2Y3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Y3"
FT                   /protein_id="CAR40287.1"
FT                   /translation="MNHKYKLVALAVSSVLLAGCAKNYDEANVVDVRVIALNDFHGALK
FT                   APGPNKPGGIEHMATLVKELKKDNPNNIVVAAGDMVGASPLLSSMFHDEPTIEALSLAG
FT                   LEATSVGNHEFDKGMGELLRKQNGGCHPVTGCQGPTEFKGADFQYLAANVTVNETGKTL
FT                   FPEYVIKEFNGIPVAFIGLTLEGTAAIVTPKGTEGLSFHNEAKTINALVPKLQAQGVQA
FT                   IGVLIHEGAAQRRDGGPVNINACNGITGKVLGVVEQLDPAVDFVVTGHTHQAYNCTING
FT                   RSVTSAQSNGAMLTRIDLKLDKTTKDVVDVEARNIWVDNRKYEKDPAVTKLLEAYEKIA
FT                   TPLANRIIGKLEGNLTKQTNDAGESGLGQVIADAHLYTAKPKDMGGAQIALMNSGGIRA
FT                   DMTGGDVSYNAIYTVQPFSNVLLTQTLTGEQIKRLLEQQWDRSRPQVLAVSGNFQYTWD
FT                   SKAPVGQRVIVESMRIDGKPVDMKANYRVVANEYLATGGSNFSVLKEGKDPVYSVPDVD
FT                   AVVKYFAEQSPIAQPKANNITRK"
FT   misc_feature    71104..71172
FT                   /note="Signal peptide predicted for PMI0047 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992) with cleavage site
FT                   probability 0.615 between residues 23 and 24"
FT   misc_feature    71131..71163
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    71197..71925
FT                   /note="HMMPfam hit to PF00149, Calcineurin-like
FT                   phosphoesterase, score 2.1e-11"
FT   misc_feature    72142..72618
FT                   /note="HMMPfam hit to PF02872, 5'-nucleotidase, C-terminal
FT                   domain, score 3.9e-41"
FT   CDS_pept        complement(73039..73638)
FT                   /transl_table=11
FT                   /locus_tag="PMI0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40288"
FT                   /db_xref="GOA:B4F2Y4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033877"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Y4"
FT                   /protein_id="CAR40288.1"
FT                   /translation="MSNAFTELMKKRRTIYHLGNQLPISEDRVATIIKEAVKESPSAFN
FT                   SQTSRVVVLFGEQHQKLWNIVKDTLKKLVPADAFSATEAKINSFAAGAGSILYFEDTDI
FT                   VKGLQEQFPLYAENFPIWSEQASGMAQLSVWTALAAENVGASLQHYNPIIDDEVHATWD
FT                   IPRHWKLRAQMVFGSIEQEASEKNYIEDDARFKIFK"
FT   CDS_pept        complement(73768..77493)
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="PMI0049"
FT                   /product="exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40289"
FT                   /db_xref="GOA:B4F2Y5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B4F2Y5"
FT                   /protein_id="CAR40289.1"
FT                   /translation="MKILSLRFKNINSLKGEWKINFDQEPFVSNGLFAITGPTGAGKTT
FT                   LLDAISLALYHRTPRLDKVTQSQNELMTRHTAECLAEVEFEVKGVAYRAFWEQRRANYK
FT                   EEGNLQAPQAELAKINRLGGEDKVLANKISQVKEKIISITGLDFDRFTKSMLLSQGQFA
FT                   AFLNADDKSRAELLEELTGTDIYRHISQTIFKHWREEEQALNTLKQQAQMMALLDATTR
FT                   QELLTQQANIQTQITRLQKEQQEYQVAKQWQEKALEIQQQQQSAQAGLYEAQQALIIAQ
FT                   PDIQRLEKNEPAEKIRPLYDEKNRRLTEQNYLATQLTSLKTEKQAIEQQSLPINKKLAA
FT                   FHEQLKTHHEKKQHTLQLIREKVLPLDNQLVLLQQEISTNNQHKHKLEKICAEYLQHSQ
FT                   LAEKKLITTQQQVNQLNNDLTQHAYHAQLAENLPLWQHYFQQYNEISNQYLANQKRETA
FT                   EQEKVISLEKALQQATQTLATQQEQLNLQQQQLQSYQTQLEARQKADKPDEIKPRLQQI
FT                   NLQKNALAKIINLHTQLQRNGKEQQHYQTTLSENQQKIATLTQTIAENDLALKEKAQHL
FT                   KDLNDNYLLLQKVAEYEQERARLLKDKPCPLCGSTQHPYVETYHDIKPDETKLRLEALQ
FT                   QQVHSLTITLAEQRTQLVNYGSQNSTLSDNIAQLTQENSVLTQQWQTLAQAHHLPLVDD
FT                   ADNLLTLEQSLNQQELILTEKLDSYQQLEAQTHQKNTHFLNAKEQFNQQQQSVKQQQND
FT                   LDYLQKTIKTYQQQSEHLHQQQQQLAQHIQSAIEKQGYTLPEFEQFTPWLAARQQEHQQ
FT                   YQSQLKELQLLQQSLREQQVTQNEKKRYLAEKQAELEALLAKLSQQQHQQTQWQDQRQA
FT                   LFGSQSVEQVRSELDKHSQFLQTQIEQYTQEKNQLENRLNQLIGQYQENEKALQRAITQ
FT                   AQQATEHYQHALKESLFADENDFLASLLSVEERTRLQEQQKQRLDKLLQEKTRLETQEK
FT                   AYQQHLLQQPLLSTQCTAEQCNIHLDDLAKQHKALQETLFSLQIQLRQDDEKRIEQQTL
FT                   LAQIAKQQAHYDDWSYLNELVGSASGDKFSRFAQGLTLDHLIYLANRRLEKLHGRYFLQ
FT                   RKTTGSLELQIADTWQADALRDTRTLSGGESFLVSLSLALALSDLVSNKTQIESLFLDE
FT                   GFGTLDPDTLDIALDALDSLNASGKIIGVISHVEAMKERIPVQIKVKKAGGLGISQLAP
FT                   EFRYGNKSNENQSVKD"
FT   misc_feature    complement(74515..74544)
FT                   /note="HMMPfam hit to PF00904, no description, score
FT                   1.9e+02"
FT   misc_feature    complement(74770..74799)
FT                   /note="HMMPfam hit to PF00904, no description, score
FT                   3.7e+02"
FT   misc_feature    complement(74983..75012)
FT                   /note="HMMPfam hit to PF00904, no description, score
FT                   1.5e+02"
FT   misc_feature    complement(75145..75210)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1072.000, SD 2.84 at aa 762-783, sequence
FT                   KTYQQQSEHLHQQQQQLAQHIQ"
FT   misc_feature    complement(75154..75183)
FT                   /note="HMMPfam hit to PF00904, no description, score
FT                   2.9e+02"
FT   misc_feature    complement(75247..75276)
FT                   /note="HMMPfam hit to PF00904, no description, score
FT                   2.4e+02"
FT   misc_feature    complement(75364..75393)
FT                   /note="HMMPfam hit to PF00904, no description, score
FT                   1.8e+02"
FT   misc_feature    complement(76036..76065)
FT                   /note="HMMPfam hit to PF00904, no description, score 91"
FT   misc_feature    complement(76243..76272)
FT                   /note="HMMPfam hit to PF00904, no description, score 1e+02"
FT   misc_feature    complement(76744..76773)
FT                   /note="HMMPfam hit to PF00904, no description, score
FT                   2.8e+02"
FT   misc_feature    complement(76945..77493)
FT                   /note="HMMPfam hit to PF02463, RecF/RecN/SMC N terminal
FT                   domain, score 2.2e-05"
FT   misc_feature    complement(77362..77385)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(77490..78722)
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="PMI0050"
FT                   /product="exonuclease subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40290"
FT                   /db_xref="GOA:B4ETY8"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B4ETY8"
FT                   /protein_id="CAR40290.1"
FT                   /translation="MRIIHTSDWHLGQYFFTKTRAQEHQQFLDWLLAQIREQQVDAVIV
FT                   AGDIFDTGSPPSYARELYNRFVVAIRDTQCQLIILGGNHDSVATLNESKSLLACLNTTV
FT                   IANVHTETPQAPIILYQKNHTPGALLCAIPYLRPRDMINSKSGQSGADKQGALKEAIAD
FT                   YYQRQYQAALDLRKQLNVNIPIIATGHLTTIGASVSDSVREIYIGTLEAFNATLFPPFD
FT                   YIALGHIHRPQRVNKSGHIRYSGSPIPLSFDESAQQKSVCLIDFEQDKLAEMTLLPIPE
FT                   FQLLRTLSGSLQEIATQLEKLATQYNEMDTTIWLDIEVSTQDYLSDIQTRIQELTQSPL
FT                   FEVIVLRRARKQRQALMQNEKETLTELTVYDVFERRLAQHQFETEEDKIRLTTLFKQAV
FT                   EMAEQEDNNAR"
FT   misc_feature    complement(78027..78722)
FT                   /note="HMMPfam hit to PF00149, Calcineurin-like
FT                   phosphoesterase, score 6.9e-18"
FT   CDS_pept        78944..79633
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="PMI0051"
FT                   /product="phosphate regulon transcriptional regulator
FT                   (two-component response regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40291"
FT                   /db_xref="GOA:B4ETY9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4ETY9"
FT                   /protein_id="CAR40291.1"
FT                   /translation="MARRILVVEDETAIREMICFVLEQNGFQPIEAEDYDTALSFLIDP
FT                   YPDLVLLDWMIPGGSGIQVIKQMKRENNTRDIPIIMLTAKGEEEDKVKGLETGADDYVI
FT                   KPFSPKELVARVKAILRRLSPMSAEDVIEFNGLSLDPVSHRVTSQDKPIDMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNYVWGTNVYVEDRTVDVHIRRLRKAIEQDGHDRMIQTVRGTG
FT                   YRFSARF"
FT   misc_feature    78950..79315
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1.5e-35"
FT   misc_feature    79391..79618
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 2.8e-25"
FT   CDS_pept        79657..80949
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="PMI0052"
FT                   /product="phosphate regulon sensor protein (two-component
FT                   histidine kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40292"
FT                   /db_xref="GOA:B4ETZ0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4ETZ0"
FT                   /protein_id="CAR40292.1"
FT                   /translation="MLERLSWKALVWGLFLFCLPAFVLSLFIGHLPWLLVVSLLSALIW
FT                   HAYNLMKLSKWLWLDRSVLPPEGKGGWEPIFYGIRQTQQRNRKRRRELGDLIKRFRSGA
FT                   ESLPDAVVMITNEGNIFWCNSLAQHLLGFRWPDDNGQNIFNLLRYPDFLHYFTVADFSR
FT                   PLTIALNNGAIVEFRVMPYADDQRLMVARDVTEKNKLENSRRDFFANVSHELRTPLTVI
FT                   QGYLEMMEENTAENPAEHKVIKTMQEQAKRMDLLVQQLLQLSRIESAPHIDLNTVVDMP
FT                   ALLSVLEHDAHSLSQEQQNIIFDIDHKWAVRGNEEQLRSAVSNLVYNAINHTPEGTTIR
FT                   VSWKKVPQGMLFSVSDNGPGISAEHLTRLTERFYRVDKARSRHTGGTGLGLAIVKKSLQ
FT                   HHHSILNIESKVGVGSTFSFIMPQTLLTEKK"
FT   misc_feature    79657..79725
FT                   /note="Signal peptide predicted for PMI0052 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.861) with cleavage site
FT                   probability 0.777 between residues 23 and 24"
FT   misc_feature    79690..79758
FT                   /note="1 probable transmembrane helix predicted for PMI0052
FT                   by TMHMM2.0 at aa 12-34"
FT   misc_feature    79948..80133
FT                   /note="HMMPfam hit to PF00989, PAS domain, score 7.1e-06"
FT   misc_feature    80263..80463
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 2.7e-25"
FT   misc_feature    80593..80928
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 4.7e-39"
FT   CDS_pept        81447..82784
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="PMI0053"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40293"
FT                   /db_xref="GOA:B4ETZ1"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:B4ETZ1"
FT                   /protein_id="CAR40293.1"
FT                   /translation="MAHRLTSRDILALGFMTFALFVGAGNIIFPPMVGLQSGEFVWTAA
FT                   IGFLLTGVGLPVLTVVALAKVGGGIEALSTPIGKSMGLLLAIVAYLAVGPLFATPRTAT
FT                   VSFKVGIAPLVGDSDIALLIYSVIYFLIVIGISLYPGKLLDSVGHILAPIKILALAVLG
FT                   LAALFWPAGTPIPATQAYQDMAFTQGFINGYLTMDTLGAMVFGIVIVNAARSRGIDNSS
FT                   LLTRYTMWAGIIAGVLLTAIYLSLFKLGSASGSIIPEAKDGADILHAYVQHTFGNFGSF
FT                   FLALLIFLACMVTAVGLTCACAEFFSRYLPISYRTLVLILAVFSAVVSNLGLSKLIAFS
FT                   IPVLVMIYPPCIVIILMSFTLRFWHNPSRIIAPAMAISLFFGIFDAIKASDHLKHLLPD
FT                   WAAKLPLSEQGLAWLIPVLVTIVICAIYDKVAGSQHKKVIHSGINK"
FT   misc_feature    81447..81518
FT                   /note="Signal peptide predicted for PMI0053 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.894) with cleavage site
FT                   probability 0.802 between residues 24 and 25"
FT   misc_feature    81462..82739
FT                   /note="HMMPfam hit to PF05525, Branched-chain amino acid
FT                   transport p, score 1.8e-215"
FT   misc_feature    join(81483..81551,81564..81632,81693..81761,81804..81863,
FT                   81897..81965,82008..82076,82113..82181,82278..82346,
FT                   82380..82448,82461..82529,82548..82607,82674..82727)
FT                   /note="12 probable transmembrane helices predicted for
FT                   PMI0053 by TMHMM2.0 at aa 13-35, 40-62, 83-105, 120-139,
FT                   151-173, 188-210, 223-245, 278-300, 312-334, 339-361,
FT                   368-387 and 410-427"
FT   CDS_pept        complement(82844..84130)
FT                   /transl_table=11
FT                   /locus_tag="PMI0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="the E. amylovora protein (mentioned above) to which
FT                   this CDS is similar is carried on the plasmid pEA29"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40294"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B4ETZ2"
FT                   /protein_id="CAR40294.1"
FT                   /translation="MNFKPIKKLNVTRTLSTGVQVLMGTLAQNHNGVFFQYDAHYLTQF
FT                   GNSSPFNLKNNTDLQIAPKKPHGNLHGLFSDSLPDGWGRLLQDRIFRQHGIQPHEITTM
FT                   DRLAFVGNKGMSGLSYLPLSDYQTNEHFDVDLINLGLDAQAVFDGQTETVLSELAIVGS
FT                   SGGARPKALLYFKQGDFNQCKTYEEQGDESWLIKFTSQNLPLGHDEGLCEAIYLTLASK
FT                   LDLNPPQWKLIDVPKSSHGKSWLALKRFDRVTNSSGKSGCLIMHSACGLLDADFRLPSL
FT                   DYEDLIKVNRVLCKSISAGQLQFRRAIFNLFASNQDDHSKNWSFLQYDDGHWEPAPFYD
FT                   VTYNPNPRNEHITSFGGYGKQPPLNIIKHLAEIAGFESWQQAQTYIHHTVDIISQFSSL
FT                   AKEYDVSNSVRADIDKTLTNRLKENQHLL"
FT   misc_feature    complement(83111..83347)
FT                   /note="HMMPfam hit to PF07804, HipA-like C-terminal domain,
FT                   score 3.7e-25"
FT   misc_feature    complement(83375..83644)
FT                   /note="HMMPfam hit to PF07805, HipA-like N-terminal domain,
FT                   score 6e-06"
FT   CDS_pept        complement(84120..84413)
FT                   /transl_table=11
FT                   /locus_tag="PMI0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40295"
FT                   /db_xref="GOA:B4ETZ3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4ETZ3"
FT                   /protein_id="CAR40295.1"
FT                   /translation="MKLSLLTDIDVSRAFATHLRKRREKEKWSREHLAERSTVPASTIK
FT                   KFELQGKISLRQLLLLWQCLDDLNNLYAVVDPKKANKPRIPRTIEEVLQDEF"
FT   CDS_pept        complement(84801..85727)
FT                   /transl_table=11
FT                   /locus_tag="PMI0056"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /note="Highly similar to PMI0057 (79.8 38d), PMI0058 (94.7
FT                   38d), PMI0060 (78.7 0d), PMI0061 (83.6 0d), PMI0062 (83.1
FT                   38d) and PMI0063 (62.6 0d)."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40296"
FT                   /db_xref="GOA:B4ETZ4"
FT                   /db_xref="UniProtKB/TrEMBL:B4ETZ4"
FT                   /protein_id="CAR40296.1"
FT                   /translation="MTNLRTVSKHPEQLETTPLVAESHHYDDPLAPQKLVFLKAVNQQR
FT                   CVINSPQRNSQLTNTIPFFIVLLVMACYTLFNFMEGHIGAKAELESMSQYLFENNKDIN
FT                   ALNEIERKSILKYQPFWETEKISWWEYIKAYNSGEFFIDSQYDKYLVIGWLIFFPGFLW
FT                   LFGYLSFFTPPVYLIADRQRGILYSYGMGKVRLTRYKEAQFGYAGNMLAIKLYGINEKT
FT                   GQLKTILYRPNVSHYSSFLTSTDSENHRFITFLNAYMQQGRDAVSSVDYQARKPFLSFG
FT                   KNPLPADFEQQVEQILAKLDQEKKHHA"
FT   misc_feature    complement(join(85215..85283,85473..85541))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0056 by TMHMM2.0 at aa 63-85 and 149-171"
FT   CDS_pept        complement(85724..86674)
FT                   /transl_table=11
FT                   /locus_tag="PMI0057"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /note="Highly similar to PMI0056 (79.8 38d), PMI0058 (97.6
FT                   38d), PMI0060 (81.6 id), PMI0061 (81.3 0d) and PMI0062
FT                   (81.4 38d), PMI0063 (57.7 0d)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40297"
FT                   /db_xref="GOA:B4ETZ5"
FT                   /db_xref="UniProtKB/TrEMBL:B4ETZ5"
FT                   /protein_id="CAR40297.1"
FT                   /translation="MTNLRTVSKHPEQLETTPLIAESHHYDDPLAPQKLVFLEAVNQQR
FT                   CVINSPQRNSQLTNTIPFFIVLLVMACYTFWGFMDRHSSKMYTFQDTINYNKRIYDSYN
FT                   EQGKSPPKYLDKYVPYFNKGKISIWVYIKAYYTGELSRNSQAEIFLIIGWLIFFPGFLW
FT                   LFGYLSFFTPPVYLIADRQRGILYSYGMGKVRLTRYKEAQFGYAGNMLAIKLYAINEKT
FT                   GQLKTILYRPNVSHYSSFLTSTDSENHRFITFLNAYMQQGRDAVSPVDYHARKPFLSFG
FT                   KNPPPADFEQQVEQILAKLDQEKKTMRKIDKEGTE"
FT   misc_feature    complement(join(86162..86230,86438..86506))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0057 by TMHMM2.0 at aa 57-79 and 149-171"
FT   misc_feature    complement(86459..86491)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(join(86671..87132,87136..87606))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PMI0058"
FT                   /product="putative membrane protein (pseudogene)"
FT                   /note="Highly similar to PMI0056, PMI0057, PMI0060,
FT                   PMI0061, PMI0062 and PMI0063"
FT                   /note="This CDS contains an in frame TAG stop codon."
FT                   /db_xref="PSEUDO:CAR40298.1"
FT   misc_feature    complement(87370..87438)
FT                   /note="1 probable transmembrane helix predicted for PMI0059
FT                   by TMHMM2.0 at aa 57-79"
FT   CDS_pept        complement(87603..88538)
FT                   /transl_table=11
FT                   /locus_tag="PMI0060"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /note="Highly similar to PMI0056 (78.7 38d), PMI0057 (79.8
FT                   38d), PMI0058 (94.7 0d), PMI0061 (83.6 0d), PMI0062 (83.1
FT                   38d) and PMI0063 (62.6 0d)."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40299"
FT                   /db_xref="GOA:B4ETZ7"
FT                   /db_xref="UniProtKB/TrEMBL:B4ETZ7"
FT                   /protein_id="CAR40299.1"
FT                   /translation="MTNLRTVSKHPEQLETTPLVAESHHYDDPLAPQKLVFLEAVNQQR
FT                   CVINSPQRNSQLTNTIPFFIVLLVMAFYTLFGFIENHKSNYFTLQYRSNYYNEKYGIDN
FT                   LPKELSRYLPYMKVKEISIGTYLIDYYTDKIYKNDKFKILMIIGWLIFFPGFLWLFGYL
FT                   SFFTPPVYLIADRQRGILYSYGMGKVRLTRYKEAQFGYAGNMLAIKLYGINEKTGQLKT
FT                   ILYRPNVSHYSSFLTSTDSENHRFITFLNAYMQQGRDAVSPVDYQARKPFLSFGKNPLP
FT                   ADFEQQVKQILAKLDQEKKNMRKIDKEGTE"
FT   misc_feature    complement(join(88041..88109,88302..88370))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0060 by TMHMM2.0 at aa 57-79 and 144-166"
FT   CDS_pept        complement(88535..89485)
FT                   /transl_table=11
FT                   /locus_tag="PMI0061"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /note="Highly similar to PMI0056 (78.7 38d), PMI0057 (79.8
FT                   38d), PMI0058 (94.7 0d), PMI0060 (83.6 0d), PMI0062 (83.1
FT                   38d) and PMI0063 (62.6 0d)."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40300"
FT                   /db_xref="GOA:B4ETZ8"
FT                   /db_xref="UniProtKB/TrEMBL:B4ETZ8"
FT                   /protein_id="CAR40300.1"
FT                   /translation="MTRLRTVSKHPEQLETTPLIAESHHYDDPLAPQKLIFLEAVNQQR
FT                   CVINSPQRNSQLTNTIPFFIVLLVMAFYTLFGFVDNHIATKNSIEIMAKHVEEKYGHKK
FT                   EQNMLSAKLIELYKPYFGKDKISLWEYIKAYDSGNFVIDGQYDKYLILGWLIFFPGFLW
FT                   LFGYLSFFTPPVYLIADRQRGILYSYGMGKVRLTRYKEAQFGYAGNMLAIKLYGINEKT
FT                   GQLKTILYRPNVSHYSSFLTSTDSENHRFITFLNAYMQQGRDAVSPVDYQARKPFLSFG
FT                   KNPLPADFEQQVKQILAKLDQEKKTMRKIDKEGTE"
FT   misc_feature    complement(join(88973..89041,89249..89317))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0061 by TMHMM2.0 at aa 57-79 and 149-171"
FT   CDS_pept        complement(89507..90433)
FT                   /transl_table=11
FT                   /locus_tag="PMI0062"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /note="Highly similar to PMI0056 (78.7 38d), PMI0057 (79.8
FT                   38d), PMI0058 (94.7 0d), PMI0060 (83.1 0d), PMI0061 (83.6
FT                   38d) and PMI0063 (62.6 0d)."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40301"
FT                   /db_xref="GOA:B4ETZ9"
FT                   /db_xref="UniProtKB/TrEMBL:B4ETZ9"
FT                   /protein_id="CAR40301.1"
FT                   /translation="MTSLRTVSKHPEQLETTPLIAESHHYDDPLAPQKLVFLEAVNQQR
FT                   CVINSPQRNSQLTNTIPFFIVLLVMAFYTLFGFISEHINYKRHFQSMVEKVEAKYSNEL
FT                   NLDAPTLKYVNTYRPYFGKKNINYWDYIKAYNSGEFFTDGQYEKYLVIGWLIFFPGFLW
FT                   LFGYLSFFTPPVYLTADRQRGILYSYGMGKVRLTRYKEAQFGYAGNMLAIKLYSINEKT
FT                   GQLKTILYRPNVSHYSSFLTSTDSENHRFITFLNAYMQQGRDAVSPVDYQARKPFLSFG
FT                   KNPLPADFEQQVEQILAKLDQEKKHHA"
FT   misc_feature    complement(join(89921..89989,90197..90265))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0062 by TMHMM2.0 at aa 57-79 and 149-171"
FT   CDS_pept        complement(90455..91381)
FT                   /transl_table=11
FT                   /locus_tag="PMI0063"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /note="Highly similar to PMI0056 (78.7 38d), PMI0057 (79.8
FT                   38d), PMI0058 (94.7 0d), PMI0060 (62.6 0d), PMI0061 (83.6
FT                   38d), PMI0062 (83.1 0d)."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40302"
FT                   /db_xref="GOA:B4EU00"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU00"
FT                   /protein_id="CAR40302.1"
FT                   /translation="MSNPFTISNFPEQLETSPLIDESHHYDDPLPPKDLVFLQSINNQE
FT                   CKIKSSQVNGRFTNTVPMFLVLIVMMFYTLFNFIEGHIITKYTLEDNIKEIENYSTYYT
FT                   GNDRVVLRDINKYKPFFGKEKISWWEYIKAYNSGKFFVGSEDDKYFVLAWLVLFPSGLY
FT                   ILSSLAFFVPMTYLVADRKRQILYSYVDGIVMATRYEDTQFGYAGKMLAFKLFYIHPET
FT                   GELGIHIYRPNVSHYTGFLLSSDTEDHRFITFLNAYMQQGRDAVSPVDYQARKPFLSFG
FT                   KNPLPADFEQQVEQILAKLDQEKKRHA"
FT   misc_feature    complement(join(90866..90934,91145..91213))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0063 by TMHMM2.0 at aa 57-79 and 150-172"
FT   CDS_pept        92040..92522
FT                   /transl_table=11
FT                   /locus_tag="PMI0064"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40303"
FT                   /db_xref="GOA:B4EU01"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU01"
FT                   /protein_id="CAR40303.1"
FT                   /translation="MAFKYKITIIIFLLSFIFFVVYEFFIPVKVMGVHKDTYTTSILVE
FT                   NFPITDYGKIIWWKNNQDVLDKKYDLFKDKNSLFLISIWNYGDGYLEEGKYDRLCFTEI
FT                   KSNKKCIEKDKVMSIMYSLNEEEIRIGNSAYIKDKNGSFIKKDKDANTTITVVPNA"
FT   misc_feature    92040..92486
FT                   /note="HMMPfam hit to PF06092, Enterobacterial putative
FT                   membrane protein (D, score 4e-26"
FT   misc_feature    92058..92117
FT                   /note="1 probable transmembrane helix predicted for PMI0064
FT                   by TMHMM2.0 at aa 7-26"
FT   CDS_pept        complement(92694..93668)
FT                   /transl_table=11
FT                   /locus_tag="PMI0065"
FT                   /product="putative subunit of oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40304"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU02"
FT                   /protein_id="CAR40304.1"
FT                   /translation="MDQGAYMSVPSQENITLTKEDLRQLHVSSSLYRWFLRYFPHGGTY
FT                   RAIHNELIKQRQTQWIESLIQYIYLRHFSQSSFAKQEQEVIENILSLLGNEKQTGVTLQ
FT                   RLPYHQPQSSDENIQFSTEWHQLIVKSQQFNTALALCGRDNIVALSGDENSIANTGYSN
FT                   QLINSGFAGKISNTADQCRIGSLGGRSRICNSGNDVKIYASGQGAHIANSGIRNFINAT
FT                   QSRTKITNTGDLAHITVTGDNAIAINTGDNCTLSVSGDNSVCISTGHLQQFCLGKGGSA
FT                   VIAYHDGKRTRFNVFYEGEDNIEAGIHYYLDEKQRPVAMDNIT"
FT   CDS_pept        complement(93676..94473)
FT                   /transl_table=11
FT                   /locus_tag="PMI0066"
FT                   /product="putative oxidoreductase, cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40305"
FT                   /db_xref="GOA:B4EU03"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU03"
FT                   /protein_id="CAR40305.1"
FT                   /translation="MSAINIMPNAAQFQASLKQYVLIYTPDYLPLWLIVAGVLFVGMLL
FT                   VLALHGFLRYRFATPHGEHHQEEKLYLYSKAVRLWHWSNATLFILLLLSGGINHFALLS
FT                   AHDTALLVNVHEICGYLLLVCWLSFVLINLVSGNGKFYRIDSKNWLQRVLMQTRFYLYG
FT                   IIKGEDHPFPATPKVKFNPLQQMAYLGVMYALVPLLLITGILLQNPMFIPADAVLFKAW
FT                   LLIIHQILAVCSVFFIFGHLYLCTTGRTPFQTFRSMVDGYHRH"
FT   misc_feature    complement(93691..94266)
FT                   /note="HMMPfam hit to PF01292, Cytochrome b561 family,
FT                   score 0.00014"
FT   misc_feature    complement(join(93745..93813,93856..93915,94057..94125,
FT                   94168..94236,94315..94383))
FT                   /note="5 probable transmembrane helices predicted for
FT                   PMI0066 by TMHMM2.0 at aa 31-53, 80-102, 117-139, 187-206
FT                   and 221-243"
FT   CDS_pept        complement(94470..95141)
FT                   /transl_table=11
FT                   /locus_tag="PMI0067"
FT                   /product="putative oxidoreductase, Fe-S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40306"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU04"
FT                   /protein_id="CAR40306.1"
FT                   /translation="MRVSRRKFVAGIGSVIFFSAPLGSALAAATDKKPIRYAMIHDETR
FT                   CNGCNICATACRRLNKVPTGMARMDIAHIPLSLKEDNDKYHFFRHSCQQCEDAPCISVC
FT                   PTGASWRDESNGIVRVNKEKCIGCSYCISACPYQVRYLNPVTHVADKCDFCLESRLQKG
FT                   FPPICVSACPQNALLFGREDSPQIQQWLKTHDYYLYQLDGVGKPHLYRRVGPHVQGGDN
FT                   V"
FT   misc_feature    complement(94719..94790)
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain, score
FT                   9.1e-07"
FT   misc_feature    complement(94734..94769)
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT   misc_feature    complement(94956..95027)
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain, score
FT                   0.0011"
FT   misc_feature    complement(95055..95123)
FT                   /note="1 probable transmembrane helix predicted for PMI0067
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    complement(95061..95141)
FT                   /note="Signal peptide predicted for PMI0067 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.954 between residues 27 and 28"
FT   CDS_pept        complement(95208..95924)
FT                   /transl_table=11
FT                   /locus_tag="PMI0068"
FT                   /product="putative subunit of oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40307"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU05"
FT                   /protein_id="CAR40307.1"
FT                   /translation="MMNKQNASASIPPDIAHDADITLEQPDISLRRWLLPLSERGIGHG
FT                   THTLTDTTEEQIEDIAQLSAEQHLANAIRQCSKEGELLAISTLYDAPYSLSEEEVMQLR
FT                   VALKEDTFVDITYLTHNGEDYFYSDTVMSDNYAQLQLLNRYTDICTAIAGLVRFECETY
FT                   PRPLKQSMLMLEPFYYTAAEIDDALTLMKTHPDFQDIQQIFASNNAPYLFSSTLMSYGK
FT                   ARGLTEWLEVEQYENP"
FT   CDS_pept        complement(95940..98042)
FT                   /transl_table=11
FT                   /locus_tag="PMI0069"
FT                   /product="putative aldehyde ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40308"
FT                   /db_xref="GOA:B4EU06"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU06"
FT                   /protein_id="CAR40308.1"
FT                   /translation="MINGWTGNILRINLTTGAISRESSSQYKSLIGGMGFGYKIMYEEV
FT                   APGVKPFDEENKVVFAVGPLTGSGAPCSSRVNITSLSTFTRGNLVVDAHMGGFFAAWMK
FT                   FAGYDALIIEGQADNPVWIHIDDDQVSIEDASFLWGKGTRQTTEELCAQTSPEACVAAI
FT                   GPAGENLVPLSGLINSRNHSGGAGIGAVLGAKKLKAIVVEGSRGVNVADRKALKELNDY
FT                   MMTQLIGANNNHVVPSTPQSWAEYSHPGSRWTARKGLYWGAAEGGPIETGEIPPGNANT
FT                   VGFRTMKSTFDLGPEAEQYTVKMGGCHSCPIRCMSQLNVPQAKKFGVPQTGGNTCVANF
FT                   VHTTIFPNGPKDIEKKGDANVVGNLVGLNIFDDMGLWCNYGQLHRDFTYCYTHGVFKRV
FT                   LSEEEYNDIPWDKLEEGDPAFIKDFYYRLAHRKGEFSHLADGSYLIAQRWNLGEEYWGN
FT                   KKNKLWSPMGFPIHHANEASAQVGSIVNCMFNRDAMTHTHINYIGSGLPLKLQKEIAGE
FT                   LFGSGDAFDETKNYTPINKAKIAYTKWTILRSCLHDAVTLCNWVWPMTVSPHKSRNYRG
FT                   DLDMEAKFFTAITGEPTTSQDLDLASERIFTLHRAYTVKLMNTMDMRNEHDQICSWVFD
FT                   KDPDIPVFTEGTDKMDREDMQLSLTLFYEEMGWDPQLGCPTKATLVRLGLQDVADDLAS
FT                   RGLLPN"
FT   misc_feature    complement(95988..97370)
FT                   /note="HMMPfam hit to PF01314, Aldehyde ferredoxin
FT                   oxidoreductase, domains, score 2.2e-201"
FT   misc_feature    complement(97425..98030)
FT                   /note="HMMPfam hit to PF02730, Aldehyde ferredoxin
FT                   oxidoreductase, N-termin, score 6.5e-107"
FT   CDS_pept        complement(98095..98724)
FT                   /transl_table=11
FT                   /locus_tag="PMI0070"
FT                   /product="putative oxidoreductase, Fe-S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40309"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU07"
FT                   /protein_id="CAR40309.1"
FT                   /translation="MSDTHHRPILDIGLSRLEFLRISGKGLAGITIAPALLSLLGCKQE
FT                   EIDSGVIQLTTTPKGVLVTNRARCTGCHRCETACTTWNDGSVGSFFSRTKIHRHFYFGD
FT                   KGIGSGGGLYGDLNFTTDTCRQCKTPECMNVCPVKAIRYQEEFGCIVVDTRRCIGCAAC
FT                   TTACPWMMATVNPQTKKSGKCNLCGECASACPTGALHIIEWKEITV"
FT   misc_feature    complement(98125..98196)
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain, score
FT                   1.3e-05"
FT   misc_feature    complement(98140..98175)
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT   misc_feature    complement(98206..98277)
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain, score
FT                   4.1e-05"
FT   misc_feature    complement(98221..98256)
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT   misc_feature    complement(98299..98376)
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain, score
FT                   0.004"
FT   misc_feature    complement(98503..98520)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    complement(98599..98631)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(99189..99317)
FT                   /transl_table=11
FT                   /locus_tag="PMI0071"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40310"
FT                   /db_xref="GOA:B4EU08"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU08"
FT                   /protein_id="CAR40310.1"
FT                   /translation="MAKETFSLLDKVSFFIKMISSLFYNLLISFFINNNQDSFFIK"
FT   misc_feature    complement(99222..99281)
FT                   /note="1 probable transmembrane helix predicted for PMI0071
FT                   by TMHMM2.0 at aa 13-32"
FT   CDS_pept        complement(99339..101111)
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="PMI0072"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40311"
FT                   /db_xref="GOA:B4EU09"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU09"
FT                   /protein_id="CAR40311.1"
FT                   /translation="MDIIMITIKKTHLLLLTTLFSPALYAAYEPAVEAQQGMVVSSQHL
FT                   ASQVGKDILQKGGNAIDAAVAVGYAQAVVNACCGNIGGGGFMTIHLADGTNTFINFRET
FT                   APTAASKNMYLDKDGNLIKEASLYGYLASGVPGTVKGLDAALEKYGTLSRQEVMAPAIK
FT                   LAREGYILTRADTDVLDTTTERFKQDPESAKIFLKPDGTPWQPGDRLIQTDLANTLELI
FT                   ANQGADAFYQGEIPKKVEQASKQHNGLLTKEDFANFTITETPPITCTYRGYEFISAPPP
FT                   SSGGVTICQTLNILEGYDLKSMGFNSAEYVHTLTEAMRHAYMDRNTFLGDPQFINNPTE
FT                   KLLSKAYAAELRQQITPNKATPSEKVQPGIAPHESPETTHYSVIDKDGNAVSTTYTING
FT                   RFGAVVIAPGTGFFLNNEMDDFTTKVGEKNLYGLVQGERNSIAPLKRPLSSMSPTIVTK
FT                   DGKPFLVLGSPGGSRIISITLQTALNIIEFGMSPQEAVNSPRIHHQWLPDEVYYEQRGL
FT                   SKDTLEKLSAMGYKMVEQTPWGAAELIMVGLPGEQGVIPASSGNDSAVSGAIREGYLYG
FT                   SNDVRRPAGKAVGY"
FT   misc_feature    complement(99360..100961)
FT                   /note="HMMPfam hit to PF01019,
FT                   Gamma-glutamyltranspeptidase, score 2.7e-252"
FT   misc_feature    complement(99906..99980)
FT                   /note="PS00462 Gamma-glutamyltranspeptidase signature."
FT   CDS_pept        complement(101402..102004)
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="PMI0073"
FT                   /product="putative alkyl hydroperoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40312"
FT                   /db_xref="GOA:B4EU10"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU10"
FT                   /protein_id="CAR40312.1"
FT                   /translation="MVLVTRKAPDFTAAAVLGNGEIVNDFNLHSFIKGKPAVIFFWPMD
FT                   FTFVCPSELIAFDHRFEEFQKRGVEIIGVSMDSEFVHNAWRKTAIDDGGIGEVRYPMVA
FT                   DIKHDIIKAYGIEHPEAGVALRGSFLIDKEGVVRHQVVNDLPLGRNIDEMIRMVDALQF
FT                   HEEHGDVCPAQWEKGQEGMGASPDGVAKYLKANSGKL"
FT   misc_feature    complement(101537..101995)
FT                   /note="HMMPfam hit to PF00578, AhpC/TSA family, score
FT                   3.3e-56"
FT   CDS_pept        complement(102415..103002)
FT                   /transl_table=11
FT                   /locus_tag="PMI0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40313"
FT                   /db_xref="GOA:B4EU11"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU11"
FT                   /protein_id="CAR40313.1"
FT                   /translation="MNYLAHLHLAFRAKSSLLGNMMADYVKGTPSNDYSQAVIDGIRMH
FT                   RRIDVLTDTHPLVKQARQLFPNEYRRVAPITLDIFWDHFLSLHWDKFEPDIPLLEFVTY
FT                   VRNTIEPDLWRTPEKFQELNEYLWPQAWLTRYADKTYIAQTLKGMAKRRPRLSALAGSY
FT                   IALETHYKELSEIFWQFYPQLLERAQHHQLDD"
FT   misc_feature    complement(102427..102948)
FT                   /note="HMMPfam hit to PF04336, Protein of unknown function,
FT                   DUF479, score 6.2e-79"
FT   CDS_pept        103110..104183
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="PMI0075"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40314"
FT                   /db_xref="GOA:B4EU12"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU12"
FT                   /protein_id="CAR40314.1"
FT                   /translation="MRVSDFRFDLPESLIAHYPHPQRSGCRLLSLEGKTGNLSHGVFTD
FT                   VLDKLNAGDLLVFNNTRVIPARIYGRKASGGKIEVLVERMLDEHRVLAHVRASKSPKEG
FT                   ASLILGEDESVQATMIARHDTLFEIRFDDERDVLTILNSIGHMPLPPYIDRPDERSDKE
FT                   LYQTVYNERPGAVAAPTAGLHFDEPLLEALRNKGVEMAFVTLHVGAGTFQPVRVDNIEE
FT                   HTMHSEYAEVPQEVVDAVLACKARGNRVIAVGTTSVRSLESAAKAAKDALIAPFFDDTQ
FT                   IFIYPGYQYQIIDALITNFHLPESTLIMLVSAFAGYKNTMNAYNVAVEQKYRFFSYGDA
FT                   MFITRNPLAINEKVGEE"
FT   misc_feature    103110..103760
FT                   /note="HMMPfam hit to PF02547, Queuosine biosynthesis
FT                   protein, score 1.3e-128"
FT   CDS_pept        104365..105507
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="PMI0076"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40316"
FT                   /db_xref="GOA:B4EU13"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU13"
FT                   /protein_id="CAR40316.1"
FT                   /translation="MKYELDKTDGHARRGRLKFERGVVETPAFMPVGTYGTVKGMTPEE
FT                   VEATGAQILLGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKI
FT                   KEEGVHFRNPINGEKIFLSPEKSMEIQYDLGSDIVMIFDECTPYPSDWDYAKNSMEMSL
FT                   RWAKRSRQRFDELNNKNALFGIIQGGVYEDLRDISVKGLVEIGFDGYAVGGLAVGEPKE
FT                   DMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTN
FT                   GVIKIRNAKHRSDTSTLDEHCDCYTCKNYSRAYLHHLDRCNEILGARLNTIHNLRYYQR
FT                   LMAEIRQAIDESRFEDFVHEFYERIGKPVPPLNSSASKCD"
FT   misc_feature    104737..105453
FT                   /note="HMMPfam hit to PF01702, Queuine
FT                   tRNA-ribosyltransferase, score 3.3e-165"
FT   CDS_pept        105594..105929
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="PMI0077"
FT                   /product="putative preprotein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40318"
FT                   /db_xref="GOA:B4EU14"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU14"
FT                   /protein_id="CAR40318.1"
FT                   /translation="MSFFISDAVASAGQAAPEASFMSILPMLVIFILIFYFMILRPQQK
FT                   RTKEHRKLMESIGKGDEVLTTGGLIGRVVKVSDNGYIVVALNETTEVTIKRDFVAAVLP
FT                   KGTMKAI"
FT   misc_feature    105651..105902
FT                   /note="HMMPfam hit to PF02699, Preprotein translocase
FT                   subunit, score 3.2e-43"
FT   misc_feature    105651..105719
FT                   /note="1 probable transmembrane helix predicted for PMI0077
FT                   by TMHMM2.0 at aa 20-42"
FT   CDS_pept        105962..107809
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="PMI0078"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40320"
FT                   /db_xref="GOA:B4EU15"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU15"
FT                   /protein_id="CAR40320.1"
FT                   /translation="MLNRYPLWKYLMLIFAILIGLLYALPNLYGEDPAVQITGARGTAA
FT                   NEQTLDQVRSLLDKEKIEAKSIALENGAILARFSNPDIQLRAREALLPALGDKFVVALN
FT                   LAPATPKWLEAIGGEPMKLGLDLRGGVHFLMEVDMETALGKLQEQNVDSLRTLLRDEGI
FT                   PYSSIRKTDNYGVEIRFRNADDRSKASDYLARRNQDLIFRNGDNNSLKAIFTDERLRDA
FT                   RTYAVQQNITILRNRVNQLGVAEPLVQRQGADRIVVELPGIQDTARAKEILGATATLEF
FT                   RLVNTNVDPSALETGRIPGDSEVKYTRDGRPTILYKRVVLTGDHITDSTSQADEYGQPQ
FT                   VSISLDSAGGSIMSNFTKDNVGKPMATLFVEYKDSGKRDENDRAILVKNEEVINVANIQ
FT                   TRLGNNFRITGISNANEARQLSLLLRAGALIAPIQIVEERTIGPTLGLQNITQGLEACL
FT                   WGLIASVAFMIIYYRKFGVIASTALLANLVLIVGVMSLLPGATLTMPGIAGIVLTLAVA
FT                   VDANVLINERIKEELRNGRSVQQAIHEGYKGAFSSIIDANLTTLITAVILYAVGTGSIK
FT                   GFAITTAIGVATSMFTAIVGTRAIVNLLYGGKRIKKLSI"
FT   misc_feature    105962..106033
FT                   /note="Signal peptide predicted for PMI0078 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.967) with cleavage site
FT                   probability 0.549 between residues 24 and 25"
FT   misc_feature    join(105980..106048,107309..107377,107384..107452,
FT                   107465..107533,107603..107671,107699..107767)
FT                   /note="6 probable transmembrane helices predicted for
FT                   PMI0078 by TMHMM2.0 at aa 7-29, 450-472, 475-497, 502-524,
FT                   548-570 and 580-602"
FT   misc_feature    106295..106390
FT                   /note="HMMPfam hit to PF07549, SecD/SecF GG Motif, score
FT                   0.00054"
FT   misc_feature    107225..107770
FT                   /note="HMMPfam hit to PF02355, Protein export membrane
FT                   protein, score 1.6e-06"
FT   CDS_pept        107775..108788
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="PMI0079"
FT                   /product="protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40323"
FT                   /db_xref="GOA:B4EU16"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU16"
FT                   /protein_id="CAR40323.1"
FT                   /translation="MAVNASRNCLFKEHVVAQDYTVEQLNHGRKVIDFMRWDNVAFTIS
FT                   FLLLVASIAIISVKGFNWGLDFTGGTVIEINLSQPADLDKMRDSLAAAGYKDPLLQNFG
FT                   SSRDIMVRMPPVEGQAGQELGKKVIDIINVEIDNDATVKRIEFVGPSVGSELAQTGAMA
FT                   LLSALICILIYVGFRFEWRLALGAVISLAHDVVITLGILSLFQIEVDLTIVASLMSVIG
FT                   YSLNDSIVVSDRIRENFRKIRRGTSYEIMNVSLTQTLSRTIMTSATTLLVVLMLYIFGG
FT                   SMLKGFSLVMLIGVSFGTVSSIYVASALALKMGMKREHLIVQKVEKEGADQTTLLP"
FT   misc_feature    join(107889..107948,108243..108302,108321..108389,
FT                   108399..108467,108558..108626,108639..108707)
FT                   /note="6 probable transmembrane helices predicted for
FT                   PMI0079 by TMHMM2.0 at aa 39-58, 157-176, 183-205, 209-231,
FT                   262-284 and 289-311"
FT   misc_feature    107937..108023
FT                   /note="HMMPfam hit to PF07549, SecD/SecF GG Motif, score
FT                   8.4e-06"
FT   misc_feature    108156..108722
FT                   /note="HMMPfam hit to PF02355, Protein export membrane
FT                   protein, score 3.2e-96"
FT   misc_feature    108642..108671
FT                   /note="PS00120 Lipases, serine active site."
FT   CDS_pept        108907..109356
FT                   /transl_table=11
FT                   /gene="ribX"
FT                   /locus_tag="PMI0080"
FT                   /product="putative ATP-binding regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40324"
FT                   /db_xref="GOA:B4EU17"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU17"
FT                   /protein_id="CAR40324.1"
FT                   /translation="MHCPFCTAVDTKVIDSRLVGDGSQVRRRRQCLVCHERFTTFEVAE
FT                   LVMPRVVKSDEIREPFDEEKLRRGMLKALEKRPVSSDDVEAAINHIKSQLRATGEREIP
FT                   SKQIGNFVMEQLKKLDKVAYIRFASVYRSFEDVRDFGEEIAKLQD"
FT   misc_feature    108997..109014
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    109051..109323
FT                   /note="HMMPfam hit to PF03477, ATP cone domain, score
FT                   1.2e-31"
FT   CDS_pept        109413..110570
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="PMI0081"
FT                   /product="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase and 5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40325"
FT                   /db_xref="GOA:B4EU18"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU18"
FT                   /protein_id="CAR40325.1"
FT                   /translation="MMTINNSNNLTGNEPANDETYMRRAIELAALGRFTTSPNPNVGCV
FT                   IVKEGKIIGEGYHHHAGGPHAEVNALNMAGENAKGATVYVTLEPCSHFGKTPPCADALI
FT                   NAGVKRVVAAMQDPNPQVAGRGLHKLVAAGIDVSHGVLMQEAEKLNIGFFKRMRTGFPY
FT                   IQLKLAASLDGKTALASGESQWITSNASRQDVQNFRAQASAILTTSATVLADDPAMNVR
FT                   WEALSDEIKAIYPLESLRQPIRIITDSQNRVTPDYKITQLAGECLLARTHSQQEAWQGD
FT                   VSEILLPTNGKNSSVDLVLLMMQLGKRNINSVWVESGAHFAGALLELGLVDELIIYIAP
FT                   KILGNDARGLLSISPLSSLSEAPEFTIDSLQQIGPDIRVCLKPRY"
FT   misc_feature    109458..109757
FT                   /note="HMMPfam hit to PF00383, Cytidine and deoxycytidylate
FT                   deaminase, score 4.3e-45"
FT   misc_feature    109605..109721
FT                   /note="PS00903 Cytidine and deoxycytidylate deaminases
FT                   zinc-binding region signature."
FT   misc_feature    109896..110549
FT                   /note="HMMPfam hit to PF01872, RibD C-terminal domain,
FT                   score 8.3e-60"
FT   misc_feature    109917..109940
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        110783..111253
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="PMI0082"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40327"
FT                   /db_xref="GOA:B4EU19"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU19"
FT                   /protein_id="CAR40327.1"
FT                   /translation="MNVIKGVVAAPNARVAIAIARFNNFINDSLLEGAVDALERIGQVS
FT                   SENITVVWVPGAYELPLTVKALVESDKYDAVIALGTVIRGGTAHFEYVAGECSSGLSHV
FT                   AMQSEIPVTFGVLTTESIEQAIERAGTKAGNKGAEAAMTALEMINVLKAIKG"
FT   misc_feature    110810..111244
FT                   /note="HMMPfam hit to PF00885,
FT                   6,7-dimethyl-8-ribityllumazine synthase, score 3.8e-88"
FT   CDS_pept        111282..111695
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="PMI0083"
FT                   /product="N utilization substance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40329"
FT                   /db_xref="GOA:B4EU20"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU20"
FT                   /protein_id="CAR40329.1"
FT                   /translation="MKPAARRRARECAVQAIYSWQLSGNDIADVELEFLSEQDTQGVDI
FT                   AYFRELLVGVAINAARLDKAMEPYLSRQLEELGQVEKAILRLAMFELSFREDVPYKVAI
FT                   NEAIELAKVFGADDSHKFVNGVLDKAAPTVRKK"
FT   misc_feature    111300..111683
FT                   /note="HMMPfam hit to PF01029, NusB family, score 4.6e-45"
FT   CDS_pept        111789..112769
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="PMI0084"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40333"
FT                   /db_xref="GOA:B4EU21"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU21"
FT                   /protein_id="CAR40333.1"
FT                   /translation="MPCGEFSLIKQYFTSQPVKRKDVSTGIGDDCAILTVPEKQQVAIS
FT                   TDTLVSGIHFLPTISPEDLAYKALAVNISDLAAVGADPAWASLALTLPKVDNDWLEAFS
FT                   RSLFALAEYYSIQLIGGDTTKGPLSLTITIQGLVPQGMALLRSGAKIGDWIYVTGFLGD
FT                   SAAGLAVLQNRLQPSQPESRDYFITRHLRPQPRLLQGQALRSLASAAIDISDGLISDLN
FT                   HILTASGCGARINLDALPYSAAMKSQVSKEQAEIWALSGGEDYELCFTVPEINRGALDI
FT                   ALAHTGADFHCIGQIMPIAEGIRYLREGKEVHPNLKGFDHFGDNK"
FT   misc_feature    112236..112709
FT                   /note="HMMPfam hit to PF02769, AIR synthase related
FT                   protein, C-terminal dom, score 0.0003"
FT   CDS_pept        complement(112855..113190)
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="PMI0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40335"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU22"
FT                   /protein_id="CAR40335.1"
FT                   /translation="MSLPSCPKCNSEYTYEDGAMYVCPECAHEWNDAEPTTDSDELIVK
FT                   DAHGNLLADGDSVTVIKDLKVKGSSTPLKIGTKVKGIRLVEGDHNIDCKIDGFGQMKLK
FT                   SEFVKKS"
FT   misc_feature    complement(112900..113064)
FT                   /note="HMMPfam hit to PF03831, PhnA protein, score 2.2e-36"
FT   repeat_region   113611..113631
FT                   /rpt_family="PMI.dna.398"
FT                   /note="Forward repeat found by REPuter:
FT                   gcctcgttcaatcagtttggg"
FT   CDS_pept        complement(join(113618..114016,114018..114044))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PMI0086"
FT                   /product="putative plasmid-associated protein (pseudogene)"
FT                   /note="This CDS appears to have a frame shift mutation near
FT                   the N-terminus."
FT                   /db_xref="PSEUDO:CAR40339.1"
FT   misc_feature    complement(join(113651..114016,114018..114035))
FT                   /note="HMMPfam hit to PF01850, PIN domain, score 8.2e-22"
FT   CDS_pept        complement(114037..114279)
FT                   /transl_table=11
FT                   /locus_tag="PMI0087"
FT                   /product="putative plasmid-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40341"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU24"
FT                   /protein_id="CAR40341.1"
FT                   /translation="MIQYGKVFMSNRTQNVRLPAETRFPDDVKEVFVRVKGKERIITPI
FT                   QNAWDSFFLSEKSVTDDFLSERPDQATSERGSFDD"
FT   misc_feature    complement(114103..114261)
FT                   /note="HMMPfam hit to PF04014, SpoVT / AbrB like domain,
FT                   score 0.0049"
FT   CDS_pept        complement(114382..115389)
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="PMI0088"
FT                   /product="ribose operon repressor (LacI-family
FT                   transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40342"
FT                   /db_xref="GOA:B4EU25"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU25"
FT                   /protein_id="CAR40342.1"
FT                   /translation="MATMKDVARLAGVSTSTVSHVINNNRYVSEGIRAKVNHAIATLNY
FT                   APSALARSLKMNCTRTIGMLVTASNNPFYAEVVRGVERSCYEQGYSLILCNTEGDYERM
FT                   DTSLETLLQKRVDGLLLMCTEARAPSSEVLNRYPRLPMVMMDWSPFEYSSDIIQDNSLL
FT                   GGELATNYLIEKGFTDIACIAGPQDKLPAKHRLQGYYNAMQQAGLPIRKELVLTSDFEF
FT                   AGGFSAMQTLLSLPIQPQAVFTCNDAMAVGAYQAIYQKGLRVPDDISIVGYDDIDLASY
FT                   MIPPLTTIHQPKDELGKLAVSQLLRRMEDIEAQANLLVLTPKLIERGSVIAHRK"
FT   misc_feature    complement(114406..115215)
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 2.7e-18"
FT   repeat_region   114406..114426
FT                   /rpt_family="PMI.dna.398"
FT                   /note="Forward repeat found by REPuter:
FT                   gcctcgttcaatcagtttggg"
FT   misc_feature    complement(115309..115386)
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI fami, score 9e-14"
FT   misc_feature    complement(115321..115386)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2156.000, SD 6.53 at aa 2-23, sequence
FT                   ATMKDVARLAGVSTSTVSHVIN"
FT   misc_feature    complement(115324..115380)
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT   CDS_pept        complement(115394..116320)
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="PMI0089"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40344"
FT                   /db_xref="GOA:B4EU26"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU26"
FT                   /protein_id="CAR40344.1"
FT                   /translation="MTTPRLAVLGSINVDHIMNIAQFPKPGETVIGHDYKIAFGGKGAN
FT                   QAVACGRSGADITFIACVGDDAIGREIIAQLKTDNIDTDAIRIIPKTPTGVAMILVNEQ
FT                   GENVISIVAGANSALTPSHLHQYRHIIEQADALLMQLESPLDTVFEAAKQAKAHQTKVI
FT                   LNPAPAQPLSDEFLSFIDIITPNETEAEILTGISVHDEVGAAKAANILHSKGIKHVLIT
FT                   LGSRGVWFSEQGTGMIIPGFRVEAVDTIAAGDTFNGAFVTAILEGKSAHDAIRFAHAAA
FT                   AIAVTRHGAQSSVPWRDEIKSFLAERA"
FT   misc_feature    complement(115430..116308)
FT                   /note="HMMPfam hit to PF00294, pfkB family carbohydrate
FT                   kinase, score 3.8e-93"
FT   misc_feature    complement(115538..115579)
FT                   /note="PS00584 pfkB family of carbohydrate kinases
FT                   signature 2."
FT   misc_feature    complement(116129..116203)
FT                   /note="PS00583 pfkB family of carbohydrate kinases
FT                   signature 1."
FT   CDS_pept        complement(116397..117287)
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="PMI0090"
FT                   /product="D-ribose ABC transporter, substrate-binding
FT                   periplasmic protein"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40345"
FT                   /db_xref="GOA:B4EU27"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU27"
FT                   /protein_id="CAR40345.1"
FT                   /translation="MKLKKIATLLSVVALSATISANALAKESIALVISTLNNPFFVTMK
FT                   DSAQKEADKLGYDLVVLDSMDNPAKELANVQDLTVKGTRLMLINPTDSDAVGNAVLMAN
FT                   KAKIPVVTLDRVANKGEVVSHVASDNRLGGKMAGDYIAEKVGNDAKVIQLEGIAGTSAS
FT                   RERGEGFKQAVDAHKLNILASQPADFDRTKGLNVMQNLLTANPSVQAVFAQNDEMALGA
FT                   LRALQTAGRTDVLVVGFDGTNDGIKAVNRGVLGATIAQRPDQIGIIGIQTADKILKGEK
FT                   VDPTIPVELELVTQK"
FT   misc_feature    complement(116400..117212)
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 6.4e-10"
FT   misc_feature    complement(117213..117287)
FT                   /note="Signal peptide predicted for PMI0090 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.992 between residues 25 and 26"
FT   CDS_pept        complement(117327..118292)
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="PMI0091"
FT                   /product="ribose ABC transporter, permease protein"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40346"
FT                   /db_xref="GOA:B4EU28"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU28"
FT                   /protein_id="CAR40346.1"
FT                   /translation="MSTKSIPASKRWFSKAWLLEQKSLIALLLLIVVVSTLSPNFFTLN
FT                   NIFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASMVGADVNALVAVVG
FT                   ALALGAAIGGVTGVIIAKGKVQAFIATLVMMLLLRGVTRVYTDGSPINTGFSDNADLFS
FT                   WFGIGRPFGIPTPIWLMMIVFLSAWYVLHHTRLGRYIYALGGNEAATRLSGISVDKIKI
FT                   IVYALCGLLAALASVIEVARLSSAQPMAGNGYELDAIAAVVLGGTSLAGGKGRIMGTLI
FT                   GALILGFLNNALNLLGISSNYQMIVKAVVILLAVLVDNKK"
FT   misc_feature    complement(117348..118157)
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport syst, score 3.3e-75"
FT   misc_feature    complement(join(117399..117467,117561..117629,
FT                   117717..117785,117855..117914,117933..118001,
FT                   118029..118097,118158..118226))
FT                   /note="7 probable transmembrane helices predicted for
FT                   PMI0091 by TMHMM2.0 at aa 23-45, 66-88, 98-120, 127-146,
FT                   170-192, 222-244 and 276-298"
FT   misc_feature    complement(118164..118292)
FT                   /note="Signal peptide predicted for PMI0091 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.981) with cleavage site
FT                   probability 0.441 between residues 43 and 44"
FT   CDS_pept        complement(118294..119802)
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="PMI0092"
FT                   /product="ribose ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40348"
FT                   /db_xref="GOA:B4EU29"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU29"
FT                   /protein_id="CAR40348.1"
FT                   /translation="MEALLELKNIDKSFPGVKALSGATLRIYPGRVMALVGENGAGKST
FT                   LMKVLTGIYQKDAGEIIYQGERCSFNGPKSSQEAGIGIIHQELNLIPELTIAENIFLGR
FT                   EFTRAFGAIDWKKMYAEADKLLARLNLPYRSHRSVSELSIGDQQMVEIAKVLSFGSKVI
FT                   IMDEPTDALTDTETRSLFSVITELRNQGCGIVYISHRLKEIFDICDDVTVLRDGQFIGE
FT                   KPVSSLQEETLIEMMVGRKLEDQYPRIHIPAGKTKLNVSHLSGADIHDVSFSLYENEIL
FT                   GISGLMGAGRTELMKMIYGALPKTQGSVALEGKICQIKKPADALAQGIVYISEDRKRDG
FT                   LVLGMSVKENMSLTALPYFSRTMGILNHKEEQLTVSDFIKLFNIKTPSINQIIGFLSGG
FT                   NQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINKFKQEGLSIILISSEMPEV
FT                   MGMSDRILVMHEGRISGEFSANNVTQEMLMAAAVGKQYGATVGV"
FT   misc_feature    complement(118390..118971)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.8e-32"
FT   misc_feature    complement(118573..118617)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(119152..119715)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.9e-53"
FT   misc_feature    complement(119671..119694)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(119810..120229)
FT                   /transl_table=11
FT                   /gene="rbsD"
FT                   /locus_tag="PMI0093"
FT                   /product="high affinity ribose transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40350"
FT                   /db_xref="GOA:B4EU30"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU30"
FT                   /protein_id="CAR40350.1"
FT                   /translation="MKKGVLLNSSISSVIARLGHTDKITIADAGLPIPSSVERIDLALT
FT                   QGIPDFMSVLQTITHEMQVEAVMLAIEIKNINPLLFSEITRYLHLLEQQQKKPIEIIYV
FT                   THEEFKTQLPDNKAVIRTGECSPYANIVLFSGVTF"
FT   misc_feature    complement(119813..120229)
FT                   /note="HMMPfam hit to PF05025, RbsD / FucU transport
FT                   protein family, score 2.8e-70"
FT   CDS_pept        complement(120570..122444)
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="PMI0094"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40354"
FT                   /db_xref="GOA:B4EU31"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU31"
FT                   /protein_id="CAR40354.1"
FT                   /translation="MSIDIEKYPTLALVETPEDLRLLPKESLPKLCDELRLYLLNSVSR
FT                   SSGHFASGLGAIELTVALHYVYKTPFDNLIWDVGHQAYPHKILTGRRDRIDTIRQKNGL
FT                   HPFPWRDESEYDKLCVGHSSTSISAGLGMAVAAEQENLGRKTVCVIGDGAITAGMAFEA
FT                   MNHAGDINPDMLVVLNDNEMSISENVGALNNHLAQLLSGKLYTTLREGGKKVFSGIPPI
FT                   KELLKKTEEHIKGMVVPGTMFEELGFNYIGPVDGHDVIALVQTLTNMRDLKGPQLLHIM
FT                   TKKGRGYAPAEQDPISWHAVPKFDPKTGTLPKSPNARPTFSKIFGDWLCEEAATDEKLM
FT                   AITPAMREGSGMVRFSKEYPAQYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRA
FT                   YDQVIHDVAIQKLPVLFAIDRGGIVGADGQTHQGAFDLSFLRCIPNMIIMAPSDENECR
FT                   QMLHTGYHYQEGPVAVRYPRGSGVGAPLQPLSELPIGKGIIRRQGKSIAILNFGTLLPE
FT                   ALDVAEKLDATVADMRFIKPLDKELILSLAKQHDILVTLEENAIMGGAGSGVNELLMQE
FT                   RCLVPVLNLGLPDLFVPQGGQEEIRADLGLDATGIEKSIKAYQAHSLR"
FT   misc_feature    complement(120612..120962)
FT                   /note="HMMPfam hit to PF02780, Transketolase, C-terminal
FT                   domain, score 4.6e-41"
FT   misc_feature    complement(120996..121490)
FT                   /note="HMMPfam hit to PF02779, Transketolase, pyridine
FT                   binding domai, score 8.4e-63"
FT   misc_feature    complement(121122..121172)
FT                   /note="PS00802 Transketolase signature 2."
FT   misc_feature    complement(122280..122339)
FT                   /note="PS00801 Transketolase signature 1."
FT   CDS_pept        complement(122511..123434)
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="PMI0095"
FT                   /product="geranyltranstransferase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40356"
FT                   /db_xref="GOA:B4EU32"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU32"
FT                   /protein_id="CAR40356.1"
FT                   /translation="MSNATLCTDAFRQKLHSAHQRVDEALNQALQTLPFSDMPLSQAMR
FT                   YGALLGGKRLRPFLVYAVGEMFNVPVANLDVPAAAIECIHAYSLIHDDLPAMDNDDLRR
FT                   GKPTCHIEFGEANAILAGDALQTLAFEILAKNAMPDVAIADRVAMIAELATASGLAGMC
FT                   GGQALDLDAEDKSIDLVALEKIHLHKTGALIRAAVRLGALSAGQKGHDVLPALDKYAHS
FT                   IGLAFQVQDDILDVIGSTEETGKRQGSDQEAGKSTYPALLGLAQAQKKAQELYNEALDA
FT                   LAFLEQYEYDTSTLKQLANFIVERKN"
FT   misc_feature    complement(122526..123317)
FT                   /note="HMMPfam hit to PF00348, Polyprenyl synthetase, score
FT                   1.7e-113"
FT   misc_feature    complement(122730..122768)
FT                   /note="PS00444 Polyprenyl synthetases signature 2."
FT   misc_feature    complement(123120..123170)
FT                   /note="PS00723 Polyprenyl synthetases signature 1."
FT   CDS_pept        complement(123435..123743)
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="PMI0096"
FT                   /product="exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40358"
FT                   /db_xref="GOA:B4EU33"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU33"
FT                   /protein_id="CAR40358.1"
FT                   /translation="MITIIQLTCFIIKNIMAKKTTSINQDTTQTPSFEASMQELEQIVN
FT                   RLESGELPLEEALNEFEHGVRLARVGQKTLQDAEQRVRILLKEDDDATPDDFIQEAE"
FT   misc_feature    complement(123462..123653)
FT                   /note="HMMPfam hit to PF02609, Exonuclease VII small
FT                   subunit, score 1.1e-31"
FT   CDS_pept        123898..125349
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="PMI0097"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40360"
FT                   /db_xref="GOA:B4EU34"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU34"
FT                   /protein_id="CAR40360.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRIRFIKILTSNIRNVLSTLGDDITVVR
FT                   HWDNIVVVSKDESKSEAVCDALTRIPGIHHFLQVEEHSYTDLHNIFEQTFAAFGHLVEN
FT                   KTFCVRAKRRGKHSFTSNEVERYVGGGFNQHVESAKVKLTRPDVTINLEIEDDKLILVN
FT                   ARYEGIGGFPIGTQEDVLSLISGGYDSGVSSYMLMRRGSRVHYCFFNLGGSAHEIGVKQ
FT                   VAHYLWNRFGRSHKVHFVAVDFEPVVAEILEKIDDGQMGVVLKRMMVRAASRVAERYGV
FT                   QAIVTGEALGQVSSQTLTNLRLIDNATDTLILRPLITHDKENIINIARQIGTEDFARTM
FT                   PEFCGVISKNPTVKAVKAKIEAEEEKFDFSILDSVVENAKNMDIRRIAEETVQQVTEVE
FT                   MVSEFATNDVVLDIRSPEEQENSPLKLEGVDVKELPFYKLSTQFGDLDNSKTYLLYCER
FT                   GMMSRLQALYLREQGFNNVKVYRKK"
FT   misc_feature    124120..124392
FT                   /note="HMMPfam hit to PF02926, THUMP domain, score 1.2e-20"
FT   misc_feature    124420..125004
FT                   /note="HMMPfam hit to PF02568, Thiamine biosynthesis
FT                   protein (ThiI), score 3.2e-103"
FT   CDS_pept        complement(125457..125630)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PMI0098"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="This CDS appears to be truncated at N-terminus
FT                   relative to database matches."
FT                   /db_xref="PSEUDO:CAR40362.1"
FT   CDS_pept        complement(125729..125836)
FT                   /transl_table=11
FT                   /locus_tag="PMI0099"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40364"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU36"
FT                   /protein_id="CAR40364.1"
FT                   /translation="MIEISIHPDIENKTIANEYAKLLKLWKEKKYYLVI"
FT   CDS_pept        complement(125842..126423)
FT                   /transl_table=11
FT                   /locus_tag="PMI0100"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40365"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU37"
FT                   /protein_id="CAR40365.1"
FT                   /translation="MKTLQYHKNLPKLVTLISMGLASVPAESFKHNQLSFTPDIQYSFS
FT                   SAQFNQFVAIPIDEATEKMNILAESINKHLIHLKEKWINPPHYFINEDDYYQINKSIKR
FT                   LDNSLTDIKNILLSLPKSDTQKKQSVLLFGRSLAHYRSVLTEFISFIEQTHQPSKTTNK
FT                   KPNIISADMQRLIQTEHKKLGLSKPKFNNH"
FT   misc_feature    complement(126334..126423)
FT                   /note="Signal peptide predicted for PMI0100 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.871) with cleavage site
FT                   probability 0.465 between residues 30 and 31"
FT   CDS_pept        complement(126594..127211)
FT                   /transl_table=11
FT                   /gene="thiJ"
FT                   /locus_tag="PMI0101"
FT                   /product="DJ-1/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40366"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU38"
FT                   /protein_id="CAR40366.1"
FT                   /translation="MTISALICLANGSEETEVVTTADLLVRAGIKVILASAEDDVDDLV
FT                   ITCSRGIKLIADVPLVRVVDHHYDAIILPGGLIGAETLRDSPLVVEKVRRMHSENRLVA
FT                   AICAAPAIILESHNLFPIGNMTGFPGLKDKIEPKKWVDYRVYFDERVNLITSQAPATTI
FT                   DFALKIIERLKGKAVAADVAKQLVLPPGIYNYQDEFTGFGDR"
FT   misc_feature    complement(126690..127121)
FT                   /note="HMMPfam hit to PF01965, DJ-1/PfpI family, score
FT                   2.4e-38"
FT   CDS_pept        complement(127180..128103)
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /gene_synonym="apbA"
FT                   /locus_tag="PMI0102"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40367"
FT                   /db_xref="GOA:B4EU39"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU39"
FT                   /protein_id="CAR40367.1"
FT                   /translation="MMKITVLGCGSIGKLWIAGLTQQAHEVQGWLRIPQPDFDVNVDSI
FT                   NGIPFQQRIIANQKTWLQHSELLLVCLKSWQVSDAVNALIPHLSADCPILLIHNGMGTL
FT                   DELTLPETPTKRAILQGIITHGAYQQDQKVLHTAEGITHIGPLNTTARQYGYLAEILHQ
FT                   ALPDVAWHNDIHTISWLKLAVNCVINPLTVFYQCRNGDLLKYPEHIQKVCDEVYQVMER
FT                   EGVIPTSRSHLHGYIIDTIEQTANNYSSMYQDVKYQRHTEIDYITGYLLRRASEQGLVL
FT                   PENKRLFQFIKQKEGNYDHIRTHLSS"
FT   misc_feature    complement(127216..127974)
FT                   /note="HMMPfam hit to PF02558, Ketopantoate reductase
FT                   PanE/ApbA, score 3.6e-59"
FT   CDS_pept        128357..128848
FT                   /transl_table=11
FT                   /locus_tag="PMI0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40371"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU40"
FT                   /protein_id="CAR40371.1"
FT                   /translation="MPSFDIVSEVDLHEVRNAVENAQRELTTRWDFRNVEASFELNEKT
FT                   ESVKTTSVSEFQVQQLLDILREKMAKRGIDGAVLNIPEEMTHSGKTYSVEATLKQGIDT
FT                   PLAKKIVKMIKDSKLKVQAQIQGEQVRVTGKSRDDLQAVMKLVREGELGQPFQFTNFRD
FT                   "
FT   misc_feature    128357..128842
FT                   /note="HMMPfam hit to PF04461, Protein of unknown function
FT                   (DUF520), score 6.8e-111"
FT   CDS_pept        complement(128911..130281)
FT                   /transl_table=11
FT                   /locus_tag="PMI0104"
FT                   /product="MFS-family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40372"
FT                   /db_xref="GOA:B4EU41"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU41"
FT                   /protein_id="CAR40372.1"
FT                   /translation="MNDNKMTPLERKATWGLGAVFSLRMLGMFMVLPVLTTYGLQLQHA
FT                   TESLIGLAIGIYGLTQAIFQIPFGFFSDKFGRKSMIVFGLIIFIVGSLTAALSDSIYGI
FT                   IIGRALQGAGAISAAVMALLSDLTREQNRTKAMAFIGISFGITFALALVLGPILTHIFG
FT                   LQGLFWGIALLAFGGIMITLITVPNSEHHILNRESSFVRGSVKKVLFDAQLLKLNVGIF
FT                   SLHTLLMAAFVALPLIMHNAGLVNEKHWVVYLVTMLIAFISVLPFIIYAEKKRKMKQVF
FT                   LLCIFLLIIAQAIFMISGTSLWLIILGIQIFFIGFNIMEALLPSLISKEAPAGYKGTAM
FT                   GIYSTSQFLGVALGGILGGWLYQHYDAQAVFAGCLLIGLVWFAISLTLRQPPYVSSLRI
FT                   ELPSHLSNAQQQQLEQKFKQQPGVNEVVIMAHEQSAYIKVDTKQTPRATLESLVLGV"
FT   misc_feature    complement(129097..130239)
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 1.8e-05"
FT   misc_feature    complement(join(129115..129183,129196..129264,
FT                   129298..129366,129376..129444,129469..129537,
FT                   129565..129633,129724..129792,129805..129873,
FT                   129910..129978,129988..130047,130066..130134,
FT                   130177..130245))
FT                   /note="12 probable transmembrane helices predicted for
FT                   PMI0104 by TMHMM2.0 at aa 13-35, 50-72, 79-98, 102-124,
FT                   137-159, 164-186, 217-239, 249-271, 280-302, 306-328,
FT                   340-362 and 367-389"
FT   misc_feature    complement(129193..130233)
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 3.5e-55"
FT   CDS_pept        complement(130455..131339)
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="PMI0105"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40374"
FT                   /db_xref="GOA:B4EU42"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU42"
FT                   /protein_id="CAR40374.1"
FT                   /translation="MIKQYLQVTKPGIIFGNLISVIGGFLLASKGEIDYPLFFATLLGV
FT                   SLVVASGCVFNNYIDRDIDRIMERTKNRPLVQGLIDPQISLIYASVLGIAGVVLLYVAA
FT                   NPLAMFIAVFGFIIYVGVYSLYMKRKSVYGTLIGSLSGSAPPVIGYCAVSGEFDAGAAI
FT                   LLLIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVIKGISVAKRHIILYILAFMVATLML
FT                   TLVGYAGYKYLIVASAVSIWWLGMALSGYKATNDKVWARKLFIFSIIAITSLSVMMSVD
FT                   PTSSTETVLAYLR"
FT   misc_feature    complement(130494..131300)
FT                   /note="HMMPfam hit to PF01040, UbiA prenyltransferase
FT                   family, score 1.1e-80"
FT   misc_feature    complement(join(130500..130553,130587..130640,
FT                   130650..130718,130797..130865,130878..130946,
FT                   130965..131024,131037..131105,131163..131231,
FT                   131259..131327))
FT                   /note="9 probable transmembrane helices predicted for
FT                   PMI0105 by TMHMM2.0 at aa 86-108, 118-140, 160-182,
FT                   187-206, 213-235, 240-262, 289-311, 315-332 and 344-361"
FT   misc_feature    complement(131106..131174)
FT                   /note="PS00943 UbiA prenyltransferase family signature."
FT   misc_feature    complement(131181..131213)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(131351..131683)
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="PMI0105A"
FT                   /product="cytochrome O ubiquinol oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0105A"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40376"
FT                   /db_xref="GOA:B4EU43"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU43"
FT                   /protein_id="CAR40376.1"
FT                   /translation="MSHPNTSPSGASHGSMKSYLIGFILSVILTVIPFWMVMEGTATTS
FT                   TILWTVVGMAVVQIVVHLVCFLHMNTSSEERWNVIAFLFTLLIIGIVVIGSLWIMYNLN
FT                   INMMMD"
FT   CDS_pept        complement(131683..132294)
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="PMI0106"
FT                   /product="cytochrome O ubiquinol oxidase subunit III"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40377"
FT                   /db_xref="GOA:B4EU44"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU44"
FT                   /protein_id="CAR40377.1"
FT                   /translation="MSTQTLNNANAHEHHGHHDAGATKVFGFWIYLMSDLILFASLFAT
FT                   YAVLVNGIADGPSGKEIFSLPFVLVETFLLLFSSITFGFAMLSMNKGSVSQVNLWLFVT
FT                   FLFGLGFVVMEVYEFHELIAEGYGPDRSAFLSAFFALVSTHGLHVTAGLVWIIIMMIQV
FT                   SRRGLTDVNRTRLSCLSLFWHFLDVVWICVFTVVYLMGAM"
FT   misc_feature    complement(131689..132288)
FT                   /note="HMMPfam hit to PF00510, Cytochrome c oxidase subunit
FT                   III, score 8.8e-06"
FT   misc_feature    complement(join(131692..131760,131821..131889,
FT                   131947..132006,132043..132111,132154..132222))
FT                   /note="5 probable transmembrane helices predicted for
FT                   PMI0106 by TMHMM2.0 at aa 25-47, 62-84, 97-116, 136-158 and
FT                   179-201"
FT   CDS_pept        complement(132294..134276)
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="PMI0107"
FT                   /product="cytochrome O ubiquinol oxidase subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40378"
FT                   /db_xref="GOA:B4EU45"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU45"
FT                   /protein_id="CAR40378.1"
FT                   /translation="MFGKLTLDAIPLQEPIVVVTLIGIILGGLAVVGALTYFRKWKWLW
FT                   SEWLTSVDHKKIGIMYIIVAMVMMFRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFT
FT                   AHGVIMIFFMATPFVVGLMNLVVPLQIGARDVAFPFLNSLSFWFFVVGVLLINISLGIG
FT                   EFAQTGWLAYPPLSGLEYNPGVGVDYWIWSLQISGIGTLLTGVNFFATILRMRAPGMTM
FT                   MKMPVFSWAALCTNVLIIAAFPILTVTITLLTLDRYLGTHFFTNDMGGNMMMYINLVWA
FT                   WGHPEVYILILPVFGVFSEVTATFSKKRLFGYTSLVGATVVITVLSFIVWLHHFFTMGS
FT                   GANVNAFFGIATMIIAIPTGVKIFNWLFTMYQGRIEYKSPMLWTIGFLVTFSVGGMTGV
FT                   LLAVPGANFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWFPKAFGFTLNEKWGIRAFW
FT                   FWFIGFFMAFMPLYILGFMGMTRRLSQNINPEFHPMLMVAAGGAALIALGIVCQVIQIY
FT                   VSIRDRHLNRDLTGDPWGGRTLEWSISSPAPFYNFAVEPQVKARDEWWDQKEKGTAYQR
FT                   PAKYEPIHMPKNTAAGVIISAFSLVFGFAMIWHIWWLAIVGFAGMIVTWIAKSFDTDVD
FT                   YYVQVPEIETIENKHYEELKKAGVK"
FT   misc_feature    complement(join(132441..132509,132729..132797,
FT                   132840..132908,132969..133037,133065..133133,
FT                   133170..133238,133281..133349,133386..133454,
FT                   133512..133580,133638..133706,133791..133859,
FT                   133896..133964,134040..134108,134163..134231))
FT                   /note="14 probable transmembrane helices predicted for
FT                   PMI0107 by TMHMM2.0 at aa 24-46, 65-87, 113-135, 148-170,
FT                   199-221, 241-263, 283-305, 318-340, 355-377, 390-412,
FT                   422-444, 465-487, 502-524 and 598-620"
FT   misc_feature    complement(132762..134135)
FT                   /note="HMMPfam hit to PF00115, Cytochrome C and Quinol
FT                   oxidase polypeptide, score 2.5e-256"
FT   misc_feature    complement(132981..133013)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    complement(133275..133439)
FT                   /note="PS00077 Heme-copper oxidase catalytic subunit,
FT                   copper B binding region signature."
FT   CDS_pept        complement(134281..135231)
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="PMI0108"
FT                   /product="cytochrome O ubiquinol oxidase subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40381"
FT                   /db_xref="GOA:B4EU46"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU46"
FT                   /protein_id="CAR40381.1"
FT                   /translation="MRLMKYIKSIGTLSLLAAAVLLSGCDMALMNPKGAIGAEQKTLIL
FT                   IALGLMLIVVIPVILMVIVFAYRYRESNTKATYRPNWAHSNKIELVVWTVPIIIIVILA
FT                   TITWKTTHELDPYKPLVSDEKPVTIEVVSMDWKWLFIYPEQGIATVNELAFPTNVPVNF
FT                   KITSDSVMNSFFIPRLGGQIYAMAGMQTKLHLIANEPGEYQGMSASYSGHGFSDMKFTA
FT                   IATPDRAGFDAWVAKVKQSSDTLNTTAAFDELAKPSQKNPVTYYSSVKPMLFQETISKF
FT                   GHTGHGAHTGSNQTEHSDATMNMNMSHAAHAGAEE"
FT   misc_feature    complement(134374..134517)
FT                   /note="HMMPfam hit to PF06481, COX Aromatic Rich Motif,
FT                   score 8.5e-14"
FT   misc_feature    complement(134557..134847)
FT                   /note="HMMPfam hit to PF00116, Cytochrome C oxidase subunit
FT                   II, periplasmic, score 1.1e-06"
FT   misc_feature    complement(join(134908..134970,135031..135099,
FT                   135142..135207))
FT                   /note="3 probable transmembrane helices predicted for
FT                   PMI0108 by TMHMM2.0 at aa 13-34, 49-71 and 92-112"
FT   misc_feature    complement(135148..135231)
FT                   /note="Signal peptide predicted for PMI0108 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.756 between residues 32 and 33"
FT   misc_feature    complement(135157..135189)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(135728..136489)
FT                   /transl_table=11
FT                   /locus_tag="PMI0109"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40382"
FT                   /db_xref="GOA:B4EU47"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU47"
FT                   /protein_id="CAR40382.1"
FT                   /translation="MIRKSILLFITTTCTLPAQANYLGGFANISINYLDWTTHTTHKTG
FT                   QTSHKDDFAYLELEGGAHFSWGEFYGFFDLENPFNNRQTQPGDNQRYTVKGTSRIYLAD
FT                   SGLNLYGHVYGTWSLPGKEYGGNFHEVNTLYGIGYNTQLADIWFKPFIALHYVDQTYYS
FT                   GNNGYVVGWVAGYDFNLVNQKFSITNWHEMEFDRNKRYGNGGKNGFNGAVAIWWHPTAS
FT                   ITTGIQYRYAYKKLGENFLQDGVIYSLKYNF"
FT   misc_feature    complement(135731..136480)
FT                   /note="HMMPfam hit to PF07135, Protein of unknown function
FT                   (DUF1384), score 1.1e-145"
FT   misc_feature    complement(136430..136489)
FT                   /note="Signal peptide predicted for PMI0109 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.997 between residues 20 and 21"
FT   CDS_pept        136845..138218
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="PMI0110"
FT                   /product="ATP-independent RNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40383"
FT                   /db_xref="GOA:B4EU48"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028619"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU48"
FT                   /protein_id="CAR40383.1"
FT                   /translation="MTSFADLHALPAEQLTNLNELGYLTMTPVQEASLPAILAGKDVRA
FT                   QAKTGSGKTAAFGLGLLQRIDAKQFNTQSLVLCPTRELADQVANELRRLARFLPNIKIL
FT                   TLCGGVPFSIQRDSLIHAAHIIVATPGRLLDHLNKQTVTLADVKTLVLDEADRMLDMGF
FT                   FDDISDIISQMSTQRQTLLFSATWPDEIAKISRKIQQDPVTIEINSPDELPAVEQQFYE
FT                   ISRYGKLGLLQKLLSHHQPNSCVVFCNTKRDCQDVYEALTESNQSVLALHGDMEQKERD
FT                   QTLIRFANGSCRVLVATDVAARGLDIKALEMVINYELSHDPEVHIHRIGRTARAGESGL
FT                   AISFCAPEEIPRANALEEMLNIKLDWQSAPSGLSITPLVATMATLCIDGGKKAKMRPGD
FT                   ILGALTGDLGFSGEDIGKINIHPTHAYVAVKQSIAKQVWKSLQQGKIKGKSVKVRLFR"
FT   misc_feature    136920..137426
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
FT                   score 2.4e-69"
FT   misc_feature    136983..137006
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    137295..137321
FT                   /note="PS00039 DEAD-box subfamily ATP-dependent helicases
FT                   signature."
FT   misc_feature    137622..137852
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 2.1e-32"
FT   misc_feature    137958..138215
FT                   /note="HMMPfam hit to PF03880, DbpA RNA binding domain,
FT                   score 2.5e-31"
FT   CDS_pept        complement(138318..139838)
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="PMI0111"
FT                   /product="Beta-lactamase induction signal transducer
FT                   (MFS-family transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40385"
FT                   /db_xref="GOA:B4EU49"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU49"
FT                   /protein_id="CAR40385.1"
FT                   /translation="MLQAAFKQTTWYKSFILLLLGFTSGLPLALTAGTLQAWMTVENID
FT                   LKTIGFFSLVGQAYVFKFLWSPFMDRYTPSFLGRRRGWMLLTQIGLVLGIAGMGFLNPS
FT                   HHLWWLASLAVIVAFCSASQDIVFDAYKTDILKADERGTGAAVSVLGYRIAMLVSGGMA
FT                   LWLADKYIGWQNMYWLMAALMGIGIIATLLAQEPETAVKPPRTLYEAVIEPLYEFFSRN
FT                   NAWLILLLIVLYKMGDAFALSLSTTFLIRGAGFDAGEVGLVNKTLGLAATIVGALLGGL
FT                   LMRRWTLFKALMIFGILQGGSNIGYWYLAISEQNIYSMGAVIAFENICGGMGTAAFVAL
FT                   LMTLCHQSFSATQFALLSALAAIGRVYVGPVAGWYVESHGWEAFYLFSIVASVPGIILL
FT                   MIAKNTLTYTQKTGEFLQRTLFIKQYRLAIYGLLFAVLLFLCSLILLIINSLPNLEMFQ
FT                   SVDFIQSINSELLSELTSTLFLYGVIIGAVSLIIGTILDYLALKKTAN"
FT   misc_feature    complement(join(138336..138404,138492..138560,
FT                   138633..138701,138711..138779,138816..138884,
FT                   138912..138980,138993..139061,139089..139157,
FT                   139260..139313,139341..139409,139470..139523,
FT                   139536..139595,139632..139691,139734..139802))
FT                   /note="14 probable transmembrane helices predicted for
FT                   PMI0111 by TMHMM2.0 at aa 13-35, 50-69, 82-101, 106-123,
FT                   144-166, 176-193, 228-250, 260-282, 287-309, 319-341,
FT                   354-376, 380-402, 427-449 and 479-501"
FT   misc_feature    complement(138708..139790)
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 4.9e-28"
FT   misc_feature    complement(139743..139838)
FT                   /note="Signal peptide predicted for PMI0111 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.563 between residues 32 and 33"
FT   CDS_pept        complement(139896..140474)
FT                   /transl_table=11
FT                   /locus_tag="PMI0112"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40387"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU50"
FT                   /protein_id="CAR40387.1"
FT                   /translation="MIKNLLCAVFALTMLAGCATPSNKLSIEPVMSVPPSDPTMRPITL
FT                   SITSQDKRPSKNLAEMSRNGKLEVLVPTRDLAFLMQEIVQKQMMARGYTFGSPAAADVI
FT                   VVINKLNADISEGSLRHNISAKADISVVVSMPNGSTNTKTYRTSYNVQGPFGASNDKIA
FT                   AAINNVLSELVSDMAKDPSVSQYIKSNAR"
FT   misc_feature    complement(139905..140450)
FT                   /note="HMMPfam hit to PF03923, Uncharacterized lipoprotein,
FT                   score 1.2e-05"
FT   CDS_pept        140805..141119
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /locus_tag="PMI0113"
FT                   /product="BolA protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40389"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU51"
FT                   /protein_id="CAR40389.1"
FT                   /translation="MIRDDIENKLISRFSPHFLQVINESHRHNVPAGSESHFKVVIVSD
FT                   LFNDKRSVSRHRDVYQTLSHELDNGVHALALHTFTLSEWDEQQDKALHSPGCRGGSQQD
FT                   "
FT   misc_feature    140829..141056
FT                   /note="HMMPfam hit to PF01722, BolA-like protein, score
FT                   5.2e-33"
FT   CDS_pept        141442..142746
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="PMI0114"
FT                   /product="Trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40390"
FT                   /db_xref="GOA:B4EU52"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU52"
FT                   /protein_id="CAR40390.1"
FT                   /translation="MQVSVETTQGLGRRVTITVPAADIQKAVDSELKKAAKTVRIDGFR
FT                   KGHVPMSMVKQRYGMSVLNDVLGDLMQRNFINAIIENKVNPVGAPDYKPEQYKEGEDFV
FT                   YSVEFEVFPEIELKDLESIEVVKPIVTVKDEDVDNMLETLRKQQAEWKDKEGEVAAEDR
FT                   VTVDFNGSIDGEEFEGGKAEDFVLAMGQGRMIPGFEEGLIGHKAGEEFTIDVTFPEDYH
FT                   AENLKGKKAQFAINLKKVEERELPELTEEFIKRFGIADGSVDGLRAEVRKNMERELKNA
FT                   IRTRVKSQVIDGLVKANEVDVPAAAVDSEIEVLQRQAAQRFGGDEKQALQLPRELFEEQ
FT                   AKRRVIVGLLLGEVINSNELKAEDERVKALIDEMASAYEDPSEVVEFYNKNEQLMNNIR
FT                   NLALEEQAVEKILATAKVTEKETNFTELMNEVQMG"
FT   misc_feature    141442..141894
FT                   /note="HMMPfam hit to PF05697, Bacterial trigger factor
FT                   protein (TF), score 5.7e-75"
FT   misc_feature    141895..142155
FT                   /note="HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl
FT                   cis-trans isomera, score 2.3e-27"
FT   misc_feature    142156..142665
FT                   /note="HMMPfam hit to PF05698, Bacterial trigger factor
FT                   protein (TF) C-ter, score 2e-55"
FT   CDS_pept        143003..143626
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="PMI0115"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40393"
FT                   /db_xref="GOA:B4EU53"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU53"
FT                   /protein_id="CAR40393.1"
FT                   /translation="MSFNDTQEQFAPNMALVPMVIEQTSRGERSYDIYSRLLKERIIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDINLYINSPGGVITAGMSIYDTMQYIKADVSTI
FT                   CMGQACSMGAFLLSAGAKGKRICLPNSRVMIHQPLGGYQGQATDIQIHAQEILKVKSRM
FT                   NELMAQHTGKSIEEIERDTERDRFLSANEALEYGLVDKVYTQRS"
FT   misc_feature    143075..143620
FT                   /note="HMMPfam hit to PF00574, Clp protease, score
FT                   3.5e-140"
FT   misc_feature    143309..143344
FT                   /note="PS00381 Endopeptidase Clp serine active site."
FT   misc_feature    143375..143416
FT                   /note="PS00382 Endopeptidase Clp histidine active site."
FT   CDS_pept        143771..145042
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="PMI0116"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40395"
FT                   /db_xref="GOA:B4EU54"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU54"
FT                   /protein_id="CAR40395.1"
FT                   /translation="MTDKRKDSSGKLLYCSFCGKSQHEVKKLIAGPSVYICDECVDLCV
FT                   DIIREEIKELAPHHERSELPTPHEIRKHLDDYVIGQELAKKVLAVAVYNHYKRLRNGDK
FT                   ADGVELGKSNILLIGPTGSGKTLLAETLARYLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKITRKSENPSITRDVSGEGVQQALLKLVEGTVASV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVVAQRLNTHSGIGFGAEVKSQNEKA
FT                   SEGELLAQVEPEDLIKFGLIPEFIGRLPVVATLGELNEDALIQILQEPKNALTKQYQAL
FT                   FKLEGVDLEFRKDALTAIAKKAMSRKTGARGLRSIVEAALLDTMYDLPSFENAEKVVID
FT                   ENVINGKSEPLIIYSQPENQASGE"
FT   misc_feature    143813..143923
FT                   /note="HMMPfam hit to PF06689, ClpX C4-type zinc finger,
FT                   score 6.6e-26"
FT   misc_feature    144098..144703
FT                   /note="HMMPfam hit to PF07724, ATPase family associated
FT                   with various cell, score 2.3e-79"
FT   misc_feature    144110..144739
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cell, score 5.2e-23"
FT   misc_feature    144125..144148
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        145300..147654
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="PMI0117"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40399"
FT                   /db_xref="GOA:B4EU55"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU55"
FT                   /protein_id="CAR40399.1"
FT                   /translation="MNPERPERIEIPVLPLRDVVVYPHMVIPLFVGREKSIHCLEAAMN
FT                   DNKQIMLVAQKDASTDEPGVNDLFSVGTVASVLQMLKLPDGTVKVLVEGIRRAKITTLS
FT                   DNGEYFQAKAEYLDTPVVDEREQEVLNRTAINQFEGYIKLNKKIPPEVLASLHAIEESA
FT                   KLADTIASHMPLKLKDKQAVLEMSDVTERLEYLMAMMESEIDLLQVEKRIRNRVKKQME
FT                   KSQREYYLNEQMKAIQKELGEMDDAPDEMESLKRKIEAAKMPKEAREKTEAELQKLKMM
FT                   SPMSAEATVVRSYIDWMVQVPWNSRSKVKKDLVKAQEVLDTDHYGLERVKERILEYLAV
FT                   QSRVSKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYVRMALGGVRDEAEIRGHRRTYI
FT                   GSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNIAFNDHYLE
FT                   VDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIAKQHLLPKQIERNALK
FT                   ENELTIHDSAIMGIIRYYTREAGVRSLEREISKLCRKAVKQLLMDSTIKHIEIDENNLK
FT                   DYLGVRKVDYGRADTENRIGMVTGLAWTEVGGDLLTIETASVPGKGKLTFTGSLGEVMQ
FT                   ESIQAAMTVVRARADKLGINGDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSSLTG
FT                   NPVRSDVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPDENKRDLEEIPENIVA
FT                   DLDIHPVKTIEEVLTLALEKSPFGIEVVTNK"
FT   misc_feature    145327..145905
FT                   /note="HMMPfam hit to PF02190, ATP-dependent protease La
FT                   (LON) domain, score 1.9e-71"
FT   misc_feature    146350..146934
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cellul, score 3.4e-43"
FT   misc_feature    146365..146388
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    147004..147618
FT                   /note="HMMPfam hit to PF05362, Lon protease (S16)
FT                   C-terminal proteolytic do, score 5.7e-151"
FT   misc_feature    147325..147351
FT                   /note="PS01046 ATP-dependent serine proteases, lon family,
FT                   serine active site."
FT   CDS_pept        147876..148151
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="PMI0118"
FT                   /product="DNA-binding protein HU-beta"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40401"
FT                   /db_xref="GOA:B4EU56"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU56"
FT                   /protein_id="CAR40401.1"
FT                   /translation="MNKTQLIDKIAANADITKAAAGRVVDAMVASITESLQKGDDVALV
FT                   GFGTFTVRDRAARTGRNPQTGKEIQIAAAKVPAFRAGKGLKDAVNQ"
FT   misc_feature    147876..148145
FT                   /note="HMMPfam hit to PF00216, Bacterial DNA-binding
FT                   protein, score 5.7e-50"
FT   misc_feature    148011..148070
FT                   /note="PS00045 Bacterial histone-like DNA-binding proteins
FT                   signature."
FT   CDS_pept        148619..150496
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="PMI0119"
FT                   /product="peptidyl-prolyl cis-trans isomerase D"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40403"
FT                   /db_xref="GOA:B4EU57"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU57"
FT                   /protein_id="CAR40403.1"
FT                   /translation="MMDNIRSTANNPFIKILLAVIILSFVLTGVGGYLFSSGVNDAAEV
FT                   NGYKISRAQLEQAYQQRRAQLQKDMGDNFASLASSDEGQKMIRQQALNVLINQALLDQF
FT                   AQELGISAGDQQIRDAIFALPYFQTDGKFDNKKYVELLTANNIDADAFAEGIRQNLINQ
FT                   QLRYSIQGTDFALESEVKDFAGLMLQSRNVRLASLDIQPFLEKETVSDEELKAFYDQNT
FT                   SMFIAPAQVKVSYIQLEAQKDLSNITISDDEVKAYYDSNISEFTVPGQKKYSLLVLADE
FT                   TAAKEAEDALKNGADFVTLVKEKSIDTFSAKQDGSLGWITIGQELPELANASLTEKGQI
FT                   SQPVKISNGYAIFRLDDIKPSVVKPFDDIKADLLVKMRENKAIDDFFALQQKVSQAASN
FT                   DNDTLATAAKAGNVTVINTDWFDENNVPAALNNEKLTQLIFGGSLVDDNGPTGMNSDMV
FT                   TLGNDSAYIVRVEGYKPASTQPLDKVRDKVITLVKQQKASQAMNAQAQKLLAALKEGKG
FT                   EAALKEANISFGEVESVVHSSATDPIQSAIFAMPKPAEGKKEYGMSNVPGSKVVLIQLD
FT                   SVTDGKPTAEQLEFMTNLYRAQMGEEALQLMLSDLREKAKIEIFDKDYQ"
FT   misc_feature    148619..148744
FT                   /note="Signal peptide predicted for PMI0119 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.939) with cleavage site
FT                   probability 0.556 between residues 42 and 43"
FT   misc_feature    148655..148723
FT                   /note="1 probable transmembrane helix predicted for PMI0119
FT                   by TMHMM2.0 at aa 13-35"
FT   misc_feature    149444..149689
FT                   /note="HMMPfam hit to PF00639, PPIC-type PPIASE domain,
FT                   score 1.3e-11"
FT   CDS_pept        150751..151125
FT                   /transl_table=11
FT                   /locus_tag="PMI0120"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40406"
FT                   /db_xref="GOA:B4EU58"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU58"
FT                   /protein_id="CAR40406.1"
FT                   /translation="MIKMDKKTLSAFMASICLTLGLGLSPLSYADDISPSTSTMLIEKG
FT                   DQKESAVSEVNASAQGKLDINSATLDELMTLKGIGKAKAQAIIDYREKVGRFASFDDLA
FT                   KVFGIGMKLIEQNKDLIIIN"
FT   misc_feature    150751..150840
FT                   /note="Signal peptide predicted for PMI0120 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 30 and 31"
FT   misc_feature    150931..151020
FT                   /note="HMMPfam hit to PF00633, Helix-hairpin-helix motif,
FT                   score 5.4e-06"
FT   CDS_pept        151338..151745
FT                   /transl_table=11
FT                   /locus_tag="PMI0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40408"
FT                   /db_xref="GOA:B4EU59"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU59"
FT                   /protein_id="CAR40408.1"
FT                   /translation="MSTLIKVYGFHLDVFEHVNNARYLEFLEQARWDWIEQHLDLAWFK
FT                   RHGLALVVANININYRLPANLGDELIISCDIAEVGIKSGVLSQKIVRKQDGALISDALV
FT                   TFVLVDINTKKALTLTDQLREKLEYVRQSAD"
FT   misc_feature    151380..151634
FT                   /note="HMMPfam hit to PF03061, Thioesterase superfamily,
FT                   score 4.2e-12"
FT   CDS_pept        complement(152136..152834)
FT                   /transl_table=11
FT                   /locus_tag="PMI0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40410"
FT                   /db_xref="GOA:B4EU60"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU60"
FT                   /protein_id="CAR40410.1"
FT                   /translation="MKKTVVVFSGGQDSTTCLIQALEQYDEVHCITFNYGQRHKEEIEV
FT                   AQRVSQLLGATAHKVLDVSLLNELAISSLTRDNIPVPDFKQSEQSDIPSTFVPGRNILF
FT                   LTLAAIYAYQIGAESVITGVCETDFSGYPDCRDEFVKALNHAVNLGIARDIQFITPLMW
FT                   LDKAQTWALADYYGKLDFVRHNTLTCYNGIQGDGCGQCAACHLRERGLHGYLQDKNAVM
FT                   DAMKNKVGLK"
FT   misc_feature    complement(152217..152234)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    complement(152406..152630)
FT                   /note="HMMPfam hit to PF06508, ExsB, score 2.1e-42"
FT   CDS_pept        152992..153453
FT                   /transl_table=11
FT                   /locus_tag="PMI0123"
FT                   /product="AsnC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40411"
FT                   /db_xref="GOA:B4EU61"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU61"
FT                   /protein_id="CAR40411.1"
FT                   /translation="MLDKIDRKLLTLLQEDSSLSLNTLAEAVNLTSTPCWKRLKRLEDE
FT                   GYIRKRVALLDSEKIGLGLTVIVMIRTQQHNSEWYEQFVSFVKQMPEVLTFYRMAGECD
FT                   YLMHVEVVDMKSYDQFYKRMVNGVPGLIDVTSNFAMEKIKYTTAMPIPE"
FT   misc_feature    153067..153378
FT                   /note="HMMPfam hit to PF01037, AsnC family, score 4.5e-47"
FT   CDS_pept        153510..155255
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="PMI0124"
FT                   /product="putative efflux ABC transporter, ATP-binding
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40412"
FT                   /db_xref="GOA:B4EU62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU62"
FT                   /protein_id="CAR40412.1"
FT                   /translation="MALFSQLSWYFISEWRRYVGAIFLLMVIAVLQVIPPKIVGIIVDG
FT                   VDSHSLSFQQIMGWIGIMVLIALAVYLLRYIWRLWLFGASYQLAVKLRMQIYRQLSLQS
FT                   SAFYQRYRTGDLIARTTNDVDKVVFAAGEGVLTLVDSMVMGLAVLVMMSIQLSWQLTLI
FT                   SLLPMPLMAILIKRYGDKLHHRFKSAQALFSSLNNQAQESLSSIRMIKSFGLEQQHASR
FT                   FETVAKETGRQNMRVAKVDALFDPTIFMAIGFANLLAVAGGSYFVLNGTMTLGELTSFV
FT                   MYLGQMIWPMLALAWMFNIVERGSAAYSRINALLNEQPAMVDGQLSLMHQKGTLAVDIK
FT                   AFHYPKQQVDVLKNIHFTLSPGEMLGICGMTGAGKSTLLALIQRLYDVSEGDIRFQSVP
FT                   LYQLKLDEWRGRLAVVNQTPFLFSDTIAGNIALGRPDATKEEIEAVAKIANIHDDILNL
FT                   PEGYLTQVGEKGVMLSGGQKQRISIARALLLDAEILLLDDALSAVDGQTEYQILQNLAQ
FT                   WRKEKTIIISAHRLSALVDATNILVLKQGEIIEQGTHQTLIAVPGWYQDMYHYQQLEAA
FT                   LDDDK"
FT   misc_feature    153561..154382
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 5.3e-57"
FT   misc_feature    join(153570..153638,153681..153740,153894..153962,
FT                   153975..154034,154233..154301,154344..154412)
FT                   /note="6 probable transmembrane helices predicted for
FT                   PMI0124 by TMHMM2.0 at aa 21-43, 58-77, 129-151, 156-175,
FT                   242-264 and 279-301"
FT   misc_feature    154593..155147
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   9.4e-50"
FT   misc_feature    154614..154637
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    154926..154970
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        155242..157029
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /locus_tag="PMI0125"
FT                   /product="putative efflux ABC transporter, ATP-binding
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40416"
FT                   /db_xref="GOA:B4EU63"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU63"
FT                   /protein_id="CAR40416.1"
FT                   /translation="MTINNNKSIKTLLPALKRLLAYGKTYRKPMTLGVVMLWVAAIAEV
FT                   GGPLLISYFIDAKVATHQVEWRGALGLAAAFILLQIIAALLHYYQTIVFNYAAVGVVQQ
FT                   LRADVMSAALKQPLSAFDNQPVGQLISRVTNDTETIKDLFVNVFPALFRAIALVVVMLI
FT                   AMFLLEWQMALVAMTIFPAVIGVMMLYQRLSTPIVRNVRHYLANINDGFHEVINGMSVI
FT                   QQFRQQARFGKKMSDDSWQHYQARMKALKLDGLLLRPLLSMLSALVLCGLLILFGYQGS
FT                   AVIGVGVIYAFISYLGRLNEPLITLTSQQSLLQQAVVSGERVFELMDAPMQQYGNASYT
FT                   INQGDIAINGLWFAYLKQQWVLKEINLDIPARHFVAFVGHTGSGKSTLASLLMGNYPWQ
FT                   KGHIYLDNHPLECYSHQALRSGIAMVQQDPVLLSGTLRDNITLGRHCSEAHLWQVLATV
FT                   QLNSWVKTLPDGLETPLGEQGSRLSAGQKQLLALARVLLFPPRILILDEATANIDSGTE
FT                   QAVQKALTEIREKTTLIVIAHRLSTIIDADEIVVLHRGEIVEQGKHAQLLAQKGRYYNM
FT                   YQLQQVKESLQVQEPAVVE"
FT   misc_feature    155242..155370
FT                   /note="Signal peptide predicted for PMI0125 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.910) with cleavage site
FT                   probability 0.809 between residues 43 and 44"
FT   misc_feature    155329..156150
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 8.7e-30"
FT   misc_feature    join(155338..155406,155449..155508,155668..155736,
FT                   155749..155808,156001..156069,156079..156138)
FT                   /note="6 probable transmembrane helices predicted for
FT                   PMI0125 by TMHMM2.0 at aa 33-55, 70-89, 143-165, 170-189,
FT                   254-276 and 280-299"
FT   misc_feature    156355..156906
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   9.4e-53"
FT   misc_feature    156376..156399
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    156685..156729
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        157248..157586
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="PMI0126"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40421"
FT                   /db_xref="GOA:B4EU64"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU64"
FT                   /protein_id="CAR40421.1"
FT                   /translation="MKYIIAIIKPFKLEDVRESLSELGINGMTISEVKGYGRQKGHAEL
FT                   YRGAEYEVNFLPKVKIELAVCDGQLEPVLQAISQVTDTGKVGDGKIFVLELLQAIRIRT
FT                   GESGEEAL"
FT   misc_feature    157257..157562
FT                   /note="HMMPfam hit to PF00543, Nitrogen regulatory protein
FT                   P-II, score 1.6e-63"
FT   misc_feature    157383..157400
FT                   /note="PS00496 P-II protein urydylation site."
FT   misc_feature    157494..157535
FT                   /note="PS00638 P-II protein C-terminal region signature."
FT   CDS_pept        157599..158897
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="PMI0127"
FT                   /product="probable ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40425"
FT                   /db_xref="GOA:B4EU65"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU65"
FT                   /protein_id="CAR40425.1"
FT                   /translation="MKRFISYFFTLALTYFLLPQLAIGATTIDIDKADNSFMLICSALV
FT                   FFMTIPGIALFYGGLLRSKNVLSLMTQVMLIFSVVIILWIMFGYSLAFTAGNKIWGGWS
FT                   LTFLNNISVDSVAGEINQYVHVVFQGSFAVITVALIVGALGERIRFSALLIFTVIWFTF
FT                   SYIPIAHMVWGEGGWLIDDGALDFAGGTVVHINAAVAALVGAYLLGKRGDYQHTAIKPH
FT                   NLPMVFTGTAVLYIGWFGFNAGSAGSANGIAALAFLNTVVATAGAVLAWTFAEWLVRRK
FT                   PSMLGSCSGCIAGLVAITPAAGTVGPIGALVIGIIAGIIGLWGVVVLKRWLKADDVCDV
FT                   FGIHGTCGIAGCLLTGIFTASFLGGIGYSEHMTLGKQVLTQLFSVVITLIWSSVVAYIA
FT                   FKIADKLVGLRVSQEEEHDGLDITTHGERAYEQ"
FT   misc_feature    157599..157670
FT                   /note="Signal peptide predicted for PMI0127 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.966 between residues 24 and 25"
FT   misc_feature    join(157611..157670,157713..157781,157815..157883,
FT                   157965..158033,158046..158114,158157..158225,
FT                   158262..158321,158349..158417,158451..158504,
FT                   158514..158582,158619..158687,158730..158798)
FT                   /note="12 probable transmembrane helices predicted for
FT                   PMI0127 by TMHMM2.0 at aa 5-24, 39-61, 73-95, 123-145,
FT                   150-172, 187-209, 222-241, 251-273, 285-302, 306-328,
FT                   341-363 and 378-400"
FT   misc_feature    157704..158888
FT                   /note="HMMPfam hit to PF00909, Ammonium Transporter Family,
FT                   score 2.8e-164"
FT   misc_feature    158154..158231
FT                   /note="PS01219 Ammonium transporters signature."
FT   CDS_pept        complement(158941..159816)
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="PMI0128"
FT                   /product="acyl-CoA thioesterase"
FT                   /EC_number="3.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40429"
FT                   /db_xref="GOA:B4EU66"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU66"
FT                   /protein_id="CAR40429.1"
FT                   /translation="MSQALKKLINLMELEKIEEGLFRGQSEDLGLPQVFGGQVVGQALY
FT                   AAKQTIADNRYVNSFHSYFLRPGDSHKPIVYDVESIRDGGSFSTRRVSAIQQGKPIFYM
FT                   TVSFQEFEEGFEHQDMMPEVPFPNDLISQDEILKKLAPKLPEPLRTLALRETPFEARPV
FT                   QYFSPFGYEKAPAERYVWYRSRGEMPSDPFLHQYLLGYISDFDFLPTSLQPYGLGFMDP
FT                   SLQVATIDHSMWFHRPFRVDDWLLYAIESPSASGGRGFVRGKMFNMSGQLVASSVQEGV
FT                   IRQKRIKSNK"
FT   misc_feature    complement(158974..159378)
FT                   /note="HMMPfam hit to PF02551, Acyl-CoA thioesterase, score
FT                   2.1e-53"
FT   misc_feature    complement(159472..159768)
FT                   /note="HMMPfam hit to PF02551, Acyl-CoA thioesterase, score
FT                   1.7e-39"
FT   misc_RNA        160111..160210
FT   CDS_pept        complement(160608..160811)
FT                   /transl_table=11
FT                   /locus_tag="PMI0129"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40431"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU67"
FT                   /protein_id="CAR40431.1"
FT                   /translation="MTKTDYLMRLRKCTSIETLERVIEKNKYELTDDELELFYSAADHR
FT                   LAELTMNKLYDKIPASVWKFVR"
FT   misc_feature    complement(160620..160790)
FT                   /note="HMMPfam hit to PF05321, Haemolysin expression
FT                   modulating protein, score 4.9e-36"
FT   CDS_pept        complement(160857..161219)
FT                   /transl_table=11
FT                   /locus_tag="PMI0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40432"
FT                   /db_xref="InterPro:IPR019693"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU68"
FT                   /protein_id="CAR40432.1"
FT                   /translation="MDEYSPEKIDLAELSFLCEELLQQALSSLDKGTAVWNNDLSSTKS
FT                   VDLNALIDHIMGFSWLFKIKYPDKHAINTLMEECIEETYRLFGSDSISYSELNNWKELN
FT                   YSLLTLIDKNPKSYIK"
FT   CDS_pept        complement(161877..165035)
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="PMI0131"
FT                   /product="multidrug efflux protein"
FT                   /product="inner membrane rnd family protein acrb"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40435"
FT                   /db_xref="GOA:B4EU69"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU69"
FT                   /protein_id="CAR40435.1"
FT                   /translation="MPKFFIDRPIFAWVIAIITMLAGLLALIKLPVAQYPTIAPPAISI
FT                   SAVYPGADATTVQNTVTQVIEQNMNGIDNMVYMSSTSDSAGMMNITLTFEAGTDPDIAQ
FT                   VQVQNKLQLAMPLLPQEVQQQGISVDKSSSSFLMVAGFISGDGSMSQDDIADYVGATIK
FT                   DPLSRVTGVGETQLFGTQYAMRIWLDPDKLVKYNMTTLDVINAIKSQNNQVAAGQLGGT
FT                   PPVPGQRLNVSIIAQTRLNTPEQFADILMKVNQDGSQVKLKDLGIVEMGAENYSTIARF
FT                   NGLPAAGIGIKLATGANALDTATAVRAALADMEPFFPSGLEVVYPYDTTPFVKISIFEV
FT                   VKTLVEAIMLVFVVMYLFLQNFRATLIPTIAVPVVLLGTFAILSAFGYSINTLTMFAMV
FT                   LAIGLLVDDAIVVVENVERVMQEEGLSPKEATRKSMGQIQGALVGIALVLSAVFIPMAF
FT                   FGGSTGAIYRQFSVTIVSAMVLSVFVALILTPALCATLLKPIPKGSHGVQTGFFGWFNR
FT                   VFEKSSHHYTDSVSRTLRGTGRYLLIYVLLVAAMAIMFVRLPASFLPEEDQGVLLTMVQ
FT                   LPAGSTQEQTQDVLAQVNDYFNTKEKDVVKSVFTVSGFGFGGQGQNMGLAFVVLNDWDE
FT                   RKSDQDKVPAIVGRANQALSQIKEAFVYSFNIPAIVELGSAGGFEFELIDNANLGHEKL
FT                   MEARNQLLGMAAQEPQMLTGVRPNGQEDTSQYRLYIDLEKAQAQGVAVSDIYSTLGTMF
FT                   GGSYVNDFIDRGRVKKVYVQAESQFRMLPQDIANLYVRNNAGQMVPFSSFIDTSKDPWL
FT                   YGSPRLERYNGLPAVQIQGSATPGQSSGDAMLMMEQLASKLPSGIGYEWTGMSYQERLS
FT                   GNQAPALYTISLIVVFLCLAALYESWSVPFSVMLVVPLGVIGALAFTTLRGLENDVYFK
FT                   VGLLTTIGLSAKNAILIVEFAKDLMEKEGKGLVEATLDSVRMRLRPILMTSLAFMLGVI
FT                   PLVLSNGAGSGAQNSVGTGVFGGMIAATSLAIYFVPIFFVVIRRRFAKKNEDLEHPNYP
FT                   HQTK"
FT   misc_feature    complement(161940..165035)
FT                   /note="HMMPfam hit to PF00873, AcrB/AcrD/AcrF family, score
FT                   0"
FT   misc_feature    complement(join(161943..162011,162039..162107,
FT                   162276..162344,162354..162413,163146..163214,
FT                   163347..163415,163560..163628,163656..163724,
FT                   163863..163931,163959..164027,164940..165008))
FT                   /note="11 probable transmembrane helices predicted for
FT                   PMI0131 by TMHMM2.0 at aa 10-32, 337-359, 369-391, 438-460,
FT                   470-492, 541-563, 608-630, 875-894, 898-920, 977-999 and
FT                   1009-1031"
FT   CDS_pept        complement(165050..166240)
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="PMI0132"
FT                   /product="multidrug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40436"
FT                   /db_xref="GOA:B4EU70"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU70"
FT                   /protein_id="CAR40436.1"
FT                   /translation="MRKNRGVLPLALLVLSGSLVIAGCGDKNQSAGGPPPAPAVGVVTL
FT                   DAKPLTITTDLPGRTSAYRIAEVRPQVGGIILKRNYTEGSYVEAGTSLYQIDPAIFQAT
FT                   LNSAQADLAKAKANAEIARLTVERYKPLLGTNYVSKQDFDTATSQYAQAVAAVKAAEAT
FT                   VTNAKINLEYTKVTAPISGRSGKSTVTEGALVAPGQQVALTTVQQIDPIYVDVTQSSED
FT                   YLKLKNEIESGIVRQEQGKPVVHLTLTNGQSYAQKGHLEFSDVTVDESTGSITMRAIVP
FT                   NPNGELLPGMFVRTKLENGIRQNAILIPQQAVIRTPRGEATTMVVNKDNVVEVRTIEVS
FT                   QAVGNKWLVNSGVQVGDRVIVSGLQKAKPEMKVTPQEENLDATASTEKSEPAKDPQ"
FT   misc_feature    complement(165158..166051)
FT                   /note="HMMPfam hit to PF00529, HlyD family secretion
FT                   protein, score 3.3e-74"
FT   misc_feature    complement(166169..166201)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        166366..167010
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="PMI0133"
FT                   /product="acrAB operon repressor (tetR-family
FT                   transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40437"
FT                   /db_xref="GOA:B4EU71"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU71"
FT                   /protein_id="CAR40437.1"
FT                   /translation="MARKTKRQAQETRQQIIDAALRLFTVQGVSATSLSDIATEAGVTR
FT                   GAIYWHFKNKVDLFTEACELTDLKIESLELEYQSKYPDDPLFVLRELLIYILTSIVEDP
FT                   KHNALLEIYFHKCEFVGEMTPIVEIRRELCAADYSRIEQSLSRCIEKKQLPANLDLRRA
FT                   AIMLRAMMTGLAENWLFSPESFSIKEESQYLVDSFIDMIKHSVNMRISALS"
FT   misc_feature    166411..166551
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 8e-21"
FT   misc_feature    166447..166539
FT                   /note="PS01081 Bacterial regulatory proteins, tetR family
FT                   signature."
FT   misc_feature    166459..166524
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2108.000, SD 6.37 at aa 32-53, sequence
FT                   TSLSDIATEAGVTRGAIYWHFK"
FT   CDS_pept        167039..167392
FT                   /transl_table=11
FT                   /locus_tag="PMI0134"
FT                   /product="putative cytoplasmic sulphur reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40440"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU72"
FT                   /protein_id="CAR40440.1"
FT                   /translation="MSKVLVIANGAAYGNESLFNALRLSITLKEQHPETQLNIFLMSDA
FT                   VTGALAHQQPKEGYNLQQMLEILTAQNVPVKLCKTCTDTRGISELPLVDGAELGTLVDL
FT                   AQWTLDADKILTF"
FT   misc_feature    167042..167389
FT                   /note="HMMPfam hit to PF02635, DsrE/DsrF-like family, score
FT                   1.2e-34"
FT   CDS_pept        167517..170945
FT                   /transl_table=11
FT                   /gene="kefA"
FT                   /locus_tag="PMI0135"
FT                   /product="putative potassium efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40443"
FT                   /db_xref="GOA:B4EU73"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU73"
FT                   /protein_id="CAR40443.1"
FT                   /translation="MRGSNVFIRLNHFISTIFIVSILFVLLGNILFTPAKAETVSNNLP
FT                   TKESIQNQLNLLNKRSDLSAEDKLTIGDLEQALLLLDNIQQLEKKADDYNKTVEQLPEK
FT                   LRSIQNQLSQLKQKIANKEVDDYRQSLESLPLATLESQLEEVLQSLAKAQEDLANYSNE
FT                   LIVLQTQPERAQSVLFNNSERLQQIRIALNKSSADKAQMRSSSVQLLQLEQYYLQQQNS
FT                   FQKRTLQSNVQLQSLLQLQRDYSSAYIDLSQEHAQLLQEILSDKRLDSSEEVAKEAQTA
FT                   ELSNQAIKNNAFYLAQADINKKLSDKLIITTQNNNELNRHSLMVKNRLDRAIQSERNLK
FT                   EQIDVLKGSLLLSRILFEEQIELPDDIFINKLPDKIADLRLEQFEINKQRDQIFQPNLY
FT                   IDQLMQEYQAAHPEITDKNELKELHNALLQLIDARRDLLDKLNNQLGSQISESINLQMD
FT                   QQQLRSVVSSLENTLAQQIFWVSSNKPINLSWFSTFPDQAVAEFQSFKLNWSNENLLTG
FT                   AKKSYPVLIALVLFSSILIWQRKKFDKQFDKLSADINKLNKDTQLHTPLALGIVFLKTL
FT                   PLSCIVLAIGYWLINSFNVQQEFIWSFTWQFAVFWLMFEWSYRLMSDNGVAVNHFKIPL
FT                   ERVQQNRKRLLRLSLPMLPIILLSAYGINNPLLLVGDVIGQLVTIISLFFISLCALPFC
FT                   REMWQEKGNHVVRTVVITLLTFSPLLLMGLVIFGYYYTALRLANRWIDSLYLLMLWFIA
FT                   YHASLRGLTVAARRLAYRRALERRQAMLKEKKEGDDNTLEPIQEPPMDMEQINQQSLRL
FT                   TTMILFIIFASSFYGIWSDFITIFTYLDGITLWHYNLPTELGNVVKAVTVADLLLSFAI
FT                   MAISWFMIRNLPGLLEVLILSRIKLQQGASYAITTILTYIIIAIGTIVSLGILGVAWEK
FT                   LQWLAAALTVGLGFGLQEIFANFVSGIIILFERPVRIGDTVTIGSYSGTVSRIRIRATT
FT                   VTDFDRKEVIIPNKAFVTERLINWTLSDTVTRIIIQVGVAYGSDLDKVKTILMKAAKDN
FT                   PKVMTEPEPVVLFTEFGASTLNHELRFYVRTLGDRNTAIDEVNRAIDKLCNENDINIAF
FT                   NQLEVYLHNKQGEEVQEIKKGPLDGSTPEANTPFN"
FT   misc_feature    167517..167627
FT                   /note="Signal peptide predicted for PMI0135 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.983 between residues 43 and 44"
FT   misc_feature    join(167532..167600,169077..169130,169215..169283,
FT                   169311..169370,169449..169505,169533..169601,
FT                   169638..169706,169734..169802,169965..170033,
FT                   170091..170159,170220..170288,170331..170399)
FT                   /note="12 probable transmembrane helices predicted for
FT                   PMI0135 by TMHMM2.0 at aa 12-34, 527-544, 573-595, 605-624,
FT                   651-669, 679-701, 714-736, 746-768, 823-845, 865-887,
FT                   908-930 and 945-967"
FT   misc_feature    167700..167738
FT                   /note="PS00018 EF-hand calcium-binding domain."
FT   misc_feature    170232..170834
FT                   /note="HMMPfam hit to PF00924, Mechanosensitive ion
FT                   channel, score 8.2e-78"
FT   misc_feature    170448..170552
FT                   /note="PS01246 Uncharacterized protein family UPF0003
FT                   signature."
FT   CDS_pept        complement(170958..171113)
FT                   /transl_table=11
FT                   /locus_tag="PMI0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40445"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU74"
FT                   /protein_id="CAR40445.1"
FT                   /translation="MELKDAPKSVQLAVDLIYLFETNHIDPNTVLEALEIVRVDYEKKR
FT                   DNQTAN"
FT   CDS_pept        complement(171125..171667)
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="PMI0137"
FT                   /product="primosomal replication protein N''"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40448"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU75"
FT                   /protein_id="CAR40448.1"
FT                   /translation="MKKTDPLSLFKKQIDNLAETLAPIANKKIAAPCFDTALFHHRSDS
FT                   LGGYMQQIRDNFTQLITCVEAQRSQQVKFLATQILQQIEALTRELSTQTLRKQENQLSQ
FT                   RKKSVDLYQKLAQHQDYERRLQSMIQDRELALTQAQGFVRQQELQKEIAALENRLARCK
FT                   SALVSIEKSIERQEDKY"
FT   misc_feature    complement(171134..171649)
FT                   /note="HMMPfam hit to PF07445, Primosomal replication
FT                   protein priB and pri, score 1.6e-56"
FT   CDS_pept        171805..172356
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="PMI0138"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40450"
FT                   /db_xref="GOA:B4EU76"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU76"
FT                   /protein_id="CAR40450.1"
FT                   /translation="MTANAQQLQFIKDSIETIPDYPKEGILFRDITTLLDNPAAYQATI
FT                   DLLVEHYQGQGITKVVGTEARGFLFGAPVALRLGVGFVPVRKKGKLPRETLSETYDLEY
FT                   GTDTLEIHKDSITDKDKVLMVDDLLATGGTIEATARLIRRLGGTVTEAAFIICLPDLGG
FT                   IERLEKEGIHSFTLVNFPGH"
FT   misc_feature    171892..172302
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 3e-46"
FT   misc_feature    172168..172206
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT   CDS_pept        172584..174560
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="PMI0139"
FT                   /product="DNA polymerase III Tau subunit (contains DNA
FT                   polymerase III Gamma subunit)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40452"
FT                   /db_xref="GOA:B4EU77"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022001"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU77"
FT                   /protein_id="CAR40452.1"
FT                   /translation="MSYQVLARKWRPQTFNDVVGQRHVLTALANGLDHQRLHHAYLFSG
FT                   TRGVGKTTIARLFAKGLNCETGITSKPCGKCANCLEIEQGRFVDLIEIDAASRTKVEDT
FT                   RELLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLRALDVDQIATQLEKVLSAEHIENDVRARQLIARAADGSMRDALSLTD
FT                   QAIASGEGIVSTEVVSRMLGTIDDAQPLALIEALVKADGQQVMSLVNEVALRGTDWENF
FT                   LVETLSLLHQIAMLQLLPSENNPQEQFTQERLRLLAKSVSPQDLQLYYQTLLVGRKELA
FT                   YAPDRRMGVEMTLLRALAFHPKTVIDEIPTAPLAQTLPLASQPNQQRVETSAPQVRSNM
FT                   ATATPKVSPSPENSAALGNSPAAQLLRARQAIRGAEQETPPKKPQPATPKQAKPAASAL
FT                   ERLAAVSEKRQQRVNEKRSSVAVEKKKKEAYQWKPQNPQAQVTEPVVSSPKEIKEVLEY
FT                   EKTPELAAKIAQESQQRDEWAAEIAKMPLPKLVQQLALNAYKETVGEETIILHLRSKQK
FT                   HLNSANALRTLTNALSELHGKAISLTIIEDDNLTVKTPLEWRQAIYEEKLALARQSITT
FT                   DKTIQTLQHYFDAELDEESIRPV"
FT   misc_feature    172701..173273
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cellul, score 1.2e-10"
FT   misc_feature    172716..172739
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    173019..173048
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT   misc_feature    173946..173975
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   CDS_pept        174615..174944
FT                   /transl_table=11
FT                   /locus_tag="PMI0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40453"
FT                   /db_xref="GOA:B4EU78"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU78"
FT                   /protein_id="CAR40453.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQQMQEEIANLEVTGESGAGLVKIT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLIAAAFNDAARRIEETQKEKMASVSNGMQLPPG
FT                   FKMPF"
FT   misc_feature    174645..174920
FT                   /note="HMMPfam hit to PF02575, Uncharacterised BCR, YbaB
FT                   family COG0718, score 5.2e-53"
FT   CDS_pept        174944..175549
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="PMI0141"
FT                   /product="recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40459"
FT                   /db_xref="GOA:B4EU79"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EU79"
FT                   /protein_id="CAR40459.1"
FT                   /translation="MQTSPLLESLMEALRCLPGVGPKSAQRMAFHLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCCDCRTFTEEERCTICANARRQQNGQICVVESPADIHAIEQTGQFAGR
FT                   YFVLMGHLSPLDGIGPMDIGLDRLEERLSQEPISEVILATNPTVEGEATANYIAEICAQ
FT                   YDIAASRIAHGVPVGGELEMVDGTTLSHSIAGRQKIHY"
FT   misc_feature    175055..175180
FT                   /note="HMMPfam hit to PF02132, RecR protein, score 1.4e-17"
FT   misc_feature    175112..175174
FT                   /note="PS01300 RecR protein signature."
FT   misc_feature    175184..175465
FT                   /note="HMMPfam hit to PF01751, Toprim domain, score
FT                   2.3e-19"
FT   CDS_pept        176000..178150
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="PMI0142"
FT                   /product="carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40460"
FT                   /db_xref="GOA:B4EU80"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU80"
FT                   /protein_id="CAR40460.1"
FT                   /translation="MNKNTFLKHIPWVILGIIGAFCLSVVALRRGEHVSALWIVVASVA
FT                   VYLVAYRYYSLYIAQKVMKLDPTRATPSVINNDGLNYVPTNRYVLFGHHFAAIAGAGPL
FT                   VGPVLAAQMGYLPGTLWLLAGVVLAGAVQDFMVLFISTRRNGNSLGEMIKKEMGPVPGT
FT                   IALFGCFLIMIIILAVLALIVVKALAESPWGVFTVCSTVPIALFMGIYMRYIRPGRVGE
FT                   VSVIGIVLLIAAIWFGGVIASDPYWGPALTFKDTTITFGLIGYAFISALLPVWLILAPR
FT                   DYLATFLKIGVIVGLAIGIVILNPELKMPAMTQYIDGTGPLWKGALFPFLFITIACGAV
FT                   SGFHALIASGTTPKLIANEMDARFIGYGAMLMESFVAIMALVAASIIEPGLYFAMNTPP
FT                   AGLGITMPNLHELGGENTAMIMDQLKDVTVHAAATVSSWGFVISPDEILQTAKDIGEPS
FT                   VLNRAGGAPTLAVGIAMVFHKILPAADMGFWYHFGILFEALFILTALDAGTRSGRFMLQ
FT                   DLLGNFIPYLKKTDSFIAGVIGTAGCVGLWGYLLYQGVVDPLGGVKSLWPLFGISNQML
FT                   AAVALVLGTVILIKMKRTKYIWVTVIPAVWLLICTTWALGLKLLSNDPQMEGFFYLANE
FT                   YKAKILAGGADLTAAEITNMNHIVINNYTNAGLSILFLVVVYSIIFYGIRTAMKARKNP
FT                   KESAQETPYVPMPKDVKISSGH"
FT   misc_feature    176000..176080
FT                   /note="Signal peptide predicted for PMI0142 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.948) with cleavage site
FT                   probability 0.744 between residues 27 and 28"
FT   misc_feature    join(176033..176086,176099..176167,176264..176332,
FT                   176360..176419,176480..176548,176576..176644,
FT                   176657..176725,176768..176836,176855..176914,
FT                   176972..177040,177089..177157,177455..177514,
FT                   177593..177652,177695..177763,177782..177850,
FT                   177986..178054)
FT                   /note="16 probable transmembrane helices predicted for
FT                   PMI0142 by TMHMM2.0 at aa 12-29, 34-56, 89-111, 121-140,
FT                   161-183, 193-215, 220-242, 257-279, 286-305, 325-347,
FT                   364-386, 486-505, 532-551, 566-588, 595-617 and 663-685"
FT   misc_feature    176099..177364
FT                   /note="HMMPfam hit to PF02554, Carbon starvation protein
FT                   CstA, score 8.6e-278"
FT   CDS_pept        178215..178421
FT                   /transl_table=11
FT                   /locus_tag="PMI0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40463"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU81"
FT                   /protein_id="CAR40463.1"
FT                   /translation="MFGNLGQAGKYLGQAARMLIGIPDYDNYVQHMKDNHPDKPVMTYN
FT                   EFFRERQEARYGGGDGKGGFRCC"
FT   misc_feature    178215..178418
FT                   /note="HMMPfam hit to PF04328, Protein of unknown function
FT                   (DUF466), score 4.5e-43"
FT   CDS_pept        178444..179421
FT                   /transl_table=11
FT                   /locus_tag="PMI0144"
FT                   /product="putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40464"
FT                   /db_xref="GOA:B4EU82"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU82"
FT                   /protein_id="CAR40464.1"
FT                   /translation="MEPIAVTILTGFLGSGKTTLLRHMLNEEHGYKIAVIENEFGEVPI
FT                   DDEIIGDRATQIKTLTNGCICCSKSNELEDTLLDLCDSLDRGDIVFDRLVIECTGMADP
FT                   GPITQTFFSHEVICQRYLLDGIITLVDTIHAQQQLDQFAIAQSQIGYADRILLTKTDIQ
FT                   PASQQLLARLRRINARAPTYTVINGQIDLALLFNVKGFMLNDTLEVKQPLFRFQPEKQD
FT                   DIQSIVLNFDYPVELQAVSDVMESLLLSFADNLLRYKGILNIKDSPNRLLFQGVQRLYS
FT                   ADWDRPWQENETRQSTLVFIGIHLPEEEIKASFDALMHNTKEYE"
FT   misc_feature    178456..178995
FT                   /note="HMMPfam hit to PF02492, CobW/HypB/UreG,
FT                   nucleotide-binding domain, score 2.5e-68"
FT   misc_feature    178474..178497
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    179113..179397
FT                   /note="HMMPfam hit to PF07683, Cobalamin synthesis protein
FT                   cobW C-terminal, score 2.2e-35"
FT   CDS_pept        complement(179588..180910)
FT                   /transl_table=11
FT                   /locus_tag="PMI0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40466"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU83"
FT                   /protein_id="CAR40466.1"
FT                   /translation="MKEQLSSYWKILIEAVKQQVKPALGCTEPISLALAAATAARYLQH
FT                   NITRISAEVSPNLMKNGMGVTVPGTGMVGLSIAASLGAVAGDSEAGLEVLKNATPEQVE
FT                   LSKNLLNSGIVCVSIKKACQEVLYSEVTVEDGENSATVIIAGDHTNIVKIIHNGQVVLD
FT                   KLSSQSEQTALPCQIKQALTNTNTREIYQFITQAPVEEISFILQSAQLNDALSKEGLNN
FT                   TYGLHIGQTLQRQQQRGLLAKDLLSEIMIRTSAASDARMGGAVLPAMSNSGSGNQGIAA
FT                   TMPVVVVAEYLQVSEEKMARALMLSHLLAIYIHHKFPALSALCAATTASMGAAGAIAWL
FT                   MEERYEPMAMAISSMIGDISGVICDGASNSCAMKVSTGASAAYKAVLMALDDTCVTGND
FT                   GIVTHDVDMTIENLCALASRAMQHTDVQIIEIMEYKAVANG"
FT   misc_feature    complement(179603..180889)
FT                   /note="HMMPfam hit to PF06354, Protein of unknown function
FT                   (DUF1063), score 1.6e-215"
FT   CDS_pept        complement(181529..182896)
FT                   /transl_table=11
FT                   /locus_tag="PMI0146"
FT                   /product="Putative C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40468"
FT                   /db_xref="GOA:B4EU84"
FT                   /db_xref="InterPro:IPR004669"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU84"
FT                   /protein_id="CAR40468.1"
FT                   /translation="MIQILAVLIVVIIVARMILKGYKAEPVLLVAGLILMALTMIFGWG
FT                   DILPKNVKTTGISWLDPFEVMRDLFSSRAADLGLMIMALMGFAHYMDHIGANEAVVRVA
FT                   TRPLKNMRSPYVLLFFSFLLASILQLAIPSATGLAVLLMGTMFPIMIGLGLSPASAAGV
FT                   IATSLGVAYTPTAIDAIRGAKAVDLGVVEYVLYYQGPAAIATVLAVGITHIFWQRHCDR
FT                   KAGFVPQLGKIAEEAKSDKNIPGFYALLPMLPIIMAVSSSSLFVEGIHLDVVTIVLISM
FT                   AICMLIETLRLRDFKSVCAGFQHFLKGMGSAFSNVVGLLVAAGVFAHGIKVSGAIDSLI
FT                   VMAESVGLPPFAMALVFAIVTLAAAIIMGSGNAPFLAFVELIPQIAHSMGVNPIAMILP
FT                   MQQASHMGRGMSPVAGVIIAVSSGAKLQPFDVVKRTAVPLMVGFVFHCAIIAIFYY"
FT   misc_feature    complement(181532..182893)
FT                   /note="HMMPfam hit to PF03606, C4-dicarboxylate anaerobic
FT                   carrier, score 2.3e-90"
FT   misc_feature    complement(join(181535..181594,181793..181861,
FT                   181895..181963,182021..182080,182099..182167,
FT                   182249..182317,182378..182446,182489..182557,
FT                   182594..182662,182753..182821,182840..182887))
FT                   /note="11 probable transmembrane helices predicted for
FT                   PMI0146 by TMHMM2.0 at aa 4-19, 26-48, 79-101, 114-136,
FT                   151-173, 194-216, 244-266, 273-292, 312-334, 346-368 and
FT                   435-454"
FT   CDS_pept        complement(182893..184146)
FT                   /transl_table=11
FT                   /gene="pepT"
FT                   /locus_tag="PMI0147"
FT                   /product="peptidase T"
FT                   /EC_number="3.4.11.4"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40472"
FT                   /db_xref="GOA:B4EU85"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU85"
FT                   /protein_id="CAR40472.1"
FT                   /translation="MNIVDRFISYTKVNTTTNRENGAAGIMPSSEGQRVLALQLVEELK
FT                   ALGVEDIKIRDTAIVTATLPSNLDYEVPTVAFFGHLDTSAEQTNDTKAQILPYKGGDLC
FT                   LNKELEIFLRQSEFPELENYIGDDIIVTDGTSLLGADDKAAIASIMDMLQYFKQHPEVK
FT                   HGTVKIGFVPDEEQGLRGAKAFDVTEFGADFAYTLDCCGIGELVYENWNAGDVEITFIG
FT                   TSAHPMSAKGKLKNSLLMAHKFIAMLPGGEAPEYTEGREGYYWVKQLAGNSARTVLKMD
FT                   VRDFTEAGYAHRMAFLKQLSEQCEALWGEGTVVCKQADRYANVFNSLQGENRYPIDIAI
FT                   DAYKANGITPRPIPMRGGYDGAALSQKGLPCPNIFTGAHNFHSIYEYLPVKSLYAASDV
FT                   LKSVVKITAERFAPGAKA"
FT   misc_feature    complement(183211..183525)
FT                   /note="HMMPfam hit to PF07687, Peptidase dimerisation
FT                   domain, score 2.4e-10"
FT   misc_feature    complement(183613..183732)
FT                   /note="PS00759 ArgE / dapE / ACY1 / CPG2 / yscS family
FT                   signature 2."
FT   misc_feature    complement(183895..183924)
FT                   /note="PS00758 ArgE / dapE / ACY1 / CPG2 / yscS family
FT                   signature 1."
FT   CDS_pept        184549..185190
FT                   /transl_table=11
FT                   /locus_tag="PMI0148"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40473"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU86"
FT                   /protein_id="CAR40473.1"
FT                   /translation="MQIKSYFKNTPLSLKSINNESYKFNTKLKSAILSCYNTISSFIKP
FT                   FFHKTSNNSEFKVHISNIENMKKNENIQSDNKVINTPHSMKDDNDKFGDLSKVHKKFKV
FT                   DEIINLIINDIISVLEEKPTLEKGKIIQFEDELHSHSKSILSSTNDLSLTEIKNKFLAS
FT                   IIDSILTSDEKIKSEFGNINNYKYFLSNSINETVSRSLAKDKNLVKNGDK"
FT   CDS_pept        complement(185314..186654)
FT                   /transl_table=11
FT                   /locus_tag="PMI0149"
FT                   /product="putative drug/sodium antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40474"
FT                   /db_xref="GOA:B4EU87"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU87"
FT                   /protein_id="CAR40474.1"
FT                   /translation="MHQSDVADRSLFSLSWPIFIDIFLHLATLLINTYMISHVSTAYLA
FT                   AMGVGNQVFDLFITIFNFISVGCSVVIAQYLGAGKRDKASQAIHISIAFNFLLGFSSAI
FT                   IILFFGYNILNVMNTPEHLVQDGYNYLHILGICLIPEAISIILAACLRVYGKSKAAMYV
FT                   TLIANIVTVIGNMIVLYGFFGLPQYGLVGVAWSTVVGRIIAVVLLCGLLFYGLRIKFDI
FT                   RLLVIWSKNMLAKILHIGLPAAGENLVWILHYMTASAFIGLMGEVPLAAQTLYFQLSLF
FT                   LMLFGIAISIGNEILVGHLVGAKRFDDAFTRGFKSLKAGVLFTIGVVIIYWFMRDPILY
FT                   SITEDQRIIDQLLPLFILSVFLEPGRTFNIVMVNALRAAGDAKFPLITAVCFMWGVAIP
FT                   IGYFLGIKMEMGLIGIWIGFLCDEWLRGLTNAWRWRSRKWQAKRLDI"
FT   misc_feature    complement(join(185437..185505,185653..185706,
FT                   185767..185835,185878..185946,186007..186075,
FT                   186103..186171,186205..186273,186316..186384,
FT                   186421..186489,186553..186621))
FT                   /note="10 probable transmembrane helices predicted for
FT                   PMI0149 by TMHMM2.0 at aa 12-34, 56-78, 91-113, 128-150,
FT                   162-184, 194-216, 237-259, 274-296, 317-334 and 384-406"
FT   misc_feature    complement(185446..185931)
FT                   /note="HMMPfam hit to PF01554, MatE, score 5.7e-29"
FT   misc_feature    complement(185860..185877)
FT                   /note="PS00267 Tachykinin family signature."
FT   misc_feature    complement(186124..186606)
FT                   /note="HMMPfam hit to PF01554, MatE, score 1.5e-31"
FT   CDS_pept        186853..187752
FT                   /transl_table=11
FT                   /locus_tag="PMI0150"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40477"
FT                   /db_xref="GOA:B4EU88"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR010190"
FT                   /db_xref="InterPro:IPR032094"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU88"
FT                   /protein_id="CAR40477.1"
FT                   /translation="MNTKIKVAIVGYGNIGRFALDAVLAAPDFELVGVVRRDSQNIPEE
FT                   LRNITVTNDIKSLGKVDVALLCSPTRAIKDLAKSILSLGINTVDSFDVHSDIVALKTEL
FT                   DEVAKKHNRVAVISAGWDPGSDSIIRTLMLAMAPKGITYTNFGPGMSMGHSVAAKAIDG
FT                   VRDALSMTIPLGTGVHRRMVYVELETGANFAQVEQAIKADSYFSSDETHIKQVDSVDSL
FT                   KDVGHGVQMTHKGVSGKTHNQLFEYAMHINNPALTSQFMVSAARASMKQQAGAYTVIEI
FT                   PPVDFLAGDLTTLIAKLV"
FT   misc_feature    186865..187179
FT                   /note="HMMPfam hit to PF01408, Oxidoreductase family,
FT                   NAD-binding Rossm, score 1.3e-05"
FT   CDS_pept        complement(187837..188664)
FT                   /transl_table=11
FT                   /locus_tag="PMI0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40478"
FT                   /db_xref="GOA:B4EU89"
FT                   /db_xref="InterPro:IPR009215"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU89"
FT                   /protein_id="CAR40478.1"
FT                   /translation="MTYSREVLLKKFNDMIARKEPIIGGGAGTGLSAKCEEAGGIDLIV
FT                   IYNSGRYRMAGRGSLAGLLAYGNANEIVMDMAKEVLPVVKQTPVLAGVNGTDPFCNFDK
FT                   FLDDVKAIGFAGVQNFPTVGLIDGNFRANLEETGMGYALEVEMIRKAHEKGLLTTPYVF
FT                   SREDAIAMTQAGADIIVPHMGLTTGGNIGAETAVTLDDCVALINDWAKAAKSVRSDVIV
FT                   LCHGGPIATPKDAQYILDNCPDCHGFYGASSMERLPTEVALTATTKEFKNIKR"
FT   CDS_pept        complement(188681..189892)
FT                   /transl_table=11
FT                   /locus_tag="PMI0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40480"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU90"
FT                   /protein_id="CAR40480.1"
FT                   /translation="MKQYAGFIYIATTLDTKSAEIFYVSELIKKAGLPVKTVDLTTKPT
FT                   ALEREADVTAAQVASYHPDGKNAVFCGDRGKAIAAMSVAFERYLTHCDDVLAILGLGGS
FT                   GGTALITPAMQSLPIGVPKLMVSTMASGDISGYIGASDISMMYSVTDVSGLNRISRKVL
FT                   RNAANQIAGAVYFYQEENSVDKPAVALTMFGVTTPCIQQLTKKLENNYDCLVFHATGSG
FT                   GKAMEKLIDSHLLHSVLDLTTTEVCDYLFEGVLACDEDRFGAIARTKTPCIVSCGALDM
FT                   VNFGRPATVPEKYKDRHFYHHNSQVTLMRTTPRENRQMGIWIAEKLNQCEGPLTFIFPQ
FT                   GGFSALDIEGGPFWDPQANQAFFDAFITTFKETETRQLVISPYHINSAEFNQQVYDLHQ
FT                   ELIC"
FT   misc_feature    complement(188693..189880)
FT                   /note="HMMPfam hit to PF06792, Uncharacterised protein
FT                   family (UPF0261), score 7e-226"
FT   misc_feature    complement(189242..189262)
FT                   /note="PS00290 Immunoglobulins and major histocompatibility
FT                   complex proteins signature."
FT   CDS_pept        190128..190763
FT                   /transl_table=11
FT                   /locus_tag="PMI0153"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40483"
FT                   /db_xref="GOA:B4EU91"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU91"
FT                   /protein_id="CAR40483.1"
FT                   /translation="MSFSRNEIDTMSGTRKRTYQLLVTTALQLFEQGMLPTVSELAAHA
FT                   GVSRATAYRYFPTQSDLISATVDASLAPIIAWQPTPEDNTQQRITALLNLAYPQMFKHE
FT                   GALRGALQVSLQQWAKERQSSEYTEKRFIRGHRKEILLKVIEPLKAHYPQEMWDKVIKA
FT                   FSLIYGSEVFLVMKDIWKMDDQQVIDMTQWMAKAILNQAKSDFPIDND"
FT   misc_feature    190191..190325
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 3.5e-09"
FT   misc_feature    190233..190298
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1737.000, SD 5.10 at aa 36-57, sequence
FT                   PTVSELAAHAGVSRATAYRYFP"
FT   CDS_pept        190827..191459
FT                   /transl_table=11
FT                   /locus_tag="PMI0154"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40485"
FT                   /db_xref="GOA:B4EU92"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU92"
FT                   /protein_id="CAR40485.1"
FT                   /translation="MSHKTADQEWLVEQLKYIAQGIGKTLSPFCEVVLHDLTDSENTIM
FT                   VIENNLSGRKVGDRATELGMARIESSDFPQIVANYPNQFPDGRTAKSTSIGIKDKQGNY
FT                   VAALCLNIDISMIKGLQMVLNQFSTLEEGNHIIETFSSVTEDSLKKRIDEFSATYSVTP
FT                   RALKPHQRRELLLCLQDEGYLSLRKAMEITAQYLGVSRATVYNDLKE"
FT   misc_feature    191388..191453
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1438.000, SD 4.08 at aa 188-209, sequence
FT                   KAMEITAQYLGVSRATVYNDLK"
FT   CDS_pept        191673..193460
FT                   /transl_table=11
FT                   /locus_tag="PMI0155"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40487"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU93"
FT                   /protein_id="CAR40487.1"
FT                   /translation="MNRVNDVGVFNKGIELSTKKDYLGSCYVTIAKNIKDISNTTAKPS
FT                   FIKKVIHMMERFTMFFAISQTGRMGISNRDGNLNRYTETLTDLKIKVKDLKCKIDEFNN
FT                   KLIKKDTVDKEKAEIATITAEYHNLNHFLSLIENENSSFKDRYSFFNYLNELQRAEAFC
FT                   RNSSNTDYNHLADEFKNIIKERVERIKKEDVIKIFNEVLVRYDNETRFKNSNERILANF
FT                   SSNKEKEKFLSKINFLVCVSKYNLPLMVEVEQLKEEFPVQLREIMNKILYEESIMGEIL
FT                   NEANIDCVYKYSLKKVQNIWIEEYINKFYGGEEIIMDKSTDDNVAYFVGDFEWDSFDGI
FT                   NNTNNDNMNSKRNLSEASEIIHGKLNKHVKGDEISDLTSILEQIELDKLGGKETYTLIS
FT                   ILKEMGLGNLEWKEIYNLISILKEMELGKLEWDEIYTLISILKEMELDKLEWKEIYNLS
FT                   SILKGMELGKLESKEIYNLSSILKKIELDKLEWDEIYTLISILKGLELGKLEWDEIYTL
FT                   TPLLKEIERGKLIGKGIYNLTYIQEETELDEDNINKGNLKEGDIKYANIVELVEDQVFT
FT                   QLNVDGFNIIDSDYAFSSE"
FT   CDS_pept        complement(193491..193901)
FT                   /transl_table=11
FT                   /locus_tag="PMI0156"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40488"
FT                   /db_xref="GOA:B4EU94"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU94"
FT                   /protein_id="CAR40488.1"
FT                   /translation="MSLKITTAPTTNEINEIYEGLLTHNLQYIQMEQYTPLAVFKEENG
FT                   KKIGGITGDILGNWLRIRYLWVDKAYRGNNIGTELLQAMENTAKKKGAKYAEVDTFSFQ
FT                   ALPFYQKQGFEVFGTLENYPISDKKYYLNKVL"
FT   misc_feature    complement(193557..193787)
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 1.1e-17"
FT   misc_feature    complement(193716..193754)
FT                   /note="PS00213 Lipocalin signature."
FT   CDS_pept        194015..195055
FT                   /transl_table=11
FT                   /locus_tag="PMI0157"
FT                   /product="putative membrane-associated ammonia
FT                   monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40490"
FT                   /db_xref="GOA:B4EU95"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU95"
FT                   /protein_id="CAR40490.1"
FT                   /translation="MSFLKKLPGILFCALIGGLLTLSGLPMALMFGPIVVVIIAYRFKW
FT                   QLSVPKHTLTFIQLTLGTSVGLMFNQVHLGSADNLVLLLIILVICLAIQFVVSFLWFHR
FT                   HIGWTKEEAMLGAVPGAMAAILALTDHTKTPPQKIVISHTIRLIVLIIMAGFIVGSDKA
FT                   TLTEFTLPEMTLLSSMWLLLIVALGLVSGLLLQKIHFPAPFMLTSLGSAILVQYFVSEP
FT                   IAFPMLLNELSMVLIGMNIGAHFVVFPFASLIKNAFSSVQVVIINVILTVIVALSAAYL
FT                   TGAPWTTLVLAWAPGSMEAMTFAAITMNVDAAFVMSNHILRMLIIQSIPSIALFYSERK
FT                   QKRKRE"
FT   misc_feature    194015..194098
FT                   /note="Signal peptide predicted for PMI0157 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.990) with cleavage site
FT                   probability 0.654 between residues 28 and 29"
FT   misc_feature    join(194042..194137,194171..194239,194252..194320,
FT                   194429..194488,194531..194599,194612..194671,
FT                   194708..194776,194795..194863,194972..195025)
FT                   /note="9 probable transmembrane helices predicted for
FT                   PMI0157 by TMHMM2.0 at aa 10-41, 53-75, 80-102, 139-158,
FT                   173-195, 200-219, 232-254, 261-283 and 320-337"
FT   misc_feature    194099..195037
FT                   /note="HMMPfam hit to PF05145, Putative ammonia
FT                   monooxygenase, score 2.6e-31"
FT   CDS_pept        complement(195140..195502)
FT                   /transl_table=11
FT                   /locus_tag="PMI0158"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40492"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU96"
FT                   /protein_id="CAR40492.1"
FT                   /translation="MSPLMKKMFALFCTIILSFATLFSSSAKALTYTQAEDLADLTAVY
FT                   LFLNNDCGYEQISKQKIERALIIFSQSQQWDVSNYSMLPMSKLNEDSYQDLKNIQIAHN
FT                   KKCQLLAQKSLSLLNY"
FT   misc_feature    complement(195416..195502)
FT                   /note="Signal peptide predicted for PMI0158 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.828 between residues 36 and 37"
FT   CDS_pept        195703..197283
FT                   /transl_table=11
FT                   /gene="cueO"
FT                   /locus_tag="PMI0159"
FT                   /product="putative copper efflux oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40494"
FT                   /db_xref="GOA:B4EU97"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU97"
FT                   /protein_id="CAR40494.1"
FT                   /translation="MQRREFLKLGATLSAVTLLPSWSRLAFAQTNTPSLAIPPQISPDK
FT                   QQKIVLNIQQGVSQFTATASTTTWGYNGSLLGPALKLKRGEPVTIEINNTLPETTTVHW
FT                   HGLEISGEQDGGPQATIAPGKSRTVTFTPDQAESTCWFHPHTHGITGKQVAMGLGGLVI
FT                   IEDDETAKRKLPHRWGVDDLPVILQDKRLDSNGQIDYQLDVMSAAVGWFGDMMLTNGAI
FT                   QPQHIVPKGWIRLRFLNGCNARSLNLATSDGRPMYVIASDGGLLAEPVKVTELPILMGE
FT                   RFEVLVDTSDGRDFDIVTLPVRQMGMVLAPFDNVLPVLRLLPSAEKAVGILPDQLALIP
FT                   ALPSLSHIATRSLHLRMDMRLDMQGMMALTERYGDKALAGIHHGMSHMRQGNGNGMMGG
FT                   GMNCGHGSADVDIYNANSINGIPFSMTEPAFDVKQGVYERWLVSGRGDMMLHPFHVHGT
FT                   QFRILSENGRKPEKHRQGWKDIVRVEGQISEILVKFDHLATKEHPFMAHCHLLEHEDTG
FT                   MMAGFTVSR"
FT   misc_feature    195703..195786
FT                   /note="Signal peptide predicted for PMI0159 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.971 between residues 28 and 29"
FT   misc_feature    195856..196209
FT                   /note="HMMPfam hit to PF07732, Multicopper oxidase, score
FT                   1.7e-41"
FT   misc_feature    196057..196080
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    196846..197277
FT                   /note="HMMPfam hit to PF07731, Multicopper oxidase, score
FT                   3.7e-17"
FT   misc_feature    197221..197256
FT                   /note="PS00080 Multicopper oxidases signature 2."
FT   CDS_pept        197442..197984
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="PMI0160"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40496"
FT                   /db_xref="GOA:B4EU98"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU98"
FT                   /protein_id="CAR40496.1"
FT                   /translation="MKHIVDVMISEEEIKQRIAELGREITEHYRSRQEKHDLVLIGLLK
FT                   GSFIFMADLCREIEVPHEVDFMTVSSYGNGMTSTRDVKIIKDLDEDIRGKDVLIVEDII
FT                   DSGNTLNRVKEILSLREPASIAICTLLDKPSRREVDVPVEWIGYSIEDKFVIGYGIDYA
FT                   QRYRHLPYIGHVTLLDE"
FT   misc_feature    197448..197894
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 1.6e-37"
FT   misc_feature    197730..197768
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT   CDS_pept        complement(198044..198697)
FT                   /transl_table=11
FT                   /gene="can"
FT                   /locus_tag="PMI0161"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40498"
FT                   /db_xref="GOA:B4EU99"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B4EU99"
FT                   /protein_id="CAR40498.1"
FT                   /translation="MMRKIEELLANNKQWSSSVTEENPQFFKELSKGQKPHFLWIGCSD
FT                   SRVPAEKLINAAPGDLFVHRNVANLVIHTDLNCLSVIQYAVDVLQVEHIIVCGHYGCGG
FT                   IEAAIEGTELGLINNWLLHIRDIWYKHSSMLGELAPQDRLNLLCELNVIEQVYNLGHST
FT                   IMQAAWKRGQKVMIHGWVYGLNNGELHDLDITSDSREKLELSYRQAIAKLSHPR"
FT   misc_feature    complement(198119..198607)
FT                   /note="HMMPfam hit to PF00484, Carbonic anhydrase, score
FT                   1.6e-60"
FT   misc_feature    complement(198389..198451)
FT                   /note="PS00705 Prokaryotic-type carbonic anhydrases
FT                   signature 2."
FT   misc_feature    complement(198548..198571)
FT                   /note="PS00704 Prokaryotic-type carbonic anhydrases
FT                   signature 1."
FT   CDS_pept        199546..200487
FT                   /transl_table=11
FT                   /locus_tag="PMI0162"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40499"
FT                   /db_xref="GOA:B4EUA0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUA0"
FT                   /protein_id="CAR40499.1"
FT                   /translation="MTYALELTELTKTYHNGVKALKGINLTVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKSSGKVKVFGYDTDTDMVNAKRQLGLVPQEFNFNPFETVLQIVLNQAG
FT                   YYGVPRKVALERAKTYLTQLDLWEKKDDRARFLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWTFLQHLNAQGTTIILTTHYLEEAEMLCRNIGIIQRGELVENTSMKG
FT                   LLSKLESETFILDLAAKSPLPELQNYQYRLVDTSTLEVDVKREQGLNGVFAQLNAQGIQ
FT                   VLSMRNKANRLEELFVHLVNEDHTETEKGERE"
FT   misc_feature    199636..200181
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.7e-50"
FT   misc_feature    199657..199680
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    199954..199998
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        200484..201254
FT                   /transl_table=11
FT                   /locus_tag="PMI0163"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40501"
FT                   /db_xref="GOA:B4EUA1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUA1"
FT                   /protein_id="CAR40501.1"
FT                   /translation="MIQLYWVALKTIWIKEVTRFGRIWVQTLIPPVITMSLYFVIFGNL
FT                   IGKRIGDMGGVDYMQFIVPGLIMMAVITNSYANVSSSFFGAKFQRSIEELLVSPVPTHV
FT                   VIAGFVGGGVARGICVGILVTLVSLFFVPLEIHSWTMVVVTLLMTSIVFSLAGLLNAIF
FT                   AKTFDDISIIPTFVLTPLTYLGGVFYSLSLLPAFWQGVSKLNPIVYMISGFRYGFLGIT
FT                   DVSLTVTITVLCLFIAVFYIVAWYLIEKGRGLRS"
FT   misc_feature    200502..201140
FT                   /note="HMMPfam hit to PF01061, ABC-2 type transporter,
FT                   score 2.8e-46"
FT   misc_feature    join(200541..200609,200667..200735,200793..200861,
FT                   200904..200972,201009..201077,201159..201227)
FT                   /note="6 probable transmembrane helices predicted for
FT                   PMI0163 by TMHMM2.0 at aa 20-42, 62-84, 104-126, 141-163,
FT                   176-198 and 226-248"
FT   misc_feature    201015..201128
FT                   /note="PS00890 ABC-2 type transport system integral
FT                   membrane proteins signature."
FT   CDS_pept        201444..202673
FT                   /transl_table=11
FT                   /locus_tag="PMI0164"
FT                   /product="MFS-family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40503"
FT                   /db_xref="GOA:B4EUA2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUA2"
FT                   /protein_id="CAR40503.1"
FT                   /translation="MAVASETAKEPTVLSRRKLLCIAGMGWTFDAMDVGLLAFLLTALK
FT                   EDWGLTAAQLGWIGSINSIGMAVGAFVFGIMADRKGRKPVFILTLLLFSLGCGLTALAS
FT                   SLMVVLILRFFIGMGLGGELPVASTLVSESVKAHERGRIVVLLESFWAVGWLIAALIAY
FT                   FIIPDYGWRMAMLLSALPAVYALYLRSKLPEPSSTQSLLQNRLSLRQSMALIWSPQYRR
FT                   STLMLWVLWFCVVFSYYGIFLWLPSVAMLKGFSLIKSFQYVLIMTLAQLPGYFTAAWFI
FT                   ERYGRKFVLITYLAGTAISAYYFSVADSTTTLLVFGMLLSFFNLGAWGALYAYTPEQYP
FT                   DGIRATGAGTATAIGRIGGILGPLMVGYLVQYQFDISTIFLIFSLSIVIAVLAVMLLGK
FT                   ETKNRPLNSI"
FT   misc_feature    201495..202661
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 5.1e-29"
FT   misc_feature    join(201498..201566,201594..201662,201696..201755,
FT                   201768..201836,201873..201941,201954..202007,
FT                   202122..202190,202218..202286,202305..202364,
FT                   202377..202445,202482..202550,202578..202637)
FT                   /note="12 probable transmembrane helices predicted for
FT                   PMI0164 by TMHMM2.0 at aa 25-47, 57-79, 91-110, 115-137,
FT                   150-172, 177-194, 233-255, 265-287, 294-313, 318-340,
FT                   353-375 and 385-404"
FT   misc_feature    201507..202556
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 7.4e-50"
FT   misc_feature    201534..201776
FT                   /note="HMMPfam hit to PF06779, Protein of unknown function
FT                   (DUF1228), score 0.00043"
FT   misc_feature    201786..201863
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT   misc_feature    202272..202319
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT   CDS_pept        202762..202944
FT                   /transl_table=11
FT                   /locus_tag="PMI0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="appears to be truncated at C-terminus relative to
FT                   all database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40506"
FT                   /db_xref="InterPro:IPR019671"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUA3"
FT                   /protein_id="CAR40506.1"
FT                   /translation="MSHYEEVIKQVDEAIASASIQTMNELLVELGKDNTIAFAQRYEQQ
FT                   ERLRTAIFHHGEKQR"
FT   CDS_pept        complement(203036..204001)
FT                   /transl_table=11
FT                   /locus_tag="PMI0166"
FT                   /product="putative membrane-associated peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40510"
FT                   /db_xref="GOA:B4EUA4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUA4"
FT                   /protein_id="CAR40510.1"
FT                   /translation="MDFRNVLRKNAIRTRFVIVTYLLLMLMIGLLVDSAIGANPHLSLI
FT                   DNMLAFLTFQSLPIASLIIVAISIVLLIIVHFKGHKIMLTGMKARLINPEEPLNAQERQ
FT                   LLNIVEELSLSATLGYIPKLYILDTPEANAFAAGWSEKNAFIGVTRGLLNQLNRQEIQA
FT                   VLAHETGHIIHGDTRLTLYVGILANVILTVTNIFGSRLYIASGNRGGKSNDAASKARLI
FT                   LIVLNVVLPIITQVLYFYLSRTREYMADAAAVDLTQDNQSMINALKKIAAQHETENFED
FT                   GSTGRAYRKAAFIFNKGDSLFSTHPSIENRIAVLEGKKTF"
FT   misc_feature    complement(203042..203677)
FT                   /note="HMMPfam hit to PF01435, Peptidase family M48, score
FT                   9.6e-30"
FT   misc_feature    complement(join(203279..203347,203390..203458,
FT                   203777..203845,203888..203956))
FT                   /note="4 probable transmembrane helices predicted for
FT                   PMI0166 by TMHMM2.0 at aa 16-38, 53-75, 182-204 and
FT                   219-241"
FT   misc_feature    complement(203897..203947)
FT                   /note="PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1."
FT   misc_feature    complement(203900..204001)
FT                   /note="Signal peptide predicted for PMI0166 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.841) with cleavage site
FT                   probability 0.343 between residues 34 and 35"
FT   CDS_pept        complement(204061..204621)
FT                   /transl_table=11
FT                   /locus_tag="PMI0167"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40513"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUA5"
FT                   /protein_id="CAR40513.1"
FT                   /translation="MTGLIITIALLGLIFYYYNRIISMREAVISSETEISVQLDRRGKV
FT                   FDSLLATVKKYLSHEADVFTKITELRAKTQSSNNQEAKAAEDELSKIVSSGAINVAVEN
FT                   YPELKSDTIMANLQEEIVSTENKLSFAKRGYNRTLEQYRAFIASIPAVFIVKIFPSLVI
FT                   NKEYWRLDETAIKSEEARRINFD"
FT   misc_feature    complement(204067..204621)
FT                   /note="HMMPfam hit to PF04011, LemA family, score 5.9e-19"
FT   misc_feature    complement(join(204130..204198,204559..204612))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0167 by TMHMM2.0 at aa 4-21 and 142-164"
FT   CDS_pept        complement(204845..205657)
FT                   /transl_table=11
FT                   /locus_tag="PMI0168"
FT                   /product="anaerobic dimethyl sulfoxide reductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40514"
FT                   /db_xref="GOA:B4EUA6"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUA6"
FT                   /protein_id="CAR40514.1"
FT                   /translation="MHDYQMPLVLFTVMSQWGIGAVLALSLYQWQTQNSAMLSPKALRT
FT                   TIALIWLIEVIGSSMSMGHLGDPLGAYRSVLGVAHSWLSREAIAFVMLNGLISLWALAS
FT                   WLQPNKIRRNSLLGLFCGLIGLPVILITAQIYYQMQTHALWHTPATQISFIGTALLLGF
FT                   GSVIPWLQLQGKKTIHTLHFGAFIGLLLVLMGLVIRVQISGANVASLLLWWQVIASLII
FT                   GCVIITLSRSSLFTKALISIITIFILFSGEIAGRMLFYGNVMSQSPWF"
FT   misc_feature    complement(join(204878..204946,204965..205024,
FT                   205052..205111,205148..205216,205244..205312,
FT                   205349..205417,205460..205519,205577..205645))
FT                   /note="8 probable transmembrane helices predicted for
FT                   PMI0168 by TMHMM2.0 at aa 5-27, 47-66, 81-103, 116-138,
FT                   148-170, 183-202, 212-231 and 238-260"
FT   CDS_pept        complement(205660..206211)
FT                   /transl_table=11
FT                   /locus_tag="PMI0169"
FT                   /product="putative anaerobic dimethyl sulfoxide reductase,
FT                   iron-sulfur subunit"
FT                   /product="anaerobic dimethyl sulfoxide reductase chain b
FT                   (dmso reductase iron-sulfur subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40516"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUA7"
FT                   /protein_id="CAR40516.1"
FT                   /translation="MAKKQYGFLINSKDCYGCRTCSMACKSENVTPPGVLWRRVREFNE
FT                   DLPNAQAFITMSCNHCDDPQCLKVCPADTYTKRADGIVIQDHDKCIGCQMCIMACPYNA
FT                   PVYDPVEGKTSKCNMCADRIDEGLKPRCVESCPTGAIEFGEIEDLRQKHITNWALLEKR
FT                   YGVPDHTISHPNIVIIGMED"
FT   misc_feature    complement(205894..205965)
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain, score
FT                   4.5e-07"
FT   misc_feature    complement(205909..205944)
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT   misc_feature    complement(206038..206070)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    complement(206119..206190)
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain, score
FT                   0.0026"
FT   CDS_pept        complement(206214..208550)
FT                   /transl_table=11
FT                   /locus_tag="PMI0170"
FT                   /product="putative anaerobic dimethyl sulfoxide reductase,
FT                   molybdopterin-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40518"
FT                   /db_xref="GOA:B4EUA8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUA8"
FT                   /protein_id="CAR40518.1"
FT                   /translation="MYKNKQWELDRRTLLKGMGAIGLAALSPNAFSLANENKPIFNQKT
FT                   RIKLSEYQTFQSTCAMECLHCNLTAFTHQGKLIKIEATEGFNVKCCLRGISRTKWVYHK
FT                   DRLTTPLLRVGEKGKAEFKPISWNDALDLIEKNIRETIDKYGNEGLFISTHAGNMDSIK
FT                   NDMGKAFFDYLGGSTKQAGSLCCSAVTAAMIPMVGLRYADTRDTVKDSRYILCWGNNPA
FT                   VTMHAYFKNYNQARRNGARMVVIDPRFNETAAKADEWIPIIPGTDTALALGMIKLIIEE
FT                   NLTDKPFLRAHTGAVYLVDEQQKLLRDSANDKDSYLVFDTLTQQIVRHDTPNIVPALTH
FT                   DELPNKINYTTVFEQIYWQAKPWTIEKTSKETDIPQETIIRLARDYATTKPAMIVQNMS
FT                   GAQRTEFGAYVAASQFYLALLTGNIGKKGAGICDAGGVRQMAKFNPIIPPAPNVKPINP
FT                   IPVAKVGEWIVNERPHPINFWWIMTMGVMTQLPNTNMVRKALKKVPFVVVADNLMSSTA
FT                   LYADLVLPVTTIFEDTSLMAGVRSQYVQLMEKAVEPPGEAKPDYWIFARLAERFGFGDV
FT                   FNQPIEHYIDTCLAGSGITREMLEKGPVRPVEGDWIPFKDGIFRTSTQKAHFFIEEWQD
FT                   KNYSPIVTYYPVKESTTGSPELAKKYPLMAVQRKLARSVHSSHGMNEWILEVQRNQPNI
FT                   LIHPNDALSRGINNGDWVFAFNDRGEHRAIAVVTTHIKQGVVSLDNGWWEQQGGSSSHV
FT                   TNDHVEPLGNGHCCNSTLINVRREA"
FT   misc_feature    complement(206238..206564)
FT                   /note="HMMPfam hit to PF01568, Molydopterin dinucleotide
FT                   binding dom, score 1.4e-18"
FT   misc_feature    complement(206841..208235)
FT                   /note="HMMPfam hit to PF00384, Molybdopterin
FT                   oxidoreductase, score 2.2e-62"
FT   misc_feature    complement(206958..207011)
FT                   /note="PS00490 Prokaryotic molybdopterin oxidoreductases
FT                   signature 2."
FT   misc_feature    complement(207399..207464)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1249.000, SD 3.44 at aa 363-384, sequence
FT                   WTIEKTSKETDIPQETIIRLAR"
FT   misc_feature    complement(208455..208550)
FT                   /note="Signal peptide predicted for PMI0170 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993) with cleavage site
FT                   probability 0.562 between residues 32 and 33"
FT   CDS_pept        208781..209470
FT                   /transl_table=11
FT                   /locus_tag="PMI0171"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40520"
FT                   /db_xref="GOA:B4EUA9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUA9"
FT                   /protein_id="CAR40520.1"
FT                   /translation="MQNSQGVNSVDIAVTILEFLASQGGAARSSEIAKACSLSKSRLHK
FT                   YLVSLCRSDMLYQESEGGQYCLGSKIIMLAEATHTNLSLVDEINQRLCEFRDEHNMSTG
FT                   LVIAQGKKLYLVRYNRSFKHVDIDFLPNTPVPHKLSAAGATYAVFSHLEIDADLSIQQK
FT                   NSIHQQGFAIRQQPAEGIPGAQSIACPVFNRKGEMVAAALTMGFIKPENQIELGNALKA
FT                   KIRHVLS"
FT   misc_feature    208859..208924
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1127.000, SD 3.03 at aa 27-48, sequence
FT                   ARSSEIAKACSLSKSRLHKYLV"
FT   CDS_pept        complement(209535..210800)
FT                   /transl_table=11
FT                   /locus_tag="PMI0172"
FT                   /product="putative Dyp-type peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40522"
FT                   /db_xref="GOA:B4EUB0"
FT                   /db_xref="InterPro:IPR006313"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUB0"
FT                   /protein_id="CAR40522.1"
FT                   /translation="MKNKTLFKSLLTIPVNHHKRTTLKWLGGSLLLASMGANAIEKSKC
FT                   SPTLRYQRAINYLGKHQAGVITPEQKHASFIALDLTVTTPEEVEKIFRTLTQRIAFLTQ
FT                   SRELKESHNPHLPPAGSGILGSQLYPDELTITVALGDSFFDNRFGFQAHKPKRLEAMKP
FT                   FPNDRLDPKWCGGDLLLQLCANSQESIIYALRDILKYLSGQVHARWKIDGFLPARDIDN
FT                   QQTPINLFGFKDGTGNAPATDTHLMDDLVWITDKQNEPQWCLGGSYQAVRLIRFALEFW
FT                   DRTPLEDQENNFGRHRATGAPIGMKQEMDSPEFAQDPHGDRILFDSHMRRAEPRTPERY
FT                   SAKLRRRSYSYSLGLTPSGQLDMGLVFVSFQNNLKKGFIDTQKRLNGEPLERYIKPFGG
FT                   GYYFVLPGVTQASDILAKGLFT"
FT   misc_feature    complement(209571..210617)
FT                   /note="HMMPfam hit to PF04261, Dyp-type peroxidase family,
FT                   score 4.4e-125"
FT   misc_feature    complement(210684..210800)
FT                   /note="Signal peptide predicted for PMI0172 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.990 between residues 39 and 40"
FT   CDS_pept        complement(210790..211713)
FT                   /transl_table=11
FT                   /locus_tag="PMI0173"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40525"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034981"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUB1"
FT                   /protein_id="CAR40525.1"
FT                   /translation="MPNSALLKGDHIVILLLISLCSFSVSAKKIIQGITQDSENIVVAK
FT                   GDIPTPEKFTTNILNYRQKAVDQLTLVETALKNVIVNSEKNQLTDAQLAYQQAHYHYEV
FT                   IRPIIALFGATERLLNNRADFFLERENSPRFSGFHLVEYQLFKLEDMQSSAESAKALLR
FT                   GISDLKKRLAIEDIPIAKLVQSAGDSLELILTDKLAGIENQYAKSDLGDGYANLYGSRL
FT                   IIESLSNHIPLQEYQSLRKQYDTISKLFLKYQRDEELFQPLDTLSDSEKAVLFAQITQL
FT                   AEQVAQLRNVLNIDVYYYYKEAYGEK"
FT   misc_feature    complement(211633..211713)
FT                   /note="Signal peptide predicted for PMI0173 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.978) with cleavage site
FT                   probability 0.957 between residues 27 and 28"
FT   CDS_pept        complement(211703..212539)
FT                   /transl_table=11
FT                   /locus_tag="PMI0174"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40530"
FT                   /db_xref="GOA:B4EUB2"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUB2"
FT                   /protein_id="CAR40530.1"
FT                   /translation="MGQVLFVVWRESFEALLVVGIIYAWIKRSPTPKQGMKYLWGGVIV
FT                   GILLSILLALSIYGVFSSLEDIWQSLFMVMMEIIACLLIVQMVYWMNKQGKSLKANIEN
FT                   ELTQKTQQQSVWGILLIIAIAIAREGSEVVVFLSSHIMALTAQTALSFLIEVFIGLLIA
FT                   GLTLWLFLLTSKMISWRKFFVITGFLLLFLAVSLLLKAVEEIANLLIEMDIELPDFLIY
FT                   PLWDLSHILDDSSIFGNFLVSFFAYRSQPIGLSVVTFIVFWLVVALLFKQGDRHAK"
FT   misc_feature    complement(211709..212539)
FT                   /note="HMMPfam hit to PF03239, Iron permease FTR1 family,
FT                   score 1.1e-14"
FT   misc_feature    complement(join(211730..211789,211943..212011,
FT                   212024..212092,212135..212203,212264..212332,
FT                   212360..212428,212462..212530))
FT                   /note="7 probable transmembrane helices predicted for
FT                   PMI0174 by TMHMM2.0 at aa 4-26, 38-60, 70-92, 113-135,
FT                   150-172, 177-199 and 251-270"
FT   CDS_pept        complement(212542..212889)
FT                   /transl_table=11
FT                   /locus_tag="PMI0175"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40532"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUB3"
FT                   /protein_id="CAR40532.1"
FT                   /translation="MIKHLYQYTLLLLLMIASSTLAAEKYTVELEMKEGELIPRVLNVP
FT                   AKTPIRIKIRNTGSSPVEFESTQLRKEKVLAPGASSVVVIAPLKPGRYTFFDDFHLSHP
FT                   QGEIVATEKAE"
FT   misc_feature    complement(212824..212889)
FT                   /note="Signal peptide predicted for PMI0175 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.884 between residues 36 and 37"
FT   CDS_pept        complement(212955..213512)
FT                   /transl_table=11
FT                   /locus_tag="PMI0176"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40534"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="InterPro:IPR038482"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUB4"
FT                   /protein_id="CAR40534.1"
FT                   /translation="MNSRYVRALTLLSLIPTSVFALEYPVGQPIIKNGMEIQGVYLQPI
FT                   TMDTEEGHHAMKHLPADKADIHLEADIHAVEDNPNGFAEGDWIPYLTVEYTVTKLDAPE
FT                   KKQQGTFMAMVASDGPHYGENLKLDGNGQYNVTYKIYPPSYNKDVVFGRHIDKETGVAA
FT                   WFEPFEVSWDFNYSGTGRKGSY"
FT   misc_feature    complement(213450..213512)
FT                   /note="Signal peptide predicted for PMI0176 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.991 between residues 21 and 22"
FT   repeat_region   213815..213845
FT                   /rpt_family="PMI.dna.965"
FT                   /note="Forward repeat found by REPuter:
FT                   tcattaaatttgactctgtgcgctccaaaat"
FT   CDS_pept        complement(214132..214233)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PMI0177"
FT                   /product="putative transposase (fragment)"
FT                   /db_xref="PSEUDO:CAR40535.1"
FT   misc_feature    complement(214168..214233)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1067.000, SD 2.82 at aa 1-22, sequence
FT                   MKEEDICRENGISNACYYNWKS"
FT   CDS_pept        <214455..214907
FT                   /transl_table=11
FT                   /locus_tag="PMI0178"
FT                   /product="putative putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40537"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUB6"
FT                   /protein_id="CAR40537.1"
FT                   /translation="KVKKQGLISANCSTVDSIGNRYQTVHKDQIQVLSLNYTISRMQNS
FT                   VHHPVLFIKPIDKSSPLLGVAISNNELLDANFDFFRINQFGILEKYFEIKLSNATIVDF
FT                   TQSSPESSNGYSIVSHEKILLRYESISWNHICAGTSGYSINEQNII"
FT   misc_feature    214578..214859
FT                   /note="HMMPfam hit to PF05638, Protein of unknown function
FT                   (DUF796), score 5.6e-12"
FT   CDS_pept        complement(214900..215091)
FT                   /transl_table=11
FT                   /locus_tag="PMI0179"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40542"
FT                   /db_xref="GOA:B4EUB7"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUB7"
FT                   /protein_id="CAR40542.1"
FT                   /translation="MMKNFFVSILDSIRYSVIAFFLLAMFRLPESSFVAGLLFSLLLLL
FT                   YLKKIYYYLRKATYKIFK"
FT   misc_feature    complement(join(214930..214998,215011..215079))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0179 by TMHMM2.0 at aa 5-27 and 32-54"
FT   misc_feature    complement(214990..215091)
FT                   /note="Signal peptide predicted for PMI0179 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.665) with cleavage site
FT                   probability 0.510 between residues 34 and 35"
FT   CDS_pept        complement(215102..215590)
FT                   /transl_table=11
FT                   /locus_tag="PMI0180"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40544"
FT                   /db_xref="GOA:B4EUB8"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUB8"
FT                   /protein_id="CAR40544.1"
FT                   /translation="MVKETFKGNNPIRAIIIRYLEHLFTNLNDDEMNNLKTLLRGVFLT
FT                   SGALVTTGGVRVYIATAASELIYNTVLRNAIAHKLIRGGGNIAMAFVGGYGIIEMASQA
FT                   KERLRYSNPTLYYDLVLMNLEMGYFIVEPNISKWLYMIGSEKKSVDEVYRAINGLIYN"
FT   misc_feature    complement(join(215285..215353,215411..215479))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0180 by TMHMM2.0 at aa 38-60 and 80-102"
FT   repeat_region   complement(215612..215667)
FT                   /note="(AAAATAT)8"
FT   CDS_pept        complement(215645..215845)
FT                   /transl_table=11
FT                   /locus_tag="PMI0181"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40545"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUB9"
FT                   /protein_id="CAR40545.1"
FT                   /translation="MNNNNDELNNALYRVALVLDKGLESTRELAAGYVETMGLGFDRSV
FT                   RNLSYFFDGYEDVYENIKYKI"
FT   repeat_region   216176..216206
FT                   /rpt_family="PMI.dna.965"
FT                   /note="Forward repeat found by REPuter:
FT                   tcattaaatttgactctgtgcgctccaaaat"
FT   CDS_pept        complement(216179..216475)
FT                   /transl_table=11
FT                   /locus_tag="PMI0182"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40549"
FT                   /db_xref="GOA:B4EUC0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUC0"
FT                   /protein_id="CAR40549.1"
FT                   /translation="MSKVYPISQIIGHKIRQQRQHLRLSAKAVAERVGVSQQQFSRYEN
FT                   GLCKIDVDMLFLIAKELNVTPTAFLPSPLNEDPIASSSAVTQSKLFWSAQSQI"
FT   misc_feature    complement(216269..216433)
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   5.6e-13"
FT   misc_feature    complement(216341..216406)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2045.000, SD 6.15 at aa 32-53, sequence
FT                   LSAKAVAERVGVSQQQFSRYEN"
FT   CDS_pept        217066..218943
FT                   /transl_table=11
FT                   /gene="gsp"
FT                   /locus_tag="PMI0183"
FT                   /product="bifunctional glutathionylspermidine
FT                   synthetase/amidase [includes: glutathionylspermidine
FT                   synthase and glutathionylspermidine amidase"
FT                   /EC_number="6.3.1.8"
FT                   /EC_number="3.5.1.78"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40551"
FT                   /db_xref="GOA:B4EUC1"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUC1"
FT                   /protein_id="CAR40551.1"
FT                   /translation="MNVKEIIRHEPFGTLLGYAPGGVAIYSSDYSSIDKEDYAANDSFR
FT                   SYIGNEYMGHKWQCVEFARRFLYLHYGVVFTDVGMAYEIFSLRFLRRTIDDDILPLQAF
FT                   ANGSKQPPTVGALLIWQEGGEFKVTGHVAVITEVLEDKIRIAEQNVIHTRLPRGQQWTR
FT                   ELPLKVSDNGYFIEDTFDNTTLLGWMIQTEPNAYSLPQPKVAPELLAIHEAKLANKGQF
FT                   AGKWLDESDPLEKAYVLAQHGHTINQDSYEYFTISESAEHELIRASNEMHLMYLHATEK
FT                   VLKDDNLLRLFAIPEVLWPRIRLSWQNRRHQMITGRLDFCMDERGIKVYEYNADSASCH
FT                   TEAGLIIEKWAKQGGIKAGYNPGERLLDALSDAWKHSDAKPFVHILQDDDNEEDYHARF
FT                   MQQALTKAGYSSKILRGLKELHWNSRGQLIDGDKRIVECVWKTWAWETALDQLREESEQ
FT                   QSLIPIRIGDPAGEVRLVDVLLRPEITVFEPLWTLIPSNKAILPILWQLFPDNPYLLDT
FT                   EFTLTPRLSQSGYAVKPIAGRCGSNIGLVDHQENVLGETSGQFEHQENIYQELWCLPKV
FT                   SNRYIQVCTFTVDGHYGGCCLRSDPTLVIKKDSDIEPLIVLEDKHFLAD"
FT   misc_feature    217180..217596
FT                   /note="HMMPfam hit to PF05257, CHAP domain, score 1.1e-26"
FT   misc_feature    217261..217320
FT                   /note="1 probable transmembrane helix predicted for PMI0183
FT                   by TMHMM2.0 at aa 66-85"
FT   misc_feature    217738..218916
FT                   /note="HMMPfam hit to PF03738, Glutathionylspermidine
FT                   synthase, score 2.3e-15"
FT   CDS_pept        complement(219014..219958)
FT                   /transl_table=11
FT                   /gene="dsdC"
FT                   /locus_tag="PMI0184"
FT                   /product="D-serine deaminase activator (LysR-family
FT                   transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40556"
FT                   /db_xref="GOA:B4EUC2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011781"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUC2"
FT                   /protein_id="CAR40556.1"
FT                   /translation="MFGSSNVILRNKRLSSYQLARLHTFEATGRHLSFALAAEELSLTP
FT                   SAISHRINTLEKELGIKLFNRFHRRIELTEEGERIYWALKKTLEDINQEILDIYNQEIS
FT                   GVLTVYSRPSIAQCWLVPRISDFTQRYPSIELNLLTGNDDINFRGYGIDLAIYFDDKHL
FT                   KNLYCEDLISESIIPVCSPEYAARHELVGNIHHLANCTLLHDRQAWSNNSDFDEWRAWS
FT                   EYMGLGLFPNKSNICFDRSDLAVIAAVNHSGVAMGRKRLIQKQLANNELIVPFDNCEFF
FT                   CAQRYYLVTRDEKSNAKVQLFIQWLKKQILQGM"
FT   misc_feature    complement(219026..219661)
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1.8e-24"
FT   misc_feature    complement(219725..219904)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 1.6e-19"
FT   misc_feature    complement(219770..219862)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(219800..219865)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1632.000, SD 4.75 at aa 32-53, sequence
FT                   LSFALAAEELSLTPSAISHRIN"
FT   CDS_pept        220180..221517
FT                   /transl_table=11
FT                   /gene="dsdX"
FT                   /locus_tag="PMI0186"
FT                   /product="DsdX permease"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40557"
FT                   /db_xref="GOA:B4EUC3"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUC3"
FT                   /protein_id="CAR40557.1"
FT                   /translation="MEPTLWVLGTLIISILLIVFTIIKLKFHPFLALLLASFFVGMAMK
FT                   MNPLEMVSAIENGIGGTLGFLAAIIGLGTILGKMMEISGAAERIGITLQKCRWLSPDVI
FT                   MVLVGLICGITLFVEVGVVLLIPLAFSIAKKTNTSLLKLAIPLCTALMAVHCIVPPHPA
FT                   ALFVTNELGADMGTVIVAGLAVGLLASLVGGPLFLKVLGERLPFKTVPEAFSDMEIRQE
FT                   KDLPSLGATLFTVLLPIVLMLIKTAAELNMEKGTSVYIALQFIGNPITAMFIAAFVAYY
FT                   ILGIRRNMGMSTLLKKTEDSFSSIANILLIIGAGGAFNGILKGSGLSDSLAVILSNLDM
FT                   HPILLAWLVAIILHAAVGSATVAMMGATAIVAPLMPMYPDISPEIITLAIGSGAIGCTI
FT                   VTDSLFWLVKQYCNATLSETFRFYSIATFIASFVALGGTFMLSFVI"
FT   misc_feature    220180..220314
FT                   /note="Signal peptide predicted for PMI0186 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.709) with cleavage site
FT                   probability 0.648 between residues 45 and 46"
FT   misc_feature    join(220192..220248,220258..220311,220348..220407,
FT                   220489..220557,220594..220662,220705..220773,
FT                   220852..220911,220954..221022,221080..221148,
FT                   221206..221274,221332..221400,221443..221511)
FT                   /note="12 probable transmembrane helices predicted for
FT                   PMI0186 by TMHMM2.0 at aa 5-23, 27-44, 57-76, 104-126,
FT                   139-161, 176-198, 225-244, 259-281, 301-323, 343-365,
FT                   385-407 and 422-444"
FT   misc_feature    220195..221511
FT                   /note="HMMPfam hit to PF02447, GntP family permease, score
FT                   2e-215"
FT   CDS_pept        221524..222858
FT                   /transl_table=11
FT                   /gene="dsdA"
FT                   /locus_tag="PMI0187"
FT                   /product="D-serine dehydratase"
FT                   /EC_number="4.3.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40558"
FT                   /db_xref="GOA:B4EUC4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011780"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUC4"
FT                   /protein_id="CAR40558.1"
FT                   /translation="MTMTTIDINKLKNDYPLVRDLVDLKEVVWFNPNVTSTDQGLPYVG
FT                   LTQNDVMDAQARLQRFAPYLMKAFPETASTEGIIESAVVDIPQMKEALEKRYNTLIEGQ
FT                   LRLKKDSHLPISGSIKARGGIYEVLTHAEKLAIEAGLLTTEDNYEKLFSDEFRKFFSQY
FT                   SIAVGSTGNLGMSIGIISAKLGFSVSVHMSADARQWKKDKLRAHGVNVVEYEQDYSIAV
FT                   EQGRKEAEKNPRCFFIDDENSKTLFLGYAVAGLRLKHQFETLNIPVDSEHPLFVYLPCG
FT                   VGGGPGGVAFGLKLAFGDAVHCLFAEPTHSPCMLLGVYTQLHDGISVQEVGIDNITAAD
FT                   GLAVGRASGFVGRAMERLIDGYYTIDDQELYNLLSLLNKEEGIQLEPSALAGMTGAIHV
FT                   SQAKDYLQGLSLDSQKMHNATHLVWATGGGMVPTDEMQKYLAQGE"
FT   misc_feature    221743..222765
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme, score 1.9e-47"
FT   misc_feature    221851..221895
FT                   /note="PS00165 Serine/threonine dehydratases
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        complement(223039..224079)
FT                   /transl_table=11
FT                   /gene="afuC"
FT                   /gene_synonym="fbpC"
FT                   /locus_tag="PMI0188"
FT                   /product="ferric cation import ABC transporter, ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40559"
FT                   /db_xref="GOA:B4EUC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUC5"
FT                   /protein_id="CAR40559.1"
FT                   /translation="MTQSHFVELKNIVKRFGTNTVIDTLSLSIPQGKMVSLLGPSGCGK
FT                   TTVLRLVAGLEKPTEGKIFIDGEDVTDRSIQQRDICMVFQSYALFPHMSLGDNIGYGLK
FT                   MLGRPKAEIKQRVAEALALVDLAGFEDRFVDQISGGQQQRVALARALILKPKVLLFDEP
FT                   LSNLDANLRRSMREKIRELQQQFNITSLYVTHDQSEAFAVSDMVLVMNKGKIMQLGSPQ
FT                   TLYRQPASEFMASFMGDANLFPATLGADYVDIFNYRLPRPENFNSNKTEIRVGVRPEAI
FT                   TLSQQGEACQQCTIIHVAYMGPQYEVTVAWQNQTLLLQVNATQLQPNEGDSYYLQIHPY
FT                   GMFILE"
FT   misc_feature    complement(223441..223986)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3e-70"
FT   misc_feature    complement(223627..223671)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(223942..223965)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(224095..226173)
FT                   /transl_table=11
FT                   /gene="afuB"
FT                   /gene_synonym="fbpB"
FT                   /locus_tag="PMI0189"
FT                   /product="putative ferric ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40560"
FT                   /db_xref="GOA:B4EUC6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUC6"
FT                   /protein_id="CAR40560.1"
FT                   /translation="MSHTLALSEKKRWDPIFLWILIAWMAFILMPSWSLDYGLFDSTAD
FT                   ELLTSYGWSNLNISLLWFLLPSILLIRPLHPVGRENRIRHYFDASFAFFCAFITIVTAT
FT                   MEGRGLGYSVIVLFISLGMIAKHALTRLEWLGGDSFVIGSLITVVALIGVFIIFPSVAI
FT                   FIPMFQDSAGNFAPFEFIAILSQAHIVQVMINSILLSIAVGIGCTFFGLILAIYTSRIA
FT                   VRSAIIGRVFSILPIVTPPFVVGLGVTLMMGRSGYITEFLATYAGLENTNWLYGFTGIW
FT                   LAQVLAFTPMSFMILDGAIKTIHPSLEEASYTLRANRYQTFFHVFMPLLKPALANAFLI
FT                   VIVQSLADFSNPLVLGGNFDVIATQIYFYITGSQLDYQAASTLGASLLVFSLLVFCIQY
FT                   MWIGKRSYVTVSGKSYRGDVQPLPTSLVTFVTSVLGIWVIFNILLYGSIFYGSFTVNWG
FT                   VDYTLTFDNFIKLFGQGMSDGAWPSLLDTLLYAGIAAPITAILGLLIAYIVVRQDFKGK
FT                   KSIEFTTMLCFAVPGTVAGVSYILAFNDSPFYLTGTAAIVIISMTMRNVPVGIRAGIAG
FT                   LGQIDKSLDEASLSLRANSMRTILYVLLPLLRPAILSALIYSFVRAITTVSAIVFLVTP
FT                   ETRVATAYILNRVEDGEYGVAIAYGSILIIVMLAIIFLFDYLIGEARVSRSKAKNAQ"
FT   misc_feature    complement(224125..224736)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 7.8e-08"
FT   misc_feature    complement(join(224146..224214,224275..224343,
FT                   224542..224610,224644..224712,224842..224910,
FT                   224971..225039,225142..225210,225289..225357,
FT                   225415..225483,225520..225588,225685..225753,
FT                   225787..225846,225859..225927,225961..226029,
FT                   226072..226131))
FT                   /note="15 probable transmembrane helices predicted for
FT                   PMI0189 by TMHMM2.0 at aa 23-42, 57-79, 91-113, 118-137,
FT                   149-171, 204-226, 239-261, 281-303, 330-352, 387-409,
FT                   430-452, 496-518, 530-552, 619-641 and 662-684"
FT   misc_feature    complement(224953..225597)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.2e-07"
FT   misc_feature    complement(225553..225585)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(226248..227279)
FT                   /transl_table=11
FT                   /gene="afuA"
FT                   /locus_tag="PMI0190"
FT                   /product="putative ferric ABC transporter, iron-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40563"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUC7"
FT                   /protein_id="CAR40563.1"
FT                   /translation="MKLKTLSTLVAAGLALSTVSLSTSAAGRLVVYCSATNAMCEAETK
FT                   AFAEKYDVKTTFVRNGSGSTLAKIEAEKRNPQADVWYGGTMDPHSQAGEMDLLEPYVSA
FT                   NLDQIMPQFRDPAKRKGNYSSAVYVGILGFGVNKDRLKEKGLPIPTCWKDLVKPEYKGE
FT                   IQIADPQSSGTAYTALATFDQLWGTEQAFDYLKKLNTNISQYTKSGIAPARNAARGEAA
FT                   IGIGFLHDYSLEVENGAPLELISPCEGTGYEIGGVSIIKNARNMDNAKLFVDWTLSKEA
FT                   QEISWKEGKSYQILTNTTAESSPMALKLSDLKLINYDMDKYGDSDVRKELINKWVTEVK
FT                   MGK"
FT   misc_feature    complement(226431..227252)
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 7.5e-12"
FT   misc_feature    complement(227205..227279)
FT                   /note="Signal peptide predicted for PMI0190 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.892 between residues 25 and 26"
FT   CDS_pept        complement(227282..228619)
FT                   /transl_table=11
FT                   /locus_tag="PMI0191"
FT                   /product="MFS-family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40565"
FT                   /db_xref="GOA:B4EUC8"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUC8"
FT                   /protein_id="CAR40565.1"
FT                   /translation="MLGKNSASINKTYDFWRKNLMLSMIIGYATFYLTRKSVNFVMPVM
FT                   QTELHLDKGDIGWIASLFYLTYGLSKFLSGIFHDQYGYRWFMGAGLVMTGVMNIIFAYC
FT                   LSFPALLLVWALNGFFQGWGWPPCARLLTHWYSRNERGFWWGLWNISINLGGMSIPLLT
FT                   AWLATHFSWQIALVIPGLIGIVMGLWLCMQLKGTPAEEGLPTVGVWRRDIFELRQEQVS
FT                   PSTPMLTILKESILFNRMIWLLGFSYILIYLIRMAINDWGNIWLSETHGANLLSANAIL
FT                   SLFEMGGLLGALCSGWGSDLLFRGQRAPMILLFSLGLFIAVTALWLMPIHHYALLAACF
FT                   FSIGFFVFGPQMLIGLAATEYCHKNAAGTVTGYLGLYAYLGAAIAGWPLSQVMAHYGWT
FT                   GMFVLLTSAAALMGLLLMPLLIADVSKREHLVGPLSFSDDDTFKRF"
FT   misc_feature    complement(join(227354..227422,227450..227518,
FT                   227552..227620,227630..227689,227723..227791,
FT                   227849..227917,228047..228106,228119..228187,
FT                   228221..228289,228299..228367,228386..228454,
FT                   228497..228565))
FT                   /note="12 probable transmembrane helices predicted for
FT                   PMI0191 by TMHMM2.0 at aa 19-41, 56-78, 85-107, 111-133,
FT                   145-167, 172-191, 235-257, 277-299, 311-330, 334-356,
FT                   368-390 and 400-422"
FT   misc_feature    complement(227438..228550)
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 2.8e-54"
FT   CDS_pept        complement(228702..230249)
FT                   /transl_table=11
FT                   /locus_tag="PMI0192"
FT                   /product="two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40567"
FT                   /db_xref="GOA:B4EUC9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUC9"
FT                   /protein_id="CAR40567.1"
FT                   /translation="MQRGARFFLQSLFLLLTYSLLWLSLWVISFYLSHNGQQAALFLPQ
FT                   GLRLALFILLWRRFWLPMLLAEWGLYYWLTQQQLITHVTLYLSPLISLLVALEVQRIWW
FT                   RYPLYWQRLTLLIAAVGFNSLLQAFLLSFFLTTSTSAIFLTSITGGILLAPFVFLLYEY
FT                   LRELQSRVLIAEITPEPPLRTSLLMWVFLFCLIGLSAQFFLTPEIERLLVILVFIPNVF
FT                   MAYRYGWQGGVLSALLGSLMITFARQVNGAFADLHELEMFLTTQALIGIGLGIAISRQQ
FT                   QLANNLRHYQLRLEQELQARRALMEQLVHTEEDVKKAIARELHDEIGQNITAIQIQSML
FT                   VKRSADNDKTRQSGEQIERLAQQIHQSTRQLLRQLRPPILEEMSLEKALHHLIDEFSFH
FT                   ENGIHCHFHYALETEPESDTIIFTLYRLVQELLNNISKHANASEIHISLTQHQAQLRLV
FT                   VHDNGIGILPTQPNNGFGLRGIEERICALGGEWEVISQLGTKIIVNLPTNSIEKREN"
FT   misc_feature    complement(228726..228995)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 4.7e-14"
FT   misc_feature    complement(229110..229307)
FT                   /note="HMMPfam hit to PF07730, Histidine kinase, score
FT                   7.9e-16"
FT   misc_feature    complement(229122..229187)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1029.000, SD 2.69 at aa 355-376, sequence
FT                   EQIERLAQQIHQSTRQLLRQLR"
FT   misc_feature    complement(229407..230222)
FT                   /note="HMMPfam hit to PF05231, MASE1, score 2.2e-52"
FT   misc_feature    complement(join(229551..229619,229638..229697,
FT                   229755..229823,229842..229910,229938..230006,
FT                   230067..230135,230163..230231))
FT                   /note="7 probable transmembrane helices predicted for
FT                   PMI0192 by TMHMM2.0 at aa 7-29, 39-61, 82-104, 114-136,
FT                   143-165, 185-204 and 211-233"
FT   CDS_pept        complement(230251..230883)
FT                   /transl_table=11
FT                   /locus_tag="PMI0193"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40570"
FT                   /db_xref="GOA:B4EUD0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUD0"
FT                   /protein_id="CAR40570.1"
FT                   /translation="MINVALIDDHIVVRSGFAQLLMLEPDINIVGEYANGQEAWPYLLN
FT                   DNIDVAVMDLSMPGESGLQLQSRLKQKRPDFRTIILSIYDTPAFVQSALDSGAHGYLTK
FT                   RCGPQELVQAVRAVYQGGCYLCADAMKALRQTPEKEDALHSLTPREREIFNLLVQGINV
FT                   KAIAVQLNLSHKTVHVHRANILGKLNCETTIDLVHFALNNQLITGTL"
FT   misc_feature    complement(230284..230457)
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 3.4e-22"
FT   misc_feature    complement(230323..230406)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT   misc_feature    complement(230338..230403)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1056.000, SD 2.78 at aa 161-182, sequence
FT                   INVKAIAVQLNLSHKTVHVHRA"
FT   misc_feature    complement(230515..230880)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.4e-37"
FT   CDS_pept        complement(231084..231464)
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="PMI0194"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40572"
FT                   /db_xref="GOA:B4EUD1"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUD1"
FT                   /protein_id="CAR40572.1"
FT                   /translation="MLRTMLQGKLHRVKVTQADLHYEGSCAIDQDFMDAAGILENEAID
FT                   IYNVDNGERFSTYAICAERGSGIISVNGAAARRAAVGDRLIICSYVQIPDSDARSHKPN
FT                   IAYFEGDNEMKRIAKAVPVQVA"
FT   misc_feature    complement(231117..231464)
FT                   /note="HMMPfam hit to PF02261, Aspartate decarboxylase,
FT                   score 1.6e-82"
FT   CDS_pept        complement(231493..232344)
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="PMI0195"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40574"
FT                   /db_xref="GOA:B4EUD2"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUD2"
FT                   /protein_id="CAR40574.1"
FT                   /translation="MLIIETTLILRREIKRLKQEGKRIALVPTMGNLHQGHLKLIEEAR
FT                   IHADVVIASIFVNPMQFDREADLANYPRTLQEDCELLRDKHVDIVFAPSAKEMYPNGME
FT                   NQTIVEVPVLSSVLEGASRPGHFRGVTTVVSKLFNLVQPDVALFGEKDYQQLQIIKKMV
FT                   SDLCFDISIIPVPIVRDKTGLAFSSRNRLLSDNEKQQAPVLYQAMQQIAEQLKSGNLDV
FT                   NQLLQTAKATLEQQGFRADECFICDAQTLAPLSEESRCAVILMAAWLGNTRLIDSQQVS
FT                   LV"
FT   misc_feature    complement(231505..232341)
FT                   /note="HMMPfam hit to PF02569, Pantoate-beta-alanine
FT                   ligase, score 8.1e-137"
FT   CDS_pept        complement(232388..233179)
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="PMI0196"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40576"
FT                   /db_xref="GOA:B4EUD3"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUD3"
FT                   /protein_id="CAR40576.1"
FT                   /translation="MKPVTLSTLNRYKQEKKKFATITAYDASFARLFANEGIPAMLIGD
FT                   SLGMTLQGHDSTLPVTVEQIAYHTRCVRAGAPNAFLIADMPFMSYSTPEQACLNAAILM
FT                   QAGANMVKIEGGSWLIPTVKMLTERAVPVCIHLGLTPQSVNVFGGYKVQGREEAAAEQL
FT                   KQDAMALEAAGAQLAVLECVPVSVAKTITGSLNIPVIGIGAGNVTDGQILVMHDLLGLT
FT                   PNAPKFSKNFLQEAGSLPEAVRLYVQQVEQKLFPQEQHSFN"
FT   misc_feature    complement(232403..233176)
FT                   /note="HMMPfam hit to PF02548, Ketopantoate
FT                   hydroxymethyltransferase, score 4.9e-151"
FT   CDS_pept        complement(233537..234034)
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="PMI0197"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridi
FT                   ne pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40581"
FT                   /db_xref="GOA:B4EUD4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUD4"
FT                   /protein_id="CAR40581.1"
FT                   /translation="MSKQQQRVYIILGSNLNSPEQQVKSAIKAISEIPNTTLIAQSPWY
FT                   RTRPMGPQDQPDYLNMAVAVDTTLAPEELLDHTQAIELAHGRERKAGNRWGPRTLDLDI
FT                   MLFGDQVIQTERLTVPHYGLKVREFMLYPLADLAPELCFPDDGERLADRLALVPKNGME
FT                   KW"
FT   misc_feature    complement(233621..234010)
FT                   /note="HMMPfam hit to PF01288,
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosph, score
FT                   8.8e-64"
FT   misc_feature    complement(233720..233755)
FT                   /note="PS00794
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
FT                   signature."
FT   CDS_pept        complement(234027..235367)
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="PMI0198"
FT                   /product="poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40583"
FT                   /db_xref="GOA:B4EUD5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUD5"
FT                   /protein_id="CAR40583.1"
FT                   /translation="MTVIPRDQHPISRKDISDNALKVLYRLNNSGFQAYLVGGGVRDLL
FT                   LGKKPKDFDIATNATPEEVRRLFRNSRLVGRRFRLAHIMFGPEVIEVATFRGSHEDHET
FT                   SDRNQSQQAQSGMLLRDNIFGSIEEDAIRRDFTLNSLYYGVDDFAVRDYVGGLADLKSG
FT                   TIRLIGSPETRYREDPVRMLRAIRFASKLDMRIAPETAEPISQLAPLLRNIPSARLFEE
FT                   SLKLLQTGHGYKTYRLMRHFQLLEPLFPLVASRITEQQDTPMERMIEQVLKNTDYRISK
FT                   EMRVNPAFLFAAMLWYPLVEHAEKLAQESGLSYYDAFSMAMNDILDEQCRTIAIPKRIT
FT                   TTMRDIWQLQQRLPKRQGRRANKLLEHPKFRAAFDLLELRANVQRNPDLEALAAWWADF
FT                   QISNNTQQRSMVSELGPGPVRKRTRPRKRPRHPNAKNNAPRQENKHE"
FT   misc_feature    complement(234594..235094)
FT                   /note="HMMPfam hit to PF01743, Poly A polymerase family,
FT                   score 1.2e-67"
FT   CDS_pept        complement(235698..236027)
FT                   /transl_table=11
FT                   /locus_tag="PMI0199"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40584"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUD6"
FT                   /protein_id="CAR40584.1"
FT                   /translation="MTVCIRHLVPLLINQLCFGGLVTALARYLQADTNYERWRFHINNI
FT                   ILQLILLDTITQTIRTVMTMFIHIKEKLFAYNSITIADGHKQGIILMEHIFLPRQPLLS
FT                   GKIIR"
FT   misc_feature    complement(235935..236027)
FT                   /note="Signal peptide predicted for PMI0199 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.746) with cleavage site
FT                   probability 0.742 between residues 31 and 32"
FT   CDS_pept        complement(236089..236544)
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="PMI0200"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40586"
FT                   /db_xref="GOA:B4EUD7"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUD7"
FT                   /protein_id="CAR40586.1"
FT                   /translation="MQEGQKRKTSSMSILAIAGVEPYQEKPGEEYMNEAQLAHFKLILE
FT                   SWRNQLRDEVNRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDDDFGFCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   misc_feature    complement(236107..236319)
FT                   /note="HMMPfam hit to PF01258, Prokaryotic dksA/traR
FT                   C4-type zinc finge, score 4.6e-35"
FT   misc_feature    complement(236131..236205)
FT                   /note="PS01102 Prokaryotic dksA/traR C4-type zinc finger."
FT   CDS_pept        complement(236741..237451)
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="PMI0202"
FT                   /product="sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40587"
FT                   /db_xref="GOA:B4EUD8"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUD8"
FT                   /protein_id="CAR40587.1"
FT                   /translation="MKFEQPLQSATLLKRYKRFLADVVTANGEEFTLHCANTGAMTGCA
FT                   TPGDTVWYSTSSNVKRKYPHSWELTQTQSGDWICINTLRANTIIADAIEAGDIPELSDY
FT                   DEIRREVKYGSENSRIDILLKSNHKVDCYIEVKSVTLLDAGMGYFPDAKTERGQKHLRE
FT                   LTAIAKSGLRAILFYAVPHTGITQVSVAKEIDPKYDLLLKQACDAGVEILCYRINISEY
FT                   DLTIGKQLPFISKG"
FT   misc_feature    complement(236759..237415)
FT                   /note="HMMPfam hit to PF03749, Sugar fermentation
FT                   stimulation protein, score 6.2e-107"
FT   misc_feature    complement(237320..237352)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        237537..239966
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="PMI0203"
FT                   /product="ATP-dependent RNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40588"
FT                   /db_xref="GOA:B4EUD9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUD9"
FT                   /protein_id="CAR40588.1"
FT                   /translation="MHLLPIFEVAGSVVTALKQCPQVLLHAPTGAGKSTALPLYLLQQN
FT                   IFDGKIILLEPRRIAAKSIAYRLASQLNEEVGKTVGYRMRAESKVSQQTRLEVITEGVL
FT                   TRMLQQDPELTGVSLVILDEFHERSLQADLALALLLDVQSGLRDDLRLLVMSATLDNQK
FT                   LTSLLPDAPMISSEGRSYPVSRHYYPIQSHLPFEQEVATMARRLLTQETGSLLVFLPGS
FT                   AEIIRVAQLLADKVDKHTLIFPLYGALSLAQQQQAIEPVEKGYRKVVLATNIAETSLTI
FT                   EGIRLVLDSTIEKRAQFDLKSGVTSLLRQRISQASQTQRAGRAGRLEAGICWHLISQEQ
FT                   AERGATHQVPEILSSDLSSLWLSILQWGCRDINQLSWLDTPTPAAINAAKTLLQRLGAI
FT                   DNQGGLTSRGVRMAQWGIDPRLAAILDYASEKSEHHLATAARLCAILEQPPRDREINLE
FT                   WLIQQKNHQWSQREKQLLQQCKGQCRPELLASLLSVGFADRIAKNRDNQGRFRLANGQG
FT                   AMMDNTQPMSQSPWILAPLLLQNAHYADVRILLALPIDINEVSSIFPELIQDNTTVEWD
FT                   EKRGTLLAWQQRQLGQLTVSQMPLDKPNKAQMQTALLNWLRKQGLSALPLSEESKQLFI
FT                   RLALAQKWCPEANLPVLNEAVLLDSLELWLQPELGDTQSLKALLQMDINGIIKNQLTWH
FT                   EQQLLQELFPTHYIAPTGTKVMIRYDLDNPPIIAIRIQEVYGEKQSPIVAKGQLPVVME
FT                   LLSPAMRPIQKTQDLATFWAGSYTQVQKEMKGRYPKHLWPDSPATTAPTRRVKKWS"
FT   misc_feature    237552..238037
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
FT                   score 2.6e-11"
FT   misc_feature    237615..237638
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    238236..238520
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 3.9e-11"
FT   misc_feature    238698..238973
FT                   /note="HMMPfam hit to PF04408, Helicase associated domain
FT                   (HA2), score 0.00039"
FT   CDS_pept        240095..242407
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="PMI0204"
FT                   /product="penicillin-binding protein"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40591"
FT                   /db_xref="GOA:B4EUE0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUE0"
FT                   /protein_id="CAR40591.1"
FT                   /translation="MSRKKKPVKKTNRRRSWFWLFVKIAIVVAVLVGIYGVYLYSQIKE
FT                   RLDGNVWELPAAVYGRTVNLEPGMNYSQKEMVSLLEGMQYRHVNKITRPGEFVVKNGTI
FT                   EMLRRPFDFPDGREEQILAKLTFEQNSLVSITNMNNQRQFGFFRLDPKLITMMQSANGE
FT                   QRLFLARDKFPQLLVDTLIATEDRRFYEHDGISIYSIGRAVLANFTAGRAVQGGSTLTQ
FT                   QLVKNLFLTNERTLKRKLNEAYMAIIMDASYSKDRILELYLNEVFLGQSGDEQIRGFPL
FT                   ASLYYFGRPVDELSLDQQALLVGMVKGASAYNPWRNPKAALERRNVVLKLLQTQQIIDQ
FT                   ELYDVLSARPLGVKPRSEALTPQPAFMQLVRQELQTKLGDQVKDLSGTKIFTTLDPVSQ
FT                   DAAEKAVEAGVADLRKTRKINDLEGAMVVVDRLSGEVRALVGGSQPQYAGFNRAMSARR
FT                   SIGSLAKPATYLTALSEPERFRLNTWLADEPISVPIPGGKPWQPRNYDRGYKGRLMLVD
FT                   ALATSRNVPTVNLGLEVGLDQVIKTWIKLGAPAENLEKVPAMLLGALNLTPMEVAQTFQ
FT                   TIGSLGNRAKLSALRSVINQDGTVLYQSYPQAETTVSPQAAYMTLFGMQQVVNSGTAAR
FT                   ALKPKFGQYNLAGKTGTTNDLRDSWFAGIDGKEVTIAWMGRDNNGPTNLTGSTGALILY
FT                   RHYLENQTPLTLNPPVPEDIAQMSINAEGNFVCYGGGVRTLPVWTADPDSLCTPLPQES
FT                   DGDDSAAPKWLRDLFSE"
FT   misc_feature    240095..240217
FT                   /note="Signal peptide predicted for PMI0204 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.925 between residues 41 and 42"
FT   misc_feature    240143..240211
FT                   /note="1 probable transmembrane helix predicted for PMI0204
FT                   by TMHMM2.0 at aa 17-39"
FT   misc_feature    240533..241048
FT                   /note="HMMPfam hit to PF00912, Transglycosylase, score
FT                   3.6e-82"
FT   misc_feature    241364..242188
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptid, score 1.2e-20"
FT   CDS_pept        complement(242510..243796)
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="PMI0205"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40595"
FT                   /db_xref="GOA:B4EUE1"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUE1"
FT                   /protein_id="CAR40595.1"
FT                   /translation="MSKSETLYNLAQQVIPGGVNSPVRAFNGVGGTPLFIERANGAYIY
FT                   DADGRAYLDYVGSWGPMVLGHNHPAIRHAVTDAVQKGLSFGAPTAAEVEMANLVTELVP
FT                   SMDMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLLVKAGSGALTMGQP
FT                   NSPGVPADFVKHTLTCTYNDLNSVRQAFENYPEEIACIIVEPVAGNMNCVPPKADFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALGGAQAYYDVDPDLTCLGKIIGGGMPVGAFGGHKE
FT                   VMSQLAPIGPVYQAGTLSGNPIAMAAGLACLQEVSQPGVHQTLDELTTMLADGLLEKAQ
FT                   QAGIPMVVNHVGGMFGLFFTDAKEVTCYQDVMNCDVERFKQFFHLMLEKRIYLAPSAFE
FT                   AGFMSIAHSKEDIQRTIDAAEYAFSKMKA"
FT   misc_feature    complement(242516..243730)
FT                   /note="HMMPfam hit to PF00202, Aminotransferase class-III,
FT                   score 9.3e-119"
FT   misc_feature    complement(242987..243097)
FT                   /note="PS00600 Aminotransferases class-III
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        244074..244418
FT                   /transl_table=11
FT                   /locus_tag="PMI0206"
FT                   /product="putative iron-sulphur protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40598"
FT                   /db_xref="GOA:B4EUE2"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUE2"
FT                   /protein_id="CAR40598.1"
FT                   /translation="MSDDMALPLQFTDAAANKVKDLIADEENPNLRLRVYITGGGCSGF
FT                   QYGFTFDDAMNEGDMTIEKQGVALVIDPMSLQYLVGGCVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
FT   misc_feature    244095..244412
FT                   /note="HMMPfam hit to PF01521, HesB-like domain, score
FT                   1.6e-56"
FT   misc_feature    244356..244409
FT                   /note="PS01152 Hypothetical hesB/yadR/yfhF family
FT                   signature."
FT   CDS_pept        245183..245701
FT                   /transl_table=11
FT                   /gene="hcp"
FT                   /locus_tag="PMI0207"
FT                   /product="conserved hypothetical protein (putative
FT                   hemolysin co-regulated protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40599"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUE3"
FT                   /protein_id="CAR40599.1"
FT                   /translation="MPTPCYLSIEGKTQGNITEGAFTAESVGNIYVQGHENEMLIQAFS
FT                   HVVTVPTDPQSGQPAGQRAHKPFRFTVALNKAVPLLYNALASGEMLPKVDLKWYRTSVE
FT                   GKQEHFFTTTLTDATIVNIDCQMPHCQDPTKSDFTQLIEVALSYRKIDWEHTIAGTSGA
FT                   DDWRAPLEG"
FT   misc_feature    245192..245650
FT                   /note="HMMPfam hit to PF05638, Protein of unknown function
FT                   (DUF796), score 1.3e-82"
FT   CDS_pept        245814..247940
FT                   /transl_table=11
FT                   /locus_tag="PMI0208"
FT                   /product="VgrG-like protein"
FT                   /note="Also similar to PMI1331 (61.3 38d) PMI0751 (56.2 id)
FT                   PMI1118 (56.6 38d) PMI2991 (65.6 0d)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40601"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUE4"
FT                   /protein_id="CAR40601.1"
FT                   /translation="MSTDEANNTPKPRLILDEPVLSHSSGIMISAAEQRARIQRHVELL
FT                   DMLEQGLLKTGLVFTCQVAGLADDTFQVTQFDLNEGLSELFTLTIQVVSTQSDIDFSYY
FT                   LGGASSLTVRRNGKKIRTVQGLLSSAEQSNTDGIKTWYQLEIRPEMWVMTLNQDSRIFQ
FT                   HKTVPEILKHLLDEAHIKYDNRLYQPELHQPRHYVTQKRESAYDFWCRLAFEEGINFWF
FT                   EEGPKLFYSDNHLGMTAGITLTYNPQSETDITDSTATKWRYIERLCSDVRIDKDYNQIR
FT                   PSYPLSQQTTGKNHQQHPIFESYGRFQEDAQGQPFNQLRYEQSQNHRQTGYAQTNCFAL
FT                   MPGKIFTLTNHPCTRMNECWQVVSVTHHGVQPLGDNSEGQGTQLSNHVTFIPSMQEWRP
FT                   PFHYKPLADGDELATVVGPDGEEIYTNEQGAVKVYFHWDRRGTPDHSGSCWLRVAQGWS
FT                   GNGFGFIAIPRVGQEVIVSYLNGDIDRPIITGCTYNGRNTPPLDLPKEKTKTTFRSKTH
FT                   KGTGFNELRFEDAGGREEVYLHAQNDLNIHVQHDSHWHTEHDVRQRIDNQRVTEIAGDE
FT                   HFILKGTQKSLIEGNVSLQIKGAKHCKVNDALIAESGKETHFKSGGKIILEAVSEITLK
FT                   VGSSFIRLTPNAIFTSGNLDIGSSGPGIGQDPNIQLPDGVTPFEQPLFAIKKYCVLTAN
FT                   EAGSLLIKPAKDEN"
FT   misc_feature    247041..247277
FT                   /note="HMMPfam hit to PF04524, Protein of unknown function,
FT                   DUF586, score 1.2e-43"
FT   CDS_pept        247940..248740
FT                   /transl_table=11
FT                   /locus_tag="PMI0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40604"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUE5"
FT                   /protein_id="CAR40604.1"
FT                   /translation="MIPLTWMQWSDNISQGDIYFFINSTFVLDTINFFYSNDWIEEAIP
FT                   LYNRETRLSHLEDISPWLIKIKSLSRYSLAKKIDEFLMEKYNWGWVYHSELNWDVQITH
FT                   WKNHQIVIVNNEEVHLRLFDPRVAGILFPHLKKEDWFSLMYPVNNAYIPFDNENLFFEK
FT                   PKEILKVQKEISPSIYTLPSYLLDAWRHSTHMINLVVENLILNFWEENGELAYSLFSRE
FT                   KDIKEVIYKWVNKERLRHTDIAYLNNKNLLSYLLDVNLIKKDEI"
FT   CDS_pept        248741..250660
FT                   /transl_table=11
FT                   /locus_tag="PMI0210"
FT                   /product="putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40605"
FT                   /db_xref="GOA:B4EUE6"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUE6"
FT                   /protein_id="CAR40605.1"
FT                   /translation="MTDKADCISCGKKWVEIYLVDEFNQPVFDIEYELFQVFGPMTEPR
FT                   KGKVKSDGIIIEDELFDIPITLRLDTQSLIEKMSERKLRKLRGEDNSIVKSKAIEMNRS
FT                   YRYTTIGPLCKDKIDIDNKEYQDKYPFYHFPEQEAFKGLTLSKLNTVYVIEICPFRVWS
FT                   LILHHTEQYSMINAYNLGLLSQLIYNNDNLYDPNSVRNFFERQCFDLSRYPVVREKNIK
FT                   AEYPAIVIDVPFDERYDKAIFLDTEDKVQHGSYAEGSTQLFYIQNKEQFIIAWRGSQEG
FT                   TDWVDDFTYRSKDIKTHASEFKIDGKIHKGFLDAYQLGKKFFPERFSEMKKMSRERKLF
FT                   ICGHSLGGALALAHATELSVNKPLLYTYGAPRLFTISALKQLQKFTHYRHINNNDIVSR
FT                   VPPEASLDNWLFNIYGIFGTILGGAISIVDLLGQKMITQYGEYYLHHGNPVIFYEVCNL
FT                   IEYYDEKIPNATHTWHYSYFNDRNNKTKLYIVPEINKKILNKSFEKEKEFISNLSEEDK
FT                   KAIFPEQKNPEGNGGTSVTDHYMGRGYLPFLHDQLLELIDHDKTPKRLKSRERFKVALE
FT                   NNTNIINPDLYRKKTLEAYRQRNLYFLDLQNSMGNSLIPMQENPKEVDMLQQFKEQTYE
FT                   IFNQ"
FT   misc_feature    249554..249955
FT                   /note="HMMPfam hit to PF01764, Lipase (class 3), score
FT                   4.7e-25"
FT   CDS_pept        250641..251435
FT                   /transl_table=11
FT                   /locus_tag="PMI0211"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40607"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUE7"
FT                   /protein_id="CAR40607.1"
FT                   /translation="MRYLINNCPLIILGSVVLLLSGCHSLTSKIDTTFLPPENGRTVKI
FT                   SVDVPDMAELLPMKVMYRSNLCQKTYHNNEVPKYTVPGFNSEIIALEKRENSSLYSTEI
FT                   PYRGGGKCDWQLSNVTLRLTLKKNNSFTKDIVDIVGTGVIIIFDNNQPQQTGHKPIKIK
FT                   GSFDIVEHYFPWVSDSFKNSNDISLWLYGKELFLYYQSRDAQQITWKPIIHSDIVVYSE
FT                   YPAEEKTEGVSTIYSYPDGTKSANRDGKPDYKKLLSLINSSS"
FT   misc_feature    250641..250724
FT                   /note="Signal peptide predicted for PMI0211 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.933) with cleavage site
FT                   probability 0.596 between residues 28 and 29"
FT   misc_feature    250677..250709
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        251619..252413
FT                   /transl_table=11
FT                   /locus_tag="PMI0212"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40608"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUE8"
FT                   /protein_id="CAR40608.1"
FT                   /translation="MNIINKYCLFLLSVVEILLLSGCHSLSSKIDTTFSPPENGRTVKI
FT                   SVDVPDMAELSPMKVMYRSNLCQKTYHNNEVPKYTVPGFNSEIIALEKRENSSLYSTEI
FT                   PYRGGGKCDWQLSNVTLRLTLKKNNSFTKDIVDIVGTGVIIIFDNNQPQRSGGRAINKK
FT                   GDFDIVSDYFPWINRSFKNSNDISLWLYGKELFLYYQSRDAQQITWKPIIHNDIVVYSE
FT                   YPAEEKTEGVSTIYSYPDGTKSANRDGKPDYKKLLSLIKPSS"
FT   CDS_pept        complement(252452..253282)
FT                   /transl_table=11
FT                   /locus_tag="PMI0213"
FT                   /product="putative periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40610"
FT                   /db_xref="GOA:B4EUE9"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUE9"
FT                   /protein_id="CAR40610.1"
FT                   /translation="MRFLNTFALLLSLILTPCYVIAATPAQRVITLSPSATEMAYAAGM
FT                   GENMVAASAYSDYPQAAKDLVQVADWQGINVERILLLKPDLIIAWPSGNPQRPLDQLKS
FT                   LGIPIIYSDPHSIEEIIDDLTRLSSYSTHPEVALASAQKLRQQYQELQQKYASTTPHQA
FT                   KKKVFIQFGMQPLFTTSKHSLQNEITELCGGENIFANSAVPWPQVSREQVISKKPDLIL
FT                   FSGKPNQIAAIQQFWQPQLDIPIIAIDEDSFSRPAPRIIYAAQQICEAIKDNNK"
FT   misc_feature    complement(252527..253210)
FT                   /note="HMMPfam hit to PF01497, Periplasmic binding protein,
FT                   score 2.2e-30"
FT   misc_feature    complement(253214..253267)
FT                   /note="1 probable transmembrane helix predicted for PMI0213
FT                   by TMHMM2.0 at aa 13-30"
FT   misc_feature    complement(253217..253282)
FT                   /note="Signal peptide predicted for PMI0213 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.993 between residues 29 and 30"
FT   CDS_pept        complement(253382..254089)
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="PMI0214"
FT                   /product="MTA/SAH nucleosidase (5'-methylthioadenosine
FT                   nucleosidase) (s-adenosylhomocysteine nucleosidase)"
FT                   /EC_number="3.2.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40612"
FT                   /db_xref="GOA:B4EUF0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUF0"
FT                   /protein_id="CAR40612.1"
FT                   /translation="MRVGVIGAMEQEVKLLREQIENCEIVSRGGCEIYTGKINGVDVAL
FT                   LKSGIGKVAAAIGTTLLLEHFRPDVVINTGSAGGLDAKLNVGDIVVSTEVRYHDADVTA
FT                   FGYEPGQMAQCPPAFIADPKLVNIAQECIGSLKLNAVRGLICSGDAFINGAEPLARIRR
FT                   TFPEVVAVEMESTAIGHVCHQFDTPFVVVRAISDVADKESHLSFDEFLSVAAQQSSLMV
FT                   TTMLDKLKTETQF"
FT   misc_feature    complement(253412..254086)
FT                   /note="HMMPfam hit to PF01048, Phosphorylase family, score
FT                   1.4e-95"
FT   CDS_pept        254209..255717
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="PMI0215"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /EC_number="3.1.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40614"
FT                   /db_xref="GOA:B4EUF1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUF1"
FT                   /protein_id="CAR40614.1"
FT                   /translation="MIDFKLKLNYQRKYNSSDIDIDDEMQISRQFESDRGRIINSAAIR
FT                   RLQQKTQVFPLEQNSAVRSRLTHSLEVQQIGRYIAKQIIGELKKHNKLEEYGLNERIDS
FT                   VESLIEMACLMHDIGNPPFGHFGEAAIKHWFRKVLAPDASIEFDNCPFLPIRYSADRHL
FT                   NELKQTLRQDLCHFEGNAQAIRMAHHLLKLNLTYAQIGCVLKYTRPAYWQGATPKEFSY
FT                   LMKKPGYYWSEAEFVKEVQEKLAMKDFCRFPLTYIMEAADDISYCIADLDDAVEKGIFD
FT                   INRLVQLLKNAWSESGAVTEGDLFDITVNRAFKKVDQNEAKRSMQDQFFMYLRVYITGK
FT                   LVPYTAYRFIKNLPQVYEGNFNHALLEGKSAEHRLLTTLKRVAQKWVFSHPEVEELEMK
FT                   GYRVISGLLDIYKPLLLLSTDDFLRLHKYNEHPHYVIETRLYHKLSIKHKLAYNEALEK
FT                   IYDINSEEGKTLEFYYRTRLIQDYISGMTDHYAYEEYRKLMVCD"
FT   misc_feature    254401..254748
FT                   /note="HMMPfam hit to PF01966, HD domain, score 0.00022"
FT   CDS_pept        256105..257430
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="PMI0216"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40617"
FT                   /db_xref="GOA:B4EUF2"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUF2"
FT                   /protein_id="CAR40617.1"
FT                   /translation="MVQFYSPKKRPAKKQVKNLAVTANALDANGQGIAHAEGKTIFVKG
FT                   LLPQETARIRLTEEKRQFAKGEVITRLTTNPERVTPPCQYYQHCGGCQQQHVPIDWQRT
FT                   TKAEVLSHLIKRETNVVISAQPVIAGAEYGYRRRARLGLRYHPKKGLVMGFRQALSNDL
FT                   VMVTQCPVLKPQLNVLLLPLWQCLKQLSVVRDLGHVELVLADNGPLVILRHLSPLSEGD
FT                   KQLLDDFSHHAQVMIYLAGDNGEIAQLTTIEKEPFYQIEGLKLHFAPTDFIQVNDEINH
FT                   KMVAQAIAWLDLSPNDRVLDLFCGMGNFTLPMAKRVDKVVGVEGVPALVAMAKKNAELN
FT                   QLDNVQFWHADLSADFSAMPWAQEGFNKVLLDPARAGAAQVMSHIVTLSAEKIVYVSCN
FT                   PTTLARDSKILLDSGYQLTQLRMLDMFPQTGHLESMALFIRK"
FT   misc_feature    256138..256314
FT                   /note="HMMPfam hit to PF01938, TRAM domain, score 4e-10"
FT   misc_feature    256402..257427
FT                   /note="HMMPfam hit to PF05958, tRNA
FT                   (Uracil-5-)-methyltransferase, score 1.1e-09"
FT   misc_feature    257218..257310
FT                   /note="PS01230 RNA methyltransferase trmA family signature
FT                   1."
FT   misc_feature    257371..257403
FT                   /note="PS01231 RNA methyltransferase trmA family signature
FT                   2."
FT   CDS_pept        257486..259726
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="PMI0217"
FT                   /product="GTP pyrophosphokinase"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40620"
FT                   /db_xref="GOA:B4EUF3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUF3"
FT                   /protein_id="CAR40620.1"
FT                   /translation="MVAVRSAHLTPAGEFAVDKWVNSLNLTHANAGSEIMQTWEYCHRT
FT                   VLGREDAQLLLWRGVEMVELLSTLSMDKDSMRAALLFPLAEEDLINQEVITEHFGEAIW
FT                   NLVRGVMEMDAIRQLKATHTNETSSVQVDNVRRMLLSMVEDFRCVVIKLAERIAHLREV
FT                   KDATEDERVLAAKECFNIYAPLANRLGIGQLKWELEDFCFRYLHPDEYKQIANLLHERR
FT                   IDREQYIDNFVSTVRGYMQQENIEVDIYGRPKHIYSIWRKMKKKNLAFDELFDVRAVRI
FT                   VVERLQDCYAALGIVHTHFRHLPDEFDDYVANPKPNGYQSIHTVVLGPEGKTVEIQIRT
FT                   RQMHEDAELGVAAHWKYKEGATGATTKGGTGSYENRIAWLRKLIAWQEEMADSGEMLDE
FT                   VRSQVFDDRVYVFTPKGDVIDLPAGSTPLDFAYHIHSDVGHRCIGAKIGGRIVPFSYQL
FT                   QMGDQIEIITQKHPNPSRDWLNPNLGYVTTSRGRAKIHNWFRKQDRDKNIIAGRQILDN
FT                   ELAPLDINMKEAEKLLIARYNVHSLDEVLAGIGVGDIRINQLVNFLQSKLNKATAEDED
FT                   KEALRSLENKTATPKTTTSGGGSIVVEGVGNLMHHIARCCQPIPGDNIVGFITKGRGIS
FT                   IHRADCDQLAELLSHAPERIVDAVWGENYSSGYSLVVRVVANDRSGLLRDITTILANEK
FT                   VNVLGVSSRSDVKQQIATIDMNIEIYNLQVLGRILAKLNQLPDVIEAKRFSH"
FT   misc_feature    258236..258568
FT                   /note="HMMPfam hit to PF04607, Region found in RelA / SpoT
FT                   proteins, score 9.3e-49"
FT   misc_feature    258698..258889
FT                   /note="HMMPfam hit to PF02824, TGS domain, score 5.7e-32"
FT   misc_feature    259493..259717
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 1e-13"
FT   CDS_pept        259837..260634
FT                   /transl_table=11
FT                   /gene="mazG"
FT                   /locus_tag="PMI0218"
FT                   /product="putative nucleotide pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40625"
FT                   /db_xref="GOA:B4EUF4"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUF4"
FT                   /protein_id="CAR40625.1"
FT                   /translation="MSENREILRLLAIMAQLRDPQTGCEWDRVQTFDTIAPYTLEETYE
FT                   VLDAIARKDFSALKEELGDLLYQVVFYARMAQEQQLFDFNDVCEAISNKLERRHPHIFA
FT                   TENENNLATEKHRWEKIKAQEREAKAQYSLLDDIPATLPALMKAEKIQKRCASVGFDWH
FT                   ELSPVLDKVYEEIDEVMAEVKKAPRDDQRIEDELGDLLFSVVNLSRHLKQKPEQALNRA
FT                   CRKFEQRFRFVEKMLTEQGINIENASLEEMEIGWQKAKEKEIE"
FT   misc_feature    259924..260145
FT                   /note="HMMPfam hit to PF03819, MazG nucleotide
FT                   pyrophosphohydrolase domain, score 8.6e-42"
FT   misc_feature    260314..260526
FT                   /note="HMMPfam hit to PF03819, MazG nucleotide
FT                   pyrophosphohydrolase domain, score 2.9e-06"
FT   CDS_pept        260773..260988
FT                   /transl_table=11
FT                   /locus_tag="PMI0219"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40627"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUF5"
FT                   /protein_id="CAR40627.1"
FT                   /translation="MALNIVVAFDLLKSVINLKKIKSMIISKRYVTKPATLYIVKKIKH
FT                   LFSKSDILAERIKLKCLRNIFTGLVD"
FT   CDS_pept        261146..262783
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="PMI0220"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40630"
FT                   /db_xref="GOA:B4EUF6"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUF6"
FT                   /protein_id="CAR40630.1"
FT                   /translation="MKTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTMMKLDPYI
FT                   NVDPGTMSPIQHGEVFVTDDGAETDLDLGHYERFIRTKMTRRNNFTTGRVYSEVLRKER
FT                   RGDYLGATIQVIPHITNEIKERIIRGGEGHDVVLVEVGGTVGDIESLPFLEAIRQMAAE
FT                   VGREHTFYLHLTLVPYLAASGEVKTKPTQHSVKELLSIGIQPDALICRSDRVIPANERA
FT                   KIALFCNVPEKAVISLKDVDSIYKIPALLKSQGLDDYICKRFSLDCPVANLSEWEQVIY
FT                   EEANPEGEVTIGMVGKYVELPDAYKSVIEALKHGGFKSRVAVNIKLIDSQDVETRGVEI
FT                   LKGLDAILVPGGFGERGVEGKIMAARYARENKIPYLGICLGMQVAMIEFARNVANMEDA
FT                   NSTEFAPDCKYPVIALITEWRDENGNLEVRTENSDLGGTMRLGAQPCHLSGDSLVRTLY
FT                   GKNTITERHRHRYEVNNLLLKRIEDAGLRIAGRSVDNKLVEIIENPNHPWFVACQFHPE
FT                   FTSTPRDGHPLFAGFVKAAFDYQKGLLK"
FT   misc_feature    261146..261223
FT                   /note="Signal peptide predicted for PMI0220 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.974) with cleavage site
FT                   probability 0.942 between residues 26 and 27"
FT   misc_feature    261152..261979
FT                   /note="HMMPfam hit to PF06418, CTP synthase N-terminus,
FT                   score 7.5e-216"
FT   misc_feature    261164..261232
FT                   /note="1 probable transmembrane helix predicted for PMI0220
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    262043..262750
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 1.9e-76"
FT   misc_feature    262265..262300
FT                   /note="PS00442 Glutamine amidotransferases class-I active
FT                   site."
FT   CDS_pept        262848..264149
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="PMI0221"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40635"
FT                   /db_xref="GOA:B4EUF7"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUF7"
FT                   /protein_id="CAR40635.1"
FT                   /translation="MSKIVKVLGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGS
FT                   REALELRDGDKSRFLGKGVLKAVEAVNGPIAKALLGQDAKDQANIDKIMIDLDGTENKS
FT                   NFGANAILAVSLANAKAAAAAKGMPLYEHISDLNGTHGQYSMPLPMMNIINGGEHADNN
FT                   VDIQEFMIQPVGAPTLKEAVRMGSEIFHHLAKVLKAKGMNTAVGDEGGYAPNLESNAAA
FT                   LAAIKEAVEAAGYVLGKDVTLAMDCAASEFYNNETGNYELKGEGKTFTSQEFTHYLEEL
FT                   TKQYLIVSIEDGLNESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIDKGIANSI
FT                   LIKFNQIGSLTETLAAIKMAKDAGYTAIISHRSGETEDATIADLAVGTAAGQIKTGSMS
FT                   RSDRVAKYNQLIRIEEALGSKAPFNGLKEVKGQA"
FT   misc_feature    262854..263249
FT                   /note="HMMPfam hit to PF03952, Enolase, N-terminal domain,
FT                   score 2.9e-70"
FT   misc_feature    263274..264143
FT                   /note="HMMPfam hit to PF00113, Enolase, C-terminal TIM
FT                   barrel domain, score 1.5e-180"
FT   misc_feature    263865..263906
FT                   /note="PS00164 Enolase signature."
FT   CDS_pept        264470..265852
FT                   /transl_table=11
FT                   /locus_tag="PMI0222"
FT                   /product="Sodium:sulfate symporter-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40637"
FT                   /db_xref="GOA:B4EUF8"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUF8"
FT                   /protein_id="CAR40637.1"
FT                   /translation="MDASNLAPSAKSSPINKRGLIILAIDVVLLLLLLEFLPYDPKANA
FT                   GLALMVFVGVLWLTEAIHVTITALFIPILAVVLGLMNTNESLKSFANPIIFLFFGGFAL
FT                   ATALHIQGLDRLIANRLLMIAKGKLSIAVLLLFGVTALLSMWISNTATAAMMLPLVLGI
FT                   LSNLDIRSERNTFVFVLLGVAYSASIGGLGTLVGSPPNAIAAAQLNLDFITWMKYGVPI
FT                   MLVLLPIMFIVMYLMLRPNLKHKFDLKLEVLEWNNKRVITMIIFLVTVFCWIFSSFISS
FT                   AFGGVKDLDTVIAVSAAIVIGVTGVASWSQIQENTEWGVLMLFGGGLTLSAILQSSGAS
FT                   LVMADFMKDTFGNSHWFVIILAVTTFIIVLTEFTSNTASAALLVPIFATVAQALGMPVM
FT                   ALTMIIGIGASCAFMLPVATPPNAIVFGSGYIKQTEMVRVGGVLNLVCILVISLFAWFF
FT                   WL"
FT   misc_feature    264515..265849
FT                   /note="HMMPfam hit to PF00939, Sodium:sulfate symporter
FT                   transmembrane, score 3.5e-15"
FT   misc_feature    join(264527..264586,264644..264712,264749..264808,
FT                   264893..264961,264995..265063,265106..265174,
FT                   265259..265327,265340..265399,265418..265486,
FT                   265529..265582,265601..265669,265679..265747,
FT                   265784..265843)
FT                   /note="13 probable transmembrane helices predicted for
FT                   PMI0222 by TMHMM2.0 at aa 20-39, 59-81, 94-113, 142-164,
FT                   176-198, 213-235, 264-286, 291-310, 317-339, 354-371,
FT                   378-400, 404-426 and 439-458"
FT   misc_feature    265694..265744
FT                   /note="PS01271 Sodium:sulfate symporter family signature."
FT   CDS_pept        266036..267673
FT                   /transl_table=11
FT                   /locus_tag="PMI0223"
FT                   /product="putative alpha-keto acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40641"
FT                   /db_xref="GOA:B4EUF9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUF9"
FT                   /protein_id="CAR40641.1"
FT                   /translation="MITVLDYLLVRLKELEIKTIFGVPGDYNLPFIGVVDNDKDIQWVG
FT                   ACNELNASYACEGYARIKGFSALCTTYGVGELSAINGVAGAFAEQVPIIHIVGAPSQSK
FT                   QEKGKTLHHCLATGRFDAFEKMYRHISKTTAVLTYHNATEEIDRVLETLWRYRYPVYLL
FT                   IPEDVGVMKVNKPKLPLQLTLPQSNPDDLNKVITLLENKIKQSKSPCIIIGEQVSRYQL
FT                   RKQVENLLEKTNLPFFTVWGSKGVVDEGRQQYGGILFGELSNPQGLDYIINSDLIISLG
FT                   VSWDEVNTAGFTFDVPTQNCYQFYDTYSLIEEEKIYGVSLLDMPNALLALDYIYPHNIA
FT                   LLPQKIVPPDWQGLIKIDSIPLLLDKVLDDNSVILAEAGNAFLCAVNHIFSGNSQLVVS
FT                   NIWASIGYTLPAALGVTLALENQGRAFVVIGDGAFQMTAQELSTLLRLKLNPVIFIVNN
FT                   QGYAFEKIFYGPKDTFNDIQNWNYSQLPELFNCDAYSVKVDSLEALETVLPLLKVHQDE
FT                   LCLVELDMDKHDYSEPISEFIALLNQYK"
FT   misc_feature    266039..266566
FT                   /note="HMMPfam hit to PF02776, Thiamine pyrophosphate
FT                   enzyme, N-termina, score 1.3e-42"
FT   misc_feature    266618..267100
FT                   /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
FT                   enzyme, central d, score 0.00028"
FT   misc_feature    267179..267199
FT                   /note="PS00290 Immunoglobulins and major histocompatibility
FT                   complex proteins signature."
FT   CDS_pept        complement(267762..269096)
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="PMI0224"
FT                   /product="membrane-bound lytic murein transglycosylase D
FT                   precursor"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40643"
FT                   /db_xref="GOA:B4EUG0"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUG0"
FT                   /protein_id="CAR40643.1"
FT                   /translation="MKTKVILFSILLLAGCQQSKSIKPDLSAITPTSLGTSTSYQPQYD
FT                   IKTNLWGYVVSELKMDIPDNERISQQETYFLNNPKHIQTVALRAEPYMYWIIEEIEKRD
FT                   LPMELALVPVVESAFNPHVTSSAKAAGLWQFVPVTANYYGLAQNQWYDGRRDVVASTNA
FT                   ALDLLERLYIMFDSDWPLALAAYNAGEGRVMQAIKANESKNLPTDYWSLSLPKETMNYV
FT                   PKILALSKVIRDNEADITFPKSNYRDKSLAAIDIGEQITLSKVAELSQLPITTVKDYNP
FT                   GYKRGITAPNGPHVILLPRNKLAQFQNAFADEAILKTIRLAVAKANQSIKQEGIYKVRS
FT                   GDSFYAIARRYNMSVKELQRLNGLSAKSTLLVGQTLKIHNAGSVNNRPTGKPTGASPSY
FT                   YKVRQGDSYYSIARRHNINLKQLMSWNADIKMLKPGTQLTLYLKK"
FT   misc_feature    complement(267774..267899)
FT                   /note="HMMPfam hit to PF01476, LysM domain, score 1.5e-09"
FT   misc_feature    complement(267960..268091)
FT                   /note="HMMPfam hit to PF01476, LysM domain, score 1.2e-16"
FT   misc_feature    complement(268470..268820)
FT                   /note="HMMPfam hit to PF01464, Transglycosylase SLT domain,
FT                   score 2.9e-33"
FT   misc_feature    complement(268677..268763)
FT                   /note="PS00922 Prokaryotic transglycosylases signature."
FT   misc_feature    complement(268848..269096)
FT                   /note="HMMPfam hit to PF06474, MLTD_N, score 1.9e-10"
FT   misc_feature    complement(269040..269096)
FT                   /note="Signal peptide predicted for PMI0224 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.974) with cleavage site
FT                   probability 0.524 between residues 19 and 20"
FT   misc_feature    complement(269049..269081)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(269170..269925)
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="PMI0225"
FT                   /product="putative hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40645"
FT                   /db_xref="GOA:B4EUG1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUG1"
FT                   /protein_id="CAR40645.1"
FT                   /translation="MELIRIPALSDNYIWLLSNENSECVIVDPSQAKPVIDIISQRSLT
FT                   PVAILLTHHHEDHVGGVAGLVSKYPNIEVFGPQETQTKGANKIIHDQEHIIVDSFSFLV
FT                   IGTPGHTLGHVAYYSEPYLFCGDTLFSGGCGRLFEGSAQQMFSSLQKLMALPDNTLICC
FT                   AHEYTLANLTFAHHIMPKNPDITDYLNKVTEMRHHLQPTVPITLKNEKNINLFLKSDDI
FT                   DLQRILGITSNTYAPIKTFTKLRELKDNF"
FT   misc_feature    complement(269431..269895)
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 4.6e-32"
FT   misc_feature    complement(269605..269925)
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT   CDS_pept        270041..270676
FT                   /transl_table=11
FT                   /locus_tag="PMI0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40648"
FT                   /db_xref="GOA:B4EUG2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUG2"
FT                   /protein_id="CAR40648.1"
FT                   /translation="MAIELRLQNWWPKIYGFHMLKLGQLSAELDTKSSMVSHQVNVTTT
FT                   TTNTDVMASLNYLPFENKSVDVCLMAHVLDYSADPHWLLREADRVLVDDGWIILSSFNP
FT                   ISLLGIGKCTPILRHKQPYYCRMFSLRRQVDWLSVLNYEVITQQNFQIMPFSRPVKRDG
FT                   KRYHVGGCLNLILARKRTLPLTPTAMKFALPRMSVKGRVLGATRNRPD"
FT   CDS_pept        complement(270701..271180)
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="PMI0227"
FT                   /product="ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40651"
FT                   /db_xref="GOA:B4EUG3"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUG3"
FT                   /protein_id="CAR40651.1"
FT                   /translation="MHKQVEIFTDGSCLGNPGPGGYGAILRYQQHEKTLSEGFFMTTNN
FT                   RMELLAAIVALEALKFPCKITLTTDSQYVRQGITKWIHSWKKRQWRKADKSPVLNVDLW
FT                   KRLDKAIERHEIEWHWVKGHAGHDENERCDELAKAAAQSPTKEDTGYLESQQDKT"
FT   misc_feature    complement(270755..271177)
FT                   /note="HMMPfam hit to PF00075, RNase H, score 5.7e-65"
FT   CDS_pept        271246..272004
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="PMI0228"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40653"
FT                   /db_xref="GOA:B4EUG4"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUG4"
FT                   /protein_id="CAR40653.1"
FT                   /translation="MSTPITRQIVLDTETTGMNKLGVHYEGHNIIEIGAVEVINRRLTG
FT                   RNFHVYIKPERLVDPEAFEVHGISDEFLEDCPSFAEIADEFLAYIRGAELIIHNASFDI
FT                   GFMDYEFQKLNRDIPLTETFCQITDSLAMARELFPGKRNNLDALCDRYLIDNSKRTLHG
FT                   ALLDAEILADVYLAMTGGQTALAFSMEGESNEEQKGDDIQRIVRPVRGLRVIKASAEEL
FT                   VAHEARLDLVVKKGGHCLWRPAPASNDETA"
FT   misc_feature    271267..271770
FT                   /note="HMMPfam hit to PF00929, Exonuclease, score 2.1e-48"
FT   tRNA            272127..272200
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:272161..272163,aa:Asp)"
FT                   /note="tRNA Asp anticodon GTC, Cove score 80.06"
FT   CDS_pept        272591..273673
FT                   /transl_table=11
FT                   /locus_tag="PMI0229"
FT                   /product="ABC transporter, permease protein (FecCD
FT                   transport family)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40655"
FT                   /db_xref="GOA:B4EUG5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUG5"
FT                   /protein_id="CAR40655.1"
FT                   /translation="MSENRASKQHSSKTTKARVVKEYQRQILRRFFYLMILGGVLCSVL
FT                   ILDFTLGPSGLSLTELWNTLISPETADAGTRVIVWDIRLPYSLMAVVVGMSLGLAGAEM
FT                   QTILNNPLASPFTLGVSSAAAFGAALAIVLGIGIPGVPAQWFISVNAFIFALLATLLLD
FT                   FISRWMRVSTSGIILFGIALVFTFNAAVSIMQFIANEDTLQGLVFWTMGSLNRASWDKL
FT                   YILLVVLVIIFPLSLMNAWKLTALRLGEDRAMSFGINVRRLRLTTLLRISIISALAVAF
FT                   VGPIGFIGLVAPHIARMTFGEDHRFYLPASALIGALVLSIASLVSKNLLSGVIIPVGIV
FT                   TSLVGIPFFVSIILRHRGRI"
FT   misc_feature    join(272681..272749,272834..272902,272936..273004,
FT                   273017..273076,273113..273181,273254..273322,
FT                   273395..273463,273506..273565,273584..273652)
FT                   /note="9 probable transmembrane helices predicted for
FT                   PMI0229 by TMHMM2.0 at aa 31-53, 82-104, 116-138, 143-162,
FT                   175-197, 222-244, 269-291, 306-325 and 332-354"
FT   misc_feature    272744..273655
FT                   /note="HMMPfam hit to PF01032, FecCD transport family,
FT                   score 4.6e-93"
FT   CDS_pept        273673..274467
FT                   /transl_table=11
FT                   /locus_tag="PMI0230"
FT                   /product="ABC transporter, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40658"
FT                   /db_xref="GOA:B4EUG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUG6"
FT                   /protein_id="CAR40658.1"
FT                   /translation="MNTGLNAGLRIEKFSTGYAKREIIKELTVSLLPRGKITVLLGPNG
FT                   SGKSTLLRALAGLNSAQGKLFLGDDELLSLSFSKRAEQVVYLPQTLPAGVHLSVLESIL
FT                   VARRALGEHRSHSANDEVIDLLEQLGISHLAMRYLDELSGGQKQLVGLAQSLIRRPSLL
FT                   LLDEPLSALDLNYQFHVMELIARETKKRNMITVVVVHDINIALRHGEYVLMLKNGELVA
FT                   NGLPTEVITPEILADVYRVSARIERCSRGHPQVLIDGRINDI"
FT   misc_feature    273775..274326
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.6e-46"
FT   misc_feature    273796..273819
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    274096..274140
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        complement(274538..275374)
FT                   /transl_table=11
FT                   /locus_tag="PMI0231"
FT                   /product="putative citrate lyase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40659"
FT                   /db_xref="GOA:B4EUG7"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUG7"
FT                   /protein_id="CAR40659.1"
FT                   /translation="MNEEISYLFVPANKKVMISKALTYGANAIILDLEDAVHPDEKPLG
FT                   RDNIQNWLTTINNTIINTSIYIRINHPKEKEFKNDVDLLNSLNETLMTGVMIPKLEDAE
FT                   ILSYIKSKLHLAISKRPFIGIIETARGVHHCEEIANSGVTRLAFGSLDYSLDIDCQQTA
FT                   EALLYARSRIVIASRIANLISPIDCVTPEFCTPNTLLMDANHASALGFGAKLCIHPDQI
FT                   DTVNKAFKPTEEKIKWAQEVVKQSTASYAFQINGEMIDLPLIKQATRIINGKYKPN"
FT   misc_feature    complement(274718..275359)
FT                   /note="HMMPfam hit to PF03328, HpcH/HpaI aldolase/citrate
FT                   lyase family, score 2.6e-13"
FT   CDS_pept        275588..277471
FT                   /transl_table=11
FT                   /locus_tag="PMI0232"
FT                   /product="putative siderophore biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40660"
FT                   /db_xref="GOA:B4EUG8"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUG8"
FT                   /protein_id="CAR40660.1"
FT                   /translation="MMETVEKKSIAGQQTAIQTDFSTRNALARIIRCLFAEKLLDDNKL
FT                   QVFNDENNVKYPLSDGIHILQFNQTTVFPANTVINRGDIILKSMDGRHRMVQSHEELMG
FT                   ILKNELSFTPTTEGMTKFNKDVANSIHNDRLARAHRSKWRDTISNEMAQEGTSCFIEWI
FT                   TRHYSRRDGATFLDQWGALEGHSYYPTWKSRPGLSDDDIVALSAEFGARVNLRIAAIQS
FT                   DMVYCEKMPHIQDIHQWFSSAFPTVWNKWCEWLTSQYQNPQKWLPIPLHPWHLEHWIIA
FT                   HFSKEIDEGILLPLGPQLETAASMSFRTMLPTASRSPFIKLPVAIWMTSEMRSLQAKSI
FT                   HMGPRISTIIEDILRVDKDFDGKLDFFREEVAWHFRHNVRMDDAEGKFLSVVFRDTQAW
FT                   ERNDNLIAITVASLFTELPHKPQPLISELIALSGDLPETWFRNYTKVILKPVLAMYLIY
FT                   GIALEAHQQNTQVLFDDSGRAVTMLIRDFGDGRSWAPALRQQGYELQPYIWPGILPTVF
FT                   EDDIEPVRTFVVDACLVSHLHEIALCLTQLYDIPDTRIWTVIGEELELVFKALQPRVEA
FT                   DFWHKEREHFLHHPWYTRSLMSMHLQQYTDYRLQHGLNNPLAGEQVDNSKI"
FT   misc_feature    276098..277444
FT                   /note="HMMPfam hit to PF04183, IucA / IucC family, score
FT                   1.2e-101"
FT   CDS_pept        277482..279593
FT                   /transl_table=11
FT                   /locus_tag="PMI0233"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40663"
FT                   /db_xref="GOA:B4EUG9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUG9"
FT                   /protein_id="CAR40663.1"
FT                   /translation="MITNKHFLALTIAASLIPDFVSAEERIIVNAERVNPQTKGRLSQQ
FT                   ANIGLLGNKDIQDIPFSIKGYTSKYIEQRQAKTLGDVIKDDPSVQVTSPSGGILDSFMI
FT                   RGFPIGEGNIGEVALNGVYGVAPNYQLLPQYLERIELLKGPGAGLYGISPNGGVGGVVN
FT                   AVTKRPTRQGTKQITTTWGSDNQLGAYIDVGKLWVTPDGEMWGVRFNGGGSGGDLALDN
FT                   THKKTALGALALDYGKDGFTVSVDLFDQYQYVKSPNRPFIVLAGIDVPKAPNGRRNIAQ
FT                   KGMWWNTRDQGVLLHSSYELNDNLTLFMNAGGGRSIVSRISEQTPKIINDNGDVESAIT
FT                   NYRFNVHRYIFETGVRSYFSTGAIDHQMTLQASYYHDRLAVAGNVGKQKVISNIYSPSE
FT                   VDVTLPSSPASVPKVSSSQLTSFAVSDIMTILNGSVDIIPGIRLQRVQADNFMANGQRS
FT                   ASYDESAVTPMLGLVYHPLESVSLYANYIEGLSKGDIAPSFAKNAGQVMRPYRSRQYEV
FT                   GVKYDNAGIQSSLALFQITKPSGAIDSTDNIFNANSEQRNRGVEVNLSAQVLDNLQISG
FT                   NLSLIDAELIKSPKSDIRGNKPVGVSPLQANVGVEYDLPILHGLSLNSYVNYSAKQYVN
FT                   QANTQSINSWTTVDMGASYKTRVYGAPTTFRFDVQNLFNHHYWSGVASYTTIAQGAPRT
FT                   FLASVSVDF"
FT   misc_feature    277482..277550
FT                   /note="Signal peptide predicted for PMI0233 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.966) with cleavage site
FT                   probability 0.764 between residues 23 and 24"
FT   misc_feature    277644..277955
FT                   /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug
FT                   Domain, score 4.5e-16"
FT   misc_feature    278880..279590
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor,
FT                   score 1.5e-26"
FT   misc_feature    279537..279587
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="PS01156 TonB-dependent receptor proteins signature
FT                   2."
FT   CDS_pept        279605..281008
FT                   /transl_table=11
FT                   /locus_tag="PMI0234"
FT                   /product="putative decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40664"
FT                   /db_xref="GOA:B4EUH0"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042152"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUH0"
FT                   /protein_id="CAR40664.1"
FT                   /translation="MSSLLNTYYRANESWQIAITQALPPYIDPVIIRWLETSPDTLVHL
FT                   TQIYGSPLNIVWPHTVEQNVNAMVEVAKTFGIQTNLYYGVKVNKSQSLLQAAVAAGTGA
FT                   DVSSLYELNDAIRAGCKGTELCATGPAKTTAFLQALIVQGARIVIDSIEEMDELIHLAT
FT                   RWISPSGRISILLRFRPESNHISRFGMLSAEIMTALEKLNYSDQVKVDGFHFHLSGYSS
FT                   VSRIKAFFDTLPLISYARALGYSPYIIDIGGGLPVQYVDSHCYKKWLSTQTHKDYRTRR
FT                   IPDSFYPYGGEINAQGWLTEFLTGVDPTGKRVCDALIEEGLTLCLEPGRSLVNQSAISV
FT                   FRVCRVRPYDHVGHVIFVEGTSFSACETWFNSEFLSDPLHIYRNNHQPLSSAGNAWIAG
FT                   HSCLDDDVITNRLIAFAHLPKPGDLLIFANTAGYQMDLLENQFHRHPLPTRLTAVINSH
FT                   QKPIFTIDN"
FT   misc_feature    279782..280609
FT                   /note="HMMPfam hit to PF02784, Pyridoxal-dependent
FT                   decarboxylase, pyri, score 7.1e-10"
FT   misc_feature    280331..280372
FT                   /note="PS00879 Orn/DAP/Arg decarboxylases family 2
FT                   signature 2."
FT   CDS_pept        281020..282036
FT                   /transl_table=11
FT                   /locus_tag="PMI0235"
FT                   /product="putative pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40666"
FT                   /db_xref="GOA:B4EUH1"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUH1"
FT                   /protein_id="CAR40666.1"
FT                   /translation="MVFSKVTDLIGNTPIIQLPLLQSDTRLYIKVEKNNPGGSMKDRMA
FT                   RNMVVAALKSGKIKPGSTIVESSSGNTGIGLAIAAIEFGLRFIAVVDHHAAQDKIAIMR
FT                   ALGAEIRYVKGDYGENEVAVVERQRMAAEIANEIPGAIFMNQSDNAANAGGYADLVREL
FT                   ISQIGKIDAWVGCVGTGGSMTGIAHGLRVHNPELVTIAVEPEGSIIFGKPGKPYYQSGT
FT                   GTPQGDTVGLVLDYSCIDYGEQVSDVCAFETARYLARRFGLLVGGSTGGVVYKALELIN
FT                   NSTICGNVALAMADGGEKYLQTIFNDTWLKERNLISESVWEQLDNWFSLPTCLGDSR"
FT   misc_feature    281035..281883
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme, score 5.4e-68"
FT   CDS_pept        282033..283190
FT                   /transl_table=11
FT                   /locus_tag="PMI0236"
FT                   /product="putative octopine/opine/tauropine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40668"
FT                   /db_xref="GOA:B4EUH2"
FT                   /db_xref="InterPro:IPR003421"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUH2"
FT                   /protein_id="CAR40668.1"
FT                   /translation="MIPNEKLRVTLCGAGRTGHLAAILFSLNPAIDVTLYSSRSEAVTA
FT                   YKENDHQLQAVMPDGQVIKTRSVRMTEAIDEACSEADIIIITTPSHVRESLLQRMAPIL
FT                   PKHKNIFVGAIPGFAGFDWLAEKTLGDASNIVIWGMKDVPHIAFDLQPGKSVRMGGGKS
FT                   QLYVAVHRREKPQYANLLLNYLKQLYDSPITLLTDYLEITLTPGNPIMHSSVIYGLIGP
FT                   WGQWHNRPFESIPCWWNDCPELGAYFLARCDRENQALCNKAEVVLGINLSSVQPLQQEI
FT                   VAAYADSIADPRTLLSVLRTNKAYQGIPLPLISTAQSHGYIFDKQHRVFQEDIAYGLAL
FT                   LVALGERLRVPTPYIREIYDWCCGYMGGNLPHPQIPMDWPIIRVK"
FT   CDS_pept        283192..284403
FT                   /transl_table=11
FT                   /locus_tag="PMI0237"
FT                   /product="MFS-family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40669"
FT                   /db_xref="GOA:B4EUH3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUH3"
FT                   /protein_id="CAR40669.1"
FT                   /translation="MRVTGSVIFIVQFLFIVQLLSMGAMEMSGPFWPLHLESMASTELL
FT                   SIVGTGVYIAPMLGVMLTSTFWGRIGDKTGNKVMMIRALMGLALTQLGLAFANDVWVIL
FT                   LLRFLQGTCAGYIAPAQAYGIAMIPIAQRTRLLAWLQVSTNAGSLAGAIAGGAILDLLS
FT                   FFWINFGAFIICTLCALLVFFILPNDLPRHASSNCVTSSTNKAKAISSINHSVIVGLLT
FT                   VLGLLLMSRMITQTPFSLYVSSVFNASNWLTGVAYGLQATGVIVSASLWARWFEAHNIS
FT                   HALYRMVGIIAGCFIVTLLLAAVREISWFIGLYFLWGILLGATTPVLTALISRSTAESK
FT                   QGYILGLVQSISQFASMVGIALGGGILVWPGLTTLFLCVAVMYCITLIITLKMSYSSKN
FT                   TNQK"
FT   misc_feature    join(283210..283269,283327..283395,283432..283500,
FT                   283513..283581,283600..283668,283681..283749,
FT                   283822..283890,283948..284016,284035..284103,
FT                   284116..284184,284218..284286,284296..284364)
FT                   /note="12 probable transmembrane helices predicted for
FT                   PMI0237 by TMHMM2.0 at aa 7-26, 46-68, 81-103, 108-130,
FT                   137-159, 164-186, 211-233, 253-275, 282-304, 309-331,
FT                   343-365 and 369-391"
FT   misc_feature    283231..284295
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 8.2e-36"
FT   CDS_pept        284414..285541
FT                   /transl_table=11
FT                   /locus_tag="PMI0238"
FT                   /product="putative substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40671"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUH4"
FT                   /protein_id="CAR40671.1"
FT                   /translation="MILRFIFSIVLLYSSMAYSQQVVTPVTDLLGRTVNVKLPVQRVIL
FT                   GEGRQLYLVAMFDKENPAQRIVAWRKDLIQSDPATWQQYRQQFPQLAKIPTFGGSEQGT
FT                   FDIEQAINLQPDVIIMNMDARNTIVDAGHEAALARAGIPIVYVDFRYDPIAHIPPTVTL
FT                   FGKLFGQPDRAEAYLTFRDKELQRVTSRVEQLQGALPKVFLERLGGYSEECCMTFGKGS
FT                   FGRFVKIAGGDNIADNLAPGTFFTLNPEKVVVANPDIVIITSGNFQAFVPGGKWIPLGP
FT                   GINIQQSKHRLAWFTTRPAYVDSNARRRGAFFAIWHQFYNSPYDVIAIQQLAKWIHPQL
FT                   FADLDPDDTFRRLHQEFLPISYQPGYMIDLEKEGR"
FT   misc_feature    284414..284470
FT                   /note="Signal peptide predicted for PMI0238 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.942 between residues 19 and 20"
FT   misc_feature    284597..285331
FT                   /note="HMMPfam hit to PF01497, Periplasmic binding protein,
FT                   score 3.9e-05"
FT   CDS_pept        285544..285990
FT                   /transl_table=11
FT                   /locus_tag="PMI0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40673"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUH5"
FT                   /protein_id="CAR40673.1"
FT                   /translation="MEYDVVLYPIALLRPSEEVNMAHVEALTKEIVRCQRWTTPIPIEK
FT                   ETGIIMDGNHRYQVAHHLALTYIPCVLLDYTDTRITVYDWQNGRAFSPLRIREQILKQG
FT                   NIFPYKTTRHLFSPSLPAVNFPLEQLVEKIASNHLNVFKLGVGR"
FT   CDS_pept        286327..288321
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="PMI0240"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40675"
FT                   /db_xref="GOA:B4EUH6"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUH6"
FT                   /protein_id="CAR40675.1"
FT                   /translation="MTTRKTLANAIRFLSMDAVQKAKSGHPGAPMGMADIAEVLWRDFL
FT                   NHNPTNPHWADRDRFVLSNGHASMLIYSLLHLSGYQVSLDDLKNFRQLHSKTPGHPEYG
FT                   YTPGVETTTGPLGQGIANAVGFAIAERTLAAQFNRPGHDIVDHYTYAFMGDGCMMEGIS
FT                   HEVCSLAGTLQLGKLIAFYDDNGISIDGKVHGWFTDNTAERFEAYGWHVISGIDGHDAA
FT                   SIKAAIETAQQITDKPSLLICKTTIGFGSPHKAGTADSHGSPLGDAEIAETRKALGWEY
FT                   GPFEIPQEIYKEWDAKEAGKAKEAAWDAKFAEYAAQFPELAAEFKRRMSGELPANWEKE
FT                   STAFIEQLQHNPASIASRKASQNTLEAFGKVLPEFMGGSADLAPSNLTMWSGSKALNED
FT                   KAGNYIHYGVREFGMSAIMNGIALHGGFVPYGATFLMFMEYARNAVRMAALMKIRSIFV
FT                   YTHDSIGLGEDGPTHQPVEQMASLRVTPNMSTWRPCDQVESAVAWKYAVERKDGPTALI
FT                   FSRQNLAQQPRTPEQLANIEKGGYILKDCDGTPELIFIATGSEVELAVNAYDQLTAEGR
FT                   KVRVVSMPATDAFDKQDADYREAVLPAAVKARVAIEAGIADYWFKYVGLDGVIVGMHSF
FT                   GESAPANELFAEFGFTVENVVTQAKTLLK"
FT   misc_feature    286333..287328
FT                   /note="HMMPfam hit to PF00456, Transketolase, thiamine
FT                   diphosphate b, score 9.9e-244"
FT   misc_feature    286360..286422
FT                   /note="PS00801 Transketolase signature 1."
FT   misc_feature    287389..287901
FT                   /note="HMMPfam hit to PF02779, Transketolase, pyridine
FT                   binding domai, score 1.7e-66"
FT   misc_feature    287725..287775
FT                   /note="PS00802 Transketolase signature 2."
FT   misc_feature    287944..288291
FT                   /note="HMMPfam hit to PF02780, Transketolase, C-terminal
FT                   domain, score 1.3e-13"
FT   CDS_pept        288580..289599
FT                   /transl_table=11
FT                   /gene="epd"
FT                   /locus_tag="PMI0241"
FT                   /product="D-erythrose 4-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40679"
FT                   /db_xref="GOA:B4EUH7"
FT                   /db_xref="InterPro:IPR006422"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUH7"
FT                   /protein_id="CAR40679.1"
FT                   /translation="MTIRVAINGFGRIGRNVLRALYESGKRAEISVVAINELADATGIA
FT                   HLLKYDSSHGRFAWDIRVNNDLLQVGDDAIRLFHHADIADLPWGELGIDVVLDCSGVYG
FT                   SRADGEAHIAQGAKKVLFSHPGTIDLDATVVFGVNQHELKKQHRIVSNASCTTNCIIPI
FT                   IKMMDDAFGIESGTVTTIHAAMNDQPVIDAYHKDLRRTRAAGQSIIPVDTKLAAGITRI
FT                   FPKFKDHFEAISVRVPTINVTAIDLSVTVKNAVNVLDVNKLIQKSATGAFRGIVDYTEL
FT                   PLVSTDFNHDPHSAIVDGTQTRVSGQHLIKTLVWCDNEWGFANRMLDTTLAMAATGFK"
FT   misc_feature    288586..289044
FT                   /note="HMMPfam hit to PF00044, Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NA, score 2e-74"
FT   misc_feature    289036..289059
FT                   /note="PS00071 Glyceraldehyde 3-phosphate dehydrogenase
FT                   active site."
FT   misc_feature    289045..289527
FT                   /note="HMMPfam hit to PF02800, Glyceraldehyde 3-phosphate
FT                   dehydrogenase, C-, score 9.3e-73"
FT   misc_feature    289699..290856
FT                   /note="HMMPfam hit to PF00162, Phosphoglycerate kinase,
FT                   score 1.1e-212"
FT   CDS_pept        289702..290865
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="PMI0242"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40680"
FT                   /db_xref="GOA:B4EUH8"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUH8"
FT                   /protein_id="CAR40680.1"
FT                   /translation="MSVIKMTDLDLAGKRVLIRADLNVPVKDGKVTSDARIRASLPTIE
FT                   AALKQGAKVMVTSHLGRPTEGEYNEEFSLKPVVDYLKEKLSAPVSLAKDYLNGVDVNAG
FT                   ELVVLENVRFNKGEKKDDETLSKQYAALCDVFVMDAFGTAHRAQASTHGVAKFADIACA
FT                   GPLLSAELEALGKALDKPERPMVAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTFI
FT                   AAEGHSVGRSLYEADLVDDAKKLMEKCDIPVPTDVRVATEFSETAPAVLKSANDIKDDE
FT                   QVLDIGDVTAERLAEILKNAKTILWNGPVGVFEFPNFRKGTEVIAKAIADSDAFSIAGG
FT                   GDTLAAIDLFDIADKISYISTGGGAFLEFVEGKKLPAVAMLEERAKQ"
FT   misc_feature    289744..289776
FT                   /note="PS00111 Phosphoglycerate kinase signature."
FT   CDS_pept        290930..292009
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /locus_tag="PMI0243"
FT                   /product="fructose-bisphosphate aldolase class II"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40681"
FT                   /db_xref="GOA:B4EUH9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUH9"
FT                   /protein_id="CAR40681.1"
FT                   /translation="MSKVFDFVKPGVITGDDVQKVFAVAKENNFALPAVNCVGTDSINA
FT                   VLEAAAKVRSPVIVQFSNGGAAFIAGKGLKAEAPQQAAILGAISGAHHVHQMAEYYGVP
FT                   VILHTDHCAKKLLPWIDGLLDAGEKHYAKTGKPLFSSHMIDLSEESLEENIEICSKYLA
FT                   RMAKIDMTLEIELGCTGGEEDGVDNTGMDSSALYTQPEDVAYAYEKLNAISPRFTIAAS
FT                   FGNVHGVYKPGNVQLTPKILRNSQDYVSEKYNLPHNSLNFVFHGGSGSSAEEIKEAVSY
FT                   GVVKMNIDTDTQWATWDGILQFYKKNEGYLQSQLGNPEGADKPNKKYYDPRNWLRHGQT
FT                   SMVVRLEQAFKELNAIDVL"
FT   misc_feature    290972..292006
FT                   /note="HMMPfam hit to PF01116, Fructose-bisphosphate
FT                   aldolase class-II, score 3.4e-204"
FT   misc_feature    291227..291265
FT                   /note="PS00602 Fructose-bisphosphate aldolase class-II
FT                   signature 1."
FT   misc_feature    291443..291478
FT                   /note="PS00806 Fructose-bisphosphate aldolase class-II
FT                   signature 2."
FT   CDS_pept        complement(292101..292313)
FT                   /transl_table=11
FT                   /locus_tag="PMI0244"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40683"
FT                   /db_xref="GOA:B4EUI0"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUI0"
FT                   /protein_id="CAR40683.1"
FT                   /translation="MNDKNKLAAALLAIFLGGLGIHKFYLRKVGMGILYLIFCWTGIPA
FT                   IIGFIEGIYYLCISDQTFNDKYNRN"
FT   misc_feature    complement(join(292140..292208,292236..292295))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0244 by TMHMM2.0 at aa 7-26 and 36-58"
FT   misc_feature    complement(292155..292307)
FT                   /note="HMMPfam hit to PF05154, TM2 domain, score 1.8e-16"
FT   CDS_pept        complement(292575..294053)
FT                   /transl_table=11
FT                   /locus_tag="PMI0245"
FT                   /product="MFS-family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40687"
FT                   /db_xref="GOA:B4EUI1"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR023778"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUI1"
FT                   /protein_id="CAR40687.1"
FT                   /translation="MDKPAKVGLLQQPKPFFMIFFVELWERFGYYGVQGILAVYFVSKL
FT                   GFSQEQAFITFGAFSALVYGLISIGGYVGDHLLGTKRTIVLGAIVLAIGYFMTGMSIMY
FT                   PNLIFYALATIAVGNGLFKANPASLLAKCYKPKDPRLDGAFTLFYMSINVGSLISLSIA
FT                   PVLADRYGYALTYNICGIGLIMAILVYFFCRKMVVNIGSEPDHLPMNFNKLLLVIAGSV
FT                   AMVFICAWLLHNVMIANIVLISLSIVVVIIYFREAFKQKDRVARNKMYVAFVLMLEAVI
FT                   FYILYAQMPTSLNFFAIHNVHHTLLGFDINPVSFQALNPFWIIIASPILAMAYSHFGAK
FT                   GKDLSMPAKFTTGMLLCSLGFLTAAASGMWFADAQGLTSPWFVVLIYLFQSLGELMISA
FT                   LGLAMIAAFVPQYMMGFILGMWFLTQATAYLLGGHVATFTAPPEGITDPLQTLPIYTDV
FT                   FGKIGIVTLVVGLIMWATVPLLNRMMKEESKMIK"
FT   misc_feature    complement(join(292614..292682,292740..292808,
FT                   292827..292895,292938..293006,293043..293111,
FT                   293193..293246,293283..293351,293361..293414,
FT                   293475..293543,293556..293624,293661..293729,
FT                   293739..293807,293832..293900,293928..293996))
FT                   /note="14 probable transmembrane helices predicted for
FT                   PMI0245 by TMHMM2.0 at aa 20-42, 52-74, 83-105, 109-131,
FT                   144-166, 171-193, 214-231, 235-257, 270-287, 315-337,
FT                   350-372, 387-409, 416-438 and 458-480"
FT   misc_feature    complement(292743..293999)
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 3.3e-05"
FT   misc_feature    complement(292767..293813)
FT                   /note="HMMPfam hit to PF00854, POT family, score 5.2e-99"
FT   misc_feature    complement(293583..293621)
FT                   /note="PS01023 PTR2 family proton/oligopeptide symporters
FT                   signature 2."
FT   misc_feature    complement(293772..293846)
FT                   /note="PS01022 PTR2 family proton/oligopeptide symporters
FT                   signature 1."
FT   CDS_pept        complement(294677..295195)
FT                   /transl_table=11
FT                   /gene="hpaC"
FT                   /locus_tag="PMI0246"
FT                   /product="4-hydroxyphenylacetate 3-monooxygenase, reductase
FT                   component"
FT                   /EC_number="1.6.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40689"
FT                   /db_xref="GOA:B4EUI2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR011982"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUI2"
FT                   /protein_id="CAR40689.1"
FT                   /translation="MSDEKQANPLFRDAMASLGAAVNIVATNGDAGCCGLTATAVCSVT
FT                   DTPPTVMICINSKSQMNSTFQENGKLSINILNHEQEEMACHFAGMTGLAMADRFTQPGW
FT                   QYGALQQPILTNALASLEGDIYDVRQVGTHFVYMAEIKNIAVREDGDGLIYFKRRFHPV
FT                   KHKLVPTTA"
FT   misc_feature    complement(294704..295153)
FT                   /note="HMMPfam hit to PF01613, Flavin reductase like
FT                   domain, score 1.6e-54"
FT   CDS_pept        295282..295494
FT                   /transl_table=11
FT                   /locus_tag="PMI0247"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40690"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUI3"
FT                   /protein_id="CAR40690.1"
FT                   /translation="MPLHKVVMILLISLLCEFKAVTLPRISQEINLSLLQPVNFISKSR
FT                   ETTLSLVVIIPNKSRKAIGKSSDLA"
FT   CDS_pept        295772..296209
FT                   /transl_table=11
FT                   /gene="hpcR"
FT                   /locus_tag="PMI0248"
FT                   /product="homoprotocatechuate degradative operon repressor
FT                   (MarR family transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40691"
FT                   /db_xref="GOA:B4EUI4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012712"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUI4"
FT                   /protein_id="CAR40691.1"
FT                   /translation="MHESLTIALLQARESAMGFFRPVLKEHNLTEQQWRIIRVLADKRS
FT                   IDFHELAQKTCILRPSLTGILIRMERDELICRLKPVSDQRKLFVSLSTNGQNLYDKIQP
FT                   KIEEGYQLLEQKFSTEKLQHLSILLKELIALNPENSHSTEK"
FT   misc_feature    295856..296167
FT                   /note="HMMPfam hit to PF01047, MarR family, score 4.2e-23"
FT   CDS_pept        complement(296280..298283)
FT                   /transl_table=11
FT                   /gene="betU"
FT                   /locus_tag="PMI0249"
FT                   /product="putative secondary glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40693"
FT                   /db_xref="GOA:B4EUI5"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUI5"
FT                   /protein_id="CAR40693.1"
FT                   /translation="MSQQNEITPKKIRMKINPPVFYTSAILIMLVVGFSALFPELANDK
FT                   LGHLQENLFTNASWFYILAVALVLLSVTYLGLSRFGEIKLGPDHARPHFSYFAWFAMLF
FT                   SAGMGIGLMFFGVAEPVMHYLMPPTGDAQTIEAAKEAMRLTFFHWGLHAWAIYAIVALI
FT                   LAFFSYRHGLPLTLRSALYPIIGDRIYGPIGHAVDIFAVMGTVFGVATSLGFGVLQVNA
FT                   GLNHLFDIPINPTVQVVLIVVITGLATISVVSGLEKGIRFLSELNLGLAVILLLLVIIL
FT                   GPTVLILKSFVENTGGYLSEIVSKTFNLYAYEPKSSDWLGGWTLLYWGWWLSWSPFVGM
FT                   FIARISRGRTIREFVVGVLFVPAGFTLLWMTVFGNTAIYLIKDKGAEVLANIVQQDVSL
FT                   ALFEFLNYFPFSSVLSFVAMLMVIVFFVTSADSGAMVVDTLASGGDSETPVWQRIFWAA
FT                   LMGISAITLLLAGGLSALQTVTIASALPFAIVLLASIYGLIKALRVDVYKRDSQQMTTI
FT                   APPASRNPIPWQRRLRNIAYFPKRSHVKRFMEEVVNPSMEMVSAELSKQGIQCYIHDEE
FT                   EDRIGFEVDLGEDMNFFYEVRLRFYTQPAFALAGLTDEEKDEEHKYYRAEIHLKEGGQD
FT                   YDVMGWTKEQIIHDILDQYEKHIHFLHVLGKR"
FT   misc_feature    complement(296769..298226)
FT                   /note="HMMPfam hit to PF02028, BCCT family transporter,
FT                   score 2.1e-232"
FT   misc_feature    complement(join(296787..296846,296856..296924,
FT                   297003..297071,297165..297224,297261..297329,
FT                   297420..297488,297522..297581,297639..297707,
FT                   297765..297833,297930..297998,298056..298115,
FT                   298158..298226))
FT                   /note="12 probable transmembrane helices predicted for
FT                   PMI0249 by TMHMM2.0 at aa 37-59, 74-93, 113-135, 168-190,
FT                   210-232, 252-271, 283-305, 336-358, 371-390, 422-444,
FT                   471-493 and 497-516"
FT   misc_feature    complement(297291..297320)
FT                   /note="PS01303 BCCT family of transporters signature."
FT   misc_feature    complement(298026..298127)
FT                   /note="HMMPfam hit to PF05115, Cytochrome B6-F complex
FT                   subunit VI (PetL), score 0.15"
FT   misc_feature    complement(298158..298283)
FT                   /note="Signal peptide predicted for PMI0249 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.975 between residues 59 and 60"
FT   CDS_pept        complement(298652..299317)
FT                   /transl_table=11
FT                   /locus_tag="PMI0250"
FT                   /product="putative lipoprotein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40694"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUI6"
FT                   /protein_id="CAR40694.1"
FT                   /translation="MFWIHSLERNMNKKLLASLILAGLVTITAGCDDSSKKVDEGIDKA
FT                   KETATQVNETAQDKAKELTDQAKEKAADLKESASATADELKQDAAKLKEQAEDKAAELK
FT                   AQADQKTDALKESIAQKTDELKDSASAKADEIKQSLNNESDKLAGKAEEVKQNANTTAD
FT                   NLKQNASDKAAQLKEDAAKTSDDVKQQAQDTKDKALDKADELTDQAKQKIDSLKADNK"
FT   misc_feature    complement(298730..298939)
FT                   /note="HMMPfam hit to PF02987, Late embryogenesis abundant
FT                   protein, score 2.6e-05"
FT   misc_feature    complement(299003..299212)
FT                   /note="HMMPfam hit to PF02987, Late embryogenesis abundant
FT                   protein, score 0.0004"
FT   misc_feature    complement(299225..299257)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    complement(299228..299317)
FT                   /note="Signal peptide predicted for PMI0250 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.671) with cleavage site
FT                   probability 0.639 between residues 36 and 37"
FT   CDS_pept        299567..300241
FT                   /transl_table=11
FT                   /locus_tag="PMI0251"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40695"
FT                   /db_xref="GOA:B4EUI7"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUI7"
FT                   /protein_id="CAR40695.1"
FT                   /translation="MEYYLLVVIKFIIGFTIILAHMNISGKTQLSQLTPIDFIGNFVLG
FT                   GIMGGVIYTDAIPLYQYVIVFLIGVFFISFLNYISKKFNFFRAVAIGNPIPIIKKGRFI
FT                   MENITEKKNKIDILNITSRLHAQGIHSFQEVNYAQIEPDGQITVVCDGAKMPSIIIMKD
FT                   GVIRTSELEQIERDENWLNEEMKKQHIDNPEDVFLAEFWDGKVNFILQDGKIKHDFIPT
FT                   AE"
FT   misc_feature    join(299576..299644,299663..299722,299735..299803)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PMI0251 by TMHMM2.0 at aa 4-26, 33-52 and 57-79"
FT   misc_feature    299822..300160
FT                   /note="HMMPfam hit to PF04239, Protein of unknown function
FT                   (DUF421), score 6.4e-21"
FT   CDS_pept        complement(300324..301241)
FT                   /transl_table=11
FT                   /gene="rnz"
FT                   /gene_synonym="elaC"
FT                   /locus_tag="PMI0252"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40697"
FT                   /db_xref="GOA:B4EUI8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUI8"
FT                   /protein_id="CAR40697.1"
FT                   /translation="MELTFLGTNAGVPSKDRNVTSMVLDLQNKQKSLWMFDCGEATQHQ
FT                   ILHSHVKLSRINKIFITHLHGDHIFGLPGLLCSRSMGGTENPLTIYGPTGIKAFIETAL
FT                   TLSQSYLTYPLDIIEIEQDGFLFEEEGIRASCGALSHPVPCFGYRLEEDNKPGKLNADK
FT                   LETENIPRGPWYKLLKQGKTVTLPDGRIIDGKDYLSTEIKGRCIVIFGDTQPTPNAVKL
FT                   AENADVIVHEATFKHDMADKANSRGHSSTIQAAELAKKANAKRLIITHISSRYSPKETP
FT                   ELLAECHTIFDNTQIASDFETFKL"
FT   misc_feature    complement(300498..301190)
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 1e-09"
FT   CDS_pept        301428..301544
FT                   /transl_table=11
FT                   /locus_tag="PMI0253"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40698"
FT                   /db_xref="GOA:B4EUI9"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUI9"
FT                   /protein_id="CAR40698.1"
FT                   /translation="MYLFLYKQNEWGIFLICLFFLIKFKVLIEKIKKVKFKL"
FT   misc_feature    301455..301508
FT                   /note="1 probable transmembrane helix predicted for PMI0253
FT                   by TMHMM2.0 at aa 10-27"
FT   repeat_region   302190..302211
FT                   /rpt_family="PMI.dna.520"
FT                   /note="Palindromic repeat found by REPuter:
FT                   ttaataaatatatatttaatta"
FT   repeat_region   302461..302476
FT   misc_feature    302482..309536
FT                   /note="fimbrial operon 1"
FT   CDS_pept        302482..303009
FT                   /transl_table=11
FT                   /locus_tag="PMI0254"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40699"
FT                   /db_xref="GOA:B4EUJ0"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUJ0"
FT                   /protein_id="CAR40699.1"
FT                   /translation="MKLKKLHLVLGLGLSIIAGSALAADQGHGTVEFYGSIIDAPCSID
FT                   PDSGAQRIPLGQVSSSALKDGGRSASKMFKIKLLQCSTETYKTVKTTFTGAEAPDVLEG
FT                   ALGIEGIAKNAAVVITNAGGEQIKLGQASAAQTLNDGNNDLNFAAYLQGSSSKAAIPGD
FT                   FTAIATFALSYQ"
FT   misc_feature    302482..302550
FT                   /note="Signal peptide predicted for PMI0254 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 23 and 24"
FT   misc_feature    302566..303006
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   3.5e-50"
FT   CDS_pept        303249..305876
FT                   /transl_table=11
FT                   /locus_tag="PMI0255"
FT                   /product="fimbrial outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40701"
FT                   /db_xref="GOA:B4EUJ1"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUJ1"
FT                   /protein_id="CAR40701.1"
FT                   /translation="MAKLFKTIDLNVKHKSKQCRGRSATTLIYFVIIGMASIASDSFAV
FT                   SKDIEFNSDILDLKDRGNIDLSSFSRAGYITPGKYELIININNNELSGTYRVDYIVPKD
FT                   DPKASEPCISPILVKQFALRPEWLKKLTWKDKGNCLNEASLPGMSLRTDLGSGVFFITL
FT                   PQAYLEYSSPNWESPSFWDEGIAGLLFDYNVNANVRAPSDGKQKQQITANGTAGANLGV
FT                   WRFRADWQASYEHTTGVLHSTENHWNWDQFYLYRAITKWGARLVMGETYLRSNLLDNFR
FT                   FTGISLLTDEQMLPPNLRGYAPEITGVAKTNAKVTVSQQGRIIYETQIAPGPFRIQDLH
FT                   DAVSGRLDVRIEEQDGTIQEYQIDTANIPYLTRPGRLQYKVSAGKPSRLDHKTEGPIFA
FT                   MGEFSWGVNNGWSLFGGTLVSKDYNSASLGFGRDLMMLGAISFDTTHSWATFANENKHY
FT                   HGSSYRISYSKRFESIDGQITFAGYRFSDRHFMSMDQYLDRRYRYGAQENNKELYTLTL
FT                   SKQFPQWGLSTYINYNHQRYWDRPNNDYYNFSLSKYLAIGKFKNINISLSAYRNRFNGN
FT                   HDNGVYFNINLPWRDRATISYNSVINKEGNSHNVSYFDRIDDNNNYRLSAGVSSRGKPS
FT                   ADGFFTHYGDVALVTASASHINGDYTSASLSFQGGATLTTKGGDFHRSNMPGATRLLID
FT                   TQGVSDVPVKSLSAISHTNIFGKAVIPDINHYYRGSASIDLKQLPDNVEALRSIHQLTL
FT                   TEGAIGYRQFDVIAGHKAMATVQLAEGGAPPFAATVTTLNGRELGVFNDGGKVYLSGIN
FT                   SGDVLYVHWDGKNQCQLSIPKLADTQLITSLLLTCFQRKPTISTSFLETDKTQALPQHS
FT                   FLSK"
FT   misc_feature    303249..303380
FT                   /note="Signal peptide predicted for PMI0255 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.901) with cleavage site
FT                   probability 0.595 between residues 44 and 45"
FT   misc_feature    303315..303383
FT                   /note="1 probable transmembrane helix predicted for PMI0255
FT                   by TMHMM2.0 at aa 23-45"
FT   misc_feature    303393..305750
FT                   /note="HMMPfam hit to PF00577, Fimbrial Usher protein,
FT                   score 0"
FT   CDS_pept        join(305925..306539,306543..306683)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PMI0256"
FT                   /product="fimbrial chaperone (pseudogene)"
FT                   /note="This CDS appears to have an in-frame stop codon."
FT                   /db_xref="PSEUDO:CAR40702.1"
FT   misc_feature    305925..306002
FT                   /note="Signal peptide predicted for PMI0256 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.988) with cleavage site
FT                   probability 0.538 between residues 26 and 27"
FT   misc_feature    305943..306011
FT                   /note="1 probable transmembrane helix predicted for PMI0256
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    306003..306362
FT                   /note="HMMPfam hit to PF00345, Gram-negative pili assembly
FT                   chaperone, score 8.6e-47"
FT   misc_feature    306231..306284
FT                   /note="PS00635 Gram-negative pili assembly chaperone
FT                   signature."
FT   CDS_pept        306695..307249
FT                   /transl_table=11
FT                   /locus_tag="PMI0257"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40705"
FT                   /db_xref="GOA:B4EUJ3"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUJ3"
FT                   /protein_id="CAR40705.1"
FT                   /translation="MKQQINKNSLVSILVLLSFFITTNVTAVTPVLSSTGLSQNSPITP
FT                   IYPIPINIKGYVIAHPPCMINEGKTVEVNFGDVLSTRVDGLNYKRLVDYHPSCEQMPIN
FT                   TLKLSVEGNGTFFDANALMTNITGLGIRILYQNKPLKLGQAINFTYPDFPVLEAVPVRD
FT                   FSTLLVGGDFSTTATLRMEYQ"
FT   misc_feature    306695..306775
FT                   /note="Signal peptide predicted for PMI0257 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.973 between residues 27 and 28"
FT   misc_feature    306719..306787
FT                   /note="1 probable transmembrane helix predicted for PMI0257
FT                   by TMHMM2.0 at aa 9-31"
FT   CDS_pept        307263..307781
FT                   /transl_table=11
FT                   /locus_tag="PMI0258"
FT                   /product="putative minor fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40707"
FT                   /db_xref="GOA:B4EUJ4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUJ4"
FT                   /protein_id="CAR40707.1"
FT                   /translation="MFNKQRIFFFITLLSSFSLMADETANKATITNSENNLRLFGTLFI
FT                   PPPCVIQNNDMIDVNFGHQLGTSRIDGINYTKTVNYTLQCEENANGWALGLSIIGSASQ
FT                   FDAAALQTNITDLAVHLTIDSEPFILNKRFVITSDKPPIILAVPVKKSGSTLTKGAFEA
FT                   TATLLAEYQ"
FT   misc_feature    307263..307325
FT                   /note="Signal peptide predicted for PMI0258 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.986 between residues 21 and 22"
FT   misc_feature    307738..307851
FT                   /note="Signal peptide predicted for PMI0259 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.512 between residues 38 and 39"
FT   CDS_pept        307792..308328
FT                   /transl_table=11
FT                   /locus_tag="PMI0259"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40711"
FT                   /db_xref="GOA:B4EUJ5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUJ5"
FT                   /protein_id="CAR40711.1"
FT                   /translation="MILQRLSLSTAIFATVIAMANADPNMRFHGELIDEPCVIKPGDEI
FT                   IVITLDKVTDSAFYNGVERTKSQQFEIHLSECDLSMNNKVSITFKGDENKAMAGKGFLA
FT                   LSPISRASGIAIGLEDSDGVLLPINQPSKNMALLSTNNTLRFSAFIQAEPTAIANQSIK
FT                   RGPFSAIATFHLNYD"
FT   misc_feature    307861..308325
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   1.1e-21"
FT   CDS_pept        308347..309195
FT                   /transl_table=11
FT                   /locus_tag="PMI0260"
FT                   /product="putative fimbrial adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40713"
FT                   /db_xref="GOA:B4EUJ6"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUJ6"
FT                   /protein_id="CAR40713.1"
FT                   /translation="MLIPNRQLIFYLFTSMLIYPASSIAAIFSYITESKPVGNEGTGAD
FT                   YTFIIQRWDPEPPTALNPCYKKKPCYITINHRHQPNQSGGSATRTILSDGHKYRRMEDL
FT                   RIAVMKELGGFPYGPGVAIHRYVDTSTIQECVGIFYQPNAYGFAEDGYLLPGSICAIAP
FT                   PPVGHCDVLAHSVELDYGNVGENELDNAVRSQTVNVTCNRDVSLQVVATGMNNRQVPLR
FT                   NDNSLYADLYINDKSGEEGEAIFVAKGKMVSIQVSSKLRTNGHVAPGYFSGSGALILTL
FT                   P"
FT   misc_feature    308347..308421
FT                   /note="Signal peptide predicted for PMI0260 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.980) with cleavage site
FT                   probability 0.977 between residues 25 and 26"
FT   misc_feature    308371..308439
FT                   /note="1 probable transmembrane helix predicted for PMI0260
FT                   by TMHMM2.0 at aa 9-31"
FT   CDS_pept        309216..309536
FT                   /transl_table=11
FT                   /locus_tag="PMI0261"
FT                   /product="fimbrial operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40714"
FT                   /db_xref="GOA:B4EUJ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUJ7"
FT                   /protein_id="CAR40714.1"
FT                   /translation="MVKYRRANIDVNALVGKRIQKRRKELGYTGSQLAAKLGVSQQQFS
FT                   RYERGLNKIDLTYLVLLAKFLNTPIYWFFEDCITSTSVKSGKPLSRRSNLLAKKALDAF
FT                   LY"
FT   misc_feature    309270..309434
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   2.9e-16"
FT   misc_feature    309297..309362
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1977.000, SD 5.92 at aa 28-49, sequence
FT                   YTGSQLAAKLGVSQQQFSRYER"
FT   CDS_pept        complement(310101..310667)
FT                   /transl_table=11
FT                   /gene="mrpI"
FT                   /locus_tag="PMI0262"
FT                   /product="fimbriae recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40716"
FT                   /db_xref="GOA:B4EUJ8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUJ8"
FT                   /protein_id="CAR40716.1"
FT                   /translation="MKQRKFLTRFEVNAILKQAKEGRYPERDYCMFLMCFLHGFRVSEL
FT                   CNLTLSDIDLESRILYVRRLKGGLSTTQPIIDEEYEALCNWLKSRENWRESDSEWVFLS
FT                   QKTGPISRQQVYGLLRRLGKKANVSISPHPHMLRHACGYALADLGRDTRLIQDYLGHRN
FT                   ISHTVIYTASNSKRFINMWETRNSQ"
FT   misc_feature    complement(310128..310649)
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 6.8e-44"
FT   repeat_region   310896..310916
FT   regulatory      310917..311167
FT                   /note="invertible mrp promoter"
FT                   /regulatory_class="promoter"
FT   misc_feature    311000..311011
FT   repeat_region   complement(311168..311188)
FT   repeat_region   311323..311338
FT   misc_feature    311346..318873
FT                   /note="fimbrial operon 2 (MR/P fimbrial operon)"
FT   CDS_pept        311346..311873
FT                   /transl_table=11
FT                   /gene="mrpA"
FT                   /locus_tag="PMI0263"
FT                   /product="major mannose-resistant/Proteus-like fimbrial
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40720"
FT                   /db_xref="GOA:Q03011"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03011"
FT                   /protein_id="CAR40720.1"
FT                   /translation="MKLNKLALVLGLGLSVVAGSALAADQGHGTVKFVGSIIDAPCSIT
FT                   PDTENQTVPLGQISTAALKDGGRSNSRDFKISLENCTTETYKTVQTTFTGSEATEVLEG
FT                   SLGIEGIAKNAAVVITDAGGKQIKLGTPSAAQNLRDGNNDLNFAAYLQGSASEAAVPGD
FT                   FTAIATFALTYQ"
FT   misc_feature    311346..311414
FT                   /note="Signal peptide predicted for PMI0263 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 23 and 24"
FT   misc_feature    311361..311417
FT                   /note="1 probable transmembrane helix predicted for PMI0263
FT                   by TMHMM2.0 at aa 35-53"
FT   misc_feature    311430..311870
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   1.2e-59"
FT   CDS_pept        311959..312519
FT                   /transl_table=11
FT                   /gene="mrpB"
FT                   /locus_tag="PMI0264"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40722"
FT                   /db_xref="GOA:B4EUK0"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUK0"
FT                   /protein_id="CAR40722.1"
FT                   /translation="MNRKMAPLLLCLVASLVTAPTIASDVKQDKNMHQRFGWLNLQGTI
FT                   LEPSCAISAGSSDQVIPLTTVSIPTLVTEGQGPIEYFSIRLTDCTLISQKGQEADNPRF
FT                   IATFDGPSNGNGNFELSGEAKGASLAIADRYGRQAIPGQPLPPVGIDSQSMALLYQARI
FT                   VKNNDTPKAGNYRTTLRFKLEYY"
FT   misc_feature    311959..312027
FT                   /note="Signal peptide predicted for PMI0264 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.968 between residues 23 and 24"
FT   misc_feature    312067..312516
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   1.7e-13"
FT   CDS_pept        312542..315157
FT                   /transl_table=11
FT                   /gene="mrpC"
FT                   /locus_tag="PMI0265"
FT                   /product="fimbrial outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40726"
FT                   /db_xref="GOA:B4EUK1"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUK1"
FT                   /protein_id="CAR40726.1"
FT                   /translation="MVRSFKTVCLEKREKRKKHAIRPVAILIYLIVTGASSLSNSALAN
FT                   SDIEFNADILDLKDKQNIDLSDFSRAGYIMPGRYEFVVRINNNELPDIYNINYVVPADD
FT                   PKGSEPCLPPELVRQLGLKPEWLDKIRFNDNQTCLDTSSIPGMTINASLGSGNLLLTIP
FT                   QAYLEYSAPNWDPPSRWDDGISGILFDYNVNANVTDPAKGKQRQQVTGLGTLGANLGAW
FT                   RFRADWQASYQHTTGIPQSTENSWKWNQYYLYRAIPQWEARFVMGETYSRSDIFDSFRF
FT                   TGVHLATDDNMLPPNLRGYAPEVTGVAKTNAKVTISQQGRVIYETQVAPGPFRIQDIND
FT                   AVSGKLDVRVEEQDGSVQEFQMDTASIPYLTRPGRVQYKFSAGKPSNIDHNTEGPVFGM
FT                   GEFSWGVSNGWSLYGGSIVAGDYNALSAGIGRDLMAFGALSFDATHSWAKIPRDDKRYN
FT                   GGSYRLSYSKRFEAINSQVTFAGYRFSERDFMTMDQYLERRYRDGNADNNKELYTIMFS
FT                   KQFPDWGLSTYLNYSHQTYWNKPTNDNYNLSLAKSADIGRFKNINFSLSAFRNKFNGTN
FT                   DNGVYMNVSMPWGDRATISYNTVINKSGNSHNVSYYDRIDDNSSYRVGAGVSSNGKPSA
FT                   DAYFMHYADAALVTASASHINGEYTSATLSLQGGATLTPKGGALHRVSRTGSTRLLIDT
FT                   DGIANIPVKNFGAISHTNMFGKAVLPDINDYYRSSASIDLNRLPENVEALRSIQQLTLT
FT                   EGAIGYRRFDVIEGQKAMAVIRLKDGTFPPFGASVTTEKGRELGIINDGGNVYLTGINT
FT                   GDVLSVRWSGKEQCKVLIPTLVENVQISSLLLTCSDDGTATSTFNQREVSLPKTKFLSR
FT                   "
FT   misc_feature    312542..312673
FT                   /note="Signal peptide predicted for PMI0265 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.943 between residues 44 and 45"
FT   misc_feature    312602..312670
FT                   /note="1 probable transmembrane helix predicted for PMI0265
FT                   by TMHMM2.0 at aa 21-43"
FT   misc_feature    312683..315040
FT                   /note="HMMPfam hit to PF00577, Fimbrial Usher protein,
FT                   score 0"
FT   misc_feature    313523..313555
FT                   /note="PS01151 Fimbrial biogenesis outer membrane usher
FT                   protein signature."
FT   CDS_pept        315213..315971
FT                   /transl_table=11
FT                   /gene="mrpD"
FT                   /locus_tag="PMI0266"
FT                   /product="fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40727"
FT                   /db_xref="GOA:B4EUK2"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUK2"
FT                   /protein_id="CAR40727.1"
FT                   /translation="MMLLKRSCIVATTLLMGMAFTHQAVAAIALDRTRVIFNGAEKSIS
FT                   LNVSNQNKDLPYLAQGWMENENGERIESPLIVLPPIQRIEPGDKSQIKVQSLPDIAKLP
FT                   QDRESVFYFNLREIPPRSNKPNVLQIALQTRIKLFYRPASIYASQTDLTNPWQEQITLT
FT                   KKGDRFEVNNPTPYYVTLVDGLTSLKGKSLDGFEPLMIAPKSSGTINLSASMFGASPVL
FT                   SYINDYGGRPQMKFTCSGNQCKVTETAAGN"
FT   misc_feature    315213..315290
FT                   /note="Signal peptide predicted for PMI0266 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.987 between residues 26 and 27"
FT   misc_feature    315231..315299
FT                   /note="1 probable transmembrane helix predicted for PMI0266
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    315291..315650
FT                   /note="HMMPfam hit to PF00345, Gram-negative pili assembly
FT                   chaperone, score 3.8e-46"
FT   misc_feature    315519..315572
FT                   /note="PS00635 Gram-negative pili assembly chaperone
FT                   signature."
FT   misc_feature    315672..315920
FT                   /note="HMMPfam hit to PF02753, Gram-negative pili assembly
FT                   chaperone, score 1.2e-09"
FT   CDS_pept        315985..316530
FT                   /transl_table=11
FT                   /gene="mrpE"
FT                   /locus_tag="PMI0267"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40729"
FT                   /db_xref="GOA:B4EUK3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR005430"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUK3"
FT                   /protein_id="CAR40729.1"
FT                   /translation="MVMEQWFSPSKAVLVFILATFTGGLSSTAVANLPAGAVIRATPGI
FT                   VYINITGNVIAPPPCLINDGKMIEVNFGEVMSTRINDSNYKQPIEYTATCQKRPTNAMK
FT                   VYITGNATGFDSNALQTNITGLGVRILYQGKLLGLGSAVKFTYPNLPKLEAIPVRDNRE
FT                   TLVGGDFVANATLHVDYQ"
FT   misc_feature    315985..316077
FT                   /note="Signal peptide predicted for PMI0267 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991) with cleavage site
FT                   probability 0.859 between residues 31 and 32"
FT   misc_feature    316021..316089
FT                   /note="1 probable transmembrane helix predicted for PMI0267
FT                   by TMHMM2.0 at aa 13-35"
FT   misc_feature    316120..316527
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   0.00019"
FT   CDS_pept        316543..317028
FT                   /transl_table=11
FT                   /gene="mrpF"
FT                   /locus_tag="PMI0268"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40730"
FT                   /db_xref="GOA:B4EUK4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUK4"
FT                   /protein_id="CAR40730.1"
FT                   /translation="MNKLQSICLIILLNSTAVMAADSPNLKLFGTLLVPPPCVISNDER
FT                   IEVFFGKNVGINKVDGINYTESVNYTLVCDANLKGWDLGLSIIGPKTQFDEAALQTNIP
FT                   DLGIHLTQDGKPFKLNERIAISPDSPPVIQAVPVKRPGSTLPEGAFEVSATLLAEYQ"
FT   misc_feature    316543..316602
FT                   /note="Signal peptide predicted for PMI0268 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 20 and 21"
FT   CDS_pept        317039..317587
FT                   /transl_table=11
FT                   /gene="mrpG"
FT                   /locus_tag="PMI0269"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40733"
FT                   /db_xref="GOA:B4EUK5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUK5"
FT                   /protein_id="CAR40733.1"
FT                   /translation="MKIKTLSIRFILGLSVSIGLTSAAFAIPDNLYFHGILVDEPCTIK
FT                   PGDETVVLDFGNIPDKNLYAYKRTPSKLFQLRLSECDLSIGKSVKITFKGEENQAMAGE
FT                   GFLAISPGSQASGIAVGLESENGNALPINKETDKMSLTAGDTILNFYAFIQGEPDAIAN
FT                   KSIKRGPFSAIATFYLNYD"
FT   misc_feature    317039..317116
FT                   /note="Signal peptide predicted for PMI0269 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.993 between residues 26 and 27"
FT   misc_feature    317054..317122
FT                   /note="1 probable transmembrane helix predicted for PMI0269
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    317126..317584
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   1e-17"
FT   CDS_pept        317609..318436
FT                   /transl_table=11
FT                   /gene="mrpH"
FT                   /locus_tag="PMI0270"
FT                   /product="fimbrial adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40737"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUK6"
FT                   /protein_id="CAR40737.1"
FT                   /translation="MFIFKRFPAIFILIAGLFSAPAMASIFSYITESTGTPSNATYTYV
FT                   IERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVL
FT                   KNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPPVGACK
FT                   ISEGAVNLNYGDIDEASLSGAKRSETINVTCNLAMKVLVIASGSDSGRVPLRADKSLYA
FT                   DLYLNNYPGEKGVTVNVPAGGSAPVSVSSTLRTNGRVAPGRFSGSGSIILTMP"
FT   misc_feature    317609..317680
FT                   /note="Signal peptide predicted for PMI0270 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 24 and 25"
FT   misc_feature    317633..317701
FT                   /note="1 probable transmembrane helix predicted for PMI0270
FT                   by TMHMM2.0 at aa 13-35"
FT   CDS_pept        318461..318781
FT                   /transl_table=11
FT                   /gene="mrpJ"
FT                   /locus_tag="PMI0271"
FT                   /product="fimbrial operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40739"
FT                   /db_xref="GOA:B4EUK7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUK7"
FT                   /protein_id="CAR40739.1"
FT                   /translation="MMNFDFANIDVNASVGKKIQKKRKELGYTGMQLAKKIGVSQQQFS
FT                   RYERGMNKIDLRHLVLLALYLNTPIYWFFEDCYVKKPSLNNKGIDKRNYVIAQATPDAF
FT                   HY"
FT   misc_feature    318515..318679
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   3.4e-14"
FT   misc_feature    318542..318607
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1835.000, SD 5.44 at aa 32-53, sequence
FT                   YTGMQLAKKIGVSQQQFSRYER"
FT   CDS_pept        319405..320979
FT                   /transl_table=11
FT                   /gene="mtrF"
FT                   /locus_tag="PMI0272"
FT                   /product="putative efflux pump component"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40740"
FT                   /db_xref="GOA:B4EUK8"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="InterPro:IPR011540"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUK8"
FT                   /protein_id="CAR40740.1"
FT                   /translation="MQTKKQGGSRFLRTVEWLGNALPHPVILFIILIAILLVSSAVGEY
FT                   FGVTVQDPRPEGAKGRAEDGYIHIISLLDADGIRRILANIVTNFTGFAPLGTVLVALLG
FT                   VGIAERAGLLSAVMRLVVMKAPRKMTTLAIVFAGIMSNTAAELGYVVLIPLSAIIFHSL
FT                   GRHPLAGIAAAFAGVSGGYSANLLLGTIDPLLSGITQQAARIIDPSYIVGAEANWYFMF
FT                   VSTFLITFLGYIITEKIVEPQLGPYNGNELDDEETDLKNAAQVTPLEKKALWAATGTFI
FT                   VMAIILAFTVVPENGILRNQETGLIGNSPFLKSIVVFIFLFFAIPGIVYGWIAKTMRSD
FT                   KDIVDAMANSMSTLGLYLVIIFFAAQFVAFFGWTNIGQVIAVKGAALLNSIDMPSGLLF
FT                   LGFILICAFINLMIGSASAQWAVTAPIFVPMLMLAGYAPETIQAAYRIGDSVTNIITPM
FT                   MSYFGLILAVATKYKKDTGIGTMISMMLPYSIIFLIGWSLLFYLWVFVFHLPVGPGSPI
FT                   YYSPHAG"
FT   misc_feature    319432..320961
FT                   /note="HMMPfam hit to PF03806, AbgT putative transporter
FT                   family, score 0"
FT   misc_feature    join(319465..319533,319678..319746,319795..319863,
FT                   320056..320109,320218..320277,320335..320403,
FT                   320464..320532,320575..320643,320662..320715,
FT                   320743..320811,320872..320940)
FT                   /note="11 probable transmembrane helices predicted for
FT                   PMI0272 by TMHMM2.0 at aa 21-43, 92-114, 131-153, 218-235,
FT                   272-291, 311-333, 354-376, 391-413, 420-437, 447-469 and
FT                   490-512"
FT   misc_feature    320500..320529
FT                   /note="PS00019 Actinin-type actin-binding domain signature
FT                   1."
FT   CDS_pept        complement(321019..321402)
FT                   /transl_table=11
FT                   /locus_tag="PMI0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40742"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUK9"
FT                   /protein_id="CAR40742.1"
FT                   /translation="MSILDEWAERHIEKALKNGELSSLPGEGKPLVLDDNSHVPESLRT
FT                   SYHLLKNAGFLPPEMQDRKDALSLAEILSSLSETGIKDEQLQKKLTLLELKLQQAGMDT
FT                   QFLHTDYATQLTEKLATHKDKHK"
FT   CDS_pept        321534..321872
FT                   /transl_table=11
FT                   /locus_tag="PMI0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40744"
FT                   /db_xref="GOA:B4EUL0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUL0"
FT                   /protein_id="CAR40744.1"
FT                   /translation="MSKYQEIVTDISGNMGALSKNIPEVMKSFMSTTKASSKDGVLDAK
FT                   TKELIAIAIAVANRCDGCIGFHTKTLVELGTTEQELAEALGVAIYMGGGPSVMYASNTM
FT                   GAFKEFSQ"
FT   misc_feature    321600..321851
FT                   /note="HMMPfam hit to PF02627, Carboxymuconolactone
FT                   decarboxylase family, score 1.3e-24"
FT   CDS_pept        322226..323872
FT                   /transl_table=11
FT                   /gene="arnT"
FT                   /locus_tag="PMI0275"
FT                   /product="putative undecaprenyl
FT                   phosphate-alpha-4-amino-4-deoxy-l-arabinose arabinosyl
FT                   transferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40745"
FT                   /db_xref="GOA:B4EUL1"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR022839"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUL1"
FT                   /protein_id="CAR40745.1"
FT                   /translation="MNIAMTERYKWLLFFLFILLTYFIPLETRLLWQPDEIRYAEISRE
FT                   MLVSGNWSVPYLLDIRYFEKPVLGYWINCIAQWLFGESHFAVRIVVVTSTLLTGWLIYK
FT                   AAMVVWRNSALAFNAMTVFLSSFLVLAIGTYNILDPIVTLFVTAAMYSFLVALSTPNKK
FT                   GKIIAYMGIGFFCALGFLTKGFIAVVLPALVFLVMAISQARFKEVVCYSSIALLALAIT
FT                   AGPWVITVALQAPDYWNYFFWVEHVQRFIAKESARSQPTWFYIPIVILGVLPWLGFLFG
FT                   ALKSAFSLKKGTLYFLLWFTLFFAFFSASKGKLLTYMLPCFVPLSILIAHYIEELKDRP
FT                   DEKISKVNASINIAFGLMGISAVIYSLYSAKFALYDTNETLKIVLAISGFLFWSVIGAG
FT                   ALFRQTQFLTMFCSIGLSLVIGYAIPEKIESRSTPENIIQRYYEPLSNKSYLLTDEVGI
FT                   GTSLAWGLKRTDIRLTETKGELAYGLNYPDVKNKYYSLEQLLALIEANQYKGVAIVLVR
FT                   PDRKQILTKLTTLKEKPIVEKEGDLTLVFFN"
FT   misc_feature    322256..322948
FT                   /note="HMMPfam hit to PF02366,
FT                   Dolichyl-phosphate-mannose-protein mannosylt, score
FT                   3.2e-28"
FT   misc_feature    join(322259..322318,322475..322534,322568..322636,
FT                   322646..322699,322736..322804,322847..322915,
FT                   323003..323071,323099..323152,323165..323224,
FT                   323267..323335,323372..323431,323444..323497)
FT                   /note="12 probable transmembrane helices predicted for
FT                   PMI0275 by TMHMM2.0 at aa 12-31, 84-103, 115-137, 141-158,
FT                   171-193, 208-230, 260-282, 292-309, 314-333, 348-370,
FT                   383-402 and 407-424"
FT   CDS_pept        complement(324361..325713)
FT                   /transl_table=11
FT                   /gene="zapD"
FT                   /locus_tag="PMI0276"
FT                   /product="type I secretion outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40747"
FT                   /db_xref="GOA:B4EUL2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUL2"
FT                   /protein_id="CAR40747.1"
FT                   /translation="MMLIKKLFTLFSVGLLSLPASAVTLSDLYFLAIKHDPTFNAAVKE
FT                   QVAGKEYENIGLSQLLPNISVNYKNNPRNWQRKAYPINIFQDKITTVEYQNYQSYSVNA
FT                   IISQPLFDYTAFSEYKASIIKTLLADSHYQNKFSELIIRLIDNYIQVAYTQDKLLLNQA
FT                   QQEIYQKQLASSQRLFELGEGTKTDIAEIETRLYLTQSQYTDLQLEIEKAKNKLSAMIG
FT                   SQLPTHEHIAKLTDTKFVLQSLAPDDYSTWEKNAIQNNLKIQSARHEMAIAKQEIEKNR
FT                   GEFFPTVQFYAAYSSSNSDSNNTINQKYQSANVGFYVSMPLFNGGKTTASMRQSTAKYQ
FT                   MSAFERDAIIQNIMQELRYQYQICSTSHIKLMAFEQAVSSAKLQLNATRKSYIGGQRTM
FT                   VDVLNAEELLYRAQQDLIKAKYDYIQAWALLHQYTNTLDIEKIKIIENYFQ"
FT   misc_feature    complement(324409..324969)
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 1.9e-58"
FT   misc_feature    complement(325048..325641)
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 2.9e-44"
FT   misc_feature    complement(325627..325695)
FT                   /note="1 probable transmembrane helix predicted for PMI0276
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    complement(325648..325713)
FT                   /note="Signal peptide predicted for PMI0276 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.994 between residues 22 and 23"
FT   CDS_pept        complement(325713..327038)
FT                   /transl_table=11
FT                   /gene="zapC"
FT                   /locus_tag="PMI0277"
FT                   /product="type I secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40750"
FT                   /db_xref="GOA:B4EUL3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUL3"
FT                   /protein_id="CAR40750.1"
FT                   /translation="MTIEKNVIPLSEKISDDPKKFLVIGWTVVLLGLAIFIFWAAFAPL
FT                   DKGVPAIGNVVISGNKKSVQSSVEGIITHIFVKNGDPVSAGQTLIQLSPIQSQALVKSL
FT                   SEQYDNLLITQQRLYAELNQQTSFKLNNSDKYYSSTENREKLLLQQNRLLNEKSAELIS
FT                   EINGYKAAIDGITGRLTHLKRSIQNKKSQISNLQNQLNDLQILANEGYIPRHRYQEMVR
FT                   ELAENNNQLNETFGQISALEKQKLEYEQRILQRNANFHQLARTELNKIQLQISETEKQL
FT                   IIETDKLAKMAIIAPISGTVMDLSVFTQGGFVKTGQTLMDIVPEDHQLVIEARLAPHLI
FT                   DKVTPGLPVDLIFSAFNQNTTPKIPGEVTIISADRLIDERTTEPYYQVLINIKDYTLLA
FT                   DNKNKLKAGMPVDVFIKTGDRSLLNYLFKPVLDRLHTSLTEE"
FT   misc_feature    complement(325758..325826)
FT                   /note="PS00543 HlyD family secretion proteins signature."
FT   misc_feature    complement(325926..326861)
FT                   /note="HMMPfam hit to PF00529, HlyD family secretion
FT                   protein, score 2.3e-84"
FT   misc_feature    complement(326910..326978)
FT                   /note="1 probable transmembrane helix predicted for PMI0277
FT                   by TMHMM2.0 at aa 23-45"
FT   CDS_pept        complement(327055..328794)
FT                   /transl_table=11
FT                   /gene="zapB"
FT                   /locus_tag="PMI0278"
FT                   /product="Type I secretion ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40751"
FT                   /db_xref="GOA:B4EUL4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUL4"
FT                   /protein_id="CAR40751.1"
FT                   /translation="MPQIKYNNEITSIIKERRKVFLSIGLFTALINILMLVPSIYMLQV
FT                   YDRVLPSGNEMTLLMLTIIMLALFIFMGGLEYLRSIIVIRMSNKLDLSLNSRIYTAAYR
FT                   EKLNKIANINPTLALTDLITLRQFITSHAIFTFFDLPWFPIYLLVITLFNPWLGLFALC
FT                   GALILFALAILNEYLSKNHLKKANNFANQAQLIQSHHLEHPQTIEAMGMLSQLRKQWQT
FT                   SHFKYLQAQTQASDNAAGINAITKVTRMALQSLMLGLGGWLAIDNTISPGMMIAGSILL
FT                   GRALAPIEQVINVWKSWDSSKAAYNRLTTLLKTYPQENKKMALPKPQGQLLVNIDEAVY
FT                   PHSDRILLNNINFALLPGDILGIIGPSASGKSSLAKFIVGIWQVKKGIVRLDNADIFQW
FT                   SKEEIGPHIGYLPQEIALFPGTIAENIARFTEVDPQKVIQAAKMAHVHEMILRFPQGYE
FT                   TQIGAHGEGLSGGQKQRIALARALYGDPTLVVLDEPNSNLDDLGIRALTQAIETLKQHK
FT                   KTVILITHQKQLLSVTNKLLVIFDGNTKLFGPTASVIAELNNPTITKTANTISSTPATS
FT                   NNA"
FT   misc_feature    complement(327169..327723)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.2e-54"
FT   misc_feature    complement(327349..327393)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(327679..327702)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(327931..328692)
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 0.015"
FT   misc_feature    complement(join(327964..328032,328261..328329,
FT                   328345..328413,328561..328629))
FT                   /note="4 probable transmembrane helices predicted for
FT                   PMI0278 by TMHMM2.0 at aa 22-44, 94-116, 122-144 and
FT                   221-243"
FT   CDS_pept        complement(328957..330432)
FT                   /transl_table=11
FT                   /gene="zapA"
FT                   /locus_tag="PMI0279"
FT                   /product="metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40753"
FT                   /db_xref="GOA:B4EUL5"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="InterPro:IPR016294"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034033"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUL5"
FT                   /protein_id="CAR40753.1"
FT                   /translation="MGSFLLKKAVGLSNISDLLDKSGIFYNYSTKVLPSFDYDTAGKHI
FT                   AREDSTWNGKYVIGQPAEVTYSFPKWEGKFNQFGNKNPYEFNELQKEHARKSLDAWSDI
FT                   ANIKFTEVAVGNVDGMKASDVKTDITFGNIYDPNGTFQAYATLPNTYAYGKDLSGQAWF
FT                   SDYHYAGNTTPELGNYGRLTIIHEIGHTLGLMHPGDYNAGQNVPGYLKSDYAEDSRQYT
FT                   VMSYWDEYETGAHFQGAYAGAPLLHDISAMQYLYGANTTTRTGDDVYGFNSNTGIDYYT
FT                   ATDSNDKLIFSVWDSGGNDTFDFSGFYQDQLIDLRAGNFSDVGGLQKNVSIAQNVTIEN
FT                   AIGGFGNDIIHGNDADNTLIGGEGDDIIYGHSGNNTIYGGRGQDTLHGGTGSNTFIYKE
FT                   IADSLVSAADKIMDFKTGIDKIDLSTLIQDTFSSKILNFVDNFTGNAGEATLSYNEVTN
FT                   ASELAINAYGYNYNPDFKIDIVGFVNYETDFIV"
FT   misc_feature    complement(329248..329301)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.0034"
FT   misc_feature    complement(329302..329355)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 6.5e-05"
FT   misc_feature    complement(329356..329409)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.0043"
FT   misc_feature    complement(329662..330225)
FT                   /note="HMMPfam hit to PF00413, Matrixin, score 0.00032"
FT   misc_feature    complement(329857..329886)
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT   repeat_region   complement(330758..330883)
FT                   /note="(tgtttga)18"
FT   CDS_pept        complement(331042..333105)
FT                   /transl_table=11
FT                   /gene="zapE"
FT                   /locus_tag="PMI0281"
FT                   /product="putative metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40757"
FT                   /db_xref="GOA:B4EUL6"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR003995"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR034033"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUL6"
FT                   /protein_id="CAR40757.1"
FT                   /translation="MNSFNSIKKPTYFYLPDGKIVINYMYGWPKQPHSNITKITYIFPD
FT                   YDKKRNYSNKKYSVTEKDRIESIKHTAKVYELTYLKEKKEKEIASLKYYRNKYSISKIA
FT                   ELEKDIEDIENSINKNKNSIHPYFYNTQTTIYPHQQEVISDILNEIAYITQAKFVASNP
FT                   EFDADIKFGFYDDFHISHGSIEFSYTTRGFATYPSRYSTPIKKINIDEQYQYSGTIFLN
FT                   LSSHQYYKIIHQNDLDNYIKTEGNIGDAFNFKDNGTVLIIKKTNTLIETLKNNKYQPGT
FT                   YHYKVVLHEVGHALGLSHSWQYLEYKDKNHVLASLKYSVMGYDIPTSEHADFGGLYPMT
FT                   FMLLDILLLQQLYGENMTTRLENNIYGFHSNTGRVAYSLKSIEDKLVSCIWDSGGIDTL
FT                   DFSLYTVNQVINLNEGSFSDIGGLRSNISIAYKTIIENAIGGSGHDTIIGNSANNELIG
FT                   GDGNDTIKGGLGNDHLYGGMGNDILYGDIGNDYLYGGIGDDILHGGMGNDILHGSMGND
FT                   YLYGNKGNDKLFGGDGDDTLVDYYGNNTFIGGKGNDLLFSISKAGRNELQGGEGNDIFY
FT                   CGLGTNLLYGEQGNDTFNFLCYKGAKSYNLIFDFNTNEDKIIFVDQNYKKIDISKMKRV
FT                   EQLSGNENEIVLHNDIHTNKTTITISTANNDHHSTIFIKLEGILSYNDLLDI"
FT   misc_feature    complement(331327..331380)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.019"
FT   misc_feature    complement(331381..331434)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.059"
FT   misc_feature    complement(331468..331521)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.07"
FT   misc_feature    complement(331501..331557)
FT                   /note="PS00330 Hemolysin-type calcium-binding region
FT                   signature."
FT   misc_feature    complement(331522..331575)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 8.1e-05"
FT   misc_feature    complement(331576..331629)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.0012"
FT   misc_feature    complement(331582..331638)
FT                   /note="PS00330 Hemolysin-type calcium-binding region
FT                   signature."
FT   misc_feature    complement(331630..331683)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.0011"
FT   misc_feature    complement(331663..331719)
FT                   /note="PS00330 Hemolysin-type calcium-binding region
FT                   signature."
FT   misc_feature    complement(331684..331737)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.00056"
FT   misc_feature    complement(331738..331791)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.0087"
FT   misc_feature    complement(332221..332250)
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT   CDS_pept        complement(333336..335300)
FT                   /transl_table=11
FT                   /locus_tag="PMI0282"
FT                   /product="putative metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40761"
FT                   /db_xref="GOA:B4EUL7"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUL7"
FT                   /protein_id="CAR40761.1"
FT                   /translation="MTIVKNVKETTNFYLPKGIITTGTMIGWPKKSPNEITTITYTFPD
FT                   HNTYREIIKNKNPLTENMRKKTLKDIYEYYRLVNIREQKKQELNTIEDKDSEASKKRIK
FT                   ELEEGIKKIANDIYTILDNIPIYIYSTQETIFPHQQKVIEEILQHTSDIVPIFFKKISP
FT                   YTNADLKFGYYNQFVNISGTKFISGYRKGSASHPNEEGTPIKEIKPDEEHDDPGTIFID
FT                   FSSREYYKTIKQDNIDEYIENEADIYDIYYINNDKTITIARGNNELRKEYQQNKHKIGS
FT                   FVYHTFIHELGHSLGLFHIWEYILNEKHKVLDSIKYSVMSYKCPDIKDADFGGLYPMTF
FT                   MLVDILLLQYLYGENMTTRLENNTYGFNSNTGRAAYSLNSIEDKLVSCIWDAGGIDTLD
FT                   FSLYTVNQVINLNEGCFSDIGGLRSNISIAYKTIIENAIGGKGDDTLIGNPFDNNLIGG
FT                   DGNDLFYGGDGNDLFYGGSGNDVIYGELGNDVLYGDDGDDMLIDYYGANMLDGGKGNDR
FT                   ICVASTDRGLPGRNIILGGEGDDEIYLGTGTHRITGGQGNDAFNFFCYEGVESNSSIWD
FT                   FEKNKDKITLITRDYRKIDISKMKKVDKLSGSKNEFSLNYNKPANKTIIDVSTSSNDNK
FT                   SIVHIEIVGIFNHDELFAV"
FT   misc_feature    complement(333621..333674)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 4.2"
FT   misc_feature    complement(333675..333728)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.049"
FT   misc_feature    complement(333747..333800)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 4.7"
FT   misc_feature    complement(333828..333881)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 7.7e-06"
FT   misc_feature    complement(333882..333935)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.0016"
FT   misc_feature    complement(333936..333989)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.21"
FT   misc_feature    complement(334416..334445)
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT   CDS_pept        complement(335607..337571)
FT                   /transl_table=11
FT                   /locus_tag="PMI0283"
FT                   /product="putative metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40763"
FT                   /db_xref="GOA:B4EUL8"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003995"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUL8"
FT                   /protein_id="CAR40763.1"
FT                   /translation="MKLIKNTKKPTFFYLLDGVISTGAISGWPKNSIDGTTHLTYTFPN
FT                   YSERSENIRNKHPITESQKKEALKELAEYYKLDYEIEKMKKELKAIEDKDSEGFQKRIE
FT                   EINQDIKSKSERSGQIIKNIPLYFLATPMTIFPHQQEVITEILQLASDFADLTFTRVPI
FT                   QKNANLKFGYFNHFYKDSTTFFMTRGNGGFAQYPNYNGTPIKEIGPNEDYDIPGTIFIN
FT                   LATHEFYKWENGDNIDKYIENEANPGDLYNYHDNNQVAIIKSTDVLLNETMKSKHKLGS
FT                   YEYLCFIHELGHALGLMHINVYLKNIKNDVILTYKYSVMAYQFADIKDADFAGLYPMTF
FT                   MLVDILLLQYLYGPNMTTRLENNTYGFHSNTGRAAYSLNSIEDKLVSCIWDAGGIDTLD
FT                   FSLYTVNQVINLNEGCFSDIGGLRSNISIAYKTIIENAIGGKGDDTLIGNPFDNNLIGG
FT                   DGNDLFYGGDGNDLFYGGSGNDVIYGELGNDVLYGDDGDDMLIDYYGANMLDGGKGNDR
FT                   ICVASTDRGLPGRNIILGGEGDDEIYLGTGTHRITGGQGNDTFNFFCYESVESNSFIWD
FT                   FEKNKDKITLITRDYRKIDITKMKKVDKLSGSKNEFSLNYNKPANKTIIDVSTSSNDDN
FT                   TIVHIEIVGIFNHDELFAI"
FT   misc_feature    complement(335892..335945)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 1.4"
FT   misc_feature    complement(335946..335999)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.049"
FT   misc_feature    complement(336018..336071)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 4.7"
FT   misc_feature    complement(336099..336152)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 7.7e-06"
FT   misc_feature    complement(336153..336206)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.0016"
FT   misc_feature    complement(336207..336260)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.21"
FT   CDS_pept        337728..338144
FT                   /transl_table=11
FT                   /locus_tag="PMI0284"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches."
FT                   /note="Dpubtful CDS."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40764"
FT                   /db_xref="GOA:B4EUL9"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUL9"
FT                   /protein_id="CAR40764.1"
FT                   /translation="MCLYYWQHDVLLFLIKKVPQYYYSAFSIFSVTEFFGLNNLFFIII
FT                   RRYISYLCDITMWLFSSTIHIIYNYFTIRQIEVSCFFIELKLFILNSFYQKRMFYISYF
FT                   YNDRSIYRNKCYKNILFISYIFSWLLLMFIRILC"
FT   misc_feature    join(337785..337853,337872..337931,337941..338009,
FT                   338070..338138)
FT                   /note="4 probable transmembrane helices predicted for
FT                   PMI0284 by TMHMM2.0 at aa 20-42, 49-68, 72-94 and 115-137"
FT   CDS_pept        complement(338218..340167)
FT                   /transl_table=11
FT                   /locus_tag="PMI0285"
FT                   /product="putative metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40769"
FT                   /db_xref="GOA:B4EUM0"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUM0"
FT                   /protein_id="CAR40769.1"
FT                   /translation="MELIKNTKKPTVFYLSEGIISTGVISGWPKNSTDGTTHLTYTFPN
FT                   YSDRSENIRKKYPITESQKKETLKNIAEYYKLDYEIKERKKELEAIKDSEDPKKRIQEI
FT                   NEDIKLKTERRYEIKKGIPLYFSVTTMTIFPHQQEVVTEILQLASDFADLTFTRVPIQK
FT                   NANLKFGYYKQFATGYYMTRETVGFASKPNYNGTPIKEIGQNESYDFSGSIFINLASHD
FT                   FYQWVKRDNLDKYIENEANIGDLYNYHDNNQVAIIKSTDVLLNETMKSKHKLGSQIYYV
FT                   FLHELGHALGLEHIDAYLKNIKNSAIETYKYTVMGMGFADIKDADFGGLYPMTFMLVDI
FT                   LLLQYLYGPNMTTRLENNTYGFNSNTGRAAYSLKSIEDKLVSCIWDAGGIDTLDFSLYT
FT                   VNQVINLNEGCFSDIGGLRSNISIAYKTIIENAIGGKGDDTLIGNPFDNNLIGGDGNDL
FT                   FYGGDGNDLFYGGSGNDVIYGEMGNDVLYGDDGDDMLIDYYGANMLDGGKGNDRICVAS
FT                   MDRGLPGRNIIQGGEGDDEIYLGTGTHRITGGQGNDTFNFFCYEGVESNSSIWDFEKNK
FT                   DKITLITRDYRKIDISKMKKVDKLSGDKNEFSLNHNKPANKTIIDVSTSSNDDKSIVHI
FT                   EIVGIFNHDELFAV"
FT   misc_feature    complement(338503..338556)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 1.4"
FT   misc_feature    complement(338557..338610)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.026"
FT   misc_feature    complement(338629..338682)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 4.7"
FT   misc_feature    complement(338710..338763)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 5.8e-06"
FT   misc_feature    complement(338764..338817)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.0016"
FT   misc_feature    complement(338818..338871)
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding repeat, score 0.21"
FT   misc_feature    complement(339298..339327)
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT   CDS_pept        340636..341520
FT                   /transl_table=11
FT                   /locus_tag="PMI0286"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40771"
FT                   /db_xref="GOA:B4EUM1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUM1"
FT                   /protein_id="CAR40771.1"
FT                   /translation="MSYISREKIDYLSIGHRLRAYRIASSLKAEDVAESLGISRAAVYR
FT                   LEKGEIVKIETLDNLARLLNTSLSSLLGINTEYYSSANGFFERMRQLETQSSHIYTHFE
FT                   PFSYLLTSDCYDKTLVEMLTEASPENALTKKQQEVLSILKERKKHQSLHSPHIYNLISQ
FT                   QQIEKFLYVGMLGSVNVSKAIQQERKQRAKQEISHLIEKLEQKNSHLNIAIISDTMPSL
FT                   TFQLFYQNKAPLSLAVSPFRLGEFPNVSTGIATVSSSTEAIFQYQSLFDTLWAKAIKND
FT                   DAITRLKEIISHY"
FT   misc_feature    340687..340848
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   1.3e-11"
FT   misc_feature    340714..340779
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1911.000, SD 5.70 at aa 27-48, sequence
FT                   LKAEDVAESLGISRAAVYRLEK"
FT   CDS_pept        complement(341514..342770)
FT                   /transl_table=11
FT                   /locus_tag="PMI0287"
FT                   /product="putative amidohydrolase/metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40773"
FT                   /db_xref="GOA:B4EUM2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUM2"
FT                   /protein_id="CAR40773.1"
FT                   /translation="MTQPITATDFSINDMKTLIETMQIYKKDNHDKGITRIAYSEEDEA
FT                   AHLYLASVMKEAGLEVYRDGIGTLYARLPGQDRTLPAVGTGSHLDTVPQGGAYDGALGV
FT                   IAGFYALMQYKPQQLKRDLELIVFRAEESSRFGFSCIGSKVLTGKIDRTRWEQNRDDEG
FT                   NNFFDVLKSLGYQHENLDQCLLKSDRYSAFVELHIEQGKRLENDQKTIGIVNGIAAPTR
FT                   FSVTVNGHADHSGATPMYQRQDALVASAGIITDINHAACTEAVYGTVGTIGKLNVIPNS
FT                   MNVIPGQVKFSVDIRGIDTDSIQRVVQRLTNSVEKAEKDFGVKIIVQPISAESPVKLDD
FT                   SICQVIENICQKHDINYMTMLSGAGHDSMNMASLYPTAMIFTPSVAGISHHPDEFTEFS
FT                   DIAIAADILAETLGVLANQ"
FT   misc_feature    complement(341529..342521)
FT                   /note="HMMPfam hit to PF01546, Peptidase family
FT                   M20/M25/M40, score 4.7e-29"
FT   misc_feature    complement(341805..342128)
FT                   /note="HMMPfam hit to PF07687, Peptidase dimerisation
FT                   domain, score 0.0036"
FT   CDS_pept        complement(343139..344524)
FT                   /transl_table=11
FT                   /gene="rafY"
FT                   /locus_tag="PMI0288"
FT                   /product="putative glycoporin"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40775"
FT                   /db_xref="InterPro:IPR016963"
FT                   /db_xref="InterPro:IPR021570"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUM3"
FT                   /protein_id="CAR40775.1"
FT                   /translation="MNIKHLAIATCIGIAVPTIAHANTNELSIEQRLARLEERTLAAEK
FT                   RAELAEQRAAKLENALKQNQALNNNLSQTSETITAPPSSLIETNTGYGKLKLYGDVEFN
FT                   TDIASKKGQLTSINMRSGKEKDYGDYDKWGINGRILIGLDGERLLDNKNYAGFTVQPLA
FT                   NIDGKVSLDDAAFYFGKKERWQFKLGRYEAYDMFPLNQDTFVEYSGNTANDTYSDGFGY
FT                   IYMMKEGRGRSNSGGSMMFNSQYNNWYFETNLLIEDGTSIFANKEYHGNKLYNNKNVIY
FT                   FRPVIAWNNNNFKVAVALEKNIINNAYGYDDKKTGEFRDQSKRNGYGLTLGWSNLQQNP
FT                   ENGVTINWNTAYLDANDENDFTTGTNILWRKLQLGYIYAHNNIKSYTINSDDDNNNDII
FT                   FGPGKYNIHTLYSSYELSNILDMDNFKIYLGAYYSVINGKDIEIENSDKDRYGVRARFK
FT                   YFF"
FT   misc_feature    complement(344459..344524)
FT                   /note="Signal peptide predicted for PMI0288 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.990 between residues 22 and 23"
FT   CDS_pept        complement(344579..345223)
FT                   /transl_table=11
FT                   /gene="pgmB"
FT                   /locus_tag="PMI0289"
FT                   /product="beta-phosphoglucomutase"
FT                   /EC_number="5.4.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40777"
FT                   /db_xref="GOA:B4EUM4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUM4"
FT                   /protein_id="CAR40777.1"
FT                   /translation="MTKGLIFDLDGVIVDTANYHYIAWKKLSNEIGIDFDKEFNHLLKG
FT                   ISRIESLELILSHGNKSDVYSADEKKSLTETKNKYYLELLNNITPKDILPGVLDLIEQA
FT                   NNNHIPCAIASASENAPTILEKLGIKHYFKAIVDPKTLKKGKPDPEIFLRAAEFIHIPP
FT                   HLCIGFEDSIAGIQSIKQAGMYAIGVTADGPLPEADLAVHSLTEIDIHSLF"
FT   misc_feature    complement(344648..345220)
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 4.3e-27"
FT   CDS_pept        complement(345216..347933)
FT                   /transl_table=11
FT                   /locus_tag="PMI0290"
FT                   /product="glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40779"
FT                   /db_xref="GOA:B4EUM5"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUM5"
FT                   /protein_id="CAR40779.1"
FT                   /translation="MNYISIILSDTDITIKYLSEKSHYSFNTTNSHYLDWLNMAKAINH
FT                   KFNSAQGGLIYSTSNKSDSAIIKTIDNKVINLSNFFTEIFNKPFIYINKAQLEHHHDLE
FT                   EKMVTVANNFAWSIEYSGLETGKDEYCQESLLTTANGYIGLRGTLPEMTISDEHYPATY
FT                   IAGLYNQASSQIENHQVINEDFVNAPNGQFISLKIGKGEYLHPKQLITHHLTRQLDLKT
FT                   GVFTSQWRVETPEGQQLDIHCTKFANMADMSHYAILYTFKPLNFSGEITVITRLEGNTY
FT                   NYGVQRYRSLNPHHYHVLQTGANKQHAFILAQTDQSKIGIGLSSTISGDFFANEDIVCH
FT                   VSDTLVEQTITFNAQQNTTYQLEKCVAVTTSTAYPDSWQDVVNWEQQPLHSQLINSQKA
FT                   WQTLWDSADISISGDLMTQKLLRLHTFHLLSSASPFSNQQHQLDVSVTARGLHGEAYRG
FT                   HIFWDEIFILPFYIMHFPETARQLLLYRYHRLPAARLAARAEGFQGAMFPWQSGHDGSE
FT                   QTQTLHLNPLSGQWDADHSCRQRHVSLAIAYNVWLYWLNTHDHQFMEQYGLELLNDITL
FT                   FWLDQCQWDEGDQRFHINGVMGPDEFHEKYADSLEGGLKDNAYTNLMVVWLFNQIEMFI
FT                   NNDRFSKKLQQLNSQSSVFNKIQEVKNRIAINIDAHEIIEQFSGYFQLKDLDWESYRKK
FT                   YGNIYRMDRILRKENKSADDYKVAKQADTLMLFNNLDKQTVHSLITSLGYSVSKHFAEK
FT                   NLHYYLERTSHGSTLSRIVHAYLAEQIQLHDLSWQLYQDALYSDYNDIQGGTTAEGIHT
FT                   GVMAATLNTTIMAYAGVDIRQDMLTITPSLPQQWQKLSFKLLHRSTLYQINLSHKEISI
FT                   LSDKPSTILINHQTHKLTANTLLVLKLNGDTQND"
FT   misc_feature    complement(345426..346670)
FT                   /note="HMMPfam hit to PF03632, Glycosyl hydrolase family,
FT                   score 2.6e-140"
FT   misc_feature    complement(346812..347585)
FT                   /note="HMMPfam hit to PF03636, Glycosyl hydrolase family
FT                   65, N-termi, score 3.7e-37"
FT   misc_feature    complement(347148..347213)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1055.000, SD 2.78 at aa 241-262, sequence
FT                   IHCTKFANMADMSHYAILYTFK"
FT   CDS_pept        complement(347959..349380)
FT                   /transl_table=11
FT                   /gene="treB"
FT                   /locus_tag="PMI0291"
FT                   /product="trehalose-specific PTS system, EIIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40781"
FT                   /db_xref="GOA:B4EUM6"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUM6"
FT                   /protein_id="CAR40781.1"
FT                   /translation="MSIPQDNQAIEELITLVGGSDNVISVSHCLTRLRFVLNDPNLADI
FT                   DKIKKISFVKGCFNNAGQFQVIVGMDVDIYYKLLIDKLSLKAKSKDDIKSDAKKNMGSW
FT                   QKLIANLAEIFVPLLPILICGGLLLGLRNVIGEMPISDNKPLTYFYPWLTPIYDFLWLP
FT                   CEAIFHFLPVSICWSSVKKMGGTPALGIVLGITLVSPQLMNAYNLGSQLPEVWNFGLFT
FT                   IEKVGYQAQVIPSILAGLFLGWFETKLRRFIPDYLKLVIVPIVTLIVAVFVAHVILGPI
FT                   GRSIGDGLAQLIKFLMLGDFAPIGSTIFAFFYSPMVITGLHHTTLAIDLQMTQSYGGTP
FT                   IWPIIALSNIAQASAVVGIIIVSRKLNEQEITIPAAISAYLGVTEPAMYGVNLKYGFPM
FT                   LCAMIGAALAGLICGLNNVLSNGIGVGGLPGILSIQPTYWLVYLLAMIVAIVVPIGLTI
FT                   LVYRYKEKAGTLQVD"
FT   misc_feature    complement(join(347998..348066,348124..348183,
FT                   348202..348270,348298..348366,348403..348471,
FT                   348544..348612,348646..348705,348763..348831,
FT                   348868..348936,348994..349062))
FT                   /note="10 probable transmembrane helices predicted for
FT                   PMI0291 by TMHMM2.0 at aa 107-129, 149-171, 184-206,
FT                   226-245, 257-279, 304-326, 339-361, 371-393, 400-419 and
FT                   439-461"
FT   misc_feature    complement(348163..349047)
FT                   /note="HMMPfam hit to PF02378, Phosphotransferase system,
FT                   EIIC, score 5.9e-36"
FT   misc_feature    complement(349249..349350)
FT                   /note="HMMPfam hit to PF00367, phosphotransferase system,
FT                   EIIB, score 1.2e-12"
FT   misc_feature    complement(349264..349317)
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT   CDS_pept        complement(349391..349486)
FT                   /transl_table=11
FT                   /locus_tag="PMI0292"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40784"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUM7"
FT                   /protein_id="CAR40784.1"
FT                   /translation="MIINCDLYLVMGTFPLDKKKDLDILKITLLL"
FT   CDS_pept        complement(349499..350467)
FT                   /transl_table=11
FT                   /gene="treR"
FT                   /locus_tag="PMI0293"
FT                   /product="trehalose operon repressor (LacI-family
FT                   transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40791"
FT                   /db_xref="GOA:B4EUM8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012771"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUM8"
FT                   /protein_id="CAR40791.1"
FT                   /translation="MTDTNKKKLTINDIAKLCGVGKSTVSRVLNQDPMVNEETRKKVNS
FT                   IIEKYKFTPSKSARAMRGYSNRSFGIIVTRLDSYAENQAVSAILPILYQNNIDPIILES
FT                   QFSQAKVEENLKMLAHQKIDGVILFAFSGINAANLASWKQKMVVIARPLEGFVSICHDD
FT                   ERAVNALMHYFHRDKHYQHISFIGIQINDETTGLLRYQTYLQYCQQHQLISQAQLGELN
FT                   YQSGYLLAKQALASKPQAILCATDSLAFGVQKYLAEQKIDHIEVACIGRNDLLTFLFPQ
FT                   TKFYRLGFRESGQEAANILIQMLEKNIPAQKIIISSHDLNP"
FT   misc_feature    complement(349517..350272)
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 0.0015"
FT   misc_feature    complement(350366..350443)
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI fami, score 9.7e-09"
FT   misc_feature    complement(350378..350443)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2310.000, SD 7.05 at aa 9-30, sequence
FT                   LTINDIAKLCGVGKSTVSRVLN"
FT   CDS_pept        complement(350630..351082)
FT                   /transl_table=11
FT                   /locus_tag="PMI0294"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40793"
FT                   /db_xref="GOA:B4EUM9"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUM9"
FT                   /protein_id="CAR40793.1"
FT                   /translation="MKKYSAISVLVIILSLMIYFSFYFNQEKENVINCEAKLIIYDKED
FT                   TKANLELMFTLGEEQGWASIRGVIDYNGDLIPVYRKSFFDITKLKTSYKLASTQILIND
FT                   NNSEIINKIIPNLYVKEGWQRSLSVFSQNDGGYLFSSNNVYSFYCY"
FT   misc_feature    complement(351008..351082)
FT                   /note="Signal peptide predicted for PMI0294 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.977) with cleavage site
FT                   probability 0.618 between residues 25 and 26"
FT   CDS_pept        complement(351079..351903)
FT                   /transl_table=11
FT                   /locus_tag="PMI0295"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40794"
FT                   /db_xref="GOA:B4EUN0"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUN0"
FT                   /protein_id="CAR40794.1"
FT                   /translation="MYLINDDIIFYSDKNLLFSKKLNKEKKILAPSSKMLIHLITVNEL
FT                   VTQRELFRIGWGDKEKFITNSAFYQNILLLRKAFNELDIDDEIVITVPRKGYIINHNIS
FT                   IEKLSDNNIQDIKLINENKISDIPHIKKEIEEDINTNINNKDHSLSSIKKTSISLSKKK
FT                   LFIIIFTLIVLFFVVIFTFNYLDSRKHKLYNYSNCGTYKKYNLFCNKEILNEEKENLID
FT                   NYISSYSDYNFIYITESDSYSRTSLILCKKKFSPINFLHNQCVSIYVLDNKK"
FT   misc_feature    complement(351349..351414)
FT                   /note="1 probable transmembrane helix predicted for PMI0295
FT                   by TMHMM2.0 at aa 164-185"
FT   misc_feature    352544..360331
FT                   /note="fimbrial operon 3"
FT   CDS_pept        352544..352828
FT                   /transl_table=11
FT                   /locus_tag="PMI0296"
FT                   /product="fimbrial operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40796"
FT                   /db_xref="GOA:B4EUN1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUN1"
FT                   /protein_id="CAR40796.1"
FT                   /translation="MEREKYEIDKTYDTKAIHQYLGKEIRSKRKAIGLTGEDLAKKLNV
FT                   SQQQVSRYETAESKISFEKLLLISDVLDLNIQYLLKVIISDKFKIISDD"
FT   misc_feature    352616..352780
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   2.8e-15"
FT   misc_feature    352643..352708
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2289.000, SD 6.98 at aa 34-55, sequence
FT                   LTGEDLAKKLNVSQQQVSRYET"
FT   CDS_pept        352973..353533
FT                   /transl_table=11
FT                   /locus_tag="PMI0297"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40798"
FT                   /db_xref="GOA:B4EUN2"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUN2"
FT                   /protein_id="CAR40798.1"
FT                   /translation="MKFNKIALTVLLATSAISLNAMADNANTGVITFTGSVVNTPCNIA
FT                   QSSLKQTVEFGQLSRKALESGKMVEADFDIEFTGCDFTNFGIDATSGKPVPVKSMELVF
FT                   TGQNYADTANTLLATSAGNTNNLGILIDGFEFGKAKDVLPSITNLKGDNVLTFKALAKA
FT                   VDASKDVSEGKFSAISNFRITYQ"
FT   misc_feature    352973..353041
FT                   /note="Signal peptide predicted for PMI0297 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 23 and 24"
FT   misc_feature    353057..353530
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   5.6e-23"
FT   CDS_pept        353710..354294
FT                   /transl_table=11
FT                   /locus_tag="PMI0298"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40800"
FT                   /db_xref="GOA:B4EUN3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUN3"
FT                   /protein_id="CAR40800.1"
FT                   /translation="MEKKVAIYRRIGLQVISSLLSLISSTALAFDPKVIEHEGSTYLVG
FT                   SVISTPCSIVMSNRYQTVDFSSLTLAMLSSKEKREQQTLPFEIELRDCGSIYTSIDSKT
FT                   WMIRFDGQSVSNINAFILQGTSKGLGVSVLDNNKNALIPGETYPLFDSVLRQDKSGQIL
FT                   YLRYFLRLELTGEPLRAGDYQGLVRFFIHYQ"
FT   misc_feature    353710..353796
FT                   /note="Signal peptide predicted for PMI0298 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.839) with cleavage site
FT                   probability 0.799 between residues 29 and 30"
FT   misc_feature    353824..354291
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   1.2e-06"
FT   CDS_pept        354349..356877
FT                   /transl_table=11
FT                   /locus_tag="PMI0299"
FT                   /product="fimbrial outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40802"
FT                   /db_xref="GOA:B4EUN4"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUN4"
FT                   /protein_id="CAR40802.1"
FT                   /translation="MGMVNSMIFELNQLRQVVLLTMSISVFSAYATEFNIDVLDAEDIQ
FT                   NIDMSQFSIAGYVPPGDYVLTVFVNGQRLGAPRDITVLEQKTQTQAICIPADLLDSIGL
FT                   KESVKPKVTVYPNSQCLDLSVLKGMQTVIDLPTLSLKITIPQLWMEYRDPYWTPPALWE
FT                   EGINGAFLDYSANVSITEEKEGDKRTYLSTNGTAGINLGVWRFRGDYSAIYQKKRGGRQ
FT                   SQEIHDFDFSRLYGFTSLKKLASILTIGENYFYSDVFESWQYSGISLESDDRMLPPKLV
FT                   GYAPEITGVADTNATVIVRSQNRVLLETTVPPGPFRIQTLDSGVRGILDITIREENGEE
FT                   KKFSISTASLPYLTRPGRLIYKLVMGKTRYDGHHLTGKPVFSGEFSYGLSNAWSLYGGT
FT                   QFNSDYQATAIGIGRDLFSFGALSLDITQSFARFTDKKIKGRSYRLNYAKSFDALRTDI
FT                   TFAGYRFAARDYRTLTQFMDQRRTGYDIRSPKENYQIYINKYFDNFNISLNYQYSTYWQ
FT                   DKPQTQYGLYASTNISIPMLSQQNANISLSATRTERDSGYQDDAINLYLTIPLYKGHSI
FT                   SFSESYSRIGKSNQYSHRASYSGYSDRDNYSLNVGYSHGEEIDSQSSISGYYSRDFSQA
FT                   NLSANASYVPQQYRSVGASINSGITATTQGIALHRSANGDTRLMIETPGVGDVPLDSGV
FT                   IKTNHFGLAVIPNVNSYRKSTVSINTSQLPENIETLESTTDITLTKGAIGYRSLSVMKG
FT                   EKLFAIISLNDGKKPPFGASVRNADNRELGIVGEDGVTWLVGISSKEKLSVYWAGKKQC
FT                   ELSLPEDLASPTSMLLLPCSSPTISKITEN"
FT   misc_feature    354349..354441
FT                   /note="Signal peptide predicted for PMI0299 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.950) with cleavage site
FT                   probability 0.945 between residues 31 and 32"
FT   misc_feature    354442..356805
FT                   /note="HMMPfam hit to PF00577, Fimbrial Usher protein,
FT                   score 5.7e-244"
FT   CDS_pept        356889..357644
FT                   /transl_table=11
FT                   /locus_tag="PMI0300"
FT                   /product="fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40805"
FT                   /db_xref="GOA:B4EUN5"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUN5"
FT                   /protein_id="CAR40805.1"
FT                   /translation="MFYIVRLVMFNFSRGLYCILVGYSIFISMAAHSAVTLDRTRIIFP
FT                   GTEKSINITISNDNPEEAYLAQSWIEDLQGNKLTKGAILATPPLQRIEPNSYSLVRLST
FT                   TPELHKLPQDRESVFYFNLREVPPKSTDGNTLQIALQSRVKLFYRPNSILSEAETKWTH
FT                   KVTLTKTAQGYRVNNITPFNLTIIGFGNSKAAAEKNPFDVVMVPPKSTHDIASSILSTP
FT                   YLTYINDYGGKPSLVFRCQGDTCVVTGEQ"
FT   misc_feature    356889..356987
FT                   /note="Signal peptide predicted for PMI0300 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.988) with cleavage site
FT                   probability 0.965 between residues 33 and 34"
FT   misc_feature    356925..356993
FT                   /note="1 probable transmembrane helix predicted for PMI0300
FT                   by TMHMM2.0 at aa 13-35"
FT   misc_feature    356988..357350
FT                   /note="HMMPfam hit to PF00345, Gram-negative pili assembly
FT                   chaperone, score 6e-44"
FT   misc_feature    357219..357272
FT                   /note="PS00635 Gram-negative pili assembly chaperone
FT                   signature."
FT   CDS_pept        357676..358104
FT                   /transl_table=11
FT                   /locus_tag="PMI0301"
FT                   /product="putative fimbrial protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40807"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUN6"
FT                   /protein_id="CAR40807.1"
FT                   /translation="MSKYHVFKIAKWFKVLLLIVGCAFSQFIIAESSIVSTTTKQSVYE
FT                   PLHQGVVQVRATLFNAPCNLSFDNNLSLIGCGAGKDYRTINLFDVTANTPASIRYYDIQ
FT                   RRLFSEDYSLSLHNGNNPIYLPTLMKDQHILRLEVSYE"
FT   misc_feature    357676..357765
FT                   /note="Signal peptide predicted for PMI0301 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.959 between residues 30 and 31"
FT   misc_feature    357709..357765
FT                   /note="1 probable transmembrane helix predicted for PMI0301
FT                   by TMHMM2.0 at aa 12-30"
FT   CDS_pept        358097..358630
FT                   /transl_table=11
FT                   /locus_tag="PMI0302"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40809"
FT                   /db_xref="GOA:B4EUN7"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUN7"
FT                   /protein_id="CAR40809.1"
FT                   /translation="MNKMVKFLGLISLTICNWQSQALAANNLDVEFSGELISVACQVAS
FT                   ESINKKVTLHNLRWQFINENEISKVTHFTIAIDKCSETDLQKSIKLTWKSNELVDIDGN
FT                   HFLITKGDSGALLGIIDNNGRSVIWNKPMTIGDVSVVDGSQQFEFGVFVRKPAIGEIKI
FT                   GEFSSIVTFNVEYE"
FT   misc_feature    358097..358168
FT                   /note="Signal peptide predicted for PMI0302 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.876 between residues 24 and 25"
FT   misc_feature    358184..358627
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   3.5e-06"
FT   CDS_pept        358630..359166
FT                   /transl_table=11
FT                   /locus_tag="PMI0303"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40813"
FT                   /db_xref="GOA:B4EUN8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR005430"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUN8"
FT                   /protein_id="CAR40813.1"
FT                   /translation="MLIWLNKMKNLLGVALLFISLVCNADIFINISATMVEPVCNIRSE
FT                   NGSAPLKIGFDTLTISSLTKSPVVKDFSLYISDCNFNNTLAIVLNPKGGSTLLYKGKNI
FT                   LATSTDGLGIDINEVTGGTIRSLETSKKHKINPERINSTLYRVDLQAQLVNTVPINQLK
FT                   LGKFNSIVTISVTYN"
FT   misc_feature    358630..358704
FT                   /note="Signal peptide predicted for PMI0303 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.990 between residues 25 and 26"
FT   misc_feature    358663..358731
FT                   /note="1 probable transmembrane helix predicted for PMI0303
FT                   by TMHMM2.0 at aa 12-34"
FT   misc_feature    358714..359163
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   0.0028"
FT   CDS_pept        359179..360330
FT                   /transl_table=11
FT                   /locus_tag="PMI0304"
FT                   /product="putative fimbrial adhesin"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40814"
FT                   /db_xref="GOA:B4EUN9"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUN9"
FT                   /protein_id="CAR40814.1"
FT                   /translation="MLKLIHKFSSWKKEIALNNVIIPLLNDLIYFLILLSVFFINFIFT
FT                   SIAIADYAPRIQDINTGYMIKLASNSPIALNPVKGTDGKNYYKVGNTIVINNTPSSVSV
FT                   SGIVQCIGLTWGHASTNISWNNAYHRLFTYVPMAGTNIEGHMAYRINSNLVMTIDTQML
FT                   NWVNIRGSVCEQATPTLTAHASEFTVQFPISVTFYINDMVIDSQLPIPEMDLGGYVRAF
FT                   TRSGTSPPQNSWALNDVTVPMRLAASQLNVTSSCKTVTSTGQVSTLNLKHGQLNTLNYD
FT                   SLVTESVTYNCVFSKATKVRLRLDYITDNDPQKRLPMVSTQNSNNKIYSELTMTDEITG
FT                   QKGKDFKIDINDLRTIKITSHLQGTNAIAGDYKGSAWLIATFD"
FT   misc_feature    359179..359328
FT                   /note="Signal peptide predicted for PMI0304 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.884) with cleavage site
FT                   probability 0.865 between residues 50 and 51"
FT   misc_feature    359260..359328
FT                   /note="1 probable transmembrane helix predicted for PMI0304
FT                   by TMHMM2.0 at aa 28-50"
FT   CDS_pept        complement(360449..361141)
FT                   /transl_table=11
FT                   /locus_tag="PMI0305"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40816"
FT                   /db_xref="GOA:B4EUP0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUP0"
FT                   /protein_id="CAR40816.1"
FT                   /translation="MMISEITKLKRGRPPKNHSPNTDVKNIVIQSGIEMFAEKGYISSD
FT                   ICKILEKVGIPKGSFYYYFGSKEKFGLVVIQHYDNFISKQLDNYLSYTALPFPKRLLAF
FT                   CHMIKSEMEKYHWQRGCLVSNLIQDIVNLPINYYKILNNVISGWQKKVENYLLEAQKYK
FT                   FISKNIDCRQMAIFFWMGWQGAIMQAKLTCSNQPLDIFISIFMAQVFGIHYQASEYPIL
FT                   FNKNTFTN"
FT   misc_feature    complement(360920..361060)
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 1.6e-07"
FT   misc_feature    complement(361082..361120)
FT                   /note="HMMPfam hit to PF02178, AT hook motif, score 0.025"
FT   CDS_pept        complement(361271..362599)
FT                   /transl_table=11
FT                   /gene="potE"
FT                   /locus_tag="PMI0306"
FT                   /product="putrescine-ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40818"
FT                   /db_xref="GOA:B4EUP1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR027566"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUP1"
FT                   /protein_id="CAR40818.1"
FT                   /translation="MSTSKNKMSVLQLTILTAVNMMGSGIIMLPTKLAEVGTISILSWI
FT                   VTAVGSMALAYAFAKCGMFSRRSGGMGGYAEYAFGKSGNFMANYTYGISLLIANVAIAI
FT                   SAVGYGAELMDATMTPLGICIATIVVLWICTIANFGGARITGQISSITVWGVIIPVVGI
FT                   SIIGWWWFNPEQYINSWNPHNFPFFEAVGSSIAMTLWAFLGMESACANSEAVENPEKNV
FT                   PIAVLGGTLGAAVIYIVSTNVIAGIVPNMDLANSTAPFGLAFSQMFTPGVGKIIMALMI
FT                   MSCCGSLLGWQFTIAQVFKASSDSGYFPKIFSAVSKADAPVKGMLVIVVIQSALSLMTI
FT                   SPSLNKQFNVLVNLAVVTNIIPYILSMAAMIILQKVAKVEPHKARTSNIIAFIGAIYSF
FT                   YALYSSGEDAVMWGALATFLGWTLYGFVSPRFEMKQNQDLMTK"
FT   misc_feature    complement(361292..362566)
FT                   /note="HMMPfam hit to PF00324, Amino acid permease, score
FT                   7.9e-07"
FT   misc_feature    complement(join(361316..361375,361388..361444,
FT                   361481..361549,361577..361630,361733..361801,
FT                   361859..361927,361988..362047,362090..362158,
FT                   362177..362245,362273..362341,362426..362494,
FT                   362507..362575))
FT                   /note="12 probable transmembrane helices predicted for
FT                   PMI0306 by TMHMM2.0 at aa 2-24, 29-51, 80-102, 112-134,
FT                   141-163, 178-197, 218-240, 260-282, 317-334, 344-366,
FT                   379-397 and 402-421"
FT   misc_feature    complement(362354..362377)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(362663..364825)
FT                   /transl_table=11
FT                   /gene="speF"
FT                   /locus_tag="PMI0307"
FT                   /product="ornithine decarboxylase, inducible"
FT                   /EC_number="4.1.1.17"
FT                   /note="Also similar over its N-terminal region to PMI02625
FT                   (75.5 38d)."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40820"
FT                   /db_xref="GOA:B4EUP2"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027464"
FT                   /db_xref="InterPro:IPR027568"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUP2"
FT                   /protein_id="CAR40820.1"
FT                   /translation="MKSYKIAVSYDMSDYISTHRECVDILHTDFSDVAVIVISLNDIQN
FT                   GKLNLIEQNSFEQPIFAIINKDEVIPANIINRLTGVIDLNKKNSELYNKQLETAALKYE
FT                   ESLLPPFFGSLKKYVEQGNSAFDCPGHQGGEFFRRHPLGNQFVEYFGENLFRSDLCNAD
FT                   VSMGDLLIHEGAPCAAQQHAAKVFNADKTYFVLNGTSSSNKVVLNALLAPDDLVLFDRN
FT                   NHKSNHHGALIQAGATPVYLEAARNPFGFIGGIDAHCFEEKYLRELIKEVAPTRANEKR
FT                   PFRLAVIQLGTYDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFIPMMKDCSPLLLEL
FT                   NENDPGILVTQSVHKQQAGFSQTSQIHKKDRHIKGQKRYVNHKRLNNAFMMHASTSPFY
FT                   PLFAALDVNAKMHEGESGKRLWMNCVKTGIETRKLLLQSCKHIRPFIPETIDGRAWEDF
FT                   DTDEIANDLRFFNFVPGERWHSFEGYEENQYFVDPCKLLLTTPGINAKTGKYESFGVPA
FT                   TILANYLRENNIIPEKCDLNSILFLLTPAESMAKMQHLVAQIARFEQLLEQDAPLKEVL
FT                   PSVYHANQTRYQGYTIRQLCQEMHDMYVKFNVKQLQKEMFRKSHFPQVSMLPQEANIAF
FT                   VRGEVELVAVEKIEGRIAAEGALPYPPGVLCVVPGEIWGGSVQQYFLALEEGINLFPGF
FT                   SPELQGVYIRNDEDGRLRAYGYVIKH"
FT   misc_feature    complement(362699..363100)
FT                   /note="HMMPfam hit to PF03711, Orn/Lys/Arg decarboxylase,
FT                   C-terminal doma, score 5.4e-82"
FT   misc_feature    complement(363122..364501)
FT                   /note="HMMPfam hit to PF01276, Orn/Lys/Arg decarboxylase,
FT                   major domain, score 0"
FT   misc_feature    complement(363734..363778)
FT                   /note="PS00703 Orn/Lys/Arg decarboxylases family 1
FT                   pyridoxal-P attachment site."
FT   misc_feature    complement(364517..364825)
FT                   /note="HMMPfam hit to PF03709, Orn/Lys/Arg decarboxylase,
FT                   N-terminal doma, score 1.6e-19"
FT   CDS_pept        complement(366482..367252)
FT                   /transl_table=11
FT                   /locus_tag="PMI0308"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40824"
FT                   /db_xref="GOA:B4EUP3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUP3"
FT                   /protein_id="CAR40824.1"
FT                   /translation="MGLIIQEQCVIVDHNCPDWLITQSEGNPTIDYTDGLKVYAIFKRQ
FT                   FLSGKRRRNRKQRQLGDNCPLIYALKKKDDLYTNISSIKKLNDSFKIICNKLMELEPKG
FT                   YQLIISMPSAHNISPIIAKRLAKKFNATYLTDILRKITVDNAFQLLDKADINIEEAKSL
FT                   SFKIKLQAKEVGLKGGFSLKSIPTEFRNIFPPFVLNTQASSNTEKIRILLVDDLMATGT
FT                   TLTTARDIIAQQYPNAIIHAICLFSSIKKQNKKT"
FT   misc_feature    complement(366584..366622)
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT   CDS_pept        join(367540..367917,367917..368090)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PMI0309"
FT                   /product="putative resolvase/recombinase (pseudogene)"
FT                   /note="This CDS appears to have a frameshift mutation
FT                   following codon 126."
FT                   /db_xref="PSEUDO:CAR40825.1"
FT   misc_feature    367546..367935
FT                   /note="HMMPfam hit to PF00239, Resolvase, N terminal
FT                   domain, score 8.5e-49"
FT   misc_feature    367555..367581
FT                   /note="PS00397 Site-specific recombinases active site."
FT   misc_feature    367711..367749
FT                   /note="PS00398 Site-specific recombinases signature 2."
FT   misc_feature    367959..368084
FT                   /note="HMMPfam hit to PF02796, Helix-turn-helix domain of
FT                   resolvase, score 1.9e-10"
FT   misc_feature    368013..368078
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1736.000, SD 5.10 at aa 26-47, sequence
FT                   WGGTAIAKEMKVARSTVYKILN"
FT   CDS_pept        complement(368261..368581)
FT                   /transl_table=11
FT                   /locus_tag="PMI0311"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40826"
FT                   /db_xref="GOA:B4EUP5"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUP5"
FT                   /protein_id="CAR40826.1"
FT                   /translation="MNLASASIDSIPMPTFLITALLIIVFTRYFNVLLNDYVSKEKLMS
FT                   KLFRHIVLYASCFIETVWAGMISVVVGLMTGGVQITLALAKFSRFFIFHLKQPHPKYYP
FT                   IY"
FT   misc_feature    complement(join(368360..368428,368486..368554))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0311 by TMHMM2.0 at aa 10-32 and 52-74"
FT   CDS_pept        complement(369084..369944)
FT                   /transl_table=11
FT                   /locus_tag="PMI0312"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40828"
FT                   /db_xref="GOA:B4EUP6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUP6"
FT                   /protein_id="CAR40828.1"
FT                   /translation="MINLTPYSDSSISFLRSIINSKNRGDYKDRISNLFNSLNTYYQNY
FT                   DTSFDNNTLNLIQQSLIFSDLEKKDLLKLYNYSSKPFANFKNQLLKLPNGRDMDTCQYC
FT                   TLNSVNTLDHIIPKENYPEYAVHPKNLFPACSQCNSKKSNKWLDNNNNFEFINLYSHDL
FT                   PNLQYLFANINLIGNTFNVNFELRNENNINEDIFMLIERHYINLDLLNRFKSKSNEKIA
FT                   QFENIIISNIESFDILLSSALNSALVAVNKSRLIFGANHWEQILYLGLINGSAFRTYCN
FT                   NKGYQ"
FT   CDS_pept        complement(join(369937..370404,370406..370651,
FT                   370654..370854))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PMI0313"
FT                   /product="phage-related protein (fragment)"
FT                   /db_xref="PSEUDO:CAR40830.1"
FT   misc_feature    complement(370825..370848)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   repeat_region   370891..370960
FT                   /note="(aaagtta)10"
FT   CDS_pept        complement(370951..371931)
FT                   /transl_table=11
FT                   /locus_tag="PMI0316"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40833"
FT                   /db_xref="InterPro:IPR041427"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUP8"
FT                   /protein_id="CAR40833.1"
FT                   /translation="MFTIPIDKKCKLEIINTLATMESELFKNISPLEFFDSILNLRILA
FT                   SEDPRYQDAYGDLNQHYINNNDWTLEYILLERFDFLKSDELFTLLLNTLVSPSIMKIGV
FT                   NEISYIYNKLNPILIIYNIEYQLNGHDENNIPIYELSNFNNDDEFKDIKNNNIPFIIKN
FT                   NKNKENEYFKLIEINWNDFGRYNKFLLSYYKNQKEYIIGDLKIISKEDISTTNEIKNNF
FT                   FKLDNKHCSLGQKFEYYENIFKGNALSILKALNDVAFFTKIQESFEHLSQFKDSLIRYD
FT                   EQEQLLRQARHRIRKYDLSQLYSFEYIFKPDYIDDEDKLKLTFNF"
FT   misc_feature    372024..372038
FT   CDS_pept        372184..372738
FT                   /transl_table=11
FT                   /locus_tag="PMI0317"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40835"
FT                   /db_xref="InterPro:IPR022260"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUP9"
FT                   /protein_id="CAR40835.1"
FT                   /translation="MNKPISFIICFTTLFITACTPKEKLQQLETEPRSIILNKNIQIAQ
FT                   PDLYLTTPKVVRYDRYLLINTSPTLAQSDPIEQIIDVHIPTSQQSSVSDAMRYILQPSG
FT                   YSLCKTTSSNQVLYNQKLPVVHHQLGPMRLKQALQVLAGVAWQLEIDAVQRIICHSLRE
FT                   GYQLPTEILTNSTLSADRMLQ"
FT   misc_feature    372184..372237
FT                   /note="Signal peptide predicted for PMI0317 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.673) with cleavage site
FT                   probability 0.620 between residues 18 and 19"
FT   misc_feature    372208..372240
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        372735..373439
FT                   /transl_table=11
FT                   /locus_tag="PMI0318"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40837"
FT                   /db_xref="InterPro:IPR022293"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUQ0"
FT                   /protein_id="CAR40837.1"
FT                   /translation="MKIQSILNSQFLVSLGISVLTLSTEGMADQSQHQVLKTEQQALEQ
FT                   SLIAENAQEWKLTEKEWQRYEMLKKGKRGLFSPNLDPLTLLGIEARTYEERRYFAELVV
FT                   RQEFQRVEAELAFQREANQAWLRLYPEILPIQNEMRESRQALFVKESCSICEVKLAQLI
FT                   KLNQPIDIYLVGSGGKDDVIRNWAKKHHIPIEKVKNRHITLNHDNGIWLKHGNGIMPVV
FT                   LQQGTQGWQRVD"
FT   misc_feature    372735..372818
FT                   /note="Signal peptide predicted for PMI0318 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993) with cleavage site
FT                   probability 0.973 between residues 28 and 29"
FT   CDS_pept        373458..373715
FT                   /transl_table=11
FT                   /locus_tag="PMI0319"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40838"
FT                   /db_xref="GOA:B4EUQ1"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUQ1"
FT                   /protein_id="CAR40838.1"
FT                   /translation="MFILVIIVAVVDGLVRRDLRRYGAAYESSFVYHHAKRIIKPAIYI
FT                   LCVLYLSLPFAVYPNFLLLPSIFLIGIAISVTIGCFKKYL"
FT   misc_feature    join(373578..373631,373641..373700)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0319 by TMHMM2.0 at aa 41-58 and 62-81"
FT   CDS_pept        373758..374336
FT                   /transl_table=11
FT                   /locus_tag="PMI0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40839"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUQ2"
FT                   /protein_id="CAR40839.1"
FT                   /translation="MELLMPELTIRECGEEAIRLTNELFQQSEQSFMAYLLNESDLAWC
FT                   IASTRNFPPERQLPWDHAGQTFQNDNGFSFCFKFLDMQNRPAGACICEYCSDNVLNIEM
FT                   IQNFQIKPSILDGNTLKFMLYTIVFFLLLTQGTGVRLMFPINENVATYYVEKHGFQDLT
FT                   GDGSKEILYRSAEDLLNWFEQNNRSVDSE"
FT   CDS_pept        374340..374609
FT                   /transl_table=11
FT                   /locus_tag="PMI0321"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40840"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUQ3"
FT                   /protein_id="CAR40840.1"
FT                   /translation="MSDTIMQSTWQTKELGMVTRKGKSVTPESSFFQTPHIIQTREDGS
FT                   TVSTVCSRSGKEVTFVTPKGKRIRASQNEVFNTLLKSIKSVNHS"
FT   CDS_pept        374836..375108
FT                   /transl_table=11
FT                   /locus_tag="PMI0322"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40845"
FT                   /db_xref="GOA:B4EUQ4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUQ4"
FT                   /protein_id="CAR40845.1"
FT                   /translation="MKKRTNRVYTLEFKQEAVALVSKQGYSVSKAAASLGITDKLLYNW
FT                   KAKFDAEQSGSSLNSDERAELLRFRKENKELRMEKEILKKAAPSS"
FT   misc_feature    374851..375084
FT                   /note="HMMPfam hit to PF01527, Transposase, score 6e-18"
FT   misc_feature    374911..374976
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1043.000, SD 2.74 at aa 26-47, sequence
FT                   YSVSKAAASLGITDKLLYNWKA"
FT   CDS_pept        375328..375576
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PMI0323"
FT                   /product="putative integrase (fragment)"
FT                   /db_xref="PSEUDO:CAR40847.1"
FT   repeat_region   375647..375865
FT                   /note="repeated downstream of PMI2644"
FT   repeat_region   complement(375906..375961)
FT                   /note="repeated downstream of PMI2644"
FT   tRNA            complement(375914..375986)
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:375951..375953,aa:Phe)"
FT                   /note="tRNA Phe anticodon GAA, Cove score 75.98"
FT   CDS_pept        complement(376247..377317)
FT                   /transl_table=11
FT                   /gene="mltC"
FT                   /locus_tag="PMI0324"
FT                   /product="membrane-bound lytic murein transglycosylase"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40850"
FT                   /db_xref="GOA:B4EUQ6"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUQ6"
FT                   /protein_id="CAR40850.1"
FT                   /translation="MKKILLLLIIAPLLISCSSKPTKTFEPDYSKDTNAFDILMGQFAN
FT                   NIEMIWGMQEVLIAGPKDYVKYTDAYRTRSHINFEAGTITIETLGGDAPQFQLHKAIVT
FT                   TLLMGEDPGSIDLYSDVNNIPHSTEPFLLGQVLDNTGQPIRWEWRANKFADYLIANKLQ
FT                   KRQSGLNTIWYVTINLVPNHLDKRAHKYLPYVQQAAAKYGVEPSLILAIMQIESSFNPY
FT                   AVSSSDALGLMQIMPATAGRDVFRMQGKSGQPSRSYLFDPANNIDVGTAYISILQNSYL
FT                   GDIKDPVSRRYAVIQAYNGGAGSVLRIFHSDKKKAAAMINNLAPTEVYTTLRNKHPADQ
FT                   SRRYLEKVSTAQRNYR"
FT   misc_feature    complement(376355..376741)
FT                   /note="HMMPfam hit to PF01464, Transglycosylase SLT domain,
FT                   score 1.2e-45"
FT   misc_feature    complement(376598..376684)
FT                   /note="PS00922 Prokaryotic transglycosylases signature."
FT   CDS_pept        complement(377380..377652)
FT                   /transl_table=11
FT                   /gene="yggX"
FT                   /locus_tag="PMI0325"
FT                   /product="probable Fe(2+) trafficking protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40853"
FT                   /db_xref="GOA:B4EUQ7"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUQ7"
FT                   /protein_id="CAR40853.1"
FT                   /translation="MSRTIFCTFLNKEADGLDFQLYPGELGKRIFNEISKEAWGQWMAK
FT                   QTMLINEKKLNTMNPDDRKLLEQEMVRFLFEGHDVHIDGYTPPEK"
FT   misc_feature    complement(377389..377652)
FT                   /note="HMMPfam hit to PF04362, Protein of unknown function
FT                   (DUF495), score 3.4e-66"
FT   CDS_pept        complement(377683..378723)
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="PMI0326"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40854"
FT                   /db_xref="GOA:B4EUQ8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUQ8"
FT                   /protein_id="CAR40854.1"
FT                   /translation="MMDAQQFSQVVLDWYHKYGRKTLPWQQEKTPYHVWLSEVMLQQTQ
FT                   VATVIPYFERFIARFPNVSALAKAPLDEVLHLWTGLGYYARARNLHKAAQHIVDKHQGQ
FT                   FPDTFEDVCALPGVGRSTAGAILSLSLKKPYPILDGNVKRVLARCYAVEGWPGKKEVEN
FT                   KLWEISEQVTPTKGVEYFNQAMMDLGAMVCTRTKPKCELCPLNTGCIAYAHHSWADYPG
FT                   KKPKKAIPEKTTYFLILQYDNLVWLDKRPPAGIWGGLFSFPQFETKMLLEQWLAEHGLE
FT                   NNKTEQLISFRHTFSHFHLDIVPICVKLSTFTSLMEAQQGLWYNLQTPASVGLAAPVEN
FT                   LLRQLA"
FT   misc_feature    complement(378097..378147)
FT                   /note="PS00764 Endonuclease III iron-sulfur binding region
FT                   signature."
FT   misc_feature    complement(378220..378618)
FT                   /note="HMMPfam hit to PF00730, HhH-GPD superfamily base
FT                   excision DNA repair, score 2.8e-23"
FT   misc_feature    complement(378328..378417)
FT                   /note="PS01155 Endonuclease III family signature."
FT   misc_feature    complement(378337..378426)
FT                   /note="HMMPfam hit to PF00633, Helix-hairpin-helix motif,
FT                   score 1.8e-05"
FT   CDS_pept        378939..379658
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="PMI0327"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40856"
FT                   /db_xref="GOA:B4EUQ9"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUQ9"
FT                   /protein_id="CAR40856.1"
FT                   /translation="MIKNVISPEFNEEGRALRRVRSFVRRQGRLTPRQEQALEKQWPIF
FT                   GIEYQPEPIDFSQVFGRNAPVVLEIGFGMGASLVTMAKNSPENNYFGIEVHAPGVGACL
FT                   ASAQEENISNLRVMCHDAIEVLNHMIPDNSLQMVQLFFPDPWHKARHNKRRIVQVPFAE
FT                   LILTKLAPNGVFHMATDWEPYAEHMLEVMTSVDGYQNLSETQDYVPRPETRPVTKFEQR
FT                   GHRLGHGVWDLMFKRVK"
FT   misc_feature    379062..379652
FT                   /note="HMMPfam hit to PF02390, Putative methyltransferase,
FT                   score 3.4e-96"
FT   CDS_pept        379658..379984
FT                   /transl_table=11
FT                   /locus_tag="PMI0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40859"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUR0"
FT                   /protein_id="CAR40859.1"
FT                   /translation="MAKQRSRRLRKKMRIDEFQELGFSVKWTFPENTPIEEVDSFVDDF
FT                   ILNVIEPNGLAFDASGYLSWEGLICLQKIGKCTEEHRQLVENYLKEKNMQDVQTSELFD
FT                   VWWD"
FT   misc_feature    379658..379978
FT                   /note="HMMPfam hit to PF04320, Protein with unknown
FT                   function (DUF469), score 3.6e-71"
FT   CDS_pept        380061..380987
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="PMI0329"
FT                   /product="putative glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40861"
FT                   /db_xref="GOA:B4EUR1"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUR1"
FT                   /protein_id="CAR40861.1"
FT                   /translation="MTTTLSNALLSDILQQIRPLIGQGKVADYIPALAQVPANQLAMAV
FT                   YTVDGELYQAGMADKRFSIQSISKVLSLTLALTRYDESEIWQRVGKEPSGLPFNSLIQL
FT                   EMEKGLPRNPFINAGAIVITDMLQSRLSAPKQRMLEVIRALTNTADICYNTVVAKSEME
FT                   HLSRNAAIAYLMKSFDNFDNDVITVLETYFHYCSIEMSCVELVRCFSYLANQGICVGSK
FT                   NQIITPRQARQINALMLTCGMYDGAGEFAFRIGIPGKSGVGGGIIAVVPDAFTVAVWSP
FT                   ELDKSGNSLAGCAALELLANKVGRSIF"
FT   misc_feature    380130..380984
FT                   /note="HMMPfam hit to PF04960, Glutaminase, score 3.4e-174"
FT   CDS_pept        381059..381796
FT                   /transl_table=11
FT                   /locus_tag="PMI0330"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40863"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUR2"
FT                   /protein_id="CAR40863.1"
FT                   /translation="MGFKKLVVALVFVASSATAAPSFDCAVTPKDDLRITPEFVEVAGS
FT                   NGLLVIYPDGTLLRDEKSVTLTPEQQAIAKKYQATVRQDIPWLRKEMGIKLQESRKVLD
FT                   KVVIEAFGQDSRILKRLSDLEKNLNQQMDTVISLKPDNVTFHAQAIKQVETKGREIIES
FT                   SLGGMLQDSINELGQKQLLAAASGDRKKALSGLLGNLDGFQQIIEKEWKQQEASFNQFG
FT                   QQACNKITQMENQRVELINSLNK"
FT   misc_feature    381059..381115
FT                   /note="Signal peptide predicted for PMI0330 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.945 between residues 19 and 20"
FT   CDS_pept        381944..382894
FT                   /transl_table=11
FT                   /locus_tag="PMI0331"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40864"
FT                   /db_xref="GOA:B4EUR3"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUR3"
FT                   /protein_id="CAR40864.1"
FT                   /translation="MKKILALVTASLLSVSSFSALSNTSVTYQPNQIVEQQNDKVVIKH
FT                   LLGETAVSKNPSKVVLFDFGLYDSLVALGLADKVVGLPLGNAPEYIKGRIANDVANVGG
FT                   MKAPDFERLAELKPDLIIITGRQGASYEKLTNIAPTINLGTNSANYLDSVEANIQLIGE
FT                   LFDKQQATQTQLATLNTVIEQAQKKAAGSDKKVLVLLHNAGNLMPNNQSVIYDVVKAKK
FT                   AELPPVAEEEKGKRRVVTSEMIAKVNPDVIFIIDRSEAIGAGKLEKNTFENDEVKTTSA
FT                   YKNGGIVYLQSDLWYLSGGGLESLTQQIEAVQSAL"
FT   misc_feature    381944..382009
FT                   /note="Signal peptide predicted for PMI0331 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.909 between residues 22 and 23"
FT   misc_feature    382109..382825
FT                   /note="HMMPfam hit to PF01497, Periplasmic binding protein,
FT                   score 1.7e-39"
FT   CDS_pept        complement(382997..384127)
FT                   /transl_table=11
FT                   /gene="yggW"
FT                   /locus_tag="PMI0332"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40866"
FT                   /db_xref="GOA:B4EUR4"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUR4"
FT                   /protein_id="CAR40866.1"
FT                   /translation="MLKLPPLSLYIHIPWCVQKCPYCDFNSHTLKGEVPHQEYVQHLLN
FT                   DLDADLTHVGSREVQTIFIGGGTPSLLSAESMADLLYGVKERIAVAPDAEITMEANPGT
FT                   VEAERFAGFQRAGINRISIGVQSFGNDKLIRLGRIHDADEAKNAARLAKELGLRSFNLD
FT                   LMHGLPDQSLSQALSDLQQAIALSPPHLSWYQLTIEPNTQFGSRPPKLPDDDMLWDIFS
FT                   EGDKLLTAAGYQQYETSAYCKPGFQCQHNLNYWRFGDYLGIGCGAHGKISFADGRIMRT
FT                   VKTKHPKGFMAGRYLHQQNWVDNDDRPFEFFMNRFRLLEAFPRQDFSDYTGLAQETIRR
FT                   QIDEALALGYISETETHWQITPHGKLFLNSLLELFL"
FT   misc_feature    complement(383030..383374)
FT                   /note="HMMPfam hit to PF06969, HemN C-terminal region,
FT                   score 5.7e-20"
FT   misc_feature    complement(383099..383164)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1576.000, SD 4.55 at aa 326-347, sequence
FT                   FPRQDFSDYTGLAQETIRRQID"
FT   misc_feature    complement(383588..384100)
FT                   /note="HMMPfam hit to PF04055, Radical SAM superfamily,
FT                   score 8.4e-25"
FT   CDS_pept        complement(384120..384713)
FT                   /transl_table=11
FT                   /locus_tag="PMI0333"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40869"
FT                   /db_xref="GOA:B4EUR5"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUR5"
FT                   /protein_id="CAR40869.1"
FT                   /translation="MQKVVLATGNPGKVTELASLLADFGLDIVAQTELGVGSVEETGLT
FT                   FVENALIKARHAAKVTGLPAIADDSGISVDALGGAPGIYSARYAGIEATDQQNVDKLLE
FT                   AMKDVPAEKRQAQFNCVLVYLRHENDPTPLIFHGIWQGVLTQEMQGDGGFGYDPIFFIP
FT                   ELNCTAAQLTREQKNQYSHRGKALKLMLDALKNA"
FT   misc_feature    complement(384132..384704)
FT                   /note="HMMPfam hit to PF01725, Ham1 family, score 1.8e-99"
FT   CDS_pept        complement(384724..385287)
FT                   /transl_table=11
FT                   /locus_tag="PMI0334"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40871"
FT                   /db_xref="GOA:B4EUR6"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUR6"
FT                   /protein_id="CAR40871.1"
FT                   /translation="MNFLNFVILTLIQLYISVLLLRVWMQCVRADFYNPFSQFVVKITQ
FT                   PVVRPLRRIIPSIGSIDTASVILAYVLVLLEIILPSYLSGAGGAIPFSLVLPFAFIELL
FT                   TAAGKIIFWMIIIRAILSWVSQGRNPIDHLLFQLTEPLMAPIRRVIPAMGGLDFSAMIV
FT                   ILILYALNYLRVDVLQWLITMTLY"
FT   misc_feature    complement(384757..384996)
FT                   /note="HMMPfam hit to PF02325, YGGT family, score 9.3e-23"
FT   misc_feature    complement(join(384775..384843,384937..385005,
FT                   385024..385092,385213..385281))
FT                   /note="4 probable transmembrane helices predicted for
FT                   PMI0334 by TMHMM2.0 at aa 3-25, 66-88, 95-117 and 149-171"
FT   misc_feature    complement(385042..385287)
FT                   /note="HMMPfam hit to PF02325, YGGT family, score 1.2e-18"
FT   CDS_pept        complement(385306..386124)
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="PMI0335"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40873"
FT                   /db_xref="GOA:B4EUR7"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUR7"
FT                   /protein_id="CAR40873.1"
FT                   /translation="MEHRNIAFIGAGNMAHAIIAGLVNGGYPAKNITVSSPSEVRREPL
FT                   EKEFAIQSTCDNINAVENADVIVLAVKPQMMAEVCKPLQHIDFSQKLVLTIAAGIPASR
FT                   YNDYLATSLRLIRIMPNTPALVGKGLSGMFAQNTITPEDKQFADALMKSVGMTVWVEQE
FT                   SAINDIIAVAGSAPAYFFLFMESMQQEAERLGFSADVARAIVQQAASGSTALAEKQNSL
FT                   PFSTLREQVTSKGGTTAAALAQFYAGKLPENVALAMQAAIKRAQEMEKQF"
FT   misc_feature    complement(385366..386115)
FT                   /note="HMMPfam hit to PF01089, Delta
FT                   1-pyrroline-5-carboxylate reductase, score 2.8e-93"
FT   misc_feature    complement(386035..386100)
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT   CDS_pept        complement(386143..386841)
FT                   /transl_table=11
FT                   /locus_tag="PMI0336"
FT                   /product="putative amino acid racemase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40875"
FT                   /db_xref="GOA:B4EUR8"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUR8"
FT                   /protein_id="CAR40875.1"
FT                   /translation="MNTIKQNLVNVRSHIDTAAQKCGRSPDEITLLAVSKTKPVSDIEK
FT                   AIACGQTEFGENYVQEGVDKISYFAENKNLVWHFIGPLQSNKTRLVAEHFAWCHTIDRL
FT                   KIAQRLSDQRPTTLPPLNVLIQINISDENSKSGISLTELDGLAAQISILPGIKLRGLMA
FT                   IPAPENDYNKQVEVLEKMHQAFKQLQNQYPDIDTLSMGMTGDMEAAIACGSTLVRIGTA
FT                   IFGARDYANK"
FT   misc_feature    complement(386155..386841)
FT                   /note="HMMPfam hit to PF01168, Alanine racemase, N-terminal
FT                   domain, score 4.5e-41"
FT   misc_feature    complement(386569..386613)
FT                   /note="PS01211 Uncharacterized protein family UPF0001
FT                   signature."
FT   CDS_pept        386869..387882
FT                   /transl_table=11
FT                   /locus_tag="PMI0337"
FT                   /product="putative type II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40877"
FT                   /db_xref="GOA:B4EUR9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUR9"
FT                   /protein_id="CAR40877.1"
FT                   /translation="MEKLIIYSVKHNASDLHLCCGDVPRLRINGVLYQQNQCKPITSDT
FT                   LLKWITPYLTTAQLQFFGKEGQVDTAITLAEGQRLRVNLFRQQLGISAVLRVINSQLPT
FT                   LTSLRVPKSITALLDNVSNGLILVTGATGSGKSSTLAAMIDYLNQHKRQHILTLEAPIE
FT                   FIYTNKQSIIQQREIGRDVQNIASAIKAALRQDPDVIMLGELRDLESIKMALIAAETGH
FT                   LVLATLHTQGVVQTLERVTNVFSSNERQWISAQLAGSLKAIISQQLVPATQGGRVALFE
FT                   VMYMTQGIAHLIREGKYHQVTTLMQTGFEYGMQTFTLSRQQRQYEGLLNEHINEEN"
FT   misc_feature    386875..387684
FT                   /note="HMMPfam hit to PF00437, Type II/IV secretion system
FT                   protein, score 7e-12"
FT   misc_feature    387256..387279
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    387445..387489
FT                   /note="PS00662 Bacterial type II secretion system protein E
FT                   signature."
FT   misc_feature    387772..387837
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1060.000, SD 2.80 at aa 302-323, sequence
FT                   TTLMQTGFEYGMQTFTLSRQQR"
FT   CDS_pept        complement(387879..388298)
FT                   /transl_table=11
FT                   /locus_tag="PMI0338"
FT                   /product="putative holliday junction resolvase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40879"
FT                   /db_xref="GOA:B4EUS0"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUS0"
FT                   /protein_id="CAR40879.1"
FT                   /translation="MSNRTVMGFDFGTKSIGAAIGQEVTGTARPLASFKAKDGIPDWSQ
FT                   IEKIIKEWQPDLVVVGLPLNMDGTEQLVTTQAKKFANRLHGRFGVQIALHDERLSTVEA
FT                   RAHLFEQGGYRSLDKGSVDATSAVIILESWFERQY"
FT   misc_feature    complement(387888..388289)
FT                   /note="HMMPfam hit to PF03652, Uncharacterised protein
FT                   family (UPF0081), score 8.4e-66"
FT   CDS_pept        complement(388298..388861)
FT                   /transl_table=11
FT                   /locus_tag="PMI0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40881"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUS1"
FT                   /protein_id="CAR40881.1"
FT                   /translation="MNLLNHFLIAMPSLSDPLFQRSVVYVCEHNENGAMGLVINKPIED
FT                   ISIESVLEQLEIFSADRDSAISLQKPVMSGGPVAEEHGFILHTPVSGFSSSIKISDSTM
FT                   ITTSKDVLETLGTARQPEKTLVSLGYSSWEKGQLEREILENSWLTVEATPQIIFDTPIA
FT                   ERWHKAAELIGIDIHTISPTAGHA"
FT   misc_feature    complement(388301..388861)
FT                   /note="HMMPfam hit to PF02622, Uncharacterized ACR,
FT                   COG1678, score 7.6e-92"
FT   CDS_pept        complement(388974..389930)
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="PMI0340"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40883"
FT                   /db_xref="GOA:B4EUS2"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUS2"
FT                   /protein_id="CAR40883.1"
FT                   /translation="MIKLGIVMDPISSIKIKKDTSFAMLLEAQRRGWEIHYMEMNDLYL
FT                   NQGEARAHTRLLSVEENPEKWFEFGQEQDIALGSLDTILMRKDPPFDTEFIYATYILER
FT                   AEDMGTLIVNKPQSLRDCNEKLFTAWFPSLTPNTLVTREAKHLRAFHEKHGDVIFKPLD
FT                   GMGGASIFRLKKDDPNVGVIIETLTEHGHRFCMAQNFLPEIVDGDKRILVVDGEPVPYC
FT                   LARIPAKGETRGNLAAGGRGEARPLTESDWAIARQVAPILKQKGLIFVGLDVIGDRLTE
FT                   INVTSPTCAREIEAAYPEVSITGMLMDAIEARLNKKN"
FT   misc_feature    complement(389031..389561)
FT                   /note="HMMPfam hit to PF02955, Prokaryotic glutathione
FT                   synthetase, ATP-gra, score 1.7e-127"
FT   misc_feature    complement(389115..389138)
FT                   /note="PS00030 Eukaryotic putative RNA-binding region RNP-1
FT                   signature."
FT   misc_feature    complement(389571..389927)
FT                   /note="HMMPfam hit to PF02951, Prokaryotic glutathione
FT                   synthetase, N-termi, score 9e-66"
FT   CDS_pept        complement(389941..390672)
FT                   /transl_table=11
FT                   /locus_tag="PMI0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40885"
FT                   /db_xref="GOA:B4EUS3"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUS3"
FT                   /protein_id="CAR40885.1"
FT                   /translation="MRIPRIYHPEPLSAGTQTSLAEEAANHVGRVLRMSKGQKLALFDG
FT                   SNQVFDADIIESSKKSVIVQINEGQMDDRESPLDLHLGQVLSRGEKMEFTIQKSVELGV
FT                   NTITPLISERCGVKLDPSRLEKKHQQWQKIIISACEQCGRNKIPQLMPVMSLEAWCAQT
FT                   DDSLKLNLHPRASQSINTLPLPVKKVRLLIGPEGGLSPEEIAMTAKYHFTDILLGPRVL
FT                   RTETTALTAITALQVRFGDLG"
FT   misc_feature    complement(389965..390279)
FT                   /note="HMMPfam hit to PF04452, Protein of unknown function
FT                   (DUF558), score 4.5e-41"
FT   CDS_pept        390920..391552
FT                   /transl_table=11
FT                   /locus_tag="PMI0342"
FT                   /product="putative type IV prepilin-like leader peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40886"
FT                   /db_xref="GOA:B4EUS4"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUS4"
FT                   /protein_id="CAR40886.1"
FT                   /translation="MLLPQNIMITMAFFTFLKGCSDYFSTSVLARLSPIRYQQLWQVYL
FT                   IICFYWSFTISNYSLLILFLLFSFYLLTLSFFDADYLQLPDNLTFWLLFFGITLNLTPY
FT                   GVISSTCSFYGCLVASLFFYSIYWLGYWIYQEAILGLGDVKLFSAIGAWCGIELLPYIL
FT                   FFAALLGIVIYMLIWAFTNVKIKQIAFGSCLAFSAIVVLRVKTIIMY"
FT   misc_feature    390920..391009
FT                   /note="Signal peptide predicted for PMI0342 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.741) with cleavage site
FT                   probability 0.739 between residues 30 and 31"
FT   misc_feature    join(391052..391120,391178..391246,391265..391333,
FT                   391391..391459,391478..391546)
FT                   /note="5 probable transmembrane helices predicted for
FT                   PMI0342 by TMHMM2.0 at aa 45-67, 87-109, 116-138, 158-180
FT                   and 187-209"
FT   misc_feature    391112..391444
FT                   /note="HMMPfam hit to PF01478, Type IV leader peptidase
FT                   family, score 4.1e-17"
FT   CDS_pept        complement(391654..392301)
FT                   /transl_table=11
FT                   /locus_tag="PMI0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40891"
FT                   /db_xref="GOA:B4EUS5"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUS5"
FT                   /protein_id="CAR40891.1"
FT                   /translation="MNQENSTKKLHYIYDPLCGWCYGIAPLIEVVSHEYPHVLTLHGGG
FT                   LFTPTRKVTGGDAWKEHVTPIDERISQLSGQIFSQQYRDNLANTEMTLNSLMPIAAILV
FT                   ARKMGDRDVMLLKALQDAYYLDGLNISDKDVLFFIVQKLGFDITLFSTLFTQVNEYEIT
FT                   QHIQQTQQLMHQVNGRGFPTLCIEDNQTYQLIPVENYFGDTKSWTSFLKQTL"
FT   CDS_pept        complement(392307..393194)
FT                   /transl_table=11
FT                   /locus_tag="PMI0344"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40893"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUS6"
FT                   /protein_id="CAR40893.1"
FT                   /translation="MEKIKMKKLLPLTLATTAFFATSVMATELTLDIYNPGDASVFPVS
FT                   SEIIYGDKDAVLIDAQFQKNDAQALVDKIKASGKNLTYIYISHSDPDFYFGLDVITEAF
FT                   PNAKVIASAPTVKIINETQAGKLAYWGPVLKDNAPKKVIIPEVVTGDSFSLEGEKLYIK
FT                   GLDSQSPERTYVYVPKLNAIMGGVILSENIHVWLADTQSKAQRQYWLEALQQIKTLSPK
FT                   TVIPGHYVPKSNYDMRSVDFTMNYLKEAETKLAETQNSEQFIAAMEKSYPDLADKSSLE
FT                   LSAKVLKGEMKWPQ"
FT   misc_feature    complement(392511..393068)
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 1.1e-12"
FT   misc_feature    complement(393102..393170)
FT                   /note="1 probable transmembrane helix predicted for PMI0344
FT                   by TMHMM2.0 at aa 19-41"
FT   misc_feature    complement(393117..393194)
FT                   /note="Signal peptide predicted for PMI0344 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.998 between residues 36 and 37"
FT   CDS_pept        393284..394204
FT                   /transl_table=11
FT                   /locus_tag="PMI0345"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40894"
FT                   /db_xref="GOA:B4EUS7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUS7"
FT                   /protein_id="CAR40894.1"
FT                   /translation="MDKIKASEVFVTIVKQGSMIKAADYLGMSRAMVTRYLNEMEEWAG
FT                   VRLLHRTTRKQSLTSVGELVYQQSLQLLEMAERIPANIPKESHQISGLVRITTAQSLAN
FT                   CALSVAITEFIQLYPLIAVDLQISNQTVNLIEERIDIALRITNHLEPNLIARPLAKCFS
FT                   VVCAHKDYLAKHGIPNTPDDLTYHQCLTYRFFGSSLWEFSLGDERYSVPVGGNLSANES
FT                   VVLLQATLQGAGVSLQPYCSAKPYLERGELEILLADYQPQPMGIYAVLASRQNMPAAVR
FT                   VLLDFLVDWFASSPHWLSLSGERVS"
FT   misc_feature    393308..393472
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 1.1e-10"
FT   misc_feature    393332..393397
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1757.000, SD 5.17 at aa 17-38, sequence
FT                   GSMIKAADYLGMSRAMVTRYLN"
FT   misc_feature    393335..393427
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    393542..394159
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 7e-45"
FT   CDS_pept        complement(394181..395107)
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="PMI0346"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40897"
FT                   /db_xref="GOA:B4EUS8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUS8"
FT                   /protein_id="CAR40897.1"
FT                   /translation="MKTPFSWRHIEIFHAVMTTQNLTEAADLLKTSQPTVSRELSRLEQ
FT                   LLSFKLFDRIKGRLQPTTEGLRFFEEVQRSYYGLDRIITAANSIRHFHQAELNITCLPA
FT                   FAQSLLPSICQQFLSQYPEVNLTIVPQESPLLEEWLSAQHYDLGLTEHTQTPAGTQQET
FT                   LLTLNEVAILPKSHVLSKKALLQPQDFHQTRFISLSANDSYRQLIDAMFIKQGITRQLI
FT                   METQSAASICAMVSKGIGVSIVNPITALDYQYSDLCIRPLSFTIPFTVSLITPSHRPSS
FT                   QLVRYFIDVMKTTLANYPKQLTHAFTR"
FT   misc_feature    complement(394220..394840)
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 8.6e-39"
FT   misc_feature    complement(394910..395089)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 1.1e-16"
FT   misc_feature    complement(394955..395047)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(394985..395050)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1850.000, SD 5.49 at aa 20-41, sequence
FT                   QNLTEAADLLKTSQPTVSRELS"
FT   CDS_pept        395217..396461
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="PMI0347"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40899"
FT                   /db_xref="GOA:B4EUS9"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUS9"
FT                   /protein_id="CAR40899.1"
FT                   /translation="MMTTSNNAILSQLAQTYGTPLWIYQGETISEHIEQLKAFDVVRFA
FT                   QKACSNIHILRLMKQQGVKVDSVSLGEIERALVAGFQGGRERSEIIFTADLLDEKTIER
FT                   VVELDIPVNAGSIDMLRQLGERHQGHAVWIRINPGFGHGHSQKTNTGGENSKHGIWYED
FT                   VPEALAVINQYNLSLVGFHMHIGSGVDYQHLASVCDAMVEQVLTSNVDIKAISAGGGLS
FT                   TPYQQGDKRVDLNHYFSLWDSARQRIAQHLGHDIELEIEPGRFLVAESGVLVSQVRAVK
FT                   SMGNRHYVLVDAGFSDLMRPAMYGSYHQITLLDKYGQLKSSEFQQETIVAGPLCESGDV
FT                   FTQQEGGMVAPRLLPPAEVGDYLVIHDTGAYGASMSSNYNSRPLIPEVLISQGIPQLIR
FT                   RRQTIEELLALEINL"
FT   misc_feature    395292..396023
FT                   /note="HMMPfam hit to PF02784, Pyridoxal-dependent
FT                   decarboxylase, py, score 1.1e-64"
FT   misc_feature    395346..395402
FT                   /note="PS00878 Orn/DAP/Arg decarboxylases family 2
FT                   pyridoxal-P attachment site."
FT   misc_feature    395838..395882
FT                   /note="PS00879 Orn/DAP/Arg decarboxylases family 2
FT                   signature 2."
FT   misc_feature    396030..396389
FT                   /note="HMMPfam hit to PF00278, Pyridoxal-dependent
FT                   decarboxylase, C-, score 1.5e-50"
FT   CDS_pept        complement(396595..399042)
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="PMI0348"
FT                   /product="acyl-coenzyme A dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40903"
FT                   /db_xref="GOA:B4EUT0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUT0"
FT                   /protein_id="CAR40903.1"
FT                   /translation="MTLLSIVLFLVLIGILSYRKYSLVVSSILLIAYTFVMGLANIWSY
FT                   WLLLPVALILLPFTLPSIRKAYISAPALKAFQKVMPSMSKTEQEAIDAGTTWWEGELFR
FT                   GAPDWKQLHNYPKPQLTAEEQAFLDGPVEEVCRMTNDFQITHELADLPPEIWQYLKDHR
FT                   FFAMIIKKEYGGLEFSAYAQSRVLQKLAGVSGILAITVGVPNSLGPGELLQHYGTDEQK
FT                   KRYLPGLAKGDEIPCFALTSPEAGSDAGAIPDSGVVCMGDWQGEQVLGIRLTWNKRYIT
FT                   LAPIATVLGLAFKLRDPDHLLSDNENPGITCALIPTDVKGVEIGHRHFPLNVPFMNGPT
FT                   RGKDVFVPIDFIIGGPKMAGQGWRMLVECLSVGRGITLPSNSTGGLKSAAMATGAYSRI
FT                   RRQFKLPIGKMEGIEEPLARLAGNAYLLDAASTLITTGIMLGEKPAVLSAIVKYHCTHR
FT                   AQRGIIDAMDIVGGKGICLGPSNFVARSYQGSPIAITVEGANILTRSMIIYGQGAIRCH
FT                   PYVLDEIAAARDNNLHDFDHALFGHLGHVASNTLRSLWLGITNGRLSTAPTKDETRRYY
FT                   QQINRLSANMALLSDVAMGVLGGSLKRRERISARLGDILSHIFLASAVLKRYEDEGRNT
FT                   ADLPLVHWGIKECLYQAENAIDELLRNFPNRFVAGALRAIIFPLGKVQKLPSDKLDSKV
FT                   AQIIQQPSETRDRIGKGQFLTPSEHNPHGLMEEALLDILAAEPLFERICRLYEKKFSFT
FT                   QLDKLADKALADKRVTPEEADILRKAEQSRLRSINVDEFDFDALAVPAKKSSTDTIKTD
FT                   KAA"
FT   misc_feature    complement(397522..397965)
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 1.1e-26"
FT   misc_feature    complement(398338..398682)
FT                   /note="HMMPfam hit to PF02771, Acyl-CoA dehydrogenase,
FT                   N-terminal doma, score 2.4e-05"
FT   misc_feature    complement(join(398902..398970,398989..399033))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0348 by TMHMM2.0 at aa 4-18 and 25-47"
FT   CDS_pept        399281..399859
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="PMI0349"
FT                   /product="Phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40905"
FT                   /db_xref="GOA:B4EUT1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUT1"
FT                   /protein_id="CAR40905.1"
FT                   /translation="MYQDLIRGELTEAADTLSRFLQDDANIEAIQKAAVLLADSFKAGG
FT                   KVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVSNDFGYEYVFSRY
FT                   VEAVGKEGDVLLGISTSGNSGNIIKAISAAREKGMKVITLTGKDGGKMAGSADIEIRVP
FT                   HFGYADRIQEIHIKVIHILIQLIEKEMEK"
FT   misc_feature    399392..399856
FT                   /note="HMMPfam hit to PF01380, SIS domain, score 1.7e-23"
FT   CDS_pept        399918..400685
FT                   /transl_table=11
FT                   /locus_tag="PMI0350"
FT                   /product="putative amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40907"
FT                   /db_xref="GOA:B4EUT2"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUT2"
FT                   /protein_id="CAR40907.1"
FT                   /translation="MCELLGMSANVPTDINFSLSGLIPRGGKTGPHKDGWGITFYEGLG
FT                   CRTFKDPQASAVSPVARFVQEYPIKSHAVIAHIRQANRGNVSLENTHPFTRELWGKNWT
FT                   YAHNGQLKGYQSLDTGRFRAVGQTDSEKAFCWILNQLEKRYQRTPSNWPAVFRFIAILA
FT                   DQLRQKGVFNMLLSDGRFVMAYCSTNLHWITRKAPFGKAKLLDQDIEIDFQQHTKADDI
FT                   VSVISTLPLTGNESWQKIPVGEFVLFDRGLRIL"
FT   misc_feature    399921..400568
FT                   /note="HMMPfam hit to PF00310, Glutamine amidotransferases
FT                   class-II, score 8.6e-23"
FT   CDS_pept        complement(400656..401408)
FT                   /transl_table=11
FT                   /locus_tag="PMI0351"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40910"
FT                   /db_xref="GOA:B4EUT3"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUT3"
FT                   /protein_id="CAR40910.1"
FT                   /translation="MTSHAKQLIIFLTIILTSLFVNAENSSKFLIKPVKKSTGEPIYIQ
FT                   IFKEENLLELYIEKQDGQLEKIRTYPICSYSGGLGPKKYQGDLKSPEGFYQVNQTQLNP
FT                   NSRFYRAINLGFPNQYDQEQGYTGDFLMIHGACKSVGCYAMTDTVMDEIYQYAELALKN
FT                   GQQSINIHIFPFKMTAENMKKFQYSANMDFWQQLAPAYQYVEEYKKIPSISVKNGRYLV
FT                   NNREAISTLNLAKSIDSKWLQNSQPTIK"
FT   misc_feature    complement(400725..401312)
FT                   /note="HMMPfam hit to PF06104, Bacterial protein of unknown
FT                   function (DUF94, score 2.2e-107"
FT   misc_feature    complement(401340..401408)
FT                   /note="Signal peptide predicted for PMI0351 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.996 between residues 23 and 24"
FT   CDS_pept        401824..403164
FT                   /transl_table=11
FT                   /gene="nqrA"
FT                   /locus_tag="PMI0352"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit A"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40912"
FT                   /db_xref="GOA:B4EUT4"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUT4"
FT                   /protein_id="CAR40912.1"
FT                   /translation="MIKIKKGLDLPIAGAPAQVIEDGPAIRHVALLGEEYVGMRPSMMV
FT                   SEGEHVKKGQVLFEDKKNPGVIFTSPACGKVVAINRGERRVLQSVVIEVDGDEEVTFDS
FT                   YDSSSLSELTREQVETNLVNSGLWTALRTRPYSRSPKLGTTPVAIFVTAMDTNPLAADP
FT                   TVIIEQNEQAFNDGLIVLSKLTEGKVHVCHGEKAPAKLNDGQISYNQFVGPHPAGLVGT
FT                   HIHFLEPVSAKKMVWHLNYQDVIAMGYLFTTGSLYTERVVALAGPQVKAPRLLRTCLGA
FT                   DLYELTKDQLVDGDNRIISGSILWGWKSDEAHHYLGRFHNQVSVLREGREKELFGWGYP
FT                   GTNKFSITRTTIGHFLKNKRFAFTTTMNGGERSMVPIGNYERVMPLDIMATHLLRDLIV
FT                   GDTDSAQALGCLELDEEDLGLCTYVCPSKYEYGPALRQVLTKIEQEG"
FT   misc_feature    401824..403161
FT                   /note="HMMPfam hit to PF05896, Na(+)-translocating
FT                   NADH-quinone reductase s, score 5.8e-286"
FT   misc_feature    402454..402477
FT                   /note="PS00191 Cytochrome b5 family, heme-binding domain
FT                   signature."
FT   CDS_pept        403168..404406
FT                   /transl_table=11
FT                   /gene="nqrB"
FT                   /locus_tag="PMI0353"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit B"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40914"
FT                   /db_xref="GOA:B4EUT5"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUT5"
FT                   /protein_id="CAR40914.1"
FT                   /translation="MGLKNLFEKVEHHFEPGGKYAKWYVLYEAVTTVFYTPGTVTRNGS
FT                   HVRDTIDLKRMMILVWLSVFPAMFWGMYNVGQQAIPALNQLYSGAELQQVIASDWHYAL
FT                   AQYLGASLTPDAGWGSKMLLGATYFLPIYLVVFAVGGFWEVLFSLIRGHEINEGFFVTS
FT                   ILFALIVPPTLPLWQAALGITFGVVIAKEIFGGTGRNFLNPALAGRAFLFFAYPAQISG
FT                   DLVWTAADGFSGATPLSQWSVSGQSALLNNVTQQPISWMDAFLGNIPGSIGEVSTLMIL
FT                   IGGAIILFARIASWRIVAGVMVGMIAMSYLFNLIGSDSNPLFSMPWHWHLVLGGFAFGM
FT                   MFMATDPVSASFTDKGKWAYGILIGVMAVLIRVVNPAYPEGMMLAILFANLFAPLFDYV
FT                   VVQANIKRRKARG"
FT   misc_feature    403279..404391
FT                   /note="HMMPfam hit to PF03116, NQR2, RnfD, RnfE family,
FT                   score 1.7e-204"
FT   misc_feature    join(403339..403407,403540..403608,403642..403710,
FT                   403969..404037,404056..404115,404143..404202,
FT                   404239..404292,404302..404370)
FT                   /note="8 probable transmembrane helices predicted for
FT                   PMI0353 by TMHMM2.0 at aa 58-80, 125-147, 159-181, 268-290,
FT                   297-316, 326-345, 358-375 and 379-401"
FT   CDS_pept        404399..405184
FT                   /transl_table=11
FT                   /gene="nqrC"
FT                   /locus_tag="PMI0354"
FT                   /product="Na+-translocating NADH-quinone reductase subunit
FT                   C"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40916"
FT                   /db_xref="GOA:B4EUT6"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUT6"
FT                   /protein_id="CAR40916.1"
FT                   /translation="MAKEKNKDSVGRTFLVVFILCLVCSVVVAGSAVGLKSKQEEQKLL
FT                   DKQRNILDVAGLLVPKMSASEVLKVYDTRIKAKIVNFKTGELTDSKGDFDLNSELRSDE
FT                   TSIALSPEEDIAKIRRRANTAEVYFVLDDQGKTQEVVLPVYGSGLWSVMYAFVAVDIDG
FT                   VTAKGITYYSHGETPGLGGEVDNPQWKAQWKGKRLLNEEGVPAIKIVRGGASDSPYGID
FT                   GLSGATLTSNGVQHMFDFWLGDKGFGPFLKKVREGEING"
FT   misc_feature    404399..404485
FT                   /note="Signal peptide predicted for PMI0354 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.994) with cleavage site
FT                   probability 0.871 between residues 29 and 30"
FT   misc_feature    404435..404503
FT                   /note="1 probable transmembrane helix predicted for PMI0354
FT                   by TMHMM2.0 at aa 13-35"
FT   misc_feature    404840..405133
FT                   /note="HMMPfam hit to PF04205, FMN-binding domain, score
FT                   6.8e-17"
FT   CDS_pept        405177..405806
FT                   /transl_table=11
FT                   /gene="nqrD"
FT                   /locus_tag="PMI0355"
FT                   /product="Na+-translocating NADH-quinone reductase subunit
FT                   D"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40918"
FT                   /db_xref="GOA:B4EUT7"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUT7"
FT                   /protein_id="CAR40918.1"
FT                   /translation="MADTKEIKRVLLGPLLDNNPIALQVLGVCSALAVTTKLETALVMT
FT                   IAVTLVTAFSNFFISLIRNYIPGSVRIIVQMAIIASLVIVVDQVLQAYAYEISKQLSVF
FT                   VGLIITNCIVMGRAEAYAMKSPPIESFMDGIGNGLGYGVILILVGFLRELFGSGKLFGI
FT                   TVMESIQNGGWYQPNGLFLLAPSAFFIIGLLIWGLRTLKPAQVEED"
FT   misc_feature    405186..405764
FT                   /note="HMMPfam hit to PF02508, Rnf-Nqr subunit, membrane
FT                   protein, score 1.4e-94"
FT   misc_feature    join(405294..405362,405390..405458,405477..405545,
FT                   405588..405644,405705..405773)
FT                   /note="5 probable transmembrane helices predicted for
FT                   PMI0355 by TMHMM2.0 at aa 40-62, 72-94, 101-123, 138-156
FT                   and 177-199"
FT   CDS_pept        405812..406408
FT                   /transl_table=11
FT                   /gene="nqrE"
FT                   /locus_tag="PMI0356"
FT                   /product="Na+-translocating NADH-quinone reductase subunit
FT                   E"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40920"
FT                   /db_xref="GOA:B4EUT8"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUT8"
FT                   /protein_id="CAR40920.1"
FT                   /translation="MEHYISLFVRAVFIENMALAFFLGMCTFLAVSKNVKTAFGLGIAV
FT                   TVVLGLSVPLNNLVYNYVLRANALMEGVDLSFLNFITFIGVIAALVQILEMILDRYFPS
FT                   LYNALGIFLPLITVNCAIFGGVSFMAQRDYNFSESIVYGFGSGIGWMLAIVLLASIREK
FT                   MKYADVPSGMKGLGVTFVTTGLMALGFMSFSGVQL"
FT   misc_feature    405812..406405
FT                   /note="HMMPfam hit to PF02508, Rnf-Nqr subunit, membrane
FT                   protein, score 6.6e-115"
FT   misc_feature    join(405845..405904,405932..406000,406037..406105,
FT                   406133..406201,406226..406294,406337..406399)
FT                   /note="6 probable transmembrane helices predicted for
FT                   PMI0356 by TMHMM2.0 at aa 12-31, 41-63, 76-98, 108-130,
FT                   139-161 and 176-196"
FT   CDS_pept        406425..407651
FT                   /transl_table=11
FT                   /gene="nqrF"
FT                   /locus_tag="PMI0357"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit F"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40922"
FT                   /db_xref="GOA:B4EUT9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR010205"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUT9"
FT                   /protein_id="CAR40922.1"
FT                   /translation="MDIIILGVAMFTLIVLVLTALILFAKSKLVNTGDIEVEVNGDPEK
FT                   SFHAPAGDKLLNVLSNEGIFISSACGGGGSCGQCRVKVLEGGGDILPTELSHINKREAK
FT                   EGCRLACQVNVKNNLKLELPEEIFGIKKWECEVISNDNKATFIKELVLKIPEGEVVPFR
FT                   AGGFIQIECPPHTVRYEDFDVPEEYREDWDKFNLFRYVSEVKETTVRAYSMANYPEEHG
FT                   IIMLNVRIATPPPRNPDVPPGIMSSYIWSLKPGDKVTISGPFGEFFAKETDAEMIFIGG
FT                   GAGMAPMRSHIFDQLKRLHSKRKISFWYGARSVREMFYTEDFDMLAKENENFTWHVALS
FT                   DALPEDNWTGYTGFIHNVLYENYLKDHPAPEDCEFYMCGPPVMNAAVIKMLKDLGVEDE
FT                   NIMLDDFGG"
FT   misc_feature    406425..406499
FT                   /note="Signal peptide predicted for PMI0357 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.980) with cleavage site
FT                   probability 0.946 between residues 25 and 26"
FT   misc_feature    406431..406499
FT                   /note="1 probable transmembrane helix predicted for PMI0357
FT                   by TMHMM2.0 at aa 3-25"
FT   misc_feature    406533..406775
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding doma, score 2.2e-13"
FT   misc_feature    406620..406652
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    407241..407594
FT                   /note="HMMPfam hit to PF00175, Oxidoreductase NAD-binding
FT                   domain, score 3.5e-23"
FT   CDS_pept        407737..408759
FT                   /transl_table=11
FT                   /gene="apbE"
FT                   /locus_tag="PMI0358"
FT                   /product="thiamine biosynthesis lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40924"
FT                   /db_xref="GOA:B4EUU0"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUU0"
FT                   /protein_id="CAR40924.1"
FT                   /translation="MLKRKMMHGILMLCALVFLSACGEKQQVLEGETMGTYYSIKYVPS
FT                   SDSPSQSVLQTEIDRILEEVNDQMSTYRPQSELSRFNQSREINTPFPVSPATAKVVSEA
FT                   IRINKITDGALDVTVGPLVNLWGFGPEGRFTHQPSADELAKRKKWTGIDYLAVEGNTLI
FT                   KKIPELYVDLSSIAKGYGVDAVAEYLISQNITNYMVDIGGEVRTQGVNGNDKPWRIAIE
FT                   KPANDGTTQSVQLIIEPGDNSIATSGDYRNYFEEDGVRFSHTIDPTTGRPIKHNLASIT
FT                   VIVPTCMSADGLSTGLNVLGPEKGLEVANKLNIPVFMIVKTENGFEERYSKAFAPFLKK
FT                   "
FT   misc_feature    407737..407805
FT                   /note="Signal peptide predicted for PMI0358 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.700 between residues 23 and 24"
FT   misc_feature    407755..408708
FT                   /note="HMMPfam hit to PF02424, ApbE family, score 4.9e-113"
FT   misc_feature    407770..407802
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        408779..409006
FT                   /transl_table=11
FT                   /locus_tag="PMI0359"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40927"
FT                   /db_xref="InterPro:IPR007495"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUU1"
FT                   /protein_id="CAR40927.1"
FT                   /translation="MLKIFLFAFILFLLAFFGMALGYIVKRKSIQGSCGGLGSIGIEKE
FT                   CDCPEPCDARKKRMAKEAARQELLQKNRIL"
FT   misc_feature    408779..408844
FT                   /note="Signal peptide predicted for PMI0359 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.819 between residues 22 and 23"
FT   misc_feature    408845..408979
FT                   /note="HMMPfam hit to PF04400, Protein of unknown function
FT                   (DUF539), score 8.3e-24"
FT   CDS_pept        complement(409163..409375)
FT                   /transl_table=11
FT                   /locus_tag="PMI0360"
FT                   /product="putative general stress response protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40933"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUU2"
FT                   /protein_id="CAR40933.1"
FT                   /translation="MLNNKASGDWNLFKGKVKEKWGKLTHDELDIIEGTREQLIGKLQE
FT                   HYGYSYDEAKKEVLEWEGSNPYPWK"
FT   misc_feature    complement(409208..409366)
FT                   /note="HMMPfam hit to PF05532, CsbD-like, score 3.4e-14"
FT   CDS_pept        complement(409469..410341)
FT                   /transl_table=11
FT                   /locus_tag="PMI0361"
FT                   /product="putative phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40934"
FT                   /db_xref="GOA:B4EUU3"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUU3"
FT                   /protein_id="CAR40934.1"
FT                   /translation="MIKIFIAISFLFYSVFVMTSPKIIAHRGGTADAPENTEIAIKTAL
FT                   SNQADAIWITVQLSKDNVPVLYRPSDLKSLTNGQGAISTFTAKELAQWDAGYKYGEAQQ
FT                   FPYRNKGVTIPTLEYILTQFPKTQFYIDLKSPDADPVIQGKALASVLSKHNALERTRVY
FT                   STNSAFLDALPDNVQRFESRDVTRDILANITMGHICLLPENLDITRWYGLELHRKVEVV
FT                   EKYTLGEARSAAVLSWDKDAMSCFRAGGNAHIVLFGINTEKDYLQAVELGADAVMVDSP
FT                   AKIKAFRKE"
FT   misc_feature    complement(409493..410266)
FT                   /note="HMMPfam hit to PF03009, Glycerophosphoryl diester
FT                   phosphodiesterase, score 3e-20"
FT   misc_feature    complement(410285..410341)
FT                   /note="Signal peptide predicted for PMI0361 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.917) with cleavage site
FT                   probability 0.813 between residues 19 and 20"
FT   CDS_pept        410577..411632
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="PMI0362"
FT                   /product="DNA polymerase IV"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40935"
FT                   /db_xref="GOA:B4EUU4"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUU4"
FT                   /protein_id="CAR40935.1"
FT                   /translation="MRKIIHVDMDCFYAAIEMRDNPTLKEIPIAVGGNASRRGVICTAN
FT                   YPARRFGVRSAMSTATALKLCPHLKVLPGRMALYKETSAKIRQIFARYTDLIEPLSLDE
FT                   AYLDVSDSKHCHGSATLIAQQIRQQIFAELNLTASAGIAPIKFLAKIASDLNKPNGQYV
FT                   ITPEQMDDFILKLPLNKIPGVGKVTFARLQEMGLETCADVRGTDVISLVRNLGKFGQSL
FT                   WERSHGIDERLINPERLRKSVGVERTLAEDIDSWDECLALLDGLYDELEKRLSRVKPDL
FT                   RIARQGVKLKFDDFQLTTQEHSHPILEKTDLIDIAYQAWHERRNGRGVRLVGFHVTLQD
FT                   PQMERQLLLAL"
FT   misc_feature    410595..411599
FT                   /note="HMMPfam hit to PF00817, impB/mucB/samB family, score
FT                   3.8e-114"
FT   CDS_pept        complement(411709..413871)
FT                   /transl_table=11
FT                   /locus_tag="PMI0363"
FT                   /product="TonB-dependent ferric siderephore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40937"
FT                   /db_xref="GOA:B4EUU5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUU5"
FT                   /protein_id="CAR40937.1"
FT                   /translation="MSKKIIATNLLLTLPFSLLSLQIHAAMTQNSPDKIIVTASPSQDP
FT                   QGPISGLVATKTLSTNKILSDIDKTPQSISVITRDQMDAQDVSSVSQALRYTPGVFTEY
FT                   RGSSNRNDEIFIRGYSYAPRFLDGLSYGMGASSSTGAIDPWLLERVELIRGPSSVLYGQ
FT                   LNPGGLVAMTSKRPTSTTINHIQARVGNDKLAETAFDFAGSLSDDNRILYRLNGLAKTQ
FT                   QTQIKDYKEERFALAPAITFLPNEQTRLTLLSFIQQEPEAGYRNFLPAYGTVKTTPEGT
FT                   IPFDFNVNNADYHQSWRQQYGVGYEFEHEFNDRLKLIQNARYSHIKQKYKYLVFGSLRK
FT                   DNPYILERRAQQEKRETDTFGIDTRLQADFDTEKLAHTVIIGIDYQWSKNKDNLLQAMG
FT                   PEYDLDWRNPNYHYPIDISLQKPVTNQLQKHDQLGIYLQDQIQWKNWILLGGLRQDWAQ
FT                   VRTYDHIKSSKDQQDDQKLTGRVGLLYAFDNGISPYISYSTSFEPNLQTRRAPGSAPFE
FT                   PSEGRQLEVGIKYLTPNEQTLATLSIYQLQQRNVTNYNAEKAYFEPVGEIRSRGIEAQI
FT                   NSQLTENISFISSYAYTDTEVRKTITAGTQGKELPRVPKHMASFWGQYDETSGLFNGAK
FT                   AGFGVRYIGVSQGDTKNTISVPAVTLYDAMVGYSLGELSSSLKGAEVQLNMNNIANKHY
FT                   VASCAGETACFYGIGRTMTATINYRW"
FT   misc_feature    complement(411712..412440)
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor,
FT                   score 1.3e-21"
FT   misc_feature    complement(413365..413676)
FT                   /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug
FT                   Domain, score 1.4e-26"
FT   misc_feature    complement(413797..413871)
FT                   /note="Signal peptide predicted for PMI0363 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.792 between residues 25 and 26"
FT   CDS_pept        complement(414121..415578)
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="PMI0364"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /EC_number="3.4.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40939"
FT                   /db_xref="GOA:B4EUU6"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUU6"
FT                   /protein_id="CAR40939.1"
FT                   /translation="MSELSTLSPQPLWDIFAKICSIPHPSYHEEALASHIMAWATEKGL
FT                   SVERDAVGNILIRKPATKGMEDRKTVVLQAHLDMVPQKNNDTEHDFTKDPIQPYIDGEW
FT                   VKAKGTTLGADNGVGMASALAVLADDTVKHGPLEVLLTMTEETGMDGAFGLQPGWLQAD
FT                   ILINTDSEEEGEIYMGCAGGIDVKTTVDLTYEAIPANHIVKKLVLKGLNGGHSGGDIHL
FT                   GLGNANKLLARFLAEHADELALKLIDFHGGTLRNAIPREAHIIFAIPADKATQLNSITT
FT                   EFEALLKSELAIAEKNLAIELTDTSTEKPVFTADCQSRTINLLNAMPNGVIRMSDDVEG
FT                   VVETSLNVGVVSIVDDKVEILCLIRSLIDSGKTYVVSMLTALAKLAQADIETKGGYPGW
FT                   KPDADSPVMHLVRDTYQQLFDKVPNIMVIHAGLECGLFKKPYPDMDMVSIGPTIRGAHS
FT                   PDERVHIKSVGQYWQLLTAILKAIPAK"
FT   misc_feature    complement(414694..414963)
FT                   /note="HMMPfam hit to PF07687, Peptidase dimerisation
FT                   domain, score 1.9e-15"
FT   CDS_pept        415932..416393
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="PMI0366"
FT                   /product="xanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40941"
FT                   /db_xref="GOA:B4EUU7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUU7"
FT                   /protein_id="CAR40941.1"
FT                   /translation="MSEKYVVTWDMLQIHARQLAQRLLPVEQWTGIIAVSRGGLVPAAL
FT                   LARELGIRHVDTVCISSYDHDHQRDLKILKKAEGDGEGFIVVDDLVDTGGTAKVIREMY
FT                   PKAHFVTIFAKPEGRPLVDDFVVDIPQNTWIEQPWDMGVMFVPPVCDKK"
FT   misc_feature    415932..416312
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 1.6e-19"
FT   misc_feature    416181..416219
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT   CDS_pept        416626..417876
FT                   /transl_table=11
FT                   /gene="yafA"
FT                   /locus_tag="PMI0367"
FT                   /product="putative esterase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40943"
FT                   /db_xref="GOA:B4EUU8"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUU8"
FT                   /protein_id="CAR40943.1"
FT                   /translation="MANNTNLSETLFKPRAKHAETSTLIQYTHPKSNIDSYSVLNGMSQ
FT                   QNWYRTIQRLQWIWRGISPIEIEEVLSRIAIFDAPRSDDKFIDTVVGYRRGNWSFEWSH
FT                   QAMIWQQKALRETSEEAAADCWLRAANLYSIAAYPFINGDFLADQAVVLAMKAFENAMK
FT                   FSSFEVKKLTFKLTGKGTTSGFLHLPKGCKGPYPTVIFCGGLDSLQSDYVNFFRRYLSP
FT                   KGIAMLTVDMPSIGYSVKQKLSENTCQLHGDILQQLGDIPWIDHTRVGVMGFRFGANIA
FT                   VRLAYLYPKLIKGVVALGPLIHAFFTQAELQKKIPIMYLDVLASRLGLLNIDENNLRLS
FT                   LSSYSLKNQGLIGRRMPVPMMSVYWKGDEISPKEDSQLIARSSMDGDIVEIKEKPLYKG
FT                   LEQALTKSADWIYAKLI"
FT   misc_feature    416629..417873
FT                   /note="HMMPfam hit to PF06500, Protein of unknown function
FT                   (DUF1100), score 6.5e-207"
FT   CDS_pept        417948..418349
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="PMI0368"
FT                   /product="curlin genes transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40945"
FT                   /db_xref="GOA:B4EUU9"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="PDB:3RPJ"
FT                   /db_xref="PDB:4Q11"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUU9"
FT                   /protein_id="CAR40945.1"
FT                   /translation="MTSSLHPTRGKLLKRFAQIGPYIREQQCQESQFFFDCLAVCVNKK
FT                   VTPEKREFWGWWMELERNGEQLIYYYQVGLFDKNGDWVNQVISKKDVIESIHETLIRFH
FT                   DFLQAAVSELEMTLVPDEKMSNFPLPLKP"
FT   misc_feature    417951..418340
FT                   /note="HMMPfam hit to PF07417, Transcriptional regulator
FT                   Crl, score 2.7e-52"
FT   CDS_pept        418462..419565
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="PMI0369"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40948"
FT                   /db_xref="GOA:B4EUV0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUV0"
FT                   /protein_id="CAR40948.1"
FT                   /translation="MSSSQTLVVKLGTSVLTGGSRRLDQSHIVELVRQCAKQHEKGHRI
FT                   IIVTSGAIAAGREYLNYPDLPATIASKQLLAAVGQSALIQVWKQLFAIYGIHIGQMLLT
FT                   RADIEDRERFLNARDTLHALLDNKIIPVINENDAVATAEIKVGDNDNLSALAAILGGAD
FT                   KLLLLTDIEGLYTADPRSNPDAKLIPEVFDINDELRQMAGDSVSGLGTGGMATKLQAAT
FT                   VAGRAGIDVVIAAGVKPDVISKVIDNEPVGTLFHGLKSPLETRKRWIFGAPVAGVIIVD
FT                   NGAEKAIKEQGSSLLPKGIKEIKGDFSRGCVIRIQSLQGKDLAHGVAHYNSDALRLIAG
FT                   HHSQEISQILGYEYGSVAVHRDDMIVS"
FT   misc_feature    418474..419166
FT                   /note="HMMPfam hit to PF00696, Amino acid kinase family,
FT                   score 3.4e-59"
FT   misc_feature    419080..419145
FT                   /note="PS00902 Glutamate 5-kinase signature."
FT   misc_feature    419287..419511
FT                   /note="HMMPfam hit to PF01472, PUA domain, score 5.7e-26"
FT   CDS_pept        419577..420830
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="PMI0370"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40950"
FT                   /db_xref="GOA:B4EUV1"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUV1"
FT                   /protein_id="CAR40950.1"
FT                   /translation="MLEQMGKAAREASWHLAQLSTEQKNQALLVIADLLEQQEAIILAA
FT                   NEKDMVAARESNINAAMLDRLLLTSERLKAIADDVRQVCHLEDPVGQVIDGRLLDSGLR
FT                   LERRRVPLGVVGVIYEARPNVTIDVASLCLKTGNAAILRGGKETHHTNQAVVAVIQQAL
FT                   ETCAIPAAAIQAIDKPDRELVAKMLKMDEYIDMLIPRGGAGLHKLCREQSTIPVITGGI
FT                   GVCHTFVDESADLDQALNVIINAKVQRPSACNSLETLLVHEAIAESFLPQLSDAMAAQK
FT                   VTLHASQRAITALKKGRATVVDVTEADYCDEWLSLDLNVEVVNDLTAAIAHIRQYGTAH
FT                   SDAILTQSISHADRFVRQVDSAAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGL
FT                   DALTTYKWIGYGDNTLRR"
FT   misc_feature    420543..420608
FT                   /note="PS01223 Gamma-glutamyl phosphate reductase
FT                   signature."
FT   CDS_pept        420975..421487
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="PMI0371"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40953"
FT                   /db_xref="GOA:B4EUV2"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUV2"
FT                   /protein_id="CAR40953.1"
FT                   /translation="MESTIYLIGPRGAGKTTVGKALSLSLDYQFIDTDNWITDKYQQTI
FT                   SSMVEAEGWDVFRQLESDALIQVSQPNQVISTGGGIVLAEKNRVYMKNSGVIVYLQASL
FT                   ETLVERLSQDPNEAQRPSLTGKTLVSEIHDVLIKREPLYMQCADIIVDAGLSINDIIEV
FT                   ILAKLAK"
FT   misc_feature    420999..421022
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    421005..421481
FT                   /note="HMMPfam hit to PF01202, Shikimate kinase, score
FT                   1.6e-59"
FT   misc_feature    421146..421220
FT                   /note="PS01128 Shikimate kinase signature."
FT   CDS_pept        421594..423750
FT                   /transl_table=11
FT                   /gene="aas"
FT                   /locus_tag="PMI0372"
FT                   /product="Aas bifunctional protein [includes:
FT                   2-acylglycerophosphoethanolamine acyltransferase and
FT                   acyl-[acyl-carrier-protein] synthetase"
FT                   /EC_number="2.3.1.40"
FT                   /EC_number="6.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40955"
FT                   /db_xref="GOA:B4EUV3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUV3"
FT                   /protein_id="CAR40955.1"
FT                   /translation="MLIAFFKTLFKFLFRVRIEGLINQFSQYEKCIITPNHTSFIDGIL
FT                   LRLFLPINPVFAVYTSVANAKHTKWLSRYADIVPLDPANPMAVRQLVKEVDKGRPVVIF
FT                   PEGRITVTIGLMKIYEGAAFIAAKSGAKVIPVRIEGAEFSYFSRVHKTLNIKAKLFPKI
FT                   TIKVLPAVDLPMPTAEKSAERRRLSGEKLRDIMMDAIMQARPNITLYEAFLQGMSQFGR
FT                   FSPLISDINMKEDSYQGLLKKILGVSRIIERYTEPNERIGLLLPNTTVTVAALFGATMR
FT                   QRVVAMLNYTAGSLGVQNAMKAASIKTIFTSRQFLEKGNLLHIPEQTPDANWVYLEDLK
FT                   DSITREDKRWIAQHLLTPHKAMLAQKSTDAAVILFTSGSEGTPKGVVHSHSSLLANVEQ
FT                   IRAIADFSPRDKFMAALPLFHAFGLTVSVLAPICLGARVFLYPSPLHYRVVPELVYDQN
FT                   CIVLFGTSTFLGNYGKFAHPYDFARLRYVVAGAEKLSESTRVLWQDKFGIRILEGYGVT
FT                   ECAPVVSINVPMSAKPYTVGRLLPGMEGRLIPISGITDGGRLQLRGPNIMLGYLRVESP
FT                   YKLEQPTAINAEGIEEVGWYDTGDIVAIDSEGFCTIKGRVKRFAKIAGEMVSLESVEQL
FT                   AAKASEGNHAVVAVNDPRRGESLVLFTTDKQLDRSMLSALAKSTGVAEIAVPKDIRFLK
FT                   EIPVLGSGKTDFVSLKQLAEQENN"
FT   misc_feature    421636..422010
FT                   /note="HMMPfam hit to PF01553, Acyltransferase, score
FT                   7.2e-27"
FT   misc_feature    422299..423534
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   1.5e-67"
FT   misc_feature    422710..422745
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT   misc_feature    423025..423054
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT   CDS_pept        423750..424952
FT                   /transl_table=11
FT                   /locus_tag="PMI0373"
FT                   /product="MFS-family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40958"
FT                   /db_xref="GOA:B4EUV4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUV4"
FT                   /protein_id="CAR40958.1"
FT                   /translation="MSENISQPPLLSKGMKAVLLSQFLSAFADNALLFAILAQFKSALY
FT                   PEWSQPILQMVFVLAYILLAPFVGQIADRQPKGRVMLTGNALKFAGAFLICIGTDPFLG
FT                   YALVGIGAAIYSPAKYGILGELTDGERLVKANGLMEASTIAAILLGSVIGGLLSDWSII
FT                   LALAVCAIMYALAVLVNFSIPKLSPAQIGRGWNIKKIFNQFLAACGSLWRDKESRFSLV
FT                   GTSMFWGAGVTLRFLLVQWVPIALGMTDNTTPTILNAMVAIGIVIGAGLAAKFVTLKTV
FT                   RRCMPAGVLIGLGVVYFSLQTTIIPAYFILVVIGIFGGFFVVPLNALLQDKGKHSVGAG
FT                   NAIAVQNLGENTAMLLMLGLFSLVTSMGISVITIGIGFGAIFALAIGGLWLWDCTRKRA
FT                   E"
FT   misc_feature    join(423798..423866,423903..423962,424023..424091,
FT                   424230..424298,424404..424472,424515..424583,
FT                   424602..424655,424668..424736,424773..424841,
FT                   424854..424922)
FT                   /note="10 probable transmembrane helices predicted for
FT                   PMI0373 by TMHMM2.0 at aa 17-39, 52-71, 92-114, 161-183,
FT                   219-241, 256-278, 285-302, 307-329, 342-364 and 369-391"
FT   misc_feature    423801..424847
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 3.7e-18"
FT   CDS_pept        424985..425491
FT                   /transl_table=11
FT                   /locus_tag="PMI0374"
FT                   /product="putative competence-damaged protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40961"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUV5"
FT                   /protein_id="CAR40961.1"
FT                   /translation="MINNDEMTHLSIEVGQALLKRKKTLTTAESCTGGWIAKVITDIAG
FT                   SSDYYHRGFVTYSNQAKHDMIGVDEQTLSDFGAVSEQVVCEMAKGALLTANADYAVSVS
FT                   GIAGPGGGSEEKPVGLVWFGFAIKTPEGLRVVAKHCIFSGSREEVRAQSVIFSLKSILK
FT                   EIINN"
FT   misc_feature    425003..425479
FT                   /note="HMMPfam hit to PF02464, Competence-damaged protein,
FT                   score 1.1e-78"
FT   CDS_pept        425599..426666
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="PMI0375"
FT                   /product="protein RecA (recombinase A)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40963"
FT                   /db_xref="GOA:B4EUV6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUV6"
FT                   /protein_id="CAR40963.1"
FT                   /translation="MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMNVETISTGS
FT                   LSLDVALGAGGLPRGRIVEIYGPESSGKTTLTLQVIASAQREGKICAFIDAEHALDPIY
FT                   AQKLGVDIDNLLCSQPDTGEQALEICDALSRSGAVDVIVVDSVAALTPKAEIEGEIGDS
FT                   HVGLAARMMSQAMRKLAGNLKNSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASV
FT                   RLDIRRIGSVKNGDEVIGSETRVKVVKNKVAAPFKQAEFQIMYGEGINTYGELIDLGVK
FT                   HKLVEKAGAWYSYNGEKIGQGKANATNYLKEHPEMYNELNTKLREMLLNHAGEFTSAAD
FT                   FAGEESDSDADDTKE"
FT   misc_feature    425623..426588
FT                   /note="HMMPfam hit to PF00154, recA bacterial DNA
FT                   recombination protein, score 5.9e-243"
FT   misc_feature    425797..425820
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    426241..426267
FT                   /note="PS00321 recA signature."
FT   CDS_pept        427567..430194
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="PMI0376"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40964"
FT                   /db_xref="GOA:B4EUV7"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUV7"
FT                   /protein_id="CAR40964.1"
FT                   /translation="MSKSTAEIRQAFLDFFHTKGHQIVPSSSLVPNNDPTLLFTNAGMN
FT                   QFKDVFLGLDNRPYSRATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFK
FT                   HDAINFAWELLTGKEWFNLPKERLWVTVYATDDEAYDIWNKEVGVPAERIIRIGDNKGA
FT                   PFASDNFWQMGDTGPCGPCTEIFYDHGDHIWGGPPGTPEEDGDRYIEIWNIVFMQFNRK
FT                   SDGTMDPLPKPSVDTGMGLERITAVLQHVNSNYDIDLFRALIKSVAEVTNATDLANKSL
FT                   RVIADHIRSCSFLVCDGVIPSNEGRGYVLRRIIRRAVRHGYMLGAKDTFFYKLVAPLID
FT                   VMAEAGKELKNQQEIVEKVLKTEEEQFARTLERGLQLLDEELEKLTGDTLAGETAFRLY
FT                   DTYGFPLDLTADVCRERNIKVDEEGFELAMEEQRKRARESSGFGTDYNELIKVDSRSDF
FT                   SGYDHNEQQGTINAIFHNGQTVTELKAGEEGIIFLDKTAFYAESGGQVGDKGLLIGKDS
FT                   QFEVTDTQKYGKAIGHIGKVISGSFIVNHKINAVIDVARRDAIRLNHSATHLLHAALRQ
FT                   VLGTHVTQKGSLVNDKYLRFDFSHFEAVKPEQLREIEDIVNAQIRLNSPVVTELMDLED
FT                   AKQKGAMALFGEKYEERVRVLTMGDFSTELCGGTHAARTGDIGLFRIMSESGTAAGIRR
FT                   IEAITGATAIESVHEQSDLISLVAHALKSDGSNLVEKIKTVQEKYRSLEKELQQLKDQQ
FT                   AAQESSSLGSQAKNVKGIKLLVRELNNVEPKMLRTMVDDLKNQLGSAIIVLSTISDGKV
FT                   SLIVGVTKDLTAKIKAGELISFVAQQIGGKGGGRPDMAQAGGTDVEALPAALASVDEWV
FT                   ESHL"
FT   misc_feature    427585..429681
FT                   /note="HMMPfam hit to PF01411, tRNA synthetases class II
FT                   (A), score 0"
FT   misc_feature    428278..428307
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   misc_feature    429961..430173
FT                   /note="HMMPfam hit to PF02272, DHHA1 domain, score 8e-22"
FT   CDS_pept        430412..430600
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="PMI0377"
FT                   /product="carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40967"
FT                   /db_xref="GOA:B4EUV8"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUV8"
FT                   /protein_id="CAR40967.1"
FT                   /translation="MLILTRRVGETLMIGDDVTVTVLGVKGNQVRIGVNAPKEVSVHRE
FT                   EIYQRIQAEKTQPTDNY"
FT   misc_feature    430412..430591
FT                   /note="HMMPfam hit to PF02599, Global regulator protein
FT                   family, score 1.5e-34"
FT   tRNA            431066..431155
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:431100..431102,aa:Ser)"
FT                   /note="tRNA Ser anticodon GCT, Cove score 50.68"
FT   tRNA            431168..431241
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:431202..431204,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 79.29"
FT   tRNA            431334..431407
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:431368..431370,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 79.29"
FT   tRNA            431462..431535
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:431496..431498,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 79.29"
FT   tRNA            431582..431655
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:431616..431618,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 79.29"
FT   CDS_pept        431843..433423
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="PMI0378"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40970"
FT                   /db_xref="GOA:B4EUV9"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUV9"
FT                   /protein_id="CAR40970.1"
FT                   /translation="MIPDVSKALSWLEAHPKVLCGIHRGIERETLRVTPDGHLAATGHP
FT                   VELGKSLTHKWITTDFAESLLEFITPVDDNIDHTLHFLSDLHRYTARHLTNERMWPMSM
FT                   PCFIEAEDKITLAQFGTSNVGRFKTLYREGLKNRYGALMQTISGVHYNFSLPIEFWQAW
FT                   ANITDEETGKEAISDGYLRLIRNYYRFGWIIPFFFGASPAICGSFLKGRKTNLPFENTP
FT                   KGAKYLPYATSLRLSDLGYTNKSQSDLDITFNHLETYVKGLKKAIHKPSEEFAKLGVKK
FT                   DGKYIQLNTNVLQIENELYAPIRPKRVVKGDESPSDALLRGGIEYIEVRSLDINPFTPI
FT                   GVDETQIRFLDLFLIWCVLADAPEMNAEELACCRANWNNVILEGRKPGQVIGMGCGERK
FT                   EPLAQVGKALFADLQRVAKVLDSCSGTKYLEVCLKLEEMFDNPQLTFSGRLLEKIKAQG
FT                   IGGYGLSLAEEYHQQLVNTAYEVLTDDAFEHERISSIKRQADLEKSDTISFDEYLKLHA
FT                   GPNNDGVAS"
FT   misc_feature    431858..432985
FT                   /note="HMMPfam hit to PF04262, Glutamate-cysteine ligase,
FT                   score 1.1e-247"
FT   CDS_pept        433589..434104
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="PMI0379"
FT                   /product="S-ribosylhomocysteine lyase (autoinducer-2
FT                   production protein)"
FT                   /EC_number="4.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40974"
FT                   /db_xref="GOA:B4EUW0"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUW0"
FT                   /protein_id="CAR40974.1"
FT                   /translation="MPLLDSFTVDHTRMSAPAVRVAKTMKTPSGDTITVFDLRFTVPNK
FT                   KAMPEKGIHTLEHLFAGFMRNHLNGEGVEIIDISPMGCRTGFYMSLIGQPDEQRVANAW
FT                   KAAMEDVLKVKDQNHIPELNVYQCGTYEMHSLAEAQDIARDILSHTIGINHNDELALPE
FT                   DKLKELQI"
FT   misc_feature    433592..434074
FT                   /note="HMMPfam hit to PF02664, S-Ribosylhomocysteinase
FT                   (LuxS), score 2.5e-105"
FT   CDS_pept        complement(434235..435509)
FT                   /transl_table=11
FT                   /locus_tag="PMI0380"
FT                   /product="putative transporter of ion substrates"
FT                   /note="Similar over its N-terminal region to Salmonella
FT                   typhimurium CorF and over its C-terminal region to
FT                   Salmonella typhimurium CorC"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40976"
FT                   /db_xref="GOA:B4EUW1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUW1"
FT                   /protein_id="CAR40976.1"
FT                   /translation="MEHVSTTTLIIILIGMIFASAYFSGTETSMMTINRYRLRHAAKQG
FT                   NRSAKRVEKLLQRPDRLISLVLIGNNLINIVASALATIVGMRLYGDAGVAIATGVLTFV
FT                   ILIFAEVLPKSIAALYPERFAYPSSVLLSPLQKIMLPVVWFFNQITLVFMRIFGIKSPV
FT                   IQGNAVSKEELRTIVNESKSKLSQRNQNMLISILDLEKVTIGDIMVPRNEIFGIDVNDE
FT                   WKSIVRQLTHSPHGRIVLYRDTLDDVIGMLRVREAYRLMTEKKEFTKQILIKAADKIYF
FT                   IPESTPLSLQLVNFQRNNEKAGIVVDEYGEIQGLVTVEDILEEIVGDFTTSMSPSLAEE
FT                   VIPQKDGSLLVDGTTNIRDINKAFACHLPENEARTINGVIIEELGDLPVVGAKITIDGY
FT                   EFEVLEVQDNVIKKALIRHLTPSRH"
FT   misc_feature    complement(434250..434486)
FT                   /note="HMMPfam hit to PF03471, Transporter associated
FT                   domain, score 4e-23"
FT   misc_feature    complement(434532..434693)
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 1.4e-06"
FT   misc_feature    complement(434724..434888)
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 0.071"
FT   misc_feature    complement(434943..435488)
FT                   /note="HMMPfam hit to PF01595, Domain of unknown function
FT                   DUF21, score 3.9e-68"
FT   misc_feature    complement(join(435072..435140,435174..435230,
FT                   435258..435326,435432..435500))
FT                   /note="4 probable transmembrane helices predicted for
FT                   PMI0380 by TMHMM2.0 at aa 4-26, 62-84, 94-112 and 124-146"
FT   misc_feature    complement(435438..435509)
FT                   /note="Signal peptide predicted for PMI0380 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.893) with cleavage site
FT                   probability 0.652 between residues 24 and 25"
FT   CDS_pept        complement(435545..436345)
FT                   /transl_table=11
FT                   /locus_tag="PMI0381"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40978"
FT                   /db_xref="GOA:B4EUW2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUW2"
FT                   /protein_id="CAR40978.1"
FT                   /translation="MPVISISIVAVCAYLLSLVFILPSLLRKEQNGYRGLALLFAVVAL
FT                   VTHAISLKFLIFRPHSGQNLSLTNLGAVVSLMVCVIMTIVASRGRAWFLLPIVYCFSIV
FT                   NLIIAALMPGEFVTHLESSTSLFIHIGLALLSYATLLIAALYALQLSWLDYQLKNKKLK
FT                   FSPQMPPLMSIERKMFHITQVGVVLLTLTLCTGLLYMDNIFGKENIHKSIFSIIAWFVY
FT                   IILLWGHFREGWRGKKVVIFNLIGAIILTLAFFGNRLLQELMLN"
FT   misc_feature    complement(435551..436240)
FT                   /note="HMMPfam hit to PF01578, Cytochrome C assembly
FT                   protein, score 1.7e-61"
FT   misc_feature    complement(join(435563..435631,435659..435712,
FT                   435746..435814,435902..435970,436007..436075,
FT                   436088..436156,436175..436243,436271..436339))
FT                   /note="8 probable transmembrane helices predicted for
FT                   PMI0381 by TMHMM2.0 at aa 24-46, 56-78, 85-107, 112-134,
FT                   147-169, 199-221, 233-250 and 260-282"
FT   CDS_pept        436518..437879
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="PMI0382"
FT                   /product="signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40980"
FT                   /db_xref="GOA:B4EUW3"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUW3"
FT                   /protein_id="CAR40980.1"
FT                   /translation="MFENLSDRLSRTLRNISGRGRLTEENIKDTLREVRMALLEADVAL
FT                   PVVREFIARVKESAVGHEVNKSLTPGQEFVKIVQNELVNAMGEVNNDLDLSAQPPAVVL
FT                   MAGLQGAGKTTSVAKLGKFLKEKKKKKVLVVSADVYRPAAIKQLETLAETVGVDFFPST
FT                   VQENPVTIASNALKHAQLQFYDVLLVDTAGRLHVDEGMMEEIQLLHKAINPVETLFVVD
FT                   AMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEA
FT                   LEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLATKLKKGDGFDLNDFLDQLKQ
FT                   MKNMGGMASMLSKMPGMSQVPDAVKSQMDDSILVKMEAIISSMTKKERQKPEIIKGSRK
FT                   RRIAMGSGTQVQDVNRLLKQFDDMQRMMKKMKKGGLAKMMRGMKGMMPPGFPGR"
FT   misc_feature    436518..436778
FT                   /note="HMMPfam hit to PF02881, SRP54-type protein, helical
FT                   bundle domain, score 1.4e-32"
FT   misc_feature    436812..437405
FT                   /note="HMMPfam hit to PF00448, SRP54-type protein, GTPase
FT                   domain, score 4.5e-119"
FT   misc_feature    436836..436859
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    437235..437252
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT   misc_feature    437322..437363
FT                   /note="PS00300 SRP54-type proteins GTP-binding domain
FT                   signature."
FT   misc_feature    437499..437798
FT                   /note="HMMPfam hit to PF02978, Signal peptide binding
FT                   domain, score 2.1e-48"
FT   CDS_pept        438017..438265
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="PMI0383"
FT                   /product="30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40983"
FT                   /db_xref="GOA:B4EUW4"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUW4"
FT                   /protein_id="CAR40983.1"
FT                   /translation="MVTIRLARGGAKKRPFYQVVVTDSRNARDGRFIERVGFYNPLATG
FT                   NAEELRLDVDRVEHWVAQGATVSERVAGLIKSAKKSA"
FT   misc_feature    438020..438049
FT                   /note="PS00732 Ribosomal protein S16 signature."
FT   misc_feature    438038..438220
FT                   /note="HMMPfam hit to PF00886, Ribosomal protein S16, score
FT                   2.6e-33"
FT   CDS_pept        438284..438829
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="PMI0384"
FT                   /product="16S rRNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40984"
FT                   /db_xref="GOA:B4EUW5"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUW5"
FT                   /protein_id="CAR40984.1"
FT                   /translation="MSEQKTFKEPVEPIVMGKLGSPYGIRGWLRVFSSTEHAENIFEYQ
FT                   PWFIQRHGQWESIEIETWKHHNQDIIVKLKGIDDRDAANILTNFEIVVSATQLPDLDGE
FT                   YYWKDLMGCQVETDKGYDLGVVNDMMETGSNDVMVIKANLKDAFGVRERLVPFLDGQVI
FT                   KKVDLSAKKIIVDWDPGF"
FT   misc_feature    438329..438574
FT                   /note="HMMPfam hit to PF01782, RimM N-terminal domain,
FT                   score 1.5e-30"
FT   misc_feature    438587..438826
FT                   /note="HMMPfam hit to PF05239, PRC-barrel domain, score
FT                   4.2e-19"
FT   CDS_pept        438869..439621
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="PMI0385"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /product="trna (guanine-n(1)-)-methyltransferase (ec
FT                   2.1.1.31) (m1g-methyltransferase) (trna [gm37]
FT                   methyltransferase)"
FT                   /EC_number="2.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40985"
FT                   /db_xref="GOA:B4EUW6"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUW6"
FT                   /protein_id="CAR40985.1"
FT                   /translation="MWIGVISLFPEMFRAITEYGVTGRAVKHGLLNVECWDPRDFTYDR
FT                   HHTVDDRPYGGGPGMLMMVQPLREAIHQAKAAAGDGAKVIYLSPQGRKLDQQGVCELAT
FT                   NEKLILVCGRYEGIDERVIQTEIDEEWSVGDYVLSGGELPAMIMIDAVARFVPGVLGHA
FT                   ASAKEDSFAEGLLDHPHYTRPEVLDGMAVPAVLLSGNHAHINRWRMKQSLGRTWLRRPE
FT                   LLESLALTDEQRVLLAEFQQEHLQRTAE"
FT   misc_feature    438932..439561
FT                   /note="HMMPfam hit to PF01746, tRNA
FT                   (Guanine-1)-methyltransferase, score 4.1e-136"
FT   CDS_pept        439674..440027
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="PMI0386"
FT                   /product="50S ribosomal subunit protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40986"
FT                   /db_xref="GOA:B4EUW7"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EUW7"
FT                   /protein_id="CAR40986.1"
FT                   /translation="MSNIIKQIEQEQMKQDVPSFRPGDNVEVKVWVVEGSKKRLQAFEG
FT                   VVIAIRNRGLHSAFTVRKISNGEGVERVFQTHSPVVDSITVKRRGAVRKAKLYYLRERS
FT                   GKAARIKERLNAK"
FT   misc_feature    439677..440015
FT                   /note="HMMPfam hit to PF01245, Ribosomal protein L19, score
FT                   3.1e-78"
FT   misc_feature    439929..439976
FT                   /note="PS01015 Ribosomal protein L19 signature."
FT   CDS_pept        440479..441573
FT                   /transl_table=11
FT                   /gene="aroF"
FT                   /locus_tag="PMI0387"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase,
FT                   Tyr-sensitive"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40987"
FT                   /db_xref="GOA:B4EUW8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUW8"
FT                   /protein_id="CAR40987.1"
FT                   /translation="MIMQKDALNNVNISEELVLITPEELKQKYPLSRNDLHAITQSRQT
FT                   ISEIVQRRDPRLLVVCGPCSIHDVDVALDYAKRLKVLASELSDSLYIVMRVYFEKPRTT
FT                   VGWKGLISDPFMDGSFEMEKGLHIARKLLTELVQLGLPLATEALDPNNPQYLGDLFSWS
FT                   AIGARTTESQTHREMASGLSMPVGFKNGTDGNLDTAINAMKAASMPHRFMGINQSGQVC
FT                   LLQTQGNPDGHVILRGGKKPNYHEEDVALCEAHMIKAGLTPSLMIDCSHGNSNKDFRRQ
FT                   SVVVDSVIEQIKKGNQSITGIMLESHINEGNQSSEQPRSEMKYGVSVTDACISWETTES
FT                   VLRNLHQQISPVLAQRAAQLRKVS"
FT   misc_feature    440560..441507
FT                   /note="HMMPfam hit to PF00793, DAHP synthetase I family,
FT                   score 5.7e-150"
FT   CDS_pept        441609..442733
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="PMI0388"
FT                   /product="T-protein [includes: chorismate mutase and
FT                   prephenate dehydrogenase]"
FT                   /EC_number="5.4.99.5"
FT                   /EC_number="1.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40988"
FT                   /db_xref="GOA:B4EUW9"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008244"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011277"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUW9"
FT                   /protein_id="CAR40988.1"
FT                   /translation="MAEELQNLREQIDQVDKTLLSLLAKRMQLVAEVGEVKNRHGLPIY
FT                   APDREAAMLASRRNEAEKMGISADLIEDVLRRVMRESYSKENDKGFKTLNPQLGKIVIV
FT                   GGNGKMGRLFSRLFTLSGYQVESLEADEWQSKSPAIFADAGMVIISVPIHLTVDVIEQL
FT                   PPLPENCLLVDLASIKQAPLEAMLKAHNGPVLGLHPMFGPDVPSLAKQVIAYCEGRDLS
FT                   HFEWLLEQLMVWGARVEAITAQEHDKNMSFIQALRHFTTFAYGQHLVKENVDLASLLRL
FT                   SSPIYRLELAMIGRLFAQDPQLYADIILSSQENINLIRRYHHSLGEAIALLDINTKDEF
FT                   IGSFNNVSDWFGDYASQFMKESGALLQKANDSRI"
FT   misc_feature    441615..441875
FT                   /note="HMMPfam hit to PF01817, Chorismate mutase type II,
FT                   score 1.6e-33"
FT   misc_feature    441918..442661
FT                   /note="HMMPfam hit to PF02153, Prephenate dehydrogenase,
FT                   score 5.1e-17"
FT   CDS_pept        443581..444924
FT                   /transl_table=11
FT                   /gene="dcuB"
FT                   /locus_tag="PMI0389"
FT                   /product="anaerobic C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40989"
FT                   /db_xref="GOA:B4EUX0"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUX0"
FT                   /protein_id="CAR40989.1"
FT                   /translation="MMDFIIQLAIILVCLFYGARKGGIALGLLGGVGLVILVFIFNLPP
FT                   GKPPVDVMLVIIAVVSASATLQASGGLDVMLQIAEKLLRKNPKYISIVAPLVTCTLTIL
FT                   CGTGHVVYTILPIIYDVSIKNNIRPERPMAASTIGSQMGIIASPVSVAVVTLVAMLGNV
FT                   TFNGKHLEFLDLLAITIPSTFIGILAIGIFSWFRGKELDKDQRFQDFISIPENHDYVYG
FT                   DTATLLDKKLPMKNWVAMWIFLGAIAVVAVLGAFSELRPVFNNKPLSMVLVIQMFMLLA
FT                   GASIIIICKTNPSLISKNEVFRSGMIAIVAVYGIAWMAETMFSAHMKEIEAALGQLVRE
FT                   YPWAYAVVLLLVSKFVNSQAAALAAIVPLALGIGIDPAYIVASAPACYGYYILPTYPSD
FT                   LAAIQFDRSGTTRIGRFVINHSFILPGLIGVTVSCIFGWVFAAMYGFL"
FT   misc_feature    join(443590..443637,443650..443709,443848..443916,
FT                   444007..444075,444103..444171,444289..444348,
FT                   444391..444444,444481..444534,444658..444726,
FT                   444844..444912)
FT                   /note="10 probable transmembrane helices predicted for
FT                   PMI0389 by TMHMM2.0 at aa 4-19, 24-43, 90-112, 143-165,
FT                   175-197, 237-256, 271-288, 301-318, 360-382 and 422-444"
FT   misc_feature    443599..444711
FT                   /note="HMMPfam hit to PF03605, Anaerobic c4-dicarboxylate
FT                   membrane transpo, score 7.6e-243"
FT   CDS_pept        complement(445018..446175)
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="PMI0390"
FT                   /product="P-protein [includes: chorismate mutase and
FT                   prephenate dehydratase]"
FT                   /EC_number="5.4.99.5"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40990"
FT                   /db_xref="GOA:B4EUX1"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010952"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUX1"
FT                   /protein_id="CAR40990.1"
FT                   /translation="MEKLDLLAIRDKITALDSELLSLLAQRRQLSTEVAQFKLNTHRPI
FT                   RDKNRERELLELLIEKGKNVGLDGFYISRIFQMIIEDSVLTQQAILQQHLNATANESAR
FT                   IAYLGPKGSYSHIAARQYAARHFDTFVDCTCHKFEDIFTLVETGQADYGLLPIENTSSG
FT                   AINDVYDLLQTTSLSIVGEIRIPINHALLTAVKSSLEELHTIYSHPQPFQQCSHYLNQY
FT                   PHWKIEYCESTAAAMEKVALAQSPHVAAIGSEAGGSLYNLTPLASNLANQQINVTRFIV
FT                   IARKPIDVSEQVPAKTTFLMATGQQAGALVDALITLKQYSIIMTKLESRPINGTPWEEM
FT                   FYIDVQANLRDINMQKALHDLSKTSRSLKVLGCYPSENIVPVEIQ"
FT   misc_feature    complement(445183..445206)
FT                   /note="PS00858 Prephenate dehydratase signature 2."
FT   misc_feature    complement(445315..445863)
FT                   /note="HMMPfam hit to PF00800, Prephenate dehydratase,
FT                   score 4.7e-85"
FT   misc_feature    complement(445330..445398)
FT                   /note="PS00857 Prephenate dehydratase signature 1."
FT   misc_feature    complement(445906..446166)
FT                   /note="HMMPfam hit to PF01817, Chorismate mutase type II,
FT                   score 2.1e-23"
FT   CDS_pept        complement(446485..446820)
FT                   /transl_table=11
FT                   /locus_tag="PMI0391"
FT                   /product="putative sigma 54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40991"
FT                   /db_xref="GOA:B4EUX2"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUX2"
FT                   /protein_id="CAR40991.1"
FT                   /translation="MIINITSKQMDITPALREHIESRLTKLNKWQVNLINPHIILTKDP
FT                   KGFSVDASIHTPNGQLVANAQHVDMYAAINDLLAKLERQLNKVQHKNESRRAANSLKEE
FT                   NLLVNEI"
FT   misc_feature    complement(446536..446817)
FT                   /note="HMMPfam hit to PF02482, Sigma 54 modulation protein
FT                   / S30EA r, score 9.9e-42"
FT   CDS_pept        complement(447090..447824)
FT                   /transl_table=11
FT                   /locus_tag="PMI0392"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40993"
FT                   /db_xref="GOA:B4EUX3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUX3"
FT                   /protein_id="CAR40993.1"
FT                   /translation="MRRMKYLVAAATVSLLLSGCSSSDKDATADMSPSELYATSQEKLL
FT                   DGNYGAAIKQLESLDNRYPFGPYSQQVQLDLIYAYYKSAELPMAISAIDRFMRLNPTHP
FT                   NIDYVLYMRGLTAQALDDSALQGFFGIDRSDRDPQHARVAFKDFSQLVRYYPDSLYTAD
FT                   ATKRLVFLKNRLAKYELSVAKFYTKRGAYVAVINRVEQMMRDYPDTEATREALVYMENA
FT                   YKKLGLTQEADKVASLIAANPA"
FT   misc_feature    complement(447756..447824)
FT                   /note="Signal peptide predicted for PMI0392 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.464 between residues 23 and 24"
FT   misc_feature    complement(447765..447797)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        447955..448932
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="PMI0393"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /product="ribosomal large subunit pseudouridine synthase d
FT                   (ec 5.4.99.-) (rrna-uridine isomerase d) (rrna
FT                   pseudouridylate synthase d)"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40996"
FT                   /db_xref="GOA:B4EUX4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUX4"
FT                   /protein_id="CAR40996.1"
FT                   /translation="MSQQIRLNATVADSQLGQRLDQALAELFPDYSRSRIKEWILDNRV
FT                   QVNDKIINKPKEKMLGGEKIEVDALIEEDVRWEPQNIPLNIVYEDDDILVINKPRDLVV
FT                   HPGAGNPDGTVLNALLYRYPEIVNVPRAGIVHRLDKDTTGLMVVAKTVPAQTHLVEALQ
FT                   RREITREYEAVATGRMTAGGLVNEPISRHPTKRTHMAVHPMGKPAVTHYRVMEHFRAHT
FT                   RLRLRLETGRTHQIRVHMAHIHHPLIGDQLYGGRPRPLKGASEEFRETLRRFDRQALHA
FT                   TMLRLYHPITGIEMEWHAPLPDDMVELIRVLKVDAEQFKDEMDW"
FT   misc_feature    448006..448149
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 1.1e-10"
FT   misc_feature    448228..448680
FT                   /note="HMMPfam hit to PF00849, RNA pseudouridylate
FT                   synthase, score 3.8e-68"
FT   misc_feature    448357..448401
FT                   /note="PS01129 Rlu family of pseudouridine synthase
FT                   signature."
FT   CDS_pept        448933..449664
FT                   /transl_table=11
FT                   /locus_tag="PMI0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40998"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUX5"
FT                   /protein_id="CAR40998.1"
FT                   /translation="MTSLIYPDWPQPDNIGACSTLRTGGVSLPPYNSLNLGAHVGDDAL
FT                   LVEQNRRIICQQAQLPEMPLWLTQVHGIEVVNLDNQDNHTVEGDALYTSSANKVCAIMT
FT                   ADCLPVLFSTIDGTEVGAAHGGWRGLYQGVLQQTLTQFKASNEKIMAWLGPAIGPNAFE
FT                   VGAEVRLAFVEKNIAFDSAFIPHNGKYLANIYMLARIILQESGVNQIYGGDFCTVSDKS
FT                   RFFSYRREHTTGRMASLIWIK"
FT   misc_feature    449017..449661
FT                   /note="HMMPfam hit to PF02578, Uncharacterised ACR, YfiH
FT                   family COG1496, score 1e-76"
FT   CDS_pept        449810..452386
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="PMI0395"
FT                   /product="chaperone ClpB (heat-shock protein F84.1)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41000"
FT                   /db_xref="GOA:B4EUX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUX6"
FT                   /protein_id="CAR41000.1"
FT                   /translation="MRLDKLTNKFQQALADAQSLALGNDNQFIEPIHLLSALFNQQGGS
FT                   IRPLLTSTGVNASQFNERINDALSRLPKVEGAGGEVHPSNDLIKHLNLCDKLAQKKGDE
FT                   FISSELFLLAAMESGGQVADMLKAAGANKASLELAIEKIRGGETVNDQNAEDQRQALKK
FT                   YTVDLTERAEQGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVNGEVPEGLKNKRVLSLDMGSLLAGAKYRGEFEERLKAVLNDLSKQEGSVILFIDELH
FT                   TMVGAGKADGAMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDAALERRFQKVYVAE
FT                   PTVEDTIAILRGLKERYELHHHVQITDPAIVAAATLSHRYISDRMLPDKAIDLIDEAGA
FT                   SLRMQMDSKPEALDRLDRRIIQLKLEQQALQKESDDASKKRLAMLNEELAEKEKEYSSL
FT                   EEEWKAEKAELTGTQHIKAELEQARIALEQARRSGDLAKMSEIQYGQIPTLEKQLAEAN
FT                   KTEDKHMKLLRNKVTDAEIAEILARWTGIPVSRMLEGEREKLLRMEQELHRRVIGQDEA
FT                   VNAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKALADFLFDSDDAMVRIDMS
FT                   EFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVL
FT                   DDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQERFGTLDYPAMKTIVMDVVGHHFRPEF
FT                   INRIDEVVVFHPLGKENIAAIAQIQLRRLYQRLEERGYHVTITGAALEKLGEVGFDPIY
FT                   GARPLKRAIQQEVENPLAQDILSGKLVPGKEIILDLDDNQIIAKQS"
FT   misc_feature    449858..450016
FT                   /note="HMMPfam hit to PF02861, Clp amino terminal domain,
FT                   score 5.6e-14"
FT   misc_feature    450089..450244
FT                   /note="HMMPfam hit to PF02861, Clp amino terminal domain,
FT                   score 2.1e-13"
FT   misc_feature    450410..450994
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cellul, score 5.5e-15"
FT   misc_feature    450425..450448
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    450689..450727
FT                   /note="PS00870 Chaperonins clpA/B signature 1."
FT   misc_feature    451595..452089
FT                   /note="HMMPfam hit to PF07724, ATPase family associated
FT                   with various cellul, score 7.1e-111"
FT   misc_feature    451622..451645
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    451700..451756
FT                   /note="PS00871 Chaperonins clpA/B signature 2."
FT   rRNA            452966..454507
FT                   /note="16SrRNA"
FT   tRNA            454579..454652
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:454613..454615,aa:Ile)"
FT                   /note="tRNA Ile anticodon GAT, Cove score 70.86"
FT   tRNA            454789..454861
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:454822..454824,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 74.29"
FT   rRNA            455852..458274
FT                   /note="23SrRNA"
FT   rRNA            458478..458597
FT                   /note="5S rRNA"
FT   CDS_pept        complement(458689..459036)
FT                   /transl_table=11
FT                   /locus_tag="PMI0396"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41003"
FT                   /db_xref="InterPro:IPR018736"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUX7"
FT                   /protein_id="CAR41003.1"
FT                   /translation="MKLKRNSFYLIVLLSLVTLNGCQSFHVANDNWQGKDKAQHFLFSM
FT                   VASAGANAYADHQNYSYREGLVIGLSFSISLGVAKELYDSRPQGTGWSWHDFAYDVAGA
FT                   AAGSLLYQQLK"
FT   misc_feature    complement(458956..459036)
FT                   /note="Signal peptide predicted for PMI0396 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.990) with cleavage site
FT                   probability 0.773 between residues 27 and 28"
FT   CDS_pept        complement(459184..460545)
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="PMI0397"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41005"
FT                   /db_xref="GOA:B4EUX8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUX8"
FT                   /protein_id="CAR41005.1"
FT                   /translation="MMLSKLKLAKHQQHLAQLPKLAQSVADVETLYQTSAFRSTLLKYI
FT                   AQAQKEIFITALYLEHDEAGEEILEALYTAKQQRPELSITVIVDWHRAQRGRIGVSADA
FT                   TNADWYHKVAQQHPDVDVPIYGIPVNTREALGVLHLKGFIFDDTVIYSGASINNVYLHK
FT                   LDKYRYDRYHIIHNAELANTMKQFIVDSLLQSDAIQRLDSEERVRCAEIKNCIRQFRFN
FT                   LRTHDGYDIKGNASNNQLTVTPLVGLGKKNILNKTISHLMAVTEEKLVICTPYFNLPAI
FT                   LVRQISHLLRNGKQVEIIIGDKTANDFYIPPEEPFKIIGALPYLYEINLRKFTQRFQRF
FT                   IDNDQLTVRLWKDGDNTYHLKGMWVDDEWQLITGNNLNPRAWGLDLENAILIHDPHHEL
FT                   HEQRHKELACIREKTLIVKSYQQLESIKFYPLKVKKLIKRLRRIRVDRLISRIL"
FT   misc_feature    complement(459403..459486)
FT                   /note="HMMPfam hit to PF00614, Phospholipase D Active site
FT                   motif, score 1e-07"
FT   misc_feature    complement(460066..460146)
FT                   /note="HMMPfam hit to PF00614, Phospholipase D Active site
FT                   motif, score 5.2e-05"
FT   CDS_pept        complement(460731..463391)
FT                   /transl_table=11
FT                   /locus_tag="PMI0398"
FT                   /product="putative acyl-CoA synthetase/acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41007"
FT                   /db_xref="GOA:B4EUX9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUX9"
FT                   /protein_id="CAR41007.1"
FT                   /translation="MSQRGLEALLRPKSIAVIGASDKVGRAGTTMMKNLLSGGFNGPVF
FT                   PVNPTRNSVSGVFTYPSIDKLPQVPDLAIICTHHRRNLELLEQLGQSGCKAVIVLSAQS
FT                   EQFQAIKTLCQQYHIRLLGPNSLGLLAPWQGLNASFSPLPVKKGKLAFISQSAAVANTI
FT                   LDWAYYRNIGFSYFIALGDNQDIQVDDLLDFLARDSKTSAILLHLEHIHDARRFMSASR
FT                   SASRNKPILVIKSGRTQKAQLLLGDTPSYDVAYDAAFQRAGLLRVQDTHEMFSAVETLS
FT                   YMTPLKGEKLMIISNGSAPAAMAVDELFLQSGKLAQLSADTQQQLQAIVQDTSAIRNPL
FT                   NLGDDTTVERYIRAVNCLLDSHDHDALLLIHTPSAIAPSIETAQKVIEAINKHPRRKWL
FT                   TLFTNWGGEYSSQQSRKLFSEAGIPTYRTPEGAITAFMHMVEYRRNQKQLKETPALPLE
FT                   IKMNTQQAHRCIEDALDKKQYRLDTHQVQPIMEAYGFNTLPTWIAHNAQEAVSIAEKIG
FT                   YPVALKLRSPDIPHKSEVQGVMLYLRDSNEVESAAHAIIERVSELYPQAKIQGLLVQSM
FT                   ANRAGSQELRVAIEQDPIFGPLILLGEGGVEWQIETKAAVALPPLNMALARYLVINAIK
FT                   SGKLQPRSALQPLNILSLSHFLVQVSHLLLDCPQIVRLDIHPLLVSGNDFTLLDVAMEL
FT                   SPIEGDPHQKLSIRPYPNELEETFFLRDSKPCFIRPILPEDEPLLKTFINQVTKEDLYY
FT                   RYFSEISEFTHDDLANMTQIDYDREMAFVAIRHPHDDPEIIGVARAMADPDNQQAEFAI
FT                   LVRSDLKGNTLGHQLMMKLINYTKAHGIKRLTAITMPENRNMISLAKKLGFSVEVQFDE
FT                   GIVNLNLLLDPLSDV"
FT   misc_feature    complement(460800..461039)
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 4.6e-12"
FT   misc_feature    complement(463041..463367)
FT                   /note="HMMPfam hit to PF02629, CoA binding domain, score
FT                   3.2e-07"
FT   CDS_pept        complement(463436..464119)
FT                   /transl_table=11
FT                   /locus_tag="PMI0399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41008"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUY0"
FT                   /protein_id="CAR41008.1"
FT                   /translation="MHDNAVSRLRQYRVSISTRPYKARGFRVKRCTFCLLPEKQCLCDT
FT                   IIHQTAKSRFCLMMYDTEVMKPSNTGKLIADVLPDTLAFLWSRTEPEKALLDAINDPHR
FT                   QAYVVFPDSYASPSRKVYHQLPANSKPPLFILLDGTWTEARKMFRKSPYLDALPLFSIN
FT                   EASKCDYMLRQAAREEQHCTAEVAASILANVGDDLASQQLFSHFSYFRQQYLIGKPDRR
FT                   QAKEE"
FT   misc_feature    complement(463463..464041)
FT                   /note="HMMPfam hit to PF03942, DTW domain, score 1.5e-54"
FT   CDS_pept        464257..465315
FT                   /transl_table=11
FT                   /locus_tag="PMI0400"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41010"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUY1"
FT                   /protein_id="CAR41010.1"
FT                   /translation="MKVTQILFCNNENSITDNEIKNLFNIFDTQVINNSRVDVNLETAK
FT                   NQINKLANAVRNGSSKDLDYLVNIMFHDDIKISLYATNQLYLIYPKLNNSIREDIKELV
FT                   KLLYEIKIKEDQEYFKERPLLSAMACEEAIARQKGKGENVFISAVDNYLNIKCNDSVLA
FT                   NSNESVSNNNRYISSSELESWASFQPYQCDIGSYESILKKIENSKGSAELKNYVVLVNN
FT                   NHWVALLTYKDSCFLCDSLPSSKKDERHNLLIELEKKGFNTINIEYNLQENVPNGCGLL
FT                   ALNYIDSLHNEWNKFNHEKEDDLISTIETVLQKTGKDFLNLSCGEQTTFNHDVRKKLIM
FT                   DTLFCIVKSNDE"
FT   CDS_pept        465490..466593
FT                   /transl_table=11
FT                   /locus_tag="PMI0401"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41011"
FT                   /db_xref="GOA:B4EUY2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUY2"
FT                   /protein_id="CAR41011.1"
FT                   /translation="MNDSYEGKNGKVKVMYVRSEDSADNKPKKPSRRPNNARGDTDRSH
FT                   RRDDKRGDNKFSRRDERGAGKSSGRNPSRSGSSSLRDNDSEGGNYSPWKTISRPGDEPL
FT                   KEHDGITGKSQIDPEQLRRQRLEETRIYGENACQAMFKNRPEAIVRAWFLQEVTPRFRE
FT                   ALKWMAANRKAYHVVEEEEMVKAARTDHHGGVCFLIKKRVGHDAQTYLKDAPTKDCVLA
FT                   LEDVGNPHNVGAIMRSCAHFGVKGVISPDSSVLESGAAVRTAEGGAEYIQGIDADNFAQ
FT                   TLEQFKQAGYTLVTTSSHKGSVPLAKAQLPEKMVLILGQEKDGLSDSTLKQGDMSIYIG
FT                   GTGHIESLNVSVASGVLLAEWWRQHHG"
FT   misc_feature    466141..466566
FT                   /note="HMMPfam hit to PF00588, SpoU rRNA Methylase family,
FT                   score 4.2e-47"
FT   CDS_pept        complement(466701..468239)
FT                   /transl_table=11
FT                   /gene="emrB"
FT                   /locus_tag="PMI0402"
FT                   /product="MFS-family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41012"
FT                   /db_xref="GOA:B4EUY3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUY3"
FT                   /protein_id="CAR41012.1"
FT                   /translation="MIKRGVKVIKEPLQGGKLAIMTIALALATFMQVLDSTIANVAIPT
FT                   IAGNLGASNSQGTWVITSFGVANAISIPITGWLAKRIGEVRLFMWSTALFALTSWLCGI
FT                   SQSLEMLIFFRVLQGLVAGPLIPLSQSLLLNNYPPAKRNMALALWSVTIVVAPILGPIL
FT                   GGYISDNYHWGWIFFINVPFGVLIIMCISNTLAGRETKTEIKPIDTIGLVLLVVGVGAL
FT                   QIMLDQGKELDWFNSTEIIVLTIIAVVALSFLIVWELTDEHPVIDLSLFKSRNFTIGCL
FT                   TLSLAYMIYFGTIVLLPLLLQEVFGYTATWAGLAAASVGLLPLIITPIIGKFGGKVDLR
FT                   YIISFSFIMFAVCFYWRAYTFEPGMDFATVAWPQFWQGLGVACFFMPLTTMTLSGLPPE
FT                   KMASASSLSNFLRTLAGAIGASLTTTIWTQRESLHHETFVEKINPLDPDAQLAFQQMRE
FT                   LGLSDEQTSAYLAKTITEQGLIISANEIFWLAAGIFILMLVVVWFAKPPFSPGK"
FT   misc_feature    complement(join(466731..466799,467049..467117,
FT                   467160..467219,467238..467306,467334..467402,
FT                   467463..467522,467565..467621,467655..467723,
FT                   467736..467804,467838..467906,467916..467984,
FT                   468003..468071,468114..468182))
FT                   /note="13 probable transmembrane helices predicted for
FT                   PMI0402 by TMHMM2.0 at aa 20-42, 57-79, 86-108, 112-134,
FT                   146-168, 173-195, 207-225, 240-259, 280-302, 312-334,
FT                   341-360, 375-397 and 481-503"
FT   misc_feature    complement(466956..468167)
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 2.4e-57"
FT   misc_feature    complement(468117..468239)
FT                   /note="Signal peptide predicted for PMI0402 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.864) with cleavage site
FT                   probability 0.718 between residues 41 and 42"
FT   CDS_pept        complement(468236..469411)
FT                   /transl_table=11
FT                   /gene="emrA"
FT                   /locus_tag="PMI0403"
FT                   /product="multidrug resistance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41014"
FT                   /db_xref="GOA:B4EUY4"
FT                   /db_xref="InterPro:IPR005694"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUY4"
FT                   /protein_id="CAR41014.1"
FT                   /translation="MSVNEEKNPPQAPIRNKKRTRRNVLLLLTFIFILAGLAYTAYWFM
FT                   VLRHHETTDNAYVTGNQIMVMPQISGSVTTVYVDNTDYVKAGEPLVQLDDSDEILALDK
FT                   AKTALANSVRQMHQQIINGRQLKANIVLRETELAKLQNDLRRREVLGERNVIGKEELQH
FT                   AREAVATAKAALDVAKEQYNANQAIILTTPIAQQPSVLQAATEVRNAWLALQRTKILSP
FT                   AEGYVSRRSVQVGAQVAPGKPLMAVVPVTGMWIDANFKETQLANMRIGQPAKITTDFYG
FT                   KKVIYHGRVQGLDMGTGSAFSLLPAQNASGNWIKVVQRLPVRISLDEKEVAEKPLRIGL
FT                   STEVTVDTVNLDGKVLSQSERQAPAYHTDALTIDMSEINSLINEIIEQNAG"
FT   misc_feature    complement(468380..469231)
FT                   /note="HMMPfam hit to PF00529, HlyD family secretion
FT                   protein, score 3.4e-72"
FT   misc_feature    complement(469274..469342)
FT                   /note="1 probable transmembrane helix predicted for PMI0403
FT                   by TMHMM2.0 at aa 24-46"
FT   misc_feature    complement(469298..469411)
FT                   /note="Signal peptide predicted for PMI0403 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.988) with cleavage site
FT                   probability 0.617 between residues 38 and 39"
FT   CDS_pept        complement(469587..470237)
FT                   /transl_table=11
FT                   /locus_tag="PMI0404"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41016"
FT                   /db_xref="GOA:B4EUY5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUY5"
FT                   /protein_id="CAR41016.1"
FT                   /translation="MSQVLEVEKQLRKLILNMELGPGERLTERWAEAKFNASRTPVRAA
FT                   LQKLESEGLICRDGIRWLVAPIDADEIEQLCIYREILEVAALKLSVSQITEEQLNNLER
FT                   LLKETTVDSPEESMENAGTRFHRELARLCNNAFIIEGINDALRRLSRARWLDRAPSNPA
FT                   WDEHREIFVALRSRDTDKAVELLATHLCESRLRLLDTITSSKRSLRARGIAIS"
FT   misc_feature    complement(469662..470018)
FT                   /note="HMMPfam hit to PF07729, FCD domain, score 2.6e-16"
FT   misc_feature    complement(470046..470231)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 1.3e-12"
FT   CDS_pept        470323..471525
FT                   /transl_table=11
FT                   /locus_tag="PMI0405"
FT                   /product="MFS-family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41019"
FT                   /db_xref="GOA:B4EUY6"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUY6"
FT                   /protein_id="CAR41019.1"
FT                   /translation="MTQLYNSFWRRNLLVCFIGSFSTVFAMTLMLPFLPLYVEELGVQG
FT                   HAAIVQWSGVAFSATFITAGLIAPVWGKLGDKYGRKSMLVRASLGMAVTVSLMGMVTNI
FT                   WQLVGLRLLVGLAGGYSSGATILIAVQAPRERVAWALGIVSCGVMAGNLIGPLAGGWLP
FT                   DLFGIRNTFFCAGALIFLSFIMTLTLIREDTPKYINTTTKMQVSWSQLPARFVIVSMLC
FT                   TGLLLMLANMSIEPIITVYVRTLVNDPAQITRVAGYVMAAAALGSIISASWLGKLADRI
FT                   GHLRIITLALAIAGLLLIPQAFVTSGWQLIILRFLMGLALGGLLPCIAAVIRHHVPEGM
FT                   IGSILGYSVAAQFAGQFIGPLIGGVIGGHIGMRAVFLATSVVLLLGAAWNFKLHRNSVI
FT                   R"
FT   misc_feature    join(470356..470424,470467..470535,470569..470628,
FT                   470641..470709,470728..470796,470824..470892,
FT                   470953..471018,471076..471144,471163..471222,
FT                   471250..471318,471352..471420,471433..471501)
FT                   /note="12 probable transmembrane helices predicted for
FT                   PMI0405 by TMHMM2.0 at aa 25-47, 62-84, 96-115, 120-142,
FT                   149-171, 181-203, 224-245, 265-287, 294-313, 323-345,
FT                   357-379 and 384-406"
FT   misc_feature    470368..471426
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.6e-47"
FT   CDS_pept        471566..472168
FT                   /transl_table=11
FT                   /locus_tag="PMI0406"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41022"
FT                   /db_xref="GOA:B4EUY7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUY7"
FT                   /protein_id="CAR41022.1"
FT                   /translation="MTTQFNNNNNNIDKNSALLVMDFQTTILNNFLPQDRAEDVIRNTS
FT                   SLISATRAAGIPIIYVSVEFREGYPEVSQNNIIFSSIKDNGILITNSESSAIHDDIFPQ
FT                   ENEIVIIKRRVGAFSFTELEMVLRTQGIETLILAGVTTSGVILSTVSQAFDLDYRLVIV
FT                   SDCCADPDHDTHVFLLEKILSQHAVVTSSSEISKYWV"
FT   misc_feature    471599..472156
FT                   /note="HMMPfam hit to PF00857, Isochorismatase family,
FT                   score 4.3e-17"
FT   CDS_pept        complement(472371..472898)
FT                   /transl_table=11
FT                   /gene="emrR"
FT                   /locus_tag="PMI0407"
FT                   /product="MarR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41023"
FT                   /db_xref="GOA:B4EUY8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUY8"
FT                   /protein_id="CAR41023.1"
FT                   /translation="MESSFTPTEELLNTRATQQKSLNKDIPYQEILLTRLSMHVQSKLL
FT                   ESRNNMLKSQGINETLFMALMILDTTENRSIQPSELSAALGSSRTNATRIADELEKQGW
FT                   IERRESHNDRRCLHLHLTDAGEEFLNSLLPPQHECLKKIWSVLDEGEQKQLETLMRKLL
FT                   LQLDTLADNQQE"
FT   misc_feature    complement(472413..472730)
FT                   /note="HMMPfam hit to PF01047, MarR family, score 2.3e-34"
FT   misc_feature    complement(472524..472628)
FT                   /note="PS01117 Bacterial regulatory proteins, marR family
FT                   signature."
FT   CDS_pept        complement(473391..474611)
FT                   /transl_table=11
FT                   /locus_tag="PMI0408"
FT                   /product="MFS-family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41024"
FT                   /db_xref="GOA:B4EUY9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUY9"
FT                   /protein_id="CAR41024.1"
FT                   /translation="MISIMENTAPQTSLSKGLILLMAVATGMVVASNYYAQPLLDSIAN
FT                   YFHISATLAGFIVTTAQLSYALGLMLLVPLGDIFERRSLIVIMTLISASGLLITAMAPN
FT                   IWLMLIGTALSGMFSVVAQILVPFAATLAAPHQRGKAVGTIMSGLLLGILLARTASGLM
FT                   ASFTNWQGIFWLASVFLAILAITLWRCLPTYKSQTNLNYFQLLGSIFKLFATTPVLRTR
FT                   SLIGALIFAHFGLLWTSMAFLLASDPFNYSDAVIGLFGLVGAAGALMAGKAGVWVDKGK
FT                   GKKTTTSGLILLFICWGLIVIAPYYQWIGLISFIIGVVLLDLAVQGVHVTNQSTIYRIL
FT                   PDARNRLTAAYMTSYFIGGALGSLLSGYAYHQYGWIGVSSAGAIIGLLGLLVWLFGYKN
FT                   DPVIQSE"
FT   misc_feature    complement(join(473421..473489,473502..473570,
FT                   473676..473744,473781..473849,473877..473945,
FT                   474036..474104,474132..474191,474228..474296,
FT                   474306..474365,474384..474452,474495..474563))
FT                   /note="11 probable transmembrane helices predicted for
FT                   PMI0408 by TMHMM2.0 at aa 17-39, 54-76, 83-102, 106-128,
FT                   141-160, 170-192, 223-245, 255-277, 290-312, 348-370 and
FT                   375-397"
FT   misc_feature    complement(473499..474548)
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 3.4e-44"
FT   misc_feature    complement(474504..474611)
FT                   /note="Signal peptide predicted for PMI0408 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991) with cleavage site
FT                   probability 0.634 between residues 36 and 37"
FT   CDS_pept        474978..477371
FT                   /transl_table=11
FT                   /locus_tag="PMI0409"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41027"
FT                   /db_xref="GOA:B4EUZ0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUZ0"
FT                   /protein_id="CAR41027.1"
FT                   /translation="MIIIIINMIVLLNVFLAIYLRINNHIKDTIMNFLLIKHEPHFQGM
FT                   GAVSFSSHAIFLLLTTLASFNSVASQSTEKASQTQQSETVVLDPIYVSGKLNSSVEAGS
FT                   TALTLKDINRIQPNNIAELVDKLPGISSSGSPRPGGQTLNIWGMGNPEDVKITLDGTPK
FT                   TFEKYRQGSIFIDPELIKRLDVDKGPHNITQGNGGFGGSVRIETKDPDDLLLPDQHIGM
FT                   FLKYGHHTNDRQNRYSGAIYGKLMDGTADGLFYFNRRKSDDLRRPDGTKFGYSQSDQDS
FT                   FLIKTNVYLTDAQTLTLSASRSVSDGWTPWAAKRDELAKPSQYDVDKYGFDGAMKRKLV
FT                   YRDQKDDTVSVKWNIQPIDSDLINFTLTYGYSNTKQNDKRPDNASSYLSSSMGNQSWVN
FT                   YKNHQIEVKNESTVMQGATEHVILVGARWHRNDRNVLMFTRDKAKNPNYNYGYYAPPYM
FT                   PEGTQTTTSFYLQDSISYRTLTLTPGVRYDIVKNQGAGSRAKVYQDPNPYYGHDYSDVT
FT                   YRGITPHLGILWKATPNIRFFGDITHTWRAPLIDEQYEVQASISSLTGTSRHLDKETVT
FT                   ATRIGAIVDFENVFQQEDQLQLRSTFFDTRGKDEIFRRRGVYCESGKVTGNNGSCPPSL
FT                   GNYRNLPGYHIQGMEIEAFYDSTNLFGRLAYSTMKGKRDQSPRDPWFGQKTWIAEIQPD
FT                   ALHATLGMKIPQINMVAGWTGDFIGAQRRSPMDADPAATYWSLPKSKGYAIHGLFANWK
FT                   PAFIDNTEIRFTVANLFNRDYYPYLGESVSGTGRDYRFTVVKSF"
FT   misc_feature    474981..475049
FT                   /note="1 probable transmembrane helix predicted for PMI0409
FT                   by TMHMM2.0 at aa 2-24"
FT   misc_feature    475263..475583
FT                   /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug
FT                   Domain, score 2.8e-15"
FT   misc_feature    476541..477368
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor,
FT                   score 2.3e-19"
FT   CDS_pept        complement(477460..478455)
FT                   /transl_table=11
FT                   /gene="proX"
FT                   /locus_tag="PMI0410"
FT                   /product="putative glycine betaine/L-proline ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41029"
FT                   /db_xref="GOA:B4EUZ1"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUZ1"
FT                   /protein_id="CAR41029.1"
FT                   /translation="MRNPVLWATVLSATLISTQLSAADLPGKGVSVQPVQSTISEETFQ
FT                   TLIVNKALEKLGYTVQPIKEVDYNVAYSSIANGDATFMAVSWVPLHNSQYEAAGGDNTF
FT                   YRKGDYVVNAAQGYLIDKKTAEKYNITNIEQFKDPKIAKLFDANGDGKADLTGCNPGWG
FT                   CEEAINNHLKAYDLEKSVTHNQGNYAAMMADTITRYKEGKPIFYYTWTPYWISDVLKPG
FT                   KDVVWLQVPFSSLPGDDKTDTTLPNGKNYGFPPSTMHIAANKKWAEANPAAAKLFEIMK
FT                   VSVADINAQNLRMHNGQKSQADIERHANAWIKAHQKTFDGWVEEARKAAN"
FT   misc_feature    complement(477484..478365)
FT                   /note="HMMPfam hit to PF04069, Substrate binding domain of
FT                   ABC-type glycine, score 1.4e-76"
FT   misc_feature    complement(478390..478455)
FT                   /note="Signal peptide predicted for PMI0410 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.993 between residues 22 and 23"
FT   CDS_pept        complement(478575..479804)
FT                   /transl_table=11
FT                   /gene="proW"
FT                   /locus_tag="PMI0411"
FT                   /product="glycine betaine/L-proline ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41030"
FT                   /db_xref="GOA:B4EUZ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUZ2"
FT                   /protein_id="CAR41030.1"
FT                   /translation="MSKTNNQANPWETDTQEAATENANTTQNSAQETHNNTDTDNDPWA
FT                   TTDSNTTDTDPWSSSAGGDTGGADADPWGTGSGTDGSDLSSGTDWLDAMPTESTPDHFN
FT                   IMDPFNHTLIPLDSWVTDGIDWIVLHFRPIFQGIRVPVDLVLGGFENFLTSMPAPVAII
FT                   LFSLIAWQLSGKVMGISAFISLILIGAIGAWSEAMITLALVLTSLLFCLIIGLPLGIWL
FT                   AHSDRASKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILG
FT                   IKQVPEDLIEAAQSFGANPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVG
FT                   GLGQMVLRGIGRLDMGLAAVGGAGIVILAIILDRLTQSLGQNSRLKGNRRWYMTGPIGL
FT                   ICRLFGKKAA"
FT   misc_feature    complement(478650..479216)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 2.9e-33"
FT   misc_feature    complement(join(478689..478757,478767..478835,
FT                   478992..479060,479136..479204,479223..479279,
FT                   479307..479375))
FT                   /note="6 probable transmembrane helices predicted for
FT                   PMI0411 by TMHMM2.0 at aa 144-166, 176-194, 201-223,
FT                   249-271, 324-346 and 350-372"
FT   misc_feature    complement(478875..478961)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        complement(479797..480996)
FT                   /transl_table=11
FT                   /gene="proV"
FT                   /locus_tag="PMI0412"
FT                   /product="glycine betaine/L-proline ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41033"
FT                   /db_xref="GOA:B4EUZ3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUZ3"
FT                   /protein_id="CAR41033.1"
FT                   /translation="MAIKLEVKNLYKIFGEHPKRAFELLGSGMNKDQIFDKTGLTVGVQ
FT                   NANLAIEEGEIFVIMGLSGSGKSTLVRLLNRLIDPTKGEVLIDGENITTMSDKDLRQVR
FT                   RKKISMVFQSFALMPHMNVLDNTAFGMELAGISKEERYEKAMAALEQVNLSSHAQSWPD
FT                   ELSGGMRQRIGLARALANDPDILLMDEAFSALDPLIRTEMQDELLSLQGDKQRTIVFIS
FT                   HDLDEAMRIGDRIAIMQGGVVVQIGTPDEILNNPANDYVRTFFRGVDISHVFSAKDIAK
FT                   RRPETLLHIAPGFGPRSALKVLEDEDRNFGYLIERGRKFAGIVSVTSLEEALKAKQPIG
FT                   SAILTEPCAINGDTPLNELISTVAQSPCAIPVIDEKNRYIGLISKGMLLQALDKETPNE
FT                   "
FT   misc_feature    complement(479818..479976)
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 4e-05"
FT   misc_feature    complement(480274..480837)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.5e-68"
FT   misc_feature    complement(480460..480504)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(480793..480816)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(481605..482573)
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="PMI0413"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41036"
FT                   /db_xref="GOA:B4EUZ4"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUZ4"
FT                   /protein_id="CAR41036.1"
FT                   /translation="MSASYLSRVNAINWNRIEDEKDLEVWNRLTMNFWLPEKIPLSNDI
FT                   PSWNTLTQAEKQLTIRVFTGLTLLDTIQNTVGAPTLMPDAQTPHEEAVLSNICFMEAVH
FT                   ARSYSSIFSTLCLTTDVDDAYRWSEENTYLQKKSDIILRYYQDSDPLKKKIASVFLESF
FT                   LFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKFQNQLLNKSSLEKQNIK
FT                   DFAFSLLLDLYDNEVKYTEDLYDSVGWTEDVKKFLHYNANKALMNLGYEALFPDEITNV
FT                   SPAILSSLSPDANENHDFFSGSGSSYVIGKTINTEDDDWDF"
FT   misc_feature    complement(481722..482564)
FT                   /note="HMMPfam hit to PF00268, Ribonucleotide reductase,
FT                   small chain, score 3.3e-93"
FT   misc_feature    complement(482226..482276)
FT                   /note="PS00368 Ribonucleotide reductase small subunit
FT                   signature."
FT   CDS_pept        complement(482599..484725)
FT                   /transl_table=11
FT                   /gene="nrdE"
FT                   /locus_tag="PMI0414"
FT                   /product="ribonucleoside-diphosphate reductase alpha chain"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41038"
FT                   /db_xref="GOA:B4EUZ5"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUZ5"
FT                   /protein_id="CAR41038.1"
FT                   /translation="MTHSIEQLDYHALNAMLNLYDEQGNIQFDKDKLATHHFFRQHVNQ
FT                   NTVFFHDLKEKLDFLVQQHYYEAQVLEQYDFPFIKQLFKHAYSKKFRFQSFLGAFKYYT
FT                   SYTLKTFDGERYLERYEDRVCMVALTLAQGNTKLATHLVDEIISGRFQPATPTFLNCGK
FT                   KQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLTNLREAGAPIKRIENQS
FT                   SGVVPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDIYHFLDTKRENADEKIRIKTLS
FT                   LGVVIPDITFELAKRNEDMYLFSPYDVERVYGVPMSEISISEKYTEMVNNAEIRKKKIK
FT                   ARAFFQTLAEIQFESGYPYIMFEDTVNRANPIAGRINMSNLCSEILQVNSASEYNPDLS
FT                   YRQIGHDISCNLGSMNIAMAMDSPDFAHTVNVAIRALTSVAQMTKIESVPSIEKGNQAS
FT                   HAIGLGQMNLHGYLAREGIYYGSEEGLDFTNIYFYTVTYYALLASNQLAIETKQRFKGF
FT                   EQSKYATGEYFDKYLSKQWLPKTQKVHQLFSQSNIHIPTQEDWQKLKLSIMTHGIYNQN
FT                   LQAIPPTGSISYINHSTSSIHPIVAPIEIRKEGKIGRVYYPAPFMTNENRHFYQDAYEI
FT                   GAEKIIDTYAQASQHIDQGLSLTLFFSDEATTRDVNKAQIYAWRKGIKTLYYIRIRQTA
FT                   LAGTEIKGCVSCAL"
FT   misc_feature    complement(482650..484221)
FT                   /note="HMMPfam hit to PF02867, Ribonucleotide reductase,
FT                   barrel doma, score 1e-217"
FT   misc_feature    complement(482980..483048)
FT                   /note="PS00089 Ribonucleotide reductase large subunit
FT                   signature."
FT   misc_feature    complement(484228..484452)
FT                   /note="HMMPfam hit to PF00317, Ribonucleotide reductase,
FT                   all-alpha d, score 5.5e-27"
FT   CDS_pept        complement(484754..485158)
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="PMI0415"
FT                   /product="NrdI protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41041"
FT                   /db_xref="GOA:B4EUZ6"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUZ6"
FT                   /protein_id="CAR41041.1"
FT                   /translation="MQSTAPLIYFSSRSENCHRFVQKLNLQATRIKEDEPLQATQPFVL
FT                   LCPTYGGGGVKGAVPKAVIQFLNIPENRQLIRGVIASGNTNFGSAYGLAGDIIAQKCQV
FT                   PFLYRFELLGTPEDVKRVKTGLSTFWSASK"
FT   CDS_pept        complement(485170..485394)
FT                   /transl_table=11
FT                   /gene="nrdH"
FT                   /locus_tag="PMI0416"
FT                   /product="glutaredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41042"
FT                   /db_xref="GOA:B4EUZ7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUZ7"
FT                   /protein_id="CAR41042.1"
FT                   /translation="MSVILYTKPNCVQCSATERALQQQKIPFTAVDLTQDTQALAKIVS
FT                   MGYRQVPVVVNGDEHWSGFCPDKIRQIAR"
FT   CDS_pept        485676..486149
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="PMI0417"
FT                   /product="putative methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41044"
FT                   /db_xref="GOA:B4EUZ8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUZ8"
FT                   /protein_id="CAR41044.1"
FT                   /translation="MYQDYLNTPKGFPKPYISITADDDGITSLNFVSEKEALVNSNAII
FT                   DLCIKQLKEYFSGKRTLFSVPLAPKGTEFQIRVWQTLQSIPYGEIWSYKKLALTLGSVN
FT                   YCRAVGMANSRNPISLIIPCHRVIGHNGKLVGYTGGLDIKRWLLHYEKVDIDE"
FT   misc_feature    485886..486143
FT                   /note="HMMPfam hit to PF01035, 6-O-methylguanine DNA
FT                   methyltransferas, score 4e-38"
FT   misc_feature    486039..486059
FT                   /note="PS00374 Methylated-DNA--protein-cysteine
FT                   methyltransferase active site."
FT   CDS_pept        486347..486556
FT                   /transl_table=11
FT                   /gene="cspE"
FT                   /locus_tag="PMI0418"
FT                   /product="putative cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41046"
FT                   /db_xref="GOA:B4EUZ9"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B4EUZ9"
FT                   /protein_id="CAR41046.1"
FT                   /translation="MSKLKGNVKWFNETKGFGFITPEDGSKDVFVHFSAIVSEGFKTLA
FT                   EGQKVEFEVTDGAKGPSAANVVAI"
FT   misc_feature    486353..486553
FT                   /note="HMMPfam hit to PF00313, 'Cold-shock' DNA-binding
FT                   domain, score 3.5e-42"
FT   misc_feature    486395..486454
FT                   /note="PS00352 'Cold-shock' DNA-binding domain signature."
FT   CDS_pept        complement(487014..487388)
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="PMI0419"
FT                   /product="putative membrane protein (protein CrcB)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41048"
FT                   /db_xref="GOA:B4EV00"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EV00"
FT                   /protein_id="CAR41048.1"
FT                   /translation="MLNIAIAVFIGGGLGSVLRWLISYRLNSLFPHFATGTLVANCIGA
FT                   FIIAFGIAWFSKAPNIDPIWKIMLTTGFCGGLTTFSTFSVEVVALFNEGRIGWALGTMG
FT                   ANLAGSFLMTAFAFWLLREM"
FT   misc_feature    complement(join(487026..487094,487122..487190,
FT                   487224..487292,487320..487376))
FT                   /note="4 probable transmembrane helices predicted for
FT                   PMI0419 by TMHMM2.0 at aa 5-23, 33-55, 67-89 and 99-121"
FT   misc_feature    complement(487026..487376)
FT                   /note="HMMPfam hit to PF02537, CrcB-like protein, score
FT                   2.9e-39"
FT   CDS_pept        complement(487404..488369)
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="PMI0420"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41050"
FT                   /db_xref="GOA:B4EV01"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EV01"
FT                   /protein_id="CAR41050.1"
FT                   /translation="MSKPIQMERGVKYRDADKMALIPVKTIVTEREELLRKPEWMKIKL
FT                   PADSSKIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVA
FT                   HGRPNAPDPQEPIKLAQTIKDMGLRYVVITSVDRDDLRDGGAQHFADCITAIREKNPNI
FT                   RIETLVPDFRGRMDKALEILTDTPPDVFNHNLENVPRVYRQVRPGANYQWSLTLLERFK
FT                   QAHPNIPTKSGLMVGLGETNEEIIDVMRDLRKHGVTMLTLGQYLQPSRHHLPVQRYVSP
FT                   DEFEYMKEQALAMGFTHAACGPFVRSSYHADLQAQGIEVK"
FT   misc_feature    complement(487614..488108)
FT                   /note="HMMPfam hit to PF04055, Radical SAM superfamily,
FT                   score 5.2e-26"
FT   CDS_pept        complement(488471..489115)
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="PMI0421"
FT                   /product="lipoyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41052"
FT                   /db_xref="GOA:B4EV02"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV02"
FT                   /protein_id="CAR41052.1"
FT                   /translation="MKIFTVQDKTIIIRQLGMKPYLPVSDSMHQFTEKRESHTPDEIWL
FT                   VQHEQVFTQGQAGKAEHLLNTGSIPVIQSDRGGQVTYHGPGQQVMYVLLDLKRNHIGVR
FT                   QLVTVLENTVINTLAEFNVDAYARADAPGVYVNGDKICSLGLRIRKGCSFHGLALNVDM
FT                   DLSPFTRINPCGYPDLKMTQLVDLAPNATSEQVASLLINHFCTQLGFQPQQ"
FT   misc_feature    complement(488615..488956)
FT                   /note="HMMPfam hit to PF03099, Biotin/lipoate A/B protein
FT                   ligase famil, score 8.3e-30"
FT   misc_feature    complement(488843..488890)
FT                   /note="PS01313 Lipoate-protein ligase B signature."
FT   CDS_pept        complement(489467..489733)
FT                   /transl_table=11
FT                   /locus_tag="PMI0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41055"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV03"
FT                   /protein_id="CAR41055.1"
FT                   /translation="MMKTKLNELLEFPCSFTYKVMGHAKPELVDQVVEVIQRHAPGDYT
FT                   PSVKPSSKGNYHSVSVTINATHIEQVETLYKELGELELVRMVL"
FT   misc_feature    complement(489470..489730)
FT                   /note="HMMPfam hit to PF04359, Protein of unknown function
FT                   (DUF493), score 6.2e-55"
FT   CDS_pept        complement(489929..491140)
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /gene_synonym="dacA; Synonyms=pfv;
FT                   OrderedLocusNames=b0632;"
FT                   /locus_tag="PMI0423"
FT                   /product="putative penicillin-binding protein"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41057"
FT                   /db_xref="GOA:B4EV04"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV04"
FT                   /protein_id="CAR41057.1"
FT                   /translation="MKQTRPVKLLRTRLFSATFILLAISHHAIADDTLKTMIPAVPNIE
FT                   AESYILIDYNSGKVLAEKNADVRRDPASLTKMMTSYVIGQAIRAGKISNNDIVPIGEEA
FT                   WATGNPVFRGSSLMFLKPGDKVTVSQLTRGINLQSGNDACVAMASYVAGSQDTFVTMMN
FT                   DYVKRLGLQNTQFQTVHGLDAPGQYSSARDMALIGAALIRDVPEEYAIYKEKEFTYNNI
FT                   RQTNRNGLLWDTSLNVDGIKTGHTEAAGYNLVASATEGNMRLISAVMGGHSSKGRDAES
FT                   KKLLTWGFRFFETVKPLQVGKEFAAEPIWYGDTDKVQLGVDKDVYLTIPRGRLKDLKAS
FT                   YVLDNVELHAPVSKNQVVGTINFQLDGQVIEQRPLVVMNEVKEGGIFSRLIDYIKLLFS
FT                   RWFG"
FT   misc_feature    complement(489992..490267)
FT                   /note="HMMPfam hit to PF07943, Penicillin-binding protein
FT                   5, C-termina, score 8.2e-38"
FT   misc_feature    complement(490322..491038)
FT                   /note="HMMPfam hit to PF00768, D-alanyl-D-alanine
FT                   carboxypeptidase, score 2.1e-141"
FT   misc_feature    complement(491051..491140)
FT                   /note="Signal peptide predicted for PMI0423 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 30 and 31"
FT   misc_feature    complement(491051..491104)
FT                   /note="1 probable transmembrane helix predicted for PMI0423
FT                   by TMHMM2.0 at aa 13-30"
FT   CDS_pept        complement(491267..492280)
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="PMI0424"
FT                   /product="rare lipoprotein A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41058"
FT                   /db_xref="GOA:B4EV05"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV05"
FT                   /protein_id="CAR41058.1"
FT                   /translation="MRLQWVLMGVSALLLAGCVADKPVNNNQPTTRLPNVPTQPVLGIE
FT                   PRYEPYHPTANQDYRKNGVIYRIVKDPANFSERGQAIVYDSLAMSRLTTIGERVNPYEF
FT                   AAAHPTLPIPSYAKITNLINGRTMIVRINDRGPYVEGKQIQVTPAVYNSLQLMPTTPIQ
FT                   IEGIVVDQNGQISGIGTQGAQIEKRATTLPERPNFNTQPSTMAPQPSVTAPSPITVTQP
FT                   APAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPQPVSSSSAIAQGYYVQVGALSNQTNAQ
FT                   TWLTELTNALNTQGVINTTDGLHKVQLGPYSSKTQAETIKSALKQSKNIDGFIVSQ"
FT   misc_feature    complement(491273..491383)
FT                   /note="HMMPfam hit to PF05036, Sporulation related repeat,
FT                   score 6.6e-08"
FT   misc_feature    complement(491384..491494)
FT                   /note="HMMPfam hit to PF05036, Sporulation related repeat,
FT                   score 0.0014"
FT   repeat_region   491519..491608
FT                   /note="(tggagc)15"
FT   misc_feature    complement(491789..492055)
FT                   /note="HMMPfam hit to PF03330, Rare lipoprotein A
FT                   (RlpA)-like double-psi be, score 4.2e-09"
FT   misc_feature    complement(492227..492259)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(492291..493403)
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="PMI0425"
FT                   /product="rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41062"
FT                   /db_xref="GOA:B4EV06"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV06"
FT                   /protein_id="CAR41062.1"
FT                   /translation="MTENNKKKSLWTRLHIDPFFMLCIIALLCYSAFIMWTASGQDPDM
FT                   MERKLGQIATGFIVMIIMAQIPPRVYENWAPHLYVFCVVLLIFVDVFGQISKGAQRWLD
FT                   LGIIRFQPSEIAKIAVPLMVARFMNRDVCPPTLRNTAIALVLIFVPTLLVAAQPDLGTS
FT                   ILIAASGIFVIFLAGMSWRLITVATLLIAGFIPILWFFLMHDYQRTRVMMLLDPEIDPL
FT                   GAGYHIIQSKIAIGSGGLHGKGWLQGTQSQLEFLPERHTDFIFAVLAEELGLIGVLILL
FT                   TLYILLIARGLYLATKAQNTFGRVMIGGLMLIFFVYVFVNIGMVSGILPVVGVPLPLVS
FT                   YGGSALIVLMAGFGIVMSIHTHRKLLSKSL"
FT   misc_feature    complement(492309..493352)
FT                   /note="HMMPfam hit to PF01098, Cell cycle protein, score
FT                   1.6e-165"
FT   misc_feature    complement(join(492324..492392,492420..492488,
FT                   492522..492590,492795..492863,492867..492926,
FT                   492936..492995,493107..493175,493203..493256,
FT                   493293..493361))
FT                   /note="9 probable transmembrane helices predicted for
FT                   PMI0425 by TMHMM2.0 at aa 15-37, 50-67, 77-99, 137-156,
FT                   160-179, 181-203, 272-294, 306-328 and 338-360"
FT   misc_feature    complement(492369..492443)
FT                   /note="PS00428 Cell cycle proteins ftsW / rodA / spoVE
FT                   signature."
FT   misc_feature    complement(493284..493403)
FT                   /note="Signal peptide predicted for PMI0425 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.994) with cleavage site
FT                   probability 0.976 between residues 40 and 41"
FT   CDS_pept        complement(493408..495303)
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="PMI0426"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41064"
FT                   /db_xref="GOA:B4EV07"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV07"
FT                   /protein_id="CAR41064.1"
FT                   /translation="MKKRKRTPFRDYTAESKLFIRRVIVAFSGILVLTGILVFNLYHLQ
FT                   VARHDDYQTRSNDNRIKLVPIPPSRGIIYDRNGVPLALNRTIYQLEIVPEKVANIQETL
FT                   ESLREVVDLTDDDIAAFEKERKRSRRFSSIPLKTSLDQVQVARFAINQYRYPGLEIKGY
FT                   QRRYYPYGSALTHVIGYVAKINDKDVERLEKEGLYPNYAATRDIGKLGIERYYESVLHG
FT                   KTGYEEVEVNSRGRVIRQLHEQPPQAGKDIYLTIDLELQTYIETLLTTSRAAVVVTDPR
FT                   NGEILALVSNPSYDPNLFVGGISNTDYQGLLNNPDRPLINRATQGLYPPASTVKPFMSV
FT                   AALSEGVITPNTTIHDPGWWQLPGSEKRYRDWKRWGHGKLNVTKSIIESADTFFYQVAY
FT                   DMGIDRISTWMSRFGYGEYTGIDLSEERNGIMPTREWKQQRYKKPWYQGDTIPVGIGQG
FT                   YWTATPIQMSKALMTLINDGQVKTPHLLYGTKLGNEMLPYVDKETRQIGDINSGYWELA
FT                   KYGMYGVANLPNGTGRRSFADAPYKIAAKSGTAQVFSYETYNASQLAEHLRDHKLMIAF
FT                   APYENPTVAVSIILENGGAGPSVGDITRQILDHIILGDNNTELPISPPSPRGSEE"
FT   misc_feature    complement(493480..494487)
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptid, score 2.9e-94"
FT   misc_feature    complement(494578..495111)
FT                   /note="HMMPfam hit to PF03717, Penicillin-binding Protein
FT                   dimerisatio, score 2.6e-65"
FT   misc_feature    complement(495169..495237)
FT                   /note="1 probable transmembrane helix predicted for PMI0426
FT                   by TMHMM2.0 at aa 29-51"
FT   CDS_pept        complement(495341..495811)
FT                   /transl_table=11
FT                   /locus_tag="PMI0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41066"
FT                   /db_xref="GOA:B4EV08"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EV08"
FT                   /protein_id="CAR41066.1"
FT                   /translation="MKLQLIAVGTKMPDWIQTGFMDYLNRFPKDMPLELIEIPAGKRGK
FT                   NADIKRILEKEGEQMLAAVGKGNRIVTLDIPGARWDTPKLAEQLDRWKLDGRNVSLLIG
FT                   GPEGLAPACKAAAEQSWSLSPLTMPHPLVRVVVAESLYRAWSITTNHPYHRE"
FT   misc_feature    complement(495350..495811)
FT                   /note="HMMPfam hit to PF02590, Uncharacterized ACR,
FT                   COG1576, score 4.4e-81"
FT   CDS_pept        complement(495814..496131)
FT                   /transl_table=11
FT                   /locus_tag="PMI0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41068"
FT                   /db_xref="GOA:B4EV09"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV09"
FT                   /protein_id="CAR41068.1"
FT                   /translation="MQGSELQQFIIDKLEDSKAQDIIALDVRGKSSVTDYMIICTGTSN
FT                   RHLMSVADNLVDDCREAGLQPLGIEGQGVSDWIVVDLGEAMVHVMQEDSRRMYELEKLW
FT                   S"
FT   misc_feature    complement(495817..496122)
FT                   /note="HMMPfam hit to PF02410, Domain of unknown function
FT                   DUF143, score 1.9e-48"
FT   misc_feature    complement(496039..496062)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        496531..497286
FT                   /transl_table=11
FT                   /locus_tag="PMI0429"
FT                   /product="putative conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41069"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV10"
FT                   /protein_id="CAR41069.1"
FT                   /translation="MKENYYYLEQTSEIASNKNALLQADWQRFCQLLCYEGIEIKQNND
FT                   EKRQNKAVICRVKMKGEYSSTLFTQILGGGELQLTLEQFSQPSGLEHFLTQFFALIDYQ
FT                   QQVNAKLSKKALIQFHSRYKYLLMAYSQVAYRELGRYMANIPNSLPLLQFAEQYQKALM
FT                   KALSIPATREGHTNALMHMAGYFKRALSAEQKQLLTQEILSYRQGKTSLSAPLSRLKNY
FT                   LAFYPDNYLLSQRYFSPYPAVFDDLRAQF"
FT   CDS_pept        complement(497300..497971)
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="PMI0430"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41071"
FT                   /db_xref="GOA:B4EV11"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV11"
FT                   /protein_id="CAR41071.1"
FT                   /translation="MASTNNNPPLIHQAIALYGGTFDPIHYGHLRPVEALSGLIGLKEV
FT                   IWLPNNIPPHRPQPEASSQQRLAMVRLALQPFSAFKVDTRELEKPTPSYTIETLKAFRQ
FT                   EIGEKQPLAFIIGQDSLLSIDTWHKWEELLDVCHLLVCARPGYQTTFTSPQMQTWLEQH
FT                   QTKQQADIHCLPAGKIFLADTPLYNISATDIRARHKAGLDCHDLLPESVENYIKQHQLY
FT                   R"
FT   misc_feature    complement(497381..497923)
FT                   /note="HMMPfam hit to PF01467, Cytidylyltransferase, score
FT                   2.4e-55"
FT   CDS_pept        complement(497964..498998)
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="PMI0431"
FT                   /product="DNA polymerase III delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41073"
FT                   /db_xref="GOA:B4EV12"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV12"
FT                   /protein_id="CAR41073.1"
FT                   /translation="MIRLYPEQLNAQLQEGLRQSYLLWGNEPLLLQESQDAIQTVAKSQ
FT                   GFTEHYQFTLDNSTDWNEIYSLCQSLSLFSQKQSILLHLPENGPNAAMSEKLLRLSHEL
FT                   HEDLLLILRGHKLTKAQENSEWFKTLSQQGIYVTCLTPELDKLPNWVARRAKQKGLELD
FT                   EQGNQLLCYCYEGNLLALAQAIERLCLLYPDGKLTLPRVEAAVNDASHFTAYHWIDALL
FT                   AGKTQRAWHILQQLKREDTEPVILLRTLQRELMQLITLHRSAKTASLKSVFDQHRIWQN
FT                   RRPIFTAALQRLSEHQLLTAMRLLTQIEITLKQDHGQNVWPELHALGLLLCGKALPEGF
FT                   IRHG"
FT   misc_feature    complement(498012..498938)
FT                   /note="HMMPfam hit to PF06144, DNA polymerase III, delta
FT                   subunit, score 2e-115"
FT   CDS_pept        complement(498995..499543)
FT                   /transl_table=11
FT                   /gene="rlpB"
FT                   /locus_tag="PMI0432"
FT                   /product="rare lipoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41075"
FT                   /db_xref="GOA:B4EV13"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV13"
FT                   /protein_id="CAR41075.1"
FT                   /translation="MRYLFSLFFALAVLVTAGCGFHLQGKTQVPAELKTLYLSSGDPYG
FT                   PLSRVMRQQLRLSGVQLVETPKADIPVLKIVGSSENKETVSVYQDGKSAERQLTFVLDA
FT                   QVIMPDGTIYPISSQVSRPFFDNPLEALAKDAENDIIKQEMREQATAILVRKLLVVHNA
FT                   ERQKASEAAKAKQIISPAK"
FT   misc_feature    complement(499055..499489)
FT                   /note="HMMPfam hit to PF04390, Rare lipoprotein B family,
FT                   score 1.3e-57"
FT   misc_feature    complement(499463..499486)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(499469..499543)
FT                   /note="Signal peptide predicted for PMI0432 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991) with cleavage site
FT                   probability 0.889 between residues 25 and 26"
FT   misc_feature    complement(499487..499519)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(499556..502138)
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="PMI0433"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41076"
FT                   /db_xref="GOA:B4EV14"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EV14"
FT                   /protein_id="CAR41076.1"
FT                   /translation="MQEQYRPEDIEQTIQEHWEKNNTFKVTEDNNKEKYYCLSMLPYPS
FT                   GRLHMGHVRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYEN
FT                   INYMKGQLKKLGFGYDWDREVTTCTPEYYRWEQWFFTKLYEKGLVYKKTSAVNWCPHDL
FT                   TVLANEQVIDGCCWRCDTPVERKEIPQWFIKITDYAEELLNDLDTLDEWPEQVKTMQRN
FT                   WIGRSEGVEITFDVADSDDTMTVYTTRPDTFMGVTYVAVAAGHPLAQKAAQNNPEIQHF
FT                   IDECRNMKMAEAEMATMEKKGIATGLYAIHPLTQEKVAIWVANFVLMEYGTGAVMAVPG
FT                   HDERDWEFATKYGLPIKAVIADAEGNQPDLSTGALTEKNSLINSGEFSGLDNQAGFNAI
FT                   ADKLTAMGVGERKVNYRLRDWGVSRQRYWGAPIPMATLEDGSVVPVPDDQLPVILPEDV
FT                   KMDGITSPIKADPEWAKTTINGQPALRETDTFDTFMESSWYYARYTCPDYDKGMLDPKA
FT                   ANYWLPVDWYIGGIEHAIMHLMYFRFFHKLMRDAGLVNSDEPAKRLLCQGMVLADAFYY
FT                   TGEDGARHWVSPAEAIVERDEKNRIIKATDSAGHELTYAGMSKMSKSKNNGIDPQTMVE
FT                   RYGADTVRLFMMFAAPPELTLEWQESSVEGANRFLRRLWRLVHEHTEKGTTQSLDLATL
FT                   TTEQKDLRRDLHKTIAKVSDDVGRRLAFNTAIAAIMELMNKLTRAPQETEQDRALMQEA
FT                   LEAVVRMLSPIIPHACFVMWQALGGKEDIDVAPWPVADEEAMVDDTKLIIVQVNGKVRG
FT                   RITVPANSEKDYVQEMATKEYSVAKYLENVTVRKVIYVPGKLLNIVVG"
FT   misc_feature    complement(499964..500014)
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT   misc_feature    complement(500162..502102)
FT                   /note="HMMPfam hit to PF00133, tRNA synthetases class I (I,
FT                   L, M and V), score 1.7e-271"
FT   misc_feature    complement(501980..502015)
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   CDS_pept        complement(502498..503223)
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="PMI0434"
FT                   /product="glutamate/aspartate ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41080"
FT                   /db_xref="GOA:B4EV15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV15"
FT                   /protein_id="CAR41080.1"
FT                   /translation="MISLKDVSKWYGQFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPIQQGEILVNDIKVNDKRTDLAKLRAKVGMVFQHFELFPHLSIIENLTLAQVK
FT                   VLNREKGAAKEKGLKLLERVGLANHANKYPAQLSGGQQQRVAIARALCMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFAKKVADRIIFMDEGRIVEDSPKND
FT                   FFDNPKSERAKDFLAKILH"
FT   misc_feature    complement(502588..503145)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.3e-63"
FT   misc_feature    complement(502771..502815)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(503101..503124)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(503224..503898)
FT                   /transl_table=11
FT                   /gene="gltK"
FT                   /locus_tag="PMI0435"
FT                   /product="glutamate/aspartate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41082"
FT                   /db_xref="GOA:B4EV16"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV16"
FT                   /protein_id="CAR41082.1"
FT                   /translation="MYEFDWSSVVPSLPFLMDGMVITLKITITAIVIGILWGTILAVMR
FT                   LSTFKPISWFAAAYVNTFRSIPLVMVLLWFYLIVPNILQNVLGLSPKSDIRLISAMVAF
FT                   SLFEAAYYSEIIRAGIQSISKGQFSASLALGMTKSQTMRLVILPQAFRAMIPLLLTQGI
FT                   VLFQDTSLVYVLSLTDFFRTAANIGERDGTQVEMILFAGFVYFIISFSASMLVNFLKKR
FT                   TT"
FT   misc_feature    complement(503227..503853)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 9.8e-26"
FT   misc_feature    complement(join(503242..503310,503401..503469,
FT                   503551..503610,503668..503736,503773..503841))
FT                   /note="5 probable transmembrane helices predicted for
FT                   PMI0435 by TMHMM2.0 at aa 20-42, 55-77, 97-116, 144-166 and
FT                   197-219"
FT   CDS_pept        complement(503898..504638)
FT                   /transl_table=11
FT                   /gene="gltJ"
FT                   /locus_tag="PMI0436"
FT                   /product="glutamate/aspartate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41084"
FT                   /db_xref="GOA:B4EV17"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV17"
FT                   /protein_id="CAR41084.1"
FT                   /translation="MSIDWDWGIFFQEAPFGNTTYLGWLISGFQVTVALSLCAWIIAFI
FT                   VGSFFGILRTVPNRLLSSLGAIYVELFRNVPLIVQFFTWYLVIPELLPQAIGDWFKMDL
FT                   TPNIQFFVSSALCLGLFTAARMCEQVRAAINSLPRGQKAAGLALGLTLPQTYRYVLLPN
FT                   AYRVIIPPMTSEMLNLVKNSAIASTIGLIDMAAQANKLLDYSAKAYESFTAITLAYVFI
FT                   NVIIMLIMHWLEKRVRLPGTAGGQ"
FT   misc_feature    complement(503922..504566)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.3e-32"
FT   misc_feature    complement(join(503940..504008,504258..504317,
FT                   504375..504443,504480..504548))
FT                   /note="4 probable transmembrane helices predicted for
FT                   PMI0436 by TMHMM2.0 at aa 49-71, 84-106, 126-145 and
FT                   229-251"
FT   CDS_pept        complement(504757..505650)
FT                   /transl_table=11
FT                   /gene="gltI"
FT                   /locus_tag="PMI0437"
FT                   /product="glutamate/aspartate ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41086"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV18"
FT                   /protein_id="CAR41086.1"
FT                   /translation="MRMRKLALSLMILGAAGAVQAEELTGTLKKINDNDIIIVGHRESS
FT                   VPFSYYDNQQKVVGYSQDYSNLIVEAVKEKLGKPNLQVRLIPITSQNRIPLLQNGTFDF
FT                   ECGSTTNNLARQQQADFSNTIFIVGTRLLAKKDSGIKDFADLAGKNVVVTSGTTSEMLL
FT                   NKLNDEKKMNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPALWEIVGT
FT                   PQSEEAYGCMLRKGDTQFKSLIDETIANAQKSGAAEKSFNRWFNAPIPPKNLNLEFTIS
FT                   DEMKALFASPNDKALN"
FT   misc_feature    complement(504850..505542)
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding prot, score 7.7e-54"
FT   misc_feature    complement(505588..505650)
FT                   /note="Signal peptide predicted for PMI0437 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 21 and 22"
FT   CDS_pept        505995..506396
FT                   /transl_table=11
FT                   /locus_tag="PMI0438"
FT                   /product="putative metal resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41088"
FT                   /db_xref="GOA:B4EV19"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV19"
FT                   /protein_id="CAR41088.1"
FT                   /translation="MRKSMHNWRSGRWLVLITVLLILCCIVQRSMGAHVISERLASAVS
FT                   QTQSSFSTPIAEQQNASEGKYSLSTCELSAKSLLSIPPLAIEPLFYTWAVLLLFGMAAI
FT                   YVSRQRSQKKQHHPPPRIRLHLHYCILRD"
FT   misc_feature    505995..506090
FT                   /note="Signal peptide predicted for PMI0438 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.988) with cleavage site
FT                   probability 0.342 between residues 32 and 33"
FT   misc_feature    join(506031..506090,506244..506312)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0438 by TMHMM2.0 at aa 13-32 and 84-106"
FT   CDS_pept        506477..508513
FT                   /transl_table=11
FT                   /locus_tag="PMI0439"
FT                   /product="putative metal resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41090"
FT                   /db_xref="GOA:B4EV20"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:6C29"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV20"
FT                   /protein_id="CAR41090.1"
FT                   /translation="MVRSFLIALMLMLFSLSSLAADTGWLTMPDNDHAQVRATADKSST
FT                   GDVKILLEVQLAPGWKTYWRSPGEGGVAPEINWTQSVSDMIWHWPSPSAFDVAGIHTQG
FT                   YDKEVVFPIELKSVDSDNLNGVLTLSTCSNVCILTDYSLNLDLNEPAPADFEWQYNQAM
FT                   AKVPVTSGLISAVSSDYRNSQLTLSLQREQGDWHQPNIYLDPPQGMLYGIPQLTAKGDH
FT                   LSVTVDVTDDWGDAAGDITGKALSFVVTDDGYSRQVNDTIGQGDSASLPTADSGVGLWS
FT                   ILAFALLGGLILNLMPCVLPVLAMKLGSILHIEKRDTGAIRKQFSVSVVGILVSFWALA
FT                   LFMTVLRYSQEAIGWGIQFQSPWFIGFMVLITAIFTANLFGLFELRLSSNMNTKIATAG
FT                   GQGYSRHFWEGAFATLLATPCSAPFLGTAVAYALIAPLSELWLIFTALGLGMSLPWIMV
FT                   AMFPSIAKVLPKPGKWMNRLRVVLGFMMLLSCIWLITLLIPHFGIGIVAAIFVAIALIL
FT                   LFAIAKHYGKKTLFASMVITLILGGTSYLFIAQPDTQTLAGQDHVNWQPLSEEAIHQAL
FT                   AENKRVFIDVTADWCVTCKANKYNVLLRDDVQKALSEPDVVALRGDWTKPSEQITQFLK
FT                   QRGQVAVPFNQIYGPCNKEGEILPPLLNKDLMLTILSEAKGAQ"
FT   misc_feature    506477..506536
FT                   /note="Signal peptide predicted for PMI0439 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.998 between residues 20 and 21"
FT   misc_feature    join(507320..507388,507449..507517,507560..507628,
FT                   507707..507775,507803..507871,507908..507964,
FT                   507974..508042,508061..508120)
FT                   /note="8 probable transmembrane helices predicted for
FT                   PMI0439 by TMHMM2.0 at aa 282-304, 325-347, 362-384,
FT                   411-433, 443-465, 478-496, 500-522 and 529-548"
FT   misc_feature    507332..507961
FT                   /note="HMMPfam hit to PF02683, Cytochrome C biogenesis
FT                   protein transmembran, score 2.2e-05"
FT   misc_feature    508223..508279
FT                   /note="PS00194 Thioredoxin family active site."
FT   CDS_pept        508513..509244
FT                   /transl_table=11
FT                   /locus_tag="PMI0440"
FT                   /product="putative metal resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41092"
FT                   /db_xref="GOA:B4EV21"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="PDB:6MHH"
FT                   /db_xref="PDB:6NEN"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV21"
FT                   /protein_id="CAR41092.1"
FT                   /translation="MKKTLSVLVISSLLFGANVQAAALNAAQEKEVRALVRDTLVSNPE
FT                   ILEEAIMALQTKKADEQQAQFRQALASEHDALYNDAASPRIGAKDAKLVLVSFTDYNCP
FT                   YCKRFDPLLEKITEQYPDVAVIIKPLPFKGESSAKASQAVLSVWKEDPKAFLALHQRLM
FT                   QKKTMLDNASIEDAMKSTNTSKIKLTDDSLKTLQNNLELSRKLGIQGTPATVIGDTILP
FT                   GAVDYDQLEIIVKEQLAKVKK"
FT   misc_feature    508513..508575
FT                   /note="Signal peptide predicted for PMI0440 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.953 between residues 21 and 22"
FT   misc_feature    508792..509217
FT                   /note="HMMPfam hit to PF01323, DSBA-like thioredoxin
FT                   domain, score 1.1e-21"
FT   misc_feature    508795..508851
FT                   /note="PS00194 Thioredoxin family active site."
FT   CDS_pept        509244..509747
FT                   /transl_table=11
FT                   /locus_tag="PMI0441"
FT                   /product="putative metal resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41094"
FT                   /db_xref="GOA:B4EV22"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV22"
FT                   /protein_id="CAR41094.1"
FT                   /translation="MANRLRKWGKELIILALIFVAISFAMDWWRQPTPPELTDLSTLYT
FT                   VDDKPVSLIALSQEKPLLIYFWASWCGICKLTTPTVNDLAQQGYNVTSVVIRSGDDAKI
FT                   IRGINSKQLVFPVINDDRGAISQRWGISATPSFVILYKGEMVHFTSGWTSSWGLKLRLW
FT                   WASI"
FT   misc_feature    509244..509318
FT                   /note="Signal peptide predicted for PMI0441 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.987) with cleavage site
FT                   probability 0.981 between residues 25 and 26"
FT   misc_feature    509277..509330
FT                   /note="1 probable transmembrane helix predicted for PMI0441
FT                   by TMHMM2.0 at aa 12-29"
FT   CDS_pept        complement(509756..510439)
FT                   /transl_table=11
FT                   /locus_tag="PMI0442"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41096"
FT                   /db_xref="GOA:B4EV23"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV23"
FT                   /protein_id="CAR41096.1"
FT                   /translation="MIHYPEYILDIIWQRAKKISADNETKGFRKDKETKWIKRQLFNQQ
FT                   NEFGWVLSKQPSSIHQLIEDETIVPLHWQTARAYEQKQEASSKRLNMIPLDPPALSRLI
FT                   QSPTDVLPYWQHAHQISSDNEEKGFRKDYYGRIIQKNAFGDKQHQYGWTLAQLTPANKN
FT                   NQIVIPINIVPIHINTSKRTYNEKELIVQGSQEAKIKRRRKKLVYEIIDFIISLPGIIF
FT                   SSFKL"
FT   misc_feature    complement(509765..509824)
FT                   /note="1 probable transmembrane helix predicted for PMI0442
FT                   by TMHMM2.0 at aa 206-225"
FT   CDS_pept        complement(510516..512039)
FT                   /transl_table=11
FT                   /gene="cutE"
FT                   /locus_tag="PMI0443"
FT                   /product="putative apolipoprotein N-acyltransferase (copper
FT                   homeostasis protein)"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41098"
FT                   /db_xref="GOA:B4EV24"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV24"
FT                   /protein_id="CAR41098.1"
FT                   /translation="MNNFSLLNRQWVRTLLAVFFGASGTLAFSPFDFWPAALISLSGLL
FT                   LIITQRTTRQGAWLGFAWGFGLFGSGVNWVYVSIADFGGMPFAINIFLVILLALYLSLY
FT                   TALFAGLLNKFFPKPTVWRFVFAAPAVWQLTEFLRGWVLSGFPWLQFGYSQIDGPLKGI
FT                   APIFGVTMITFLLTIISGLIAVAIYRKSLYSAVIGAILLLLPISFKSYQWYQPLTDETQ
FT                   EIALVQGNIAQSLKWQPGTLESTLNTYLTLSRPFIGKANLIIWPESAIPDVEIQQQGFL
FT                   AQLDKQLRAQDTHLMTGIIDARPTLEGYRFYNSVITLGEHYAYQYPATDRYNKHHLVPF
FT                   GEYVPLESLLRPLAPFFNLPMSSLSQGEYIQPQLTVNDAKITAAICYEIILGEQVRANF
FT                   KPDTRFLLTISNDAWFGNSIGPWQHFQMARMRSLELGRPLLRSTNNGITAFIAANGDVI
FT                   AQLPQFEAGALAEKMTPTTGSTPYYKMGSYPVWILAGVFLILAFIKRRS"
FT   misc_feature    complement(join(510531..510584,511398..511466,
FT                   511485..511553,511611..511670,511707..511775,
FT                   511803..511871,511890..511943,511956..512009))
FT                   /note="8 probable transmembrane helices predicted for
FT                   PMI0443 by TMHMM2.0 at aa 17-34, 39-56, 63-85, 95-117,
FT                   130-149, 169-191, 198-220 and 492-509"
FT   misc_feature    complement(510807..511373)
FT                   /note="HMMPfam hit to PF00795, Carbon-nitrogen hydrolase,
FT                   score 1e-34"
FT   misc_feature    complement(511959..512039)
FT                   /note="Signal peptide predicted for PMI0443 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.897) with cleavage site
FT                   probability 0.421 between residues 33 and 34"
FT   CDS_pept        complement(512047..512928)
FT                   /transl_table=11
FT                   /gene="corC"
FT                   /locus_tag="PMI0444"
FT                   /product="putative membrane protein"
FT                   /product="putative magnesium and cobalt efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41100"
FT                   /db_xref="GOA:B4EV25"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV25"
FT                   /protein_id="CAR41100.1"
FT                   /translation="MSDDQSSSNDNPGPKKGFLTLLNQLFHGEPKNRDDLMELIRDSEQ
FT                   KELIDPDTRDMLEGVMDIAEQRVRDIMIPRSQIVTLKRNQTLDECLDVIIDSAHSRFPV
FT                   ISEDKDHIEGLLMAKDLLPFMRTGAEPFSIDKVLRSAVVVPESKRVDRLLKEFRSQRYH
FT                   MAIVIDEFGGVSGLVTIEDILELIVGEIEDEYDDEDDIDIRPLSRHTYSVRALTQIEDF
FT                   NEAFGTHFSDEEVDTIGGLVMQAFGHLPARGETITIDNYQFKVVMADSRKIIQVYVHIP
FT                   DDAPVPELGNDV"
FT   misc_feature    complement(512083..512319)
FT                   /note="HMMPfam hit to PF03471, Transporter associated
FT                   domain, score 1.3e-26"
FT   misc_feature    complement(512365..512526)
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 9.9e-10"
FT   misc_feature    complement(512551..512715)
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 6.9e-10"
FT   CDS_pept        complement(512999..513466)
FT                   /transl_table=11
FT                   /locus_tag="PMI0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41113"
FT                   /db_xref="GOA:B4EV26"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EV26"
FT                   /protein_id="CAR41113.1"
FT                   /translation="MSEVILDLQVATENTQGLPSEAQFITWLEAVLPQFQPISEVTIRI
FT                   VDEAESHELNLTYRGKDRPTNVLSFPFEAPPEVELPLLGDLIICRQVVEKEADEQNKTV
FT                   EEHWAHMVIHGCLHLLGYDHIEDDEAEEMEGLETEILQKLGYEDPYLIEKE"
FT   misc_feature    complement(513056..513331)
FT                   /note="HMMPfam hit to PF02130, Uncharacterized protein
FT                   family UPF0054, score 1.6e-53"
FT   misc_feature    complement(513095..513127)
FT                   /note="PS01306 Uncharacterized protein family UPF0054
FT                   signature."
FT   CDS_pept        complement(513459..514520)
FT                   /transl_table=11
FT                   /locus_tag="PMI0446"
FT                   /product="PhoH-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41116"
FT                   /db_xref="GOA:B4EV27"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV27"
FT                   /protein_id="CAR41116.1"
FT                   /translation="MTVIAHTQVATQEIFLEPADNDRLMSLCGPFDDNIKQLERRLGIE
FT                   INHRDNRFKLTGKSLNVNAAAGILRHLYVETSPIKGVIPDIDPEQIHLAIKESRVLEQS
FT                   DEHVPEFGKSTNIRTKRGVIKPRTPNQAQYIANIQTHDITFGIGPAGTGKTYLAVAAAV
FT                   DALERQEVRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGFEKVEKLI
FT                   ERNVIEVAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVITGDITQID
FT                   LPRGHKSGLRHAIEVLSNVDDLSFNFFHSEDVVRHPVVAKIVVAYEAWEVEDQKRRQAI
FT                   KAEKERLQRENHE"
FT   misc_feature    complement(513540..514154)
FT                   /note="HMMPfam hit to PF02562, PhoH-like protein, score
FT                   4.3e-152"
FT   misc_feature    complement(514056..514079)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(514549..515979)
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="PMI0447"
FT                   /product="MiaB protein (methylthiolation of isopentenylated
FT                   A37 derivatives in rRNA)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41118"
FT                   /db_xref="GOA:B4EV28"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EV28"
FT                   /protein_id="CAR41118.1"
FT                   /translation="MSTIKKLYIKTWGCQMNEYDSSKMADLLESTHGYQLTDVAEDADI
FT                   LLLNTCSIREKAQEKVFHQLGRWKNFKDNKPDIIIGVGGCVASQEGEYIRQRAQCVDII
FT                   FGPQTLHRLPEMINQVKGTKSPVVDISFPEIEKFDRLPEPRAEGPSAFVSIMEGCNKYC
FT                   SFCVVPYTRGEEVSRPCDDILFEIAQLAAQGVREVNLLGQNVNAYRGETFDGQICSFAE
FT                   LLRLVAAIDGIDRIRFTTSHPIEFTDDIIAVYEDTPELVSFLHLPVQSGSDRILTLMKR
FT                   NHTALEYKSIIRKLRKARPDILISSDFIIGFPGETQDDFEKTMKLIADVNFDMSFSFIY
FT                   SARPGTPAADLPDDVSEEEKKQRLYLLQQRINQQAMNYSRAMLNSVQRILVEGPSRKNV
FT                   MELSGRTENNRVVNFEGTPDMIGKFVDVEIVDVYANSLRGKVVRTEDQMDLRIHESPES
FT                   VIARTRKEDELGVGVYQP"
FT   misc_feature    complement(514651..514842)
FT                   /note="HMMPfam hit to PF01938, TRAM domain, score 6.8e-22"
FT   misc_feature    complement(514999..515523)
FT                   /note="HMMPfam hit to PF04055, Radical SAM superfamily,
FT                   score 1.3e-31"
FT   misc_feature    complement(515461..515523)
FT                   /note="PS01278 Uncharacterized protein family UPF0004
FT                   signature."
FT   misc_feature    complement(515662..515964)
FT                   /note="HMMPfam hit to PF00919, Uncharacterized protein
FT                   family UPF0004, score 3e-47"
FT   CDS_pept        516195..517379
FT                   /transl_table=11
FT                   /gene="ubiF"
FT                   /locus_tag="PMI0448"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41122"
FT                   /db_xref="GOA:B4EV29"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV29"
FT                   /protein_id="CAR41122.1"
FT                   /translation="MRNVKNDFDAVIAGGGMIGAAVAIGLAQEGLRVAMVERQSPAPFD
FT                   ASSHPDIRISAISCASVSLLKQLGAWQHVLAMRSAPYLTLETWEEDNAHVIFDAKSLGL
FT                   PELGYMVENRILQLALWQEAERYSNITLLCPNSLSNMKYLDNKWQVTLADGQKITTQLV
FT                   VGADGANSQVRQMAGIGSNGWQYRQSCMLITVKTQLPPEKGTWQRFYPSGPRAYLPLFD
FT                   NWACLVWYDSPQRIRKLQTMSMAQLEKEIEHAFPERLGKVTPIAAGSFLLTRQHASRYV
FT                   DNGVILVGDAAHTINPLAGQGVNLGYRDVDCLLNLVAQAKQHFEPWHSMALLKKYQRRR
FT                   MPDNMLMQAGMDLFYHAFSHQLPGLKLARNIGLLAAQHAGKAKEAALRYALGIK"
FT   misc_feature    516669..517250
FT                   /note="HMMPfam hit to PF01360, Monooxygenase, score
FT                   1.8e-36"
FT   CDS_pept        complement(517428..518258)
FT                   /transl_table=11
FT                   /locus_tag="PMI0449"
FT                   /product="putative esterase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41125"
FT                   /db_xref="GOA:B4EV30"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV30"
FT                   /protein_id="CAR41125.1"
FT                   /translation="MNNIERHACFGGWQEVYQHTSTTLNCEMKFAIYLPPMEDGQKYPV
FT                   LYWLSGLTCNEQNFITKAGAQQYAAQHGVILVVPDTSPRGENVADDSAYDLGQGASFYL
FT                   NATQAPWNSHYKMYDYIVNELPKLIETHFPANEQRAISGHSMGGHGALMIGLRNLSRYC
FT                   SISAFSPIVAPTQVPWGQKAFSAYLGDDMAQWQQYDTIELLNKTQQTVPIRVDVGLDDP
FT                   FYQQQLQPERLAQVCDKKQFACCLNLHQGYDHSYYFVASFIGEHIAFHAKHLKA"
FT   misc_feature    complement(517452..518222)
FT                   /note="HMMPfam hit to PF00756, Putative esterase, score
FT                   1.8e-100"
FT   CDS_pept        complement(518312..519424)
FT                   /transl_table=11
FT                   /gene="adhC"
FT                   /locus_tag="PMI0450"
FT                   /product="alcohol dehydrogenase (glutathione-dependent
FT                   formaldehyde dehydrogenase)"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41127"
FT                   /db_xref="GOA:B4EV31"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV31"
FT                   /protein_id="CAR41127.1"
FT                   /translation="MKSRAAVAFGPGEPLKIVEVDVMPPQAGEVLIKISHTGVCHTDAF
FT                   TLSGDDPEGVFPAILGHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECLFCKSGKTN
FT                   LCVAVRATQGKGLMPDGTTRFSYNGQPIYHYMGCSTFSEYTVVAEVSLAKINPQANHEE
FT                   VCLLGCGVTTGIGAVHNTAKVQQGDSVAVFGLGGIGLAVLQGARQAKAGRIFAIDTNPE
FT                   KFALARQFGATDCLNPNDYDKPIQEVLVEMTQWGVDHTFECIGNVNVMRAALESAHRGW
FT                   GQSIIIGVAGAGQEISTRPFQLVTGRSWKGTAFGGVKGRSQLPNMVEDAMNGKIELKPF
FT                   VTHTLPLEKINEAFDLMHEGKSIRTVIHFD"
FT   misc_feature    complement(518318..519397)
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 7.4e-145"
FT   misc_feature    complement(519200..519244)
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT   CDS_pept        complement(519444..519719)
FT                   /transl_table=11
FT                   /locus_tag="PMI0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41128"
FT                   /db_xref="GOA:B4EV32"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV32"
FT                   /protein_id="CAR41128.1"
FT                   /translation="MPHSPAEKKAALTRVRKIKGQILALETALENENECGQVLQQIAAI
FT                   RGAINGLMAGVLESHLREGLMDAVASPEDQKNSVDDAISLIRTYLR"
FT   misc_feature    complement(519450..519638)
FT                   /note="HMMPfam hit to PF02583, Uncharacterised BCR,
FT                   COG1937, score 4.4e-16"
FT   tRNA            complement(519989..520070)
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:520034..520036,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAG, Cove score 46.62"
FT   tRNA            complement(520125..520196)
FT                   /product="transfer RNA-Gln"
FT                   /anticodon="(pos:520162..520164,aa:Gln)"
FT                   /note="tRNA Gln anticodon TTG, Cove score 54.60"
FT   tRNA            complement(520203..520276)
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:520240..520242,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 76.80"
FT   tRNA            complement(520324..520395)
FT                   /product="transfer RNA-Gln"
FT                   /anticodon="(pos:520361..520363,aa:Gln)"
FT                   /note="tRNA Gln anticodon TTG, Cove score 58.04"
FT   tRNA            complement(520443..520514)
FT                   /product="transfer RNA-Gln"
FT                   /anticodon="(pos:520480..520482,aa:Gln)"
FT                   /note="tRNA Gln anticodon TTG, Cove score 52.72"
FT   tRNA            complement(520543..520624)
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:520588..520590,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAG, Cove score 46.62"
FT   tRNA            complement(520636..520709)
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:520673..520675,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 76.80"
FT   CDS_pept        complement(521124..522356)
FT                   /transl_table=11
FT                   /gene="nagC"
FT                   /locus_tag="PMI0452"
FT                   /product="putative N-acetylglucosamine regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41129"
FT                   /db_xref="GOA:B4ESI8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESI8"
FT                   /protein_id="CAR41129.1"
FT                   /translation="MLMSHNNTETQIGNIDLVKQLNSAIVYRLIDQHGPISRIQIAEQS
FT                   QLAPASVTKITRQLLERGLIKEVDQQASTGGRRAISIVVEHRRFNTVSVRLGRNDATVA
FT                   LYDLSGKALVEQHYPLEQSTQQEVETLLINAIDDFIKQNQRRINELISISIILPGLVDP
FT                   NKGIVHYMPHMKVNNWALVDSLEKHFDLPCYAGHDIRSLALAENYFGATRDCEDSILVR
FT                   IHRGAGAGVIINNKILLNQRGNLGEIGHIQIDPLGERCHCGNFGCLETIASNSAIEAKV
FT                   RYQLEQGYPSQHLSATQCQIQDICDAAVKNDPLAVETIKQVGLHLGKAIAIAINLFNPQ
FT                   KVVLAGEVTEAAEILLPSIQSCINTQVLKEFREALPVVISELDHRSAIGAFALTKRAML
FT                   NGELLQYLFDK"
FT   misc_feature    complement(521526..522080)
FT                   /note="HMMPfam hit to PF00480, ROK family, score 1.1e-73"
FT   misc_feature    complement(522186..522251)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1021.000, SD 2.66 at aa 36-57, sequence
FT                   ISRIQIAEQSQLAPASVTKITR"
FT   CDS_pept        complement(522366..523529)
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="PMI0453"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41131"
FT                   /db_xref="GOA:B4ESI9"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESI9"
FT                   /protein_id="CAR41131.1"
FT                   /translation="MFALTNAVIYTGYDRLEDHAIIINGSRIEQVCPQDQLPKDIATRD
FT                   MQGAIVSPGFIDLQVNGCGGVQFNDTAENVTVKTLEIMQKANERLGCTSYLPTLITCSD
FT                   ELMKIGIEATRAYMQKHQNKVLGLHLEGPYINIIKKGTHDPQFIRQPSAQMIDYLCDNA
FT                   DVIAKITLAPEMVDEKYVRQLITAGIVVSAGHSNATYEEARKGFRNGISLSTHLYNAMP
FT                   YISGRGPGLVGAIYDTPEVYAGIIADGLHVSWANIRNSKRLKGEKLLLVTDATAPAGLD
FT                   PNKNEMDSFVFAGKTIYYRNGLCVDADGTLSGSSLTMIDAIKNSVLHVGIPLDETLRMA
FT                   TLYPARAIGADNELGTIEAGKIANIASFDKDFNLCTTFVNGIEITDN"
FT   misc_feature    complement(522423..523382)
FT                   /note="HMMPfam hit to PF01979, Amidohydrolase family, score
FT                   3.9e-30"
FT   CDS_pept        complement(523652..524458)
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="PMI0454"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41133"
FT                   /db_xref="GOA:B4ESJ0"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ESJ0"
FT                   /protein_id="CAR41133.1"
FT                   /translation="MRLIPLSTAQQVGKWSANYIVEKINAFAPSADRPFVLGLPTGGTP
FT                   LATYKALIELHRAGKVSFQHVVTFNMDEYVGIPADHPQSYRTFMYENFFNHIDIKDENI
FT                   NLLNGNATDPQAECARYEAKIKSYGKINLFMGGVGNDGHIAFNEPASSLASRTRMKTLT
FT                   EDTRLANSRFFDNDINKVPKYALTVGVGTLLDAEELMILATGINKAQAVQVATEGAVNH
FT                   LWTISCVQLHPKAILVCDDPATMELRVKTLRYFQQIEAQERQQYQD"
FT   misc_feature    complement(523709..524416)
FT                   /note="HMMPfam hit to PF01182, Glucosamine-6-phosphate
FT                   isomerases/6-, score 6.6e-172"
FT   misc_feature    complement(523775..523807)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    complement(524030..524086)
FT                   /note="PS01161 Glucosamine/galactosamine-6-phosphate
FT                   isomerases signature."
FT   CDS_pept        524804..526849
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="PMI0455"
FT                   /product="N-acetylglucosamine-specific PTS system, EIICBA
FT                   component"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41135"
FT                   /db_xref="GOA:B4ESJ1"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESJ1"
FT                   /protein_id="CAR41135.1"
FT                   /translation="MNILSYLQKIGRALMVPVATLPAAAILMGIGYWIDPVGWGNDNAL
FT                   AALLIKSGAAIIDNMSVLFAIGVAYGMSKDKDGAAALTGFVGFLVVTTLCSPAAVSMIK
FT                   GLPLAEVPVAFGKINNQFVGILVGVLSAELYNRFSSVELPRALSFFSGRRLVPILTSFL
FT                   MIIVAFILMYIWPVIYGGLVSFGESIKDMGALGAGIYAFFNRLLIPVGLHHALNSVFWF
FT                   DVAGINDIPNFLAGQQAIDAGLATVGVTGRYQAGFFPVMMFGLPGAALAIYHCARKEHK
FT                   AKVAGIMMAGAFAAFFTGITEPLEFSFMFVAPVLYVIHAFLMAISVYIAASMEWISGFG
FT                   FSAGLVDMFLSSRNPLAVKWYMLIVQGIAFFFIYYGIFRFTITKFNLKTPGREDEVAGD
FT                   ETADGYDEDIKAVPTNSKEAVQQEARQYIAAVGGSDNLTGIDACITRLRLNVKDASVVN
FT                   DAYAKHLGASGVIRLNKQSVQVIVGTRAEIVASAMRDVLAQGPVAAYAGRHTDNAVSTE
FT                   KTSEKQTNNDAKVILEMVAPFDGEVVALKDVPDEAFSSGVVGDGLAIKPTSNIVMAPAA
FT                   GTVVKIFDTNHAFCIETDNGVEIIVHMGIDTVALGGKGFKRLVEEGTEVKLGQPILELD
FT                   LEYLNTNAKSMISPVIISNIDDFDKVSDIASGQVTANNTIIYKVLK"
FT   misc_feature    524843..525775
FT                   /note="HMMPfam hit to PF02378, Phosphotransferase system,
FT                   EIIC, score 5.2e-79"
FT   misc_feature    join(524846..524905,524933..525001,525035..525103,
FT                   525275..525343,525380..525448,525566..525634,
FT                   525653..525721,525764..525832,525869..525937)
FT                   /note="9 probable transmembrane helices predicted for
FT                   PMI0455 by TMHMM2.0 at aa 2-21, 31-53, 65-87, 145-167,
FT                   180-202, 242-264, 271-293, 308-330 and 343-365"
FT   misc_feature    526073..526177
FT                   /note="HMMPfam hit to PF00367, phosphotransferase system,
FT                   EIIB, score 3.6e-16"
FT   misc_feature    526109..526162
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT   misc_feature    526451..526765
FT                   /note="HMMPfam hit to PF00358,
FT                   phosphoenolpyruvate-dependent sugar phosph, score 1.3e-62"
FT   misc_feature    526589..526627
FT                   /note="PS00371 PTS EIIA domains phosphorylation site
FT                   signature 1."
FT   misc_feature    527076..574546
FT                   /note="prophage??"
FT   CDS_pept        complement(527077..528078)
FT                   /transl_table=11
FT                   /locus_tag="PMI0456"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41137"
FT                   /db_xref="GOA:B4ESJ2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR015094"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESJ2"
FT                   /protein_id="CAR41137.1"
FT                   /translation="MGRSRSAKNKGLPPNLYLRKGIYYYRDVRTKKEFSVGSNKSLAIT
FT                   EAIQANLAIYKPKESLVDRINNVHCVTLHEWLDTYRGKVNSRGLKEKTLYDYESRIKLI
FT                   KLHFNDCPIENVTPRDVATFISEYPKKAMAKLLRSTMLDAFNEAIADGVIKENPVSVTK
FT                   PPKTSVQRSRLSLEEFKYALEHTNDKYRHMFLLAVLTAQRISDIINMKWDDIKNDRLYV
FT                   TQIKTGSKVAIPLSLRLESIGYSIKDVLNLMNRSSDKICGNTTAKTLRGKFIEALPEYL
FT                   ENKPTFHEIRSLSARLYEEEKSAEFAKKILGHKSMRMTDKYLDDRGNGYVEL"
FT   misc_feature    complement(527083..527619)
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 9.6e-09"
FT   misc_feature    complement(527083..527103)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="PS00030 Eukaryotic putative RNA-binding region RNP-1
FT                   signature."
FT   misc_feature    complement(527620..527862)
FT                   /note="HMMPfam hit to PF02899, Phage integrase, N-terminal
FT                   SAM-like, score 0.14"
FT   CDS_pept        complement(528035..528280)
FT                   /transl_table=11
FT                   /locus_tag="PMI0456A"
FT                   /product="excisionase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0456A"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41139"
FT                   /db_xref="GOA:B4ESJ3"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012884"
FT                   /db_xref="InterPro:IPR038137"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESJ3"
FT                   /protein_id="CAR41139.1"
FT                   /translation="MKRITLSEWNNKYFANPRSQRQLSRYIKEGRLYPAPEKVGREYEL
FT                   EPWTILTNDKMVREPQYLMEKINGQKQKCKEQGFTA"
FT   CDS_pept        complement(528277..528615)
FT                   /transl_table=11
FT                   /locus_tag="PMI0457"
FT                   /product="putative phage recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41141"
FT                   /db_xref="InterPro:IPR019701"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESJ4"
FT                   /protein_id="CAR41141.1"
FT                   /translation="MNKYTELSDFEINLLVAQSVLPETQYDVIKQTMDIIQFLVDGSFG
FT                   YRFFDPCNNPSDAMPIIIENKIGLSPMYHSNKWTADCLDYDFMSVNKNPYRGAMEVFLM
FT                   MKDTENNQ"
FT   CDS_pept        complement(528608..528784)
FT                   /transl_table=11
FT                   /locus_tag="PMI0458"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41142"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESJ5"
FT                   /protein_id="CAR41142.1"
FT                   /translation="MKDKYYAGLENYKDCIEIEPTTKDCFILNTPSWNMDVTKQDLIDI
FT                   RNTINEILGDDNE"
FT   CDS_pept        complement(528774..528935)
FT                   /transl_table=11
FT                   /locus_tag="PMI0459"
FT                   /product="putative phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41144"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESJ6"
FT                   /protein_id="CAR41144.1"
FT                   /translation="MQIIGYVLHMLIQGSAVPVTEDIYTQSECNKRAEYLMSVRNVKVV
FT                   CGEVWNER"
FT   CDS_pept        complement(528991..529716)
FT                   /transl_table=11
FT                   /locus_tag="PMI0460"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41145"
FT                   /db_xref="GOA:B4ESJ7"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESJ7"
FT                   /protein_id="CAR41145.1"
FT                   /translation="MDVSMIPIFIMVSTMIELSSKFKNIIFWALTASIALIVFGIFVID
FT                   IFANDAQGKDKLSIIFSFLSAFFALLSSLGILITIGVYFSQKNDDKRKQKEIDEKLIYF
FT                   IREKVSDFNFKIKRVLTFLENDDKYYGIGVSGNKIIYKDPLEDEYNITNTINLKLKNND
FT                   FLDRNNIHASLYLFIFILDIDSLSENFINKTYSYVMYSHAHSLDIPDEHFSCKDKNELI
FT                   DFLKETEREITSRLNELYY"
FT   misc_feature    complement(join(529462..529530,529573..529641))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0460 by TMHMM2.0 at aa 26-48 and 63-85"
FT   CDS_pept        complement(529745..530281)
FT                   /transl_table=11
FT                   /locus_tag="PMI0461"
FT                   /product="putative phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41148"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESJ8"
FT                   /protein_id="CAR41148.1"
FT                   /translation="MMKVEQSQVTKLVITGVERHDPIHVYLEDYGDNKNGRVTISEWGD
FT                   SWSCFWGSMGSSLIEFIHRINNHYWIGKLDSNLISEIDDDNDANAKYAKKQVIKLRKDD
FT                   EIDKYEAREYWDLIELSDDVKDDCCNSFLGGKLLSLFGDNAWYNDWPSIPNPQYLRMES
FT                   RLNAVSEALKQMNVS"
FT   CDS_pept        complement(530288..530467)
FT                   /transl_table=11
FT                   /locus_tag="PMI0462"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41152"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESJ9"
FT                   /protein_id="CAR41152.1"
FT                   /translation="MNMSKQMVLVARTNKVGSDSECRLGITEDEWDKLTEEEQSGYINT
FT                   AIDNLVDWYVKTED"
FT   CDS_pept        complement(530495..530689)
FT                   /transl_table=11
FT                   /locus_tag="PMI0463"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41153"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESK0"
FT                   /protein_id="CAR41153.1"
FT                   /translation="MTITLTTKQIMAMADFVGLKVEPHGLDINDETEYTIEPRKDKETG
FT                   RVHVFYCTEYPEEGAIQLD"
FT   CDS_pept        complement(530729..530905)
FT                   /transl_table=11
FT                   /locus_tag="PMI0464"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41154"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESK1"
FT                   /protein_id="CAR41154.1"
FT                   /translation="MNLVIRNLSTNEKVTLTIAISEEDFNKLSEREQDDLIENVTADYY
FT                   ENKAAEEIERKFK"
FT   CDS_pept        complement(join(530936..531265,531269..531430))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PMI0465"
FT                   /product="single-strand DNA-binding protein (pseudogene)"
FT                   /note="This CDS contains an in-frame stop codon."
FT                   /db_xref="PSEUDO:CAR41155.1"
FT   CDS_pept        complement(531420..532226)
FT                   /transl_table=11
FT                   /gene="recT"
FT                   /locus_tag="PMI0467"
FT                   /product="phage DNA recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41157"
FT                   /db_xref="GOA:B4ESK3"
FT                   /db_xref="InterPro:IPR004590"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESK3"
FT                   /protein_id="CAR41157.1"
FT                   /translation="MSNPPLAQADLQKTQGTKVKEKTKDQLLVECINKPSMKAQLAAAL
FT                   PRHMTPDRMIRIVSTEIRKTPELANCDMQSFIGAVVQCSQLGLEPGNALGHAYLLPFGN
FT                   GKSKSGQSNVQLIIGYRGMIDLARRSNQIISISARTVRQGDSFHFEYGLNENLTHVPGE
FT                   NEDSPITHVYAVARLKDGGVQFEVMTHNQIEKVRASSKAGQNGPWVSHWEEMAKKTVIR
FT                   RLFKYLPVSIEMQKAVILDEKAEANVDQENATIFEGEYEEVGTDGK"
FT   misc_feature    complement(531429..532076)
FT                   /note="HMMPfam hit to PF03837, RecT family, score 1.4e-66"
FT   CDS_pept        complement(532219..533037)
FT                   /transl_table=11
FT                   /locus_tag="PMI0468"
FT                   /product="putative phage-related exonuclease"
FT                   /note="similar to the C-terminal region of Escherichia coli
FT                   exodeoxyribonuclease VIII RecE"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41158"
FT                   /db_xref="GOA:B4ESK4"
FT                   /db_xref="InterPro:IPR024432"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESK4"
FT                   /protein_id="CAR41158.1"
FT                   /translation="MKPGIYYDISNEDYHHGLGISKSQLDLISEMPAEYIWSKEAPVDE
FT                   EKIKALDFGTAIHCLLLEPDEYSKRYKIGPDVNRRTNAGKQEEKEFLEMCEKEGITPIT
FT                   HDDNRKLMLMRNSAMAHPIARWCLEANGVAESSIYWNDEDTDILCRCRPDKLIQEHHWI
FT                   IDVKSSADIQRFDRSMYEYRYHVQDSFYSDGYKSLTGEAPVFVFLVVSTTIDCGRYPVR
FT                   VFNLDQQAKDIGRTTYKQNLRTYAECLKTDEWAGIRTLSLPYWAKELRDE"
FT   CDS_pept        complement(533034..533288)
FT                   /transl_table=11
FT                   /locus_tag="PMI0469"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41159"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESK5"
FT                   /protein_id="CAR41159.1"
FT                   /translation="MITNTYGLRNDWCERQMEREAFVNSQEEKISVDEVMDSLPEELLC
FT                   MDLARKLNPVFEISPQALDAVLAGIRTAIQIGIDKEVLG"
FT   CDS_pept        complement(533285..533548)
FT                   /transl_table=11
FT                   /locus_tag="PMI0470"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41161"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESK6"
FT                   /protein_id="CAR41161.1"
FT                   /translation="MQISYSYSNGTRVVDGKTVMEFDESSKLSIETGSFTELAKLTEID
FT                   SAEAMEYVLDCDDESLERIINAIGKEVFINRILRVSKLRRVA"
FT   CDS_pept        complement(533556..533711)
FT                   /transl_table=11
FT                   /locus_tag="PMI0471"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41165"
FT                   /db_xref="GOA:B4ESK7"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESK7"
FT                   /protein_id="CAR41165.1"
FT                   /translation="MKTNYYSAMRDGMVVRITTPQARKNKRTSPWLFSLAVVIVTTVGV
FT                   IPTFVS"
FT   misc_feature    complement(533562..533621)
FT                   /note="1 probable transmembrane helix predicted for PMI0471
FT                   by TMHMM2.0 at aa 31-50"
FT   CDS_pept        complement(533800..534027)
FT                   /transl_table=11
FT                   /locus_tag="PMI0472"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41167"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESK8"
FT                   /protein_id="CAR41167.1"
FT                   /translation="MMKQKTSVVINVKLTLEHGIKSPHVEVKTKIYVHEETPELELLLN
FT                   NFSDNLVGENSIKSSFEKAIINTLLNKKTH"
FT   CDS_pept        complement(534150..534425)
FT                   /transl_table=11
FT                   /locus_tag="PMI0473"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41169"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESK9"
FT                   /protein_id="CAR41169.1"
FT                   /translation="MEIWFKEFESHGRQILIKKAHNADESKIGMQYCWPEKLFEVDFGL
FT                   WIDYDDDDEEGCNKAEEARNKLFDTIDQEAVDTTVSNLIQKLKLDN"
FT   CDS_pept        534593..534808
FT                   /transl_table=11
FT                   /locus_tag="PMI0474"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41171"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESL0"
FT                   /protein_id="CAR41171.1"
FT                   /translation="MSNRVISDDNPVKRVAFDMALALAAKQDSIKTPEQLMAEIESLYP
FT                   ECLEVAEKQYKKETPPPMGVLLKSTI"
FT   CDS_pept        complement(534805..535020)
FT                   /transl_table=11
FT                   /locus_tag="PMI0475"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41173"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESL1"
FT                   /protein_id="CAR41173.1"
FT                   /translation="MINLKMYEYLRNDGTRIFFKTESISSIKEDTWSDGKPITKLTLNC
FT                   GTTIMELVPLEEFLKMHHIKIEKLKS"
FT   CDS_pept        complement(535180..535488)
FT                   /transl_table=11
FT                   /gene="nun"
FT                   /locus_tag="PMI0476"
FT                   /product="transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41174"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESL2"
FT                   /protein_id="CAR41174.1"
FT                   /translation="MTKIIYLEKGRNSKARRYIRRGEYLARKALEYINECERKGLCGPP
FT                   PPLVGPVAYRTTSELKLHKKLSLPKQEREEKIYNPPKDDIMNRVVNHAHQRNPNKKW"
FT   CDS_pept        complement(535490..535768)
FT                   /transl_table=11
FT                   /locus_tag="PMI0477"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41175"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESL3"
FT                   /protein_id="CAR41175.1"
FT                   /translation="MAQITYLPRTGKTNSKMRRYIARGELMARKALEEANRGRTTEEIW
FT                   DSIIKPVDETDVLSELIICLKDTPSEHRKKLRLRKPIMPSGEVTARA"
FT   CDS_pept        complement(536291..536596)
FT                   /transl_table=11
FT                   /locus_tag="PMI0478"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41177"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESL4"
FT                   /protein_id="CAR41177.1"
FT                   /translation="MKNIILLLITVSSISAHATNKIDITNEDDFKLITTIMKASECNAY
FT                   SSLYKFQQENNVPNGDEFIDKFMSNEAKKKNSTLIDMTNDCQKALLDFAEITSSKN"
FT   misc_feature    complement(536543..536596)
FT                   /note="Signal peptide predicted for PMI0478 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.970 between residues 18 and 19"
FT   CDS_pept        complement(536627..537328)
FT                   /transl_table=11
FT                   /gene="ci"
FT                   /locus_tag="PMI0479"
FT                   /product="phage reprossor"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41178"
FT                   /db_xref="GOA:B4ESL5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESL5"
FT                   /protein_id="CAR41178.1"
FT                   /translation="MKTMRERIKQARLAKNMTQAELAELVGVSPQSVQQWETSTEPRKN
FT                   RVIKIAEILEVDTNWLLFGITDIDERNKVSSIQINQDIEVSDKNTYKVEMLDIQASAGP
FT                   GVMVLDDFIETITAIEYSADEAKRLFGGRSASTIKMITVKGDSMAGTFEPRDQIFVDIT
FT                   TNFFDGDGIYVFVLDNQLYIKRLQKQYKRLAVISDNARYETWYLEEDSINSLYIHAKVL
FT                   VSQSIKYKFHG"
FT   misc_feature    complement(536699..536905)
FT                   /note="HMMPfam hit to PF00717, Peptidase S24-like, score
FT                   2.1e-16"
FT   misc_feature    complement(537146..537307)
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   2.7e-16"
FT   misc_feature    complement(537215..537280)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2462.000, SD 7.57 at aa 22-43, sequence
FT                   MTQAELAELVGVSPQSVQQWET"
FT   CDS_pept        537436..537621
FT                   /transl_table=11
FT                   /locus_tag="PMI0480"
FT                   /product="putative phage regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41180"
FT                   /db_xref="GOA:B4ESL6"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR031856"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESL6"
FT                   /protein_id="CAR41180.1"
FT                   /translation="MNALETTIKKAGGIPALAKKLKISDQAIRQWEQKGRIPPARYAQI
FT                   NELFGIPFEHLVKDKN"
FT   misc_feature    537469..537534
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1865.000, SD 5.54 at aa 12-33, sequence
FT                   GGIPALAKKLKISDQAIRQWEQ"
FT   CDS_pept        537742..538089
FT                   /transl_table=11
FT                   /locus_tag="PMI0481"
FT                   /product="putative phage regulatory protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41182"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESL7"
FT                   /protein_id="CAR41182.1"
FT                   /translation="MECANTRKQFNQFISNHLIASALQALRNKTQSAVARTLGVHDSTI
FT                   LRRTEKYPEICETLVASGIIDFVMEGERKISEEEYRFLWKQMGELSQMKIKENASIAAT
FT                   NEACCSMEFTI"
FT   misc_feature    537826..537891
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1523.000, SD 4.37 at aa 29-50, sequence
FT                   KTQSAVARTLGVHDSTILRRTE"
FT   CDS_pept        538355..539122
FT                   /transl_table=11
FT                   /locus_tag="PMI0482"
FT                   /product="putative phage replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41184"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESL8"
FT                   /protein_id="CAR41184.1"
FT                   /translation="MSMLLMAKAMQLQVGSTAQKMVLLKLADNANDKGECFPSYETIAR
FT                   HCEISRQSAINHIKSLCKKGFVRKVTRKTDKVHTSNLYILDLEAKSLDDGSQNTVPPSQ
FT                   NSVPEVVKEFDHGSQTVGLGGSQKFLPRTSQSFNQSINLKKLSSDDSKPAKQISINRQA
FT                   KIPYQEIMQAFNESVGDRLPNAESLNDKRKRAISKFLKELKEPTVESAKNYFDYFMETA
FT                   SAWYFGENNRGWRANFDYLLRPETVLKTREGAL"
FT   misc_feature    538466..538531
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1053.000, SD 2.77 at aa 38-59, sequence
FT                   PSYETIARHCEISRQSAINHIK"
FT   CDS_pept        539122..540507
FT                   /transl_table=11
FT                   /locus_tag="PMI0483"
FT                   /product="putative phage replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41185"
FT                   /db_xref="GOA:B4ESL9"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESL9"
FT                   /protein_id="CAR41185.1"
FT                   /translation="MNQVPNNLMAEQNVIGGLLLDPQSDNAQSIFSLLKPEDFYARHHQ
FT                   IIYLTLREMYTQRMPIDIMTVTDCLESKGRINQSGGFAYLAEMARETPSIANIMAYAKK
FT                   IRECSAQRFVIEKTVEIQKLMMAPSELGFTDKIEQAQRLLDEATSFGKMGRKTGLRRID
FT                   DVLDDVFTDICDRQDNPEKHRGLKTGFKDFDRLLSPKQIVIGSLFVIGARPKMGKTTVL
FT                   TEMAKNVSQQGKPVLLFSMEMTDKQLVERTLAQQTQINSDKFYQKLEEHEWDRLCNAIG
FT                   RLKDEPNIWVDDTPGMSLQHIRSESRKIKRKVGDIGFIGVDYLTLMQAGKADRNDIAYG
FT                   EITKGLKILAKELNTVVVLLVQLNRGLENRADKRPVPSDSRDTGQIEQDCDYWLGIYRD
FT                   AVYHDNADETLTEMILRLNRHGKTGTVYVDQQGLSITPVDQYMAAYRAQPKREPKRYCE
FT                   KSF"
FT   misc_feature    539128..539442
FT                   /note="HMMPfam hit to PF00772, DnaB-like helicase N
FT                   terminal domain, score 9.1e-35"
FT   misc_feature    539665..540261
FT                   /note="HMMPfam hit to PF03796, DnaB-like helicase C
FT                   terminal domain, score 1.7e-75"
FT   misc_feature    539755..539778
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        540533..540982
FT                   /transl_table=11
FT                   /locus_tag="PMI0484"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41186"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESM0"
FT                   /protein_id="CAR41186.1"
FT                   /translation="MTDDICLHKSNLNSIFKVLSEIVTTGKRYRIKITEWRDLRTIPMN
FT                   KTWRMWMETTGEWLRARGVVIDIKNGVGEIVLSKPITNEETHEYFVGHWLGRNENGERE
FT                   ETSKMDKARMLYMMEKHEQWCIEKGIPIIIPRNSEYMSLKRKQEE"
FT   CDS_pept        541061..541351
FT                   /transl_table=11
FT                   /locus_tag="PMI0485"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41187"
FT                   /db_xref="InterPro:IPR010774"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESM1"
FT                   /protein_id="CAR41187.1"
FT                   /translation="MMNLRNEAKGRECQIRIPSVCNGNSETVVLAHYRMSGLCGAGIKS
FT                   HDLFGAWACSACHDEVDRRTRFTDMEYAKQCHLEGVLRTQAILIQEGKLNV"
FT   misc_feature    541061..541342
FT                   /note="HMMPfam hit to PF07102, Protein of unknown function
FT                   (DUF1364), score 8.6e-63"
FT   misc_feature    541220..541237
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   CDS_pept        541348..541704
FT                   /transl_table=11
FT                   /locus_tag="PMI0486"
FT                   /product="putative phage holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41188"
FT                   /db_xref="GOA:B4ESM2"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESM2"
FT                   /protein_id="CAR41188.1"
FT                   /translation="MKVFNIEPVPKPRMTQADKWKKRPPVLKYFAFKDEVKLNKITLPE
FT                   SHYHITFILPMPKSWSKTKRSEMNGKPHQQKPDKDNLEKALLDAIFDDDSRVWDGRVTK
FT                   VWGKRGQIIIQEVR"
FT   misc_feature    541357..541698
FT                   /note="HMMPfam hit to PF05866, Endodeoxyribonuclease RusA,
FT                   score 1.5e-09"
FT   CDS_pept        541704..542336
FT                   /transl_table=11
FT                   /locus_tag="PMI0487"
FT                   /product="phage antitermination protein Q"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41191"
FT                   /db_xref="InterPro:IPR010455"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESM3"
FT                   /protein_id="CAR41191.1"
FT                   /translation="MNIEWIRERVSTALMNVCIIENGPLSAMEEQAILVTDRFKRNPIR
FT                   YAGERKSRYRLPSHPLKIKQKHAKGKSKPLINEVTYRTSSWRRGIHQLPNEMRLWLLYC
FT                   YGDYQYYREQILIVPYIWHEFQRLNSKKRITKKVKQRLQSLTLLAIQAVKAEINQTAKK
FT                   YTDVKLAELLGVSADAWRKSYKLYWICLLDCCYQLDRDSLFKISALS"
FT   misc_feature    541704..542333
FT                   /note="HMMPfam hit to PF06323, Phage antitermination
FT                   protein Q, score 2.9e-25"
FT   CDS_pept        542647..543168
FT                   /transl_table=11
FT                   /locus_tag="PMI0488"
FT                   /product="putative phage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41192"
FT                   /db_xref="GOA:B4ESM4"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESM4"
FT                   /protein_id="CAR41192.1"
FT                   /translation="MIDLFKLTKKSSRHIGIAIYVGIIAGIFSALVKSGFEDLIPPRTL
FT                   ETTPPPVVLLEKLGLNIDTMTYHWMGYSINWGGNGVHILFSIVIAVTYCVIAEFLPKVK
FT                   LLHGICFGIGVSVFAHGLVVPLLGLSGWLWTAGYQALISEFVGTAFWIWSIEAIRQNLR
FT                   YCLTKENDAE"
FT   misc_feature    join(542683..542742,542878..542946,542959..543027,
FT                   543040..543108)
FT                   /note="4 probable transmembrane helices predicted for
FT                   PMI0488 by TMHMM2.0 at aa 13-32, 78-100, 105-127 and
FT                   132-154"
FT   misc_feature    542710..543120
FT                   /note="HMMPfam hit to PF07274, Protein of unknown function
FT                   (DUF1440), score 2e-33"
FT   CDS_pept        543327..543749
FT                   /transl_table=11
FT                   /locus_tag="PMI0489"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41196"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESM5"
FT                   /protein_id="CAR41196.1"
FT                   /translation="MSKEISELQFSLHYASETDSEKNTSIILTANIHTADGETQQLTQL
FT                   ICTTSSAGKKQYRIGLQKISDAGAPLLVAIESYWRKNTQESCVYLLEKAKQFIQGHLQQ
FT                   TNTWISMYGLVIVSNASLEEQLPEGLLKALKVSIPA"
FT   CDS_pept        543797..544072
FT                   /transl_table=11
FT                   /locus_tag="PMI0490"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41197"
FT                   /db_xref="GOA:B4ESM6"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESM6"
FT                   /protein_id="CAR41197.1"
FT                   /translation="MTMRMEKLTNVTYGTAGLTAFFASLSLYEWVFVIGMAFSMLLGLA
FT                   TYFMTRREQRKRTQLFEELVRHVDPQNPTETLKKLAELMVKAPKDI"
FT   misc_feature    543875..543943
FT                   /note="1 probable transmembrane helix predicted for PMI0490
FT                   by TMHMM2.0 at aa 27-49"
FT   CDS_pept        544072..544542
FT                   /transl_table=11
FT                   /locus_tag="PMI0491"
FT                   /product="phage lysozome"
FT                   /note="Almost identical to PMI0920 (99.3 38d)"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41199"
FT                   /db_xref="GOA:B4ESM7"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESM7"
FT                   /protein_id="CAR41199.1"
FT                   /translation="MSLKQKIAALTTAGATAIALVVIAHFEGVRYEPYRDVAGVLTVCY
FT                   GHTGKDIIQGKRYTQQECDALLQIDFIKTQQQVDALIKVSLDDYTKAALYSFAFNVGTT
FT                   AFARSTLLKKLNAGDRAGACEEMKRWIYAGGKVWRGLVSRREAESALCHGKL"
FT   misc_feature    544072..544143
FT                   /note="Signal peptide predicted for PMI0491 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991) with cleavage site
FT                   probability 0.736 between residues 24 and 25"
FT   misc_feature    544090..544158
FT                   /note="1 probable transmembrane helix predicted for PMI0491
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    544189..544512
FT                   /note="HMMPfam hit to PF00959, Phage lysozyme, score
FT                   6.1e-34"
FT   CDS_pept        544524..544682
FT                   /transl_table=11
FT                   /locus_tag="PMI0491A"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0491A"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41205"
FT                   /db_xref="GOA:B4ESM8"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESM8"
FT                   /protein_id="CAR41205.1"
FT                   /translation="MSWKTLIIIIGFILALLITVAGGIYLLIDNSCTKDQVSLEKRCQI
FT                   ALSYHRY"
FT   CDS_pept        544685..545146
FT                   /transl_table=11
FT                   /locus_tag="PMI0492"
FT                   /product="putative phage endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41206"
FT                   /db_xref="GOA:B4ESM9"
FT                   /db_xref="InterPro:IPR004929"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESM9"
FT                   /protein_id="CAR41206.1"
FT                   /translation="MKYGKLYAVIAMVGIIVGSYWVINWQANRINSLTDINKKLAVALE
FT                   EQKSINTDYQARIMRLNQLDIQYTQELANAKNEISHLRDISERHPERVYIKAECPKVKT
FT                   TPSTSLAYATTARPTDTAIRNYWLLRERIAESEQMIKGLQDYIKQECME"
FT   misc_feature    544691..545140
FT                   /note="HMMPfam hit to PF03245, Bacteriophage lysis protein,
FT                   score 2.7e-13"
FT   misc_feature    544700..544759
FT                   /note="1 probable transmembrane helix predicted for PMI0492
FT                   by TMHMM2.0 at aa 6-25"
FT   CDS_pept        545287..546078
FT                   /transl_table=11
FT                   /locus_tag="PMI0493"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41208"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESN0"
FT                   /protein_id="CAR41208.1"
FT                   /translation="MTARNRLEVAWQCIAKLRTLRISFCAFTAQLKTLTEPYRKSNLRK
FT                   TVNGVFCGAVISGEQVRFSIRIYTMSKSLVFKGNEITPFDNGDNKIWFTSSQMAKLLEY
FT                   KNEKSVTNLYNANKDEFSDDMTMVTETMTNGINNNLRKKKVRIFSVRGAHLIGMLANTD
FT                   VAKSLRRWLLDLAEKESKPQTGLANLDMNELKTLTINEMQNRLVAADNWSFENFGRKGS
FT                   DLMNLRKRHLKKIRKAKKAIKELSQLTLPDMGEFPDGEEPA"
FT   CDS_pept        546075..546281
FT                   /transl_table=11
FT                   /locus_tag="PMI0494"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41210"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESN1"
FT                   /protein_id="CAR41210.1"
FT                   /translation="MNHEQFIEQNVLAELKKLGFSLPVCRRASYMAVDHYRRSSQASRK
FT                   GRMFDDCLHIAKVWASKFAKEKV"
FT   CDS_pept        546278..546436
FT                   /transl_table=11
FT                   /locus_tag="PMI0495"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41212"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESN2"
FT                   /protein_id="CAR41212.1"
FT                   /translation="MTKQEKANLSILYRQLQQSLEYLHCGRVDDGRIVAEIVERELGKL
FT                   VNKQKTK"
FT   CDS_pept        546464..547072
FT                   /transl_table=11
FT                   /locus_tag="PMI0496"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41214"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESN3"
FT                   /protein_id="CAR41214.1"
FT                   /translation="MDMAKRPDWEAIESAYRAGVMSIREIASQYEITHQAISKRAKKEG
FT                   WERDLKAKVKARAENLVAKREVASLVATEKAISERQLIEANAEVIANVRMEHRGDIRRA
FT                   RELTNNLFDELSAECADVPALRKLGELMFSPDDNGRDKLNEIYHSIISLPERVKSAKSL
FT                   SETFKNLVGLERQAYGLDDVQPNKTASQLSELMDDLSKE"
FT   misc_feature    546524..546589
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1349.000, SD 3.78 at aa 21-42, sequence
FT                   MSIREIASQYEITHQAISKRAK"
FT   CDS_pept        547075..548562
FT                   /transl_table=11
FT                   /locus_tag="PMI0497"
FT                   /product="putative phage terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41216"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESN4"
FT                   /protein_id="CAR41216.1"
FT                   /translation="MKPEHLALLRDKLWRLNHLYWITNKEGKPVRFKMTPEQLEYFEGM
FT                   HTRNIILKARQLGFTTEVCIIQLDAALFEAAKCALIAHTLNDAKRLFREKIKYAYDKLP
FT                   DEIKAANPASNDAVGELVFSKGGSLYISTSFRGGTLRYLHVSEFGKICAKYPEKAREIV
FT                   TGAFEAVSSDCFTTIESTAEGRAGYFFDYCQSAEKAQIQNKTLSNLDWKFFFFSWWKNP
FT                   EYAINPVEPLPQRLVDYFDEIASKHGVQLNERQKAWYYAKEKTLGDDMKREYPSIPSEA
FT                   FQQSVEGAYYAKQFRFLYENKRIGTLPDNSHLPVHTYWDIGVGDSTSIWFIREVGEEFH
FT                   IIDHYSNSGEGLRHYMKVLKDKGYTYASHNGPHDIDNREFGSDAKSRRELAREGYEIDG
FT                   QIYSIRFEVVPKLSVDEGIEAVREILPLCVFDEHKCSEGIAHLEAYRKEWDDKRGCWKD
FT                   KPLHDYTSHDADGFRYFAVSRRNTKRPAFEINLGTTF"
FT   CDS_pept        548562..549932
FT                   /transl_table=11
FT                   /locus_tag="PMI0498"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41218"
FT                   /db_xref="InterPro:IPR025129"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESN5"
FT                   /protein_id="CAR41218.1"
FT                   /translation="MSTTNVDFTRPEYKTAAPQWELVRSVCRGGEDIKSYLPELEEQDS
FT                   ERKKKRNKDYQDRAVFYPITGNTRNGMIGMAFKKDPLVAVVEKLSCLKDDADGAGSSIY
FT                   QLAQSSLESVLEVGRHGLYVDYNSDSKLPYIFQYRAEDIINWRTARINGRTMLTLVVLR
FT                   ETVEEEDGFGFKDEVQYRVLSIEEGKFVCRVYRKPSGSSVFEISSEYIPARAGNGVWNE
FT                   IPFTFIGAQNNDHTIDEAPLLGLAKINLGHYRNSADYEDSVFFCGQIQPYLGGLGTEWR
FT                   DYLEKKGVMVGSRSPIMLPEKGFFGYAQAQPNMLAKEAMDSKRDYMVALGAQLVSADSK
FT                   VKTVIQSVGEQNAQTSILSICCSNVSDACSKSLIWCAEYLGLDTAGISFEINKDLVNHI
FT                   ADSSMIREIVAAWQSGATRKSDLVRSLQKYDVIDPADDVDVVVDELNNQEPTMVGET"
FT   CDS_pept        549929..551050
FT                   /transl_table=11
FT                   /locus_tag="PMI0499"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41221"
FT                   /db_xref="InterPro:IPR017029"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV33"
FT                   /protein_id="CAR41221.1"
FT                   /translation="MRSVNERLMDELIAHSLFSGRYSTGVARRMIKALNEFDAELTASL
FT                   IVSLDDTSIDVNSFTARRLESLLSSVRSINKRAVDSAFSLLTEEMRAHALYEAGYYPSL
FT                   FDALLPDVVLRKYPLMSITEEMLFSSVMSRPFQGKLLSEWADGLESDRMTRINNAVRNG
FT                   YLNGDSAVEIGRKIRGHANQGYKDGVLQLSRANATTIAKTAISHLQATARDQFADANKD
FT                   ILDCKQWLSTLDNKTSHDCIIRDRLRYTLEGKPIGHKVPYLQGPGKIHFNCRSTETLVT
FT                   KSWRELGIDLDEMDAGTRASMDGQVPADTNFLDWIQRQPEWRQRQVFGETRFRLMKEGG
FT                   MHPSEFYTDKGEFISLERLREIDGHAFREAGYS"
FT   CDS_pept        551162..551923
FT                   /transl_table=11
FT                   /locus_tag="PMI0500"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41223"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV34"
FT                   /protein_id="CAR41223.1"
FT                   /translation="MLFMNIERKYYSQADDGSQGGGGGTPEITPEIQAIIDQQVSGLKA
FT                   KNSELLGKLKEQGDNLKRFEGIDPDTVKGMLKRFENDEEAKLIADGKIDEVLNKRTERL
FT                   RGDFDKKLKEASSKAEKAEAFANKFRARVLGDEIRFAAGKAGALTSAQEDLILRAKGIF
FT                   QINDEGQAVAVDEDGNPIMGKDGRTPLSPIEWIESLKESAPHLFPAASGTDAGKHKQGG
FT                   AHFKRSQMSASDKADYIRRYGRDAYLKLPKE"
FT   CDS_pept        551937..552890
FT                   /transl_table=11
FT                   /locus_tag="PMI0501"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41225"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV35"
FT                   /protein_id="CAR41225.1"
FT                   /translation="MATMTNNDLVIYNDLAQTAFLERRQDNLAVFNQASNGAIVLDNLF
FT                   IEGDFRKRAFYQIGGSIEHRDVNSTASVENKKIGAGESVDVKAPWKYGPYATTEEAFKR
FT                   RGRDVSEFSELVGTDAADASLEGYIKYSLAALGAAIGNNKEMVVTADIATDGKKTLTKG
FT                   LRRYGDKFNRVNLFVMHSTTYFDIVDQAIDNKVYEEAGVVIYGGQPGTLGKPVLVTDTA
FT                   PVDAIFGLVPGAVTITESQEPTFRSYEINDKENLEVGYRGEGVVNVGVLGYSWDESKGK
FT                   NPDLTQLGTAGNWKKHFTSNKLTAGVMIKLTAEEGK"
FT   CDS_pept        552866..553177
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PMI0502"
FT                   /product="phage protein (fragment)"
FT                   /note="Lacks an appropriate start codon. Similar to
FT                   N-terminal region of Escherichia coli intimin theta."
FT   CDS_pept        553217..553696
FT                   /transl_table=11
FT                   /locus_tag="PMI0503"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41228"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV36"
FT                   /protein_id="CAR41228.1"
FT                   /translation="MIDPDKNSPIFNSYASVDDLKKYAEDRNITLADSGLEALLITAMD
FT                   YLESQKWLGKRTNLNQPLSFPRSGLSRDGVAIPSDQIPKQLIQAQCRLAIESVENDLQP
FT                   TLGAEITSERIEGAITVQYAEGTNTGAPNFPWLKGLLSGLIDVSDGFAINTFAMR"
FT   CDS_pept        553699..554049
FT                   /transl_table=11
FT                   /locus_tag="PMI0504"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41230"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV37"
FT                   /protein_id="CAR41230.1"
FT                   /translation="MNIYQRGQSTALRMLKKYGVSYQAKRDGKHWVDDEGQEHFEPETL
FT                   FSVVGVKTQYKPYEIDGTLILSTDIKMILPPDIDIQKGDKVLVDGVWLRVHEPNPVKPA
FT                   DIIICYQSQLRA"
FT   CDS_pept        554051..554632
FT                   /transl_table=11
FT                   /locus_tag="PMI0505"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41233"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV38"
FT                   /protein_id="CAR41233.1"
FT                   /translation="MSDQFMKSINIFIDKSNANIETVVKNTGFKILAKLVDMSPVGNPE
FT                   LWEVNRVASNYNKAVFEHNEYLKQDPNNLTPKRRQLKKRVRVNDSMDIYVPPGYTGGRF
FT                   RGNWQVSFDAPAEGETGRIDKSGNMTKALGNVVIEQFKVGMKAIYFTNNVPYAYRLEMG
FT                   HSKQAPNGMVAVTAEEFSQFFNSAVSETKS"
FT   CDS_pept        554629..555030
FT                   /transl_table=11
FT                   /locus_tag="PMI0506"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41235"
FT                   /db_xref="InterPro:IPR025395"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV39"
FT                   /protein_id="CAR41235.1"
FT                   /translation="MNQSTINTEIRKLVASIGKDLNLKIAWPNLPFNDINDPYLQLHVM
FT                   PAETDNIGLSLDMPVYRGVIQINVVGKVGGGDAKISTIADDVKNRLENGLTLGEGIYIN
FT                   GEPSQFPPISDETNYTIPIRASYRCNAIR"
FT   CDS_pept        555076..555732
FT                   /transl_table=11
FT                   /locus_tag="PMI0507"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41237"
FT                   /db_xref="InterPro:IPR014918"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV40"
FT                   /protein_id="CAR41237.1"
FT                   /translation="MAYNIPNGSRVYVASKYDDEIKITEATNAEEAVLTVDDVGDIAKG
FT                   DIVHVTSGWKKASGAFRVASVAESKITLEGVDTSDKNVFPAGGGTGTLKKVLSWEVMPQ
FT                   VMTLSTEGGEQQTQEVQFLEDEQAETIDTYKNGVVQVYTFAHDAKLPIRKLLTKLDDSK
FT                   QVTAIRFFNKRAEEDRYYTASISFQRVPNTAINEVENVTARFSLKSEMQIYTNAS"
FT   CDS_pept        555784..556089
FT                   /transl_table=11
FT                   /locus_tag="PMI0508"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41239"
FT                   /db_xref="InterPro:IPR014859"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV41"
FT                   /protein_id="CAR41239.1"
FT                   /translation="MPKFTLVPNPTFKANVKIPVAGKEKPEVVTFTFKHHSVSELDGMR
FT                   EKPISEFFEQIIADWAIEEPYNKENLNILLDNYPSASRAISSTYYNELLGNREKNS"
FT   CDS_pept        556116..556391
FT                   /transl_table=11
FT                   /locus_tag="PMI0509"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41241"
FT                   /db_xref="InterPro:IPR014915"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV42"
FT                   /protein_id="CAR41241.1"
FT                   /translation="MSSKESAEFERAFGFPPDIDDVEVWPDVWDSYQVFSAMNTQWRVG
FT                   MNGITGLDYNPLNQIMDLLNIKDRATVFSDIRIMEAKALEVMHKRS"
FT   CDS_pept        556617..556850
FT                   /transl_table=11
FT                   /locus_tag="PMI0510"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41243"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV43"
FT                   /protein_id="CAR41243.1"
FT                   /translation="MKKLIREFLRVILSVEKITNPIIGGNDQKSKDEKEALDNKDNFFV
FT                   GRDGSISLNPNSIVVQKAFKDNIEKLQSTKGR"
FT   CDS_pept        556857..557666
FT                   /transl_table=11
FT                   /locus_tag="PMI0511"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41246"
FT                   /db_xref="GOA:B4EV44"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV44"
FT                   /protein_id="CAR41246.1"
FT                   /translation="MWAAVIVLVLVCGYNYVDNHLPSRYKLNNSVGWNAYFFVALKGGE
FT                   FLIQGLMASVVVAIGLYIIMYILNAPSYLFGWYEPFTFVDSIFNIRVSGMSFWTILWLS
FT                   FTVLISIGKTADVKKRNQSLQKRMEDFREVAKVYAIESLLLESFERMDDGLLVFVTLKS
FT                   RKVYVGMVDGIRFEGMDINTLVLIPFMSGYREKDTLTFHVEHNYTDHYAQQGINFSSEP
FT                   LSVFQFRHVLPYEQIESFSLFNVNTYNVFQEVAKEKEIKKKSETDSN"
FT   misc_feature    join(556992..557060,557124..557192)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0511 by TMHMM2.0 at aa 46-68 and 90-112"
FT   CDS_pept        complement(557917..558750)
FT                   /transl_table=11
FT                   /gene="ant"
FT                   /locus_tag="PMI0512"
FT                   /product="putative phage antirepressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41248"
FT                   /db_xref="InterPro:IPR018875"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV45"
FT                   /protein_id="CAR41248.1"
FT                   /translation="MTSVSTINVPFHGNNLYVVNFNGEPYVPMKPIVEGMGLTWQSQFE
FT                   KLKQRFSKGITEIVIPSKGGEQSMLCLALRKLAGWLHTISPNKVKPEIRDKVIKYQEEC
FT                   DDVLYEYWTTGEVKKKHKSTVQERNPLKNAVNLLVSKKGIMYPEAYSLVHQKFNVSSIE
FT                   ELTADQIPDAVEYIHKFVLEGEYIPKQEENILFEPNQNSITVTIPKEGRWLFSYKNEKQ
FT                   QVVSVDGHNVVSVEYIQKLQRDSNALIELLQNFRLRTQVMQGEKSGDILNTPLIA"
FT   CDS_pept        complement(558820..558981)
FT                   /transl_table=11
FT                   /locus_tag="PMI0513"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41250"
FT                   /db_xref="GOA:B4EV46"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV46"
FT                   /protein_id="CAR41250.1"
FT                   /translation="MNTNKKTGKFQLRLTEVLKSKVVELSAKDGISQNSIVNQAIAWYV
FT                   KEREKRVN"
FT   CDS_pept        559095..559352
FT                   /transl_table=11
FT                   /gene="mnt"
FT                   /locus_tag="PMI0514"
FT                   /product="phage regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41251"
FT                   /db_xref="GOA:B4EV47"
FT                   /db_xref="InterPro:IPR005569"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV47"
FT                   /protein_id="CAR41251.1"
FT                   /translation="MSQKNTRIRDITPYSLRMPDTLKEKLMQRASKNGRSLNAEMVMIL
FT                   QSAVDEDNTPKNLNELSQLDPEKFKELFMETIKKMNEGKK"
FT   CDS_pept        559453..560298
FT                   /transl_table=11
FT                   /gene="EP0005"
FT                   /locus_tag="PMI0515"
FT                   /product="putative phage replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41252"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV48"
FT                   /protein_id="CAR41252.1"
FT                   /translation="MNAPVISFINMKGGVGKTTLCISIGEYLANYKDKKVLIIDIDPQF
FT                   NATQSFMGKHDKISEYLSLVKQRKTIKRIFEVNASIYDEDAVLKKEDVIYSVYPNLDII
FT                   PGDINIMFEHNTVDTIRLIRIRNFIEDNKLREIYDYIFIDCPPTISMYTEASIMASTHY
FT                   IMPMRIDQYSVLGSNNLLSIVSKLARDQRLTIKPLGVIYTDTAPKRLTKKTRAIKTAIE
FT                   TEKGIRDLYFFKNHFSKVRDLQVGQQLNFASAYSQSKEIIDRICTELEAKLKEVDDESE
FT                   "
FT   misc_feature    559468..560193
FT                   /note="HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA
FT                   nucleotide binding domai, score 2.7e-20"
FT   CDS_pept        560285..560704
FT                   /transl_table=11
FT                   /locus_tag="PMI0516"
FT                   /product="putative phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41253"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV49"
FT                   /protein_id="CAR41253.1"
FT                   /translation="MNQNKLITKKKLMELKDSESLEFMIGFLSLVIFSKEIFKSNFELS
FT                   EFIKDAFKIEYKRYVVSSRTLMFSRLAKDIVRKYSDGNHFTAKNTVVNIIYEKLDQLPI
FT                   NDIALEAKKKENKKRKGKNTTTESISKWIKGFRGE"
FT   CDS_pept        560697..561365
FT                   /transl_table=11
FT                   /locus_tag="PMI0517"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41254"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV50"
FT                   /protein_id="CAR41254.1"
FT                   /translation="MSNFLTIDPYNVLGTVSKFKEDLKVIPDQYVVDSLISAVKKSIFL
FT                   KIIHEKSLRGNRHLLSVIYDFLGCISAIKKNEDRYFYFNIRSCIENSIRFLLNKDNDDE
FT                   IGVTRMFSEFKERYKGVDGVSALTRVYSDACNYVHNNVKADIDVSKSYKYIDSSKIFEK
FT                   KKSRNLCNDLVSVQSSLDNFLLINNKEDIKYSFLYLNENIEYLINKKFLERLFSSELVS
FT                   "
FT   CDS_pept        561463..562116
FT                   /transl_table=11
FT                   /locus_tag="PMI0518"
FT                   /product="putative phage lipoprotein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41257"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV51"
FT                   /protein_id="CAR41257.1"
FT                   /translation="MKKLLNISGVIALLVSCLFFSTTTLAVEKKISAPFGLKWGMTYSD
FT                   VLSKTGNIKLIGNEKNRVKEYLIKNDSSLIDGLDMYSVSIDDKYGLINVDALIYVYDDD
FT                   DSKVIEKYNILKQALSSKYSEQYSEEYLWKNRTRGMLTLPECLNNEGCGKYVSLFQGND
FT                   SSSVMIMLNATGDNRSVIISLFYKSEFIEKIKQEEKKQNEIIIKEKSDALANSL"
FT   misc_feature    561463..561540
FT                   /note="Signal peptide predicted for PMI0518 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 26 and 27"
FT   misc_feature    561475..561543
FT                   /note="1 probable transmembrane helix predicted for PMI0518
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    561481..561513
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        562176..565115
FT                   /transl_table=11
FT                   /locus_tag="PMI0519"
FT                   /product="putative phage tail tape measure protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41258"
FT                   /db_xref="InterPro:IPR006431"
FT                   /db_xref="InterPro:IPR009628"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV52"
FT                   /protein_id="CAR41258.1"
FT                   /translation="MADIATISLKADTSDLERGTQKLKEFGDTAEKVSGSSRNLNDQFN
FT                   RGVDHQKRAADAIKRQKKELDDLLNSINPTNKAFDALDKATQKLIEANKKGILPKDQFA
FT                   DYNAILEQTRDKLTRVNMSLTAEGRALLAQEAATNRAKQAADDFLNSLKNQTEIIGKTR
FT                   TEILELKAAQLGVSQQAAPMINKLKEQEKAFMNGSITIGQYKQAMRQLPMQMSDIVTSL
FT                   ASGMPVWMVMIQQGGQIKDSFGGVGNSLKALASLITPARVAMFGFAGAAAAVALAAYKG
FT                   SQEFGEYNKQLILTGGYAGRTAAQLDALARSLSGNGIAQYGMADTISKVVGSGSFSGRD
FT                   VDMVSKTAAAMEKTVGQSVDETIKQFQRLQEDPVKAVTELDKSLHFLTATQLEQITTLQ
FT                   TQGKEQEAAKMAMESYANAMDERTKQIKENLGHLERAWEGVKNMASSAWDAMLDIGREN
FT                   TLEQQIKEYEEALIEFQINPASKGLYYNKTGLMPDEVKSKLALLKEEKFQRDIKNAREK
FT                   AARDEEERKKAQFRADQELKRQYETAEEKHQRLLKEIINNADASQAAKDEAIRREKERY
FT                   EKEKAKGKGKTPTYRPDYGTRVDESANQALLSLQAQLKVLKEHKTVSDVISSERKKLWD
FT                   MEAKISILEEAQKTRQLTKDEKALLAKKDYILASQEALAIAGDEVKLQELHNRELDKQL
FT                   KRVEEINARSRALELGAGKSGRMYQRDIALEKAKSPDERKALEEYYAKEDSIRANWELG
FT                   VKKGFAEFQDQATNVYGNVAQISQSAFQGMSNSLSDFVLTGKANFADFTRSFLEMTTKM
FT                   LMQMAMLNAMKAAFGGNAVGNFFGFASGGYTGGGGKYDPAGVVHKGEFVFTKEATQRLG
FT                   VDNLYRLMDAGKRGYASGGHVGGSAPMSVTQPTAFIARNPQIAGGGVNVTIDMSGVKIE
FT                   TEQQQSAMPNIDVRAAEQSLKNKVKSLFISEGREGGDLYKIIKAVSGNR"
FT   misc_feature    562737..563366
FT                   /note="HMMPfam hit to PF06791, Prophage tail length tape
FT                   measure protein, score 3.8e-81"
FT   CDS_pept        565138..565350
FT                   /transl_table=11
FT                   /locus_tag="PMI0520"
FT                   /product="putative phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41260"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV53"
FT                   /protein_id="CAR41260.1"
FT                   /translation="MKLKLGNICIRPEDKEISIPVDVYMGNEADFEPPKAYLVYQTSFD
FT                   ANKPLSEYFKESEEYARKTIKELNQ"
FT   CDS_pept        565390..565680
FT                   /transl_table=11
FT                   /locus_tag="PMI0521"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41262"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV54"
FT                   /protein_id="CAR41262.1"
FT                   /translation="MKIKVEFPLLSNKFSGVEITGDVKRYGIGAIKISEKPILTSEITV
FT                   TEIVGNNTPDEEPKLQFKYTEDYNPNETFASFMGRAEKYARTMIDRIKAAQ"
FT   CDS_pept        complement(565700..565900)
FT                   /transl_table=11
FT                   /locus_tag="PMI0522"
FT                   /product="phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41263"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV55"
FT                   /protein_id="CAR41263.1"
FT                   /translation="MLVSEMAKDIETLQTRTLALEYIIQVMIRNMSDIEKEKLISELNK
FT                   VSHDSPVTIEAFGIIQSHLHN"
FT   CDS_pept        566044..566385
FT                   /transl_table=11
FT                   /locus_tag="PMI0523"
FT                   /product="putative phage minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41264"
FT                   /db_xref="InterPro:IPR010265"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV56"
FT                   /protein_id="CAR41264.1"
FT                   /translation="MEEFKWRTQIQDSPSGEFKHRIKEVEFGDGYKQVAGDGINPESQT
FT                   WPFSYMGLKDEVMPIFKFIRQHTVKSFIWTPPFGEKGLYRVKADSISMIPISGGVMKLS
FT                   ATFEQAFSA"
FT   misc_feature    566044..566379
FT                   /note="HMMPfam hit to PF05939, Phage minor tail protein,
FT                   score 7.5e-41"
FT   CDS_pept        566382..567125
FT                   /transl_table=11
FT                   /locus_tag="PMI0524"
FT                   /product="putative phage minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41269"
FT                   /db_xref="InterPro:IPR006487"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV57"
FT                   /protein_id="CAR41269.1"
FT                   /translation="MNITADVQKLEPGNKVQLIEVDGSGFDGPILRFHAYNLPHTPEEI
FT                   EKSNGDIKPKPIWWQENEYGAWPYEVEGMAKNSDGSPARPSLKVANIDGLISSLCLQLD
FT                   DMVQAKVTIYETFSHYLDAKNFPDGNPTANPDECFKQVYYIDRKTNEVAGESVEFELSS
FT                   PFDLQGVMIPVRQIHNLCYWCMKGDYRSGNGCSYSGNKYFDERGNPVDDPALDSCGGLI
FT                   SDCKKRFGENEPLDFGGFPAAGLTR"
FT   misc_feature    566451..567119
FT                   /note="HMMPfam hit to PF05100, Phage minor tail protein L,
FT                   score 1.4e-101"
FT   CDS_pept        567122..567832
FT                   /transl_table=11
FT                   /locus_tag="PMI0525"
FT                   /product="putative phage tail assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41272"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV58"
FT                   /protein_id="CAR41272.1"
FT                   /translation="MITKKLRESIFEHVKAEYPKEACGIICQKSRVKKYFPCSNLSDNP
FT                   TEHFELSPEDYALAEDWGEPIAIVHSHCGDGVTTQPSEIDKLQCDATGLPWVIASCPEG
FT                   DIRIIYPRGERELEGRPFVLGYADCWSLIMDYYHQKHGIELHNYSVDRHWWEEGENLYT
FT                   DNYEKAGFVDIAGEPKEGDMIIMQVQADVPNHAGVIMNGMLLHHLYGQLSRLVPYSDYW
FT                   RDRTVKIVRRKEFV"
FT   misc_feature    567476..567814
FT                   /note="HMMPfam hit to PF00877, NlpC/P60 family, score
FT                   2e-31"
FT   CDS_pept        567829..568416
FT                   /transl_table=11
FT                   /locus_tag="PMI0526"
FT                   /product="putative phage tail assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41274"
FT                   /db_xref="GOA:B4EV59"
FT                   /db_xref="InterPro:IPR010654"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV59"
FT                   /protein_id="CAR41274.1"
FT                   /translation="MSLKTIRLYGVLGAKFGREHKLDIDSPREAIKALSVLYDGFELFL
FT                   ANAHLKGLEFAVFKGKRNIAEDELHLDTKEEIRIAPIIKGSKRGGFFQTMLGIAMIGVA
FT                   TFAPWGTALFASDLIGAIGLGVALGGVYQMLSPQPRGLSMRQDSDNKPSYAFGGAVNST
FT                   AQGNPVPLLYGLDRREVGGAIISAGIYTEDQQ"
FT   misc_feature    567850..568407
FT                   /note="HMMPfam hit to PF06805, Bacteriophage lambda tail
FT                   assembly prot, score 3.1e-91"
FT   misc_feature    join(568093..568152,568165..568233)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PMI0526 by TMHMM2.0 at aa 89-108 and 113-135"
FT   CDS_pept        568468..572661
FT                   /transl_table=11
FT                   /locus_tag="PMI0527"
FT                   /product="putative phage host specificity protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41276"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015406"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV60"
FT                   /protein_id="CAR41276.1"
FT                   /translation="MELIHGAKGGGGGGHTPTESPDSLLSESTAKILLAISEGEIAGGL
FT                   DDTRIFLDDTPIGNADGTKNFEGVTWEFRPGSEHQEYIQGIPSVDSETSVGLELKDDQP
FT                   YVRSINNTQLSAVRIRLSVPQLFQQHDNGDTTGYRIEYAIDLSTDGAGYNEVLKSAFDG
FT                   KTTSEYQRTHRIDLPKANTGWQIRVRRLTKNQNTARIVDKVTISAVTDVIDAKLRYPNT
FT                   ALLFITFNARQFNNRIPKISVRPKGGLLIKVPTNYDPINRAYSGVWDGTFKLAATNNPA
FT                   WVFYDLVLNNRYGCGDRIQSSQVEKWDLYKIAQYCDELVPDGHGGDGKEPRFLCDVYIQ
FT                   SQESAYQVLRDIAAIFRGMTFWADNKVNVVADMPDSIFRTFTNANIVGGKPTYSGGSQQ
FT                   NRYTQALVSYTDTNNHSNDAIEAVADIKLQRRYGVRKTEISAIGCTRQTEANRRGRWAL
FT                   LTNANDRVISFATGLEGAIPSPGHIIAVADSTLAGRDNGGRISRVEGRKITLDRRANIK
FT                   AGDRLIVNLPNGRSEGRTVSLVADNIITISTEYSQEPEKNAVWTVDADDLTLQLYRVVN
FT                   ITDNGDNTYTITGAIHNPSNYDHIDSGARIGERPITIVPPSVQAPPKNIRISSYSQVNQ
FT                   GISFITLRVDWDAVDNAITYEAQWRRDNNNWVSMPRTSTCGFEVDGIYAGRYQVRVRAI
FT                   NASEISSVWTNAPETTLTGKVGSPPKPVNFRASPLVFGIKLGWEFGENTSDTLKTEIQY
FT                   SKTNNGEGLMLLSDVPYPSKTYEMAGLSAGLTFYFRARLVDKIGNHSEWTEFILGESEF
FT                   DASIILDELAGQISRDQLAQDLLGEINSKANQIDITELHELMRINHDKILSELMRHGAT
FT                   IEESEKKWEEAGKLLAERMNQVSTATEAQAAAIKQEQQARIEGDKTEAQQRQSLATQLR
FT                   GDYTGNDLSKVTAGLISAEKQARVSGDQAEAKARQSLETRMNGNVSAINKSLETLTSKQ
FT                   QAQTQEISTLNSNLKGKADSSVVNALNTRVTNLDGKVMSATSQVQTLSSKLDTVKADLT
FT                   ESVVVDLDLSKLNENTYYPIILPLVTSRRYAFKVFRTLGQYRDNKPSYATHSTKGFAMI
FT                   VEWQVSGSGWGTQSENRIIDNFDWRWTNQSPVMGPAQLTNGSVEYIYLRGGAKYQLTKH
FT                   KSVNHQIITRTYTNNKQSVAPKGFVANEVPKSSEQKANATANAVNQLETKVTEVSGKVT
FT                   STAQQVTRLESQVGTSSAKIEQTSKVVTDINGKISASWTMKVQQDSKGNKVITGIGLGF
FT                   NAQGNSQFLVNAQNFAVISSLNGKVVTPFIVKNGQVVVNEAFIGDATITSAKIANVLQS
FT                   TNFSHANKVGYQLNMRTGEEIKYGNNAQGYWIETNILKRLFDKKGTMRIRMGIW"
FT   misc_feature    570355..570567
FT                   /note="HMMPfam hit to PF00041, Fibronectin type III domain,
FT                   score 0.037"
FT   misc_feature    570619..570876
FT                   /note="HMMPfam hit to PF00041, Fibronectin type III domain,
FT                   score 0.034"
FT   CDS_pept        572655..573023
FT                   /transl_table=11
FT                   /locus_tag="PMI0528"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41279"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV61"
FT                   /protein_id="CAR41279.1"
FT                   /translation="MVMGMGLEIYDEKGRLIIGEDTIIPRHLGQFDLPLSQYGSLTIPE
FT                   ISLGGEVVCHFWLRYRSRWSGEFHVDKPNERTEYSISGNTLNYRVDYNIYRWENNGSGG
FT                   GQTQANDSFSSHVVVWVV"
FT   CDS_pept        573025..573639
FT                   /transl_table=11
FT                   /locus_tag="PMI0529"
FT                   /product="phage protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41282"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV62"
FT                   /protein_id="CAR41282.1"
FT                   /translation="MVGVEIYTNNRLIQLTDKLETICVLRKATPDELTSSSGPHDSYPR
FT                   IYALNSQWMVAPISKVSIPQHGVGLEVYDEQGKMKFSSLAKLVCFEKYYDVNTGSAGKG
FT                   SLRIAGKSGHRYGMIKTRSMGYFHNTNIRSYIDPDTWDEVWTFKRYSERYVLIDDVGGL
FT                   TFEYRYEFLGEEDGWISMPPSREGSGLMEQGLMIDVSMLED"
FT   CDS_pept        573689..573949
FT                   /transl_table=11
FT                   /locus_tag="PMI0530"
FT                   /product="putative phage protein"
FT                   /note="Similar to N-terminal region of Photorhabdus
FT                   luminescens NgrE (UniProt:Q9AHZ4)."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41284"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV63"
FT                   /protein_id="CAR41284.1"
FT                   /translation="MIYTTGTVSTVSGSAIVSGTGTIILIKNGNANFIYMVDRVNSDTE
FT                   LVISQPATFTVKNTSYSINLTEPNSYSDANNRMTAIASDIT"
FT   misc_feature    573698..573766
FT                   /note="1 probable transmembrane helix predicted for PMI0530
FT                   by TMHMM2.0 at aa 4-26"
FT   CDS_pept        join(574032..574103,574103..574510,574519..574635)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PMI0531"
FT                   /product="putative phage protein (fragment)"
FT                   /note="Highly similar to PMI0941 (91.4 38d)."
FT   repeat_region   574504..574511
FT   repeat_region   574512..574519
FT   repeat_region   574558..574613
FT   misc_feature    574658..580036
FT                   /note="fimbrial operon 4"
FT   CDS_pept        complement(574658..574963)
FT                   /transl_table=11
FT                   /locus_tag="PMI0532"
FT                   /product="fimbrial operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41287"
FT                   /db_xref="GOA:B4EV64"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV64"
FT                   /protein_id="CAR41287.1"
FT                   /translation="MSTINSIIAYRIMQKRKELGMTGREIAHSLEISQQHYSRIENGHT
FT                   KITVEHLFSIAFILGVKPKELLPNYKFSNEKEMIKAKQSLSAESIMPIKKSDMYPT"
FT   misc_feature    complement(574766..574930)
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   1.7e-13"
FT   misc_feature    complement(574838..574903)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1573.000, SD 4.54 at aa 24-45, sequence
FT                   MTGREIAHSLEISQQHYSRIEN"
FT   CDS_pept        complement(575064..576146)
FT                   /transl_table=11
FT                   /locus_tag="PMI0533"
FT                   /product="putative fimbrial adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41289"
FT                   /db_xref="GOA:B4EV65"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="PDB:6H1X"
FT                   /db_xref="PDB:6H2L"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV65"
FT                   /protein_id="CAR41289.1"
FT                   /translation="MKRIFVILFLLTLFPSLAVAGANDYVPSPITINTSTLPVVVIGPA
FT                   DAHTYPRVIGELTGTSNQYIFNGGSLIALMRGKFTPTLPKIGKITYNFRQGNNTQSSDF
FT                   DIFDTGVPGLGIIIGMAGYWPATPLVPINSSSIYIDPVAANTNPNAYNGATGSFGARLY
FT                   VAFVATGRLPNGYVTIPTKQLGHILLESNRASLNNKRLTAPVMLNGGRIQVQSQTCSMN
FT                   QKNYVVPLNTVYQSQFTSLYKEVQGGEVNIQLQCQDGIDVYATLNDATQHGNRSDILTL
FT                   ATDSTAKGVGLRLYKNNEVTAISYGSDTPNKGNQNQWHFSNYRGEINPRIKLKANYIKT
FT                   ENTITPGSVKAVATITFSYQ"
FT   misc_feature    complement(575067..575519)
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   5.4e-05"
FT   misc_feature    complement(576087..576146)
FT                   /note="Signal peptide predicted for PMI0533 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.914 between residues 20 and 21"
FT   CDS_pept        complement(576156..578690)
FT                   /transl_table=11
FT                   /locus_tag="PMI0534"
FT                   /product="fimbrial usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41290"
FT                   /db_xref="GOA:B4EV66"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV66"
FT                   /protein_id="CAR41290.1"
FT                   /translation="MNFNNRLHLISYRYSLPFCVALGIGVITISSFAAEEAEFDPSFLH
FT                   SVQGKNAIDIRRFNYGNPIPEGKYYADIYLNNEWKGKANVQYLYTDNANTSTLCLTPEL
FT                   LSLIDVVKGTVPENSYKATCYPASEGLPSAKFHFDLSTLKLNIEIPQAQVNTRPRGYIA
FT                   PAQWQSGVPAAFVNYDVNYYQYNTPDINNEQTYLGLKAGLNLWGWAFRHRGGESWNNGH
FT                   STGYQNIETNVTHDIARLRAQFTLGDFYTNGELMDSLSLRGIRLASDERMLPNSLRGYA
FT                   PIVRGIANSNAKVTIYQNAHILYETTVPAGPFVINDLYPSGYAGDLLVQITESNGQTRT
FT                   FTVPFASVAQLIRPGFSRWQMSVGRYRYANETYHDLIAQGTYQYGLTNDITLNSGLTTS
FT                   SKYTAGLAGVAFNTPIGAIASDITLSRTTFNHSNVTRKGYSLHTSYSVNIPTTSTNITL
FT                   AAYRYSSKDFYHLKDALLANHSEFIDDVSIKSAAFYRPKNQFQVSINQELGEKWGNIFL
FT                   TGTTYNYWEHKGSRNEYQMGYSHFWKKLGYQIGFSQSRDNEQQHRDDRFYVNFTLPLGE
FT                   RVQSPIFSTVLNYNKGEKNSIQTSISGIAGEDNQFSYGISGNSQESGPSGYAMNGGYRS
FT                   PYVNVTATVGQDTQHNRQMSLGASGAVVVHPYGVTLSNDLSDTFTIIHAKGAQGAVINN
FT                   APGSRLDFWGNGIVPYVTPYEKNQISIDPTNLDLNVELSATEQEIIPRANSATLVTFNT
FT                   QTGRSLLFDIRMPDGSTPPMASEVLDEHKQLVGYVAQAGRLFTRGLPKQGQLDVIWGPN
FT                   HDDKCSFTYHATRNETDMRPQTIPVQCIPHSN"
FT   misc_feature    complement(576219..578582)
FT                   /note="HMMPfam hit to PF00577, Fimbrial Usher protein,
FT                   score 0"
FT   misc_feature    complement(577737..577769)
FT                   /note="PS01151 Fimbrial biogenesis outer membrane usher
FT                   protein signature."
FT   misc_feature    complement(578589..578657)
FT                   /note="1 probable transmembrane helix predicted for PMI0534
FT                   by TMHMM2.0 at aa 12-34"
FT   misc_feature    complement(578592..578690)
FT                   /note="Signal peptide predicted for PMI0534 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.936 between residues 33 and 34"
FT   CDS_pept        complement(578700..579425)
FT                   /transl_table=11
FT                   /locus_tag="PMI0535"
FT                   /product="fimbrial chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41292"
FT                   /db_xref="GOA:B4EV67"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV67"
FT                   /protein_id="CAR41292.1"
FT                   /translation="MLKFILIFLTLFVSTVAQASVVIMGTRVVYPATQKSINVQLNNND
FT                   ESPALIQSWLDTGNAAAAPDSIHVPFIITPPIFRMEPKSGQTIRIVYTGESLPQDRESL
FT                   FYLNVLDIPAKPKVEENSENSEGNNNYLQLAVRSRIKFFFRPDNLNVTPDDAYQKVTWH
FT                   QEGALRIKAINPTPYYITYNKISVGQDKQLTPVEQSGMIAPFSSKIFSLKEKPTLTNKV
FT                   TWVVVNDYGGYQQGESTLE"
FT   misc_feature    complement(578712..578966)
FT                   /note="HMMPfam hit to PF02753, Gram-negative pili assembly
FT                   chaperone, score 9.4e-18"
FT   misc_feature    complement(578976..579368)
FT                   /note="HMMPfam hit to PF00345, Gram-negative pili assembly
FT                   chaperone, score 2.7e-65"
FT   misc_feature    complement(579084..579137)
FT                   /note="PS00635 Gram-negative pili assembly chaperone
FT                   signature."
FT   misc_feature    complement(579354..579422)
FT                   /note="1 probable transmembrane helix predicted for PMI0535
FT                   by TMHMM2.0 at aa 20-42"
FT   misc_feature    complement(579369..579425)
FT                   /note="Signal peptide predicted for PMI0535 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.960) with cleavage site
FT                   probability 0.953 between residues 37 and 38"
FT   CDS_pept        complement(579491..580036)
FT                   /transl_table=11
FT                   /gene="uca"
FT                   /locus_tag="PMI0536"
FT                   /product="putative major fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41294"
FT                   /db_xref="GOA:B4EV68"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV68"
FT                   /protein_id="CAR41294.1"
FT                   /translation="MKRKVIALATILSAAFAGSSMAYDGTITFTGKVVDQTCSVDTQSK
FT                   NLAVILPTVSVATLNNVATTAGLTPFTIKLTGCSTDKDGAKNVKVYFEPSADTDLTTHN
FT                   LKNTATGTKANNVQVQLLNSDAATTIQLGTDVNSQNVQEVQIDNADVNLPYFAQYYATG
FT                   SSTAGDVKATVHYTIAYE"
FT   misc_feature    complement(579494..579964)
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   1.6e-42"
FT   misc_feature    complement(579926..579976)
FT                   /note="PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1."
FT   misc_feature    complement(579956..580024)
FT                   /note="1 probable transmembrane helix predicted for PMI0536
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    complement(579971..580036)
FT                   /note="Signal peptide predicted for PMI0536 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 22 and 23"
FT   CDS_pept        580267..580419
FT                   /transl_table=11
FT                   /locus_tag="PMI0537"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41296"
FT                   /db_xref="GOA:B4EV69"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV69"
FT                   /protein_id="CAR41296.1"
FT                   /translation="MVFSIDGVDFDSYDLLMVGEMIVKIDLVIVVQCVISMIDDIYMRR
FT                   LLVKT"
FT   misc_feature    580309..580377
FT                   /note="1 probable transmembrane helix predicted for PMI0537
FT                   by TMHMM2.0 at aa 15-37"
FT   CDS_pept        complement(580530..580670)
FT                   /transl_table=11
FT                   /gene="holE1"
FT                   /locus_tag="PMI0538"
FT                   /product="putative DNA polymerase III, theta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="This CDS is truncated at the C-terminus relative to
FT                   all database matches. Also similar to PMI1602 (71.1 38d)."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41298"
FT                   /db_xref="GOA:B4EV70"
FT                   /db_xref="InterPro:IPR009052"
FT                   /db_xref="InterPro:IPR036745"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV70"
FT                   /protein_id="CAR41298.1"
FT                   /translation="MNLANLSQEEKDKINVDLAASGVAYKERLNMPIVASEVERQQPAH
FT                   L"
FT   misc_feature    complement(580533..580670)
FT                   /note="HMMPfam hit to PF06440, DNA polymerase III, theta
FT                   subunit, score 3.9e-11"
FT   CDS_pept        580915..582582
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="PMI0539"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /EC_number="6.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41300"
FT                   /db_xref="GOA:B4EV71"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4EV71"
FT                   /protein_id="CAR41300.1"
FT                   /translation="MNEADARPTNFIRQIIDEDLATGKHNSVHTRFPPEPNGYLHIGHA
FT                   KSICLNFGIAQDYQGKCNLRFDDTNPVKEDVEYINSIQKDVQWLGFQWDGNVHYSSDYF
FT                   DQLYQYAIELINKGLAYVDELSAEEIREYRGTLKEPGKNSPYRSRSVEENLALFEKMRA
FT                   GGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDAL
FT                   ENITHSLCTLEFQDNRRLYDWVLDNITIPCHPRQYEFSRLNLEYTVMSKRKLNQLVTEN
FT                   IVDGWDDPRMPTISGLRRRGYTAESIREFCQRIGVTKQDNNVEMASLEACIRDDLNENA
FT                   PRAMAVIDPVRLVIENMPEGEEILTAPNHPNKPEMGTREVPFSREIYIDRADFKEEANR
FT                   QYKRLVLGKEVRLRNAYVIKAERVEKDEQGEITTIYCTYDPQTLNKDPADGRKVKGVIH
FT                   WVSIPHAIPAEIRLYDRLFSVPNPGAEEDFLSTINPESLVIRQGFVEASLKDAAIEKAY
FT                   QFEREGYFCADKLSTADKLVFNRTVGLRDTWAKISKQG"
FT   misc_feature    580993..581928
FT                   /note="HMMPfam hit to PF00749, tRNA synthetases class I (E
FT                   and Q), ca, score 4.1e-184"
FT   misc_feature    581014..581049
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   misc_feature    581932..582498
FT                   /note="HMMPfam hit to PF03950, tRNA synthetases class I (E
FT                   and Q), an, score 6.1e-104"
FT   CDS_pept        583221..584615
FT                   /transl_table=11
FT                   /locus_tag="PMI0540"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41302"
FT                   /db_xref="GOA:B4EV72"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV72"
FT                   /protein_id="CAR41302.1"
FT                   /translation="MVMQHAKPGRVALAVMGALLVTALPAKMSYAEGFIDDSTLTGGIY
FT                   YWQRDRDRKELTPNSPDYGKYKANLHHSTFNANLDFSSGYLGDFFGIDLAAFGAVELNN
FT                   SGPAAPNEIGFSDAKSRWDEKWTGDRSGVSIYKAAAKFKLGHFWAQGGYIQPKGQTLLR
FT                   PHWSFLPGTYRGAEAGAVFDFDKNGELSFSYMWTDEYKAPWYRNMYNFRKADLETNISY
FT                   LHSFGAKYDFKNSLVLEAAFGQADGYIDQYFGKVSYDFPIANNTLKTSYQFYGAKDKVT
FT                   GGGINDVYDGLAWLQAFTLGYTYNVFDFKVEGTWVKAEGNQGYFLQRMTPGWATSNGRL
FT                   DIWWDGRSDFNANGEKALYAGVMYDLKNWDLPGWAIGTSYVYAWDAKPSSNPIYDQSKR
FT                   IRESAWNADIMYTVQEGRAKGTLFKLHYTRYDNHSDIPSYEGGFGNIFQDEKDVKFNVI
FT                   MPFTIF"
FT   CDS_pept        584889..585728
FT                   /transl_table=11
FT                   /locus_tag="PMI0542"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41304"
FT                   /db_xref="GOA:B4EV73"
FT                   /db_xref="InterPro:IPR008535"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV73"
FT                   /protein_id="CAR41304.1"
FT                   /translation="MLKRLDDFLLEPPLKPFRGINRFIVEFLFFGVKEARSCLFAGFFF
FT                   FILFATPSKGVLGIPRYDVLLILAIVFQLWMVWGKLETWDELKAICFFHVVGFVMELFK
FT                   TSAAIGSWKYPDFAYTKLWEVPLFTGFMYSAVGSYLIQAWRFLKVRIEHYPPYWMATLV
FT                   ALAIYINFFSHHFIGDYRWYLTAFILGLYARSVVYFTPYDTERRMPLLLAFVLIGFFIW
FT                   LAENFGTFFGVWQYPNQIGAWSVVHAGKWGSWSLLVIVTFTIVVHLKHIKHSISVVK"
FT   misc_feature    584958..585674
FT                   /note="HMMPfam hit to PF05675, Protein of unknown function
FT                   (DUF817), score 1.2e-156"
FT   misc_feature    join(584967..585035,585063..585122,585156..585224,
FT                   585252..585311,585348..585416,585426..585494,
FT                   585513..585581,585639..585692)
FT                   /note="8 probable transmembrane helices predicted for
FT                   PMI0542 by TMHMM2.0 at aa 27-49, 59-78, 90-112, 122-141,
FT                   154-176, 180-202, 209-231 and 251-268"
FT   misc_feature    585633..585653
FT                   /note="PS00340 Growth factor and cytokines receptors family
FT                   signature 2."
FT   CDS_pept        complement(585792..586238)
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="PMI0543"
FT                   /product="ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41306"
FT                   /db_xref="GOA:B4EV74"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV74"
FT                   /protein_id="CAR41306.1"
FT                   /translation="MTDNNKALKNAGLKVTLPRLKILEVLQDPECHHVSAEDLYKKLID
FT                   IGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFTD
FT                   DAIEVRQRNIAERHGIKLSNHSLYLYGHCAAGNCKEDSHAHDEK"
FT   misc_feature    complement(585849..586211)
FT                   /note="HMMPfam hit to PF01475, Ferric uptake regulator
FT                   family, score 2.2e-68"
FT   CDS_pept        complement(586429..586956)
FT                   /transl_table=11
FT                   /gene="fldA"
FT                   /locus_tag="PMI0544"
FT                   /product="flavodoxin 1"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41311"
FT                   /db_xref="GOA:B4EV75"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV75"
FT                   /protein_id="CAR41311.1"
FT                   /translation="MAIIGIFFGSDTGNTENIAKMLQERLGADNAEVHDIAKSSQEDIE
FT                   AFDILLLGIPTWYYGEAQCDWDDFFPTLEDIDFNGKLVALFGCGDQEDYAEYFCDAMGT
FT                   IRDIIEPRGAVIVGHWPTEGYHFEASKGLADDNHFIGLAIDEDRQPELTEERVDAWVAQ
FT                   IKEEMSLDEILG"
FT   misc_feature    complement(586477..586941)
FT                   /note="HMMPfam hit to PF00258, Flavodoxin, score 4.6e-53"
FT   misc_feature    complement(586891..586941)
FT                   /note="PS00201 Flavodoxin signature."
FT   CDS_pept        complement(587115..587414)
FT                   /transl_table=11
FT                   /locus_tag="PMI0545"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41314"
FT                   /db_xref="GOA:B4EV76"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B4EV76"
FT                   /protein_id="CAR41314.1"
FT                   /translation="MAKEQTDRTTLDLFANERRPGRPKTNPLSRDEQLRINKRNQLRRD
FT                   RVNGLRRVELKLNEDAVNALNELASAKNVSRSELIEEILLEQLAQTYALKKHQS"
FT   misc_feature    complement(587145..587267)
FT                   /note="HMMPfam hit to PF01402, Ribbon-helix-helix protein,
FT                   copG family, score 8.9e-07"
FT   CDS_pept        complement(587613..588398)
FT                   /transl_table=11
FT                   /locus_tag="PMI0546"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41317"
FT                   /db_xref="GOA:B4ESN6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESN6"
FT                   /protein_id="CAR41317.1"
FT                   /translation="MKLNALLNYQIHQPETATINNLPIVLIHGLFGDLNNLGVLGRDLR
FT                   QDHTVIQIDVRNHGHSPHSESMHYHDMAQDVLTLLDSLNIAKAIVIGHSMGGKIAMAMT
FT                   ALAPLRLERIVVIDMSPVAYNVRRHDKIFAALEAVTKAHVTQRTEAIAIMRPFIEEDGV
FT                   IQFLLKSFKKGEWLFNLPAIKQAYPDIIGWQEVPAWHHPVLFIRGGLSPYILDEYRNNI
FT                   ARQFPQATAFVVANTGHWVHSEKPETVIKAIRRFLAKTV"
FT   misc_feature    complement(587634..588257)
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 4.7e-16"
FT   CDS_pept        588863..589414
FT                   /transl_table=11
FT                   /gene="seqA"
FT                   /locus_tag="PMI0547"
FT                   /product="putative negative regulator of replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41319"
FT                   /db_xref="GOA:B4ESN7"
FT                   /db_xref="InterPro:IPR005621"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026577"
FT                   /db_xref="InterPro:IPR033761"
FT                   /db_xref="InterPro:IPR036835"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ESN7"
FT                   /protein_id="CAR41319.1"
FT                   /translation="MKKIEIDDELYRYIASETRHIGESASDILRRLLKLDAKQPVQPVV
FT                   VTESVQAPVVKQDADLKPVAPAKNPVREMRELLLSDSYAEKTKSVDRFLQILSTLYSLD
FT                   SATFTQSAETVHGRTRIYFAGDEKTLLDSGRHTKPRHIPGTPFWVITNSNTERKRTMVQ
FT                   SIMQDMQFPANEIDKVCGTI"
FT   misc_feature    588863..589411
FT                   /note="HMMPfam hit to PF03925, SeqA protein, score 6.3e-95"
FT   CDS_pept        589489..591132
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="PMI0548"
FT                   /product="phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41321"
FT                   /db_xref="GOA:B4ESN8"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESN8"
FT                   /protein_id="CAR41321.1"
FT                   /translation="MAIHSRAGQHTRQSDLINVAQLTAQYYSLKPQANQNAHRVKFGTS
FT                   GHRGSAKRHSFNEAHILAIAQAIAEVRANNGVTGPCYVGKDTHALSEPAFISVLEVLAA
FT                   NKVNVIIQENNGYTPTPSVSFSILTYNQGHQDIADGIVITPSHNPPEDGGIKYNPSNGG
FT                   PADTDLTSVIEKRANELLKNNLSGVKRLSYDDALASGYIHEQDLIMPYVKALGDVVDMK
FT                   AIKKAGLKLGVDPLGGSGIEYWKRIGEYYELDLELVNDQVDQTFRFMTLDHDGVIRMDC
FT                   SSPWAMEGLLQLRDKFDLAFANDPDYDRHGIVTPSGLMNPNHYLAAAINYLFRHRPQWS
FT                   NEVKVGKTLVSSAMIDRVVADLGRELVEVPVGFKWFVQGLFSGEFGFGGEESAGASFLR
FT                   FNGKPWSTDKDGIILCLLAAEIKAVTGKDPQQHYNELAQRFGSPSYNRIQASATHEQKA
FT                   LLSRLSPEMVTANTLAGDPITARLTHASGNGAAIGGLKVMTDYGWFAARPSGTEEAYKI
FT                   YCESFRGSEHRELIEKEAIEIVNNVFASKQ"
FT   misc_feature    589603..590040
FT                   /note="HMMPfam hit to PF02878,
FT                   Phosphoglucomutase/phosphomannomutase, al, score 1.4e-42"
FT   misc_feature    589906..589950
FT                   /note="PS00710 Phosphoglucomutase and phosphomannomutase
FT                   phosphoserine signature."
FT   misc_feature    590113..590445
FT                   /note="HMMPfam hit to PF02879,
FT                   Phosphoglucomutase/phosphomannomutase, al, score 1.6e-17"
FT   misc_feature    590446..590808
FT                   /note="HMMPfam hit to PF02880,
FT                   Phosphoglucomutase/phosphomannomutase, al, score 3.3e-24"
FT   misc_feature    590851..591120
FT                   /note="HMMPfam hit to PF00408,
FT                   Phosphoglucomutase/phosphomannomutase, C-, score 5.8e-14"
FT   CDS_pept        591289..591771
FT                   /transl_table=11
FT                   /locus_tag="PMI0549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41323"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESN9"
FT                   /protein_id="CAR41323.1"
FT                   /translation="MQNNYVLRSVRYMLDLSDGHIVDIMKLADFTATKEQVNQWLKKDD
FT                   DPAFVECDDMALGHFLNGLIFYRRGKDEKYPTPEVEKRITNNIILKKLRVAFELKDMDM
FT                   INIYELADFRVSKPELSAIFRKPGHKNYRNCGDQLVRYFLKGLTETLRGKGKAVKK"
FT   misc_feature    591295..591498
FT                   /note="HMMPfam hit to PF07308, Protein of unknown function
FT                   (DUF1456), score 2.3e-32"
FT   misc_feature    591544..591747
FT                   /note="HMMPfam hit to PF07308, Protein of unknown function
FT                   (DUF1456), score 1.2e-33"
FT   CDS_pept        591928..592170
FT                   /transl_table=11
FT                   /locus_tag="PMI0550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41325"
FT                   /db_xref="GOA:B4ESP0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESP0"
FT                   /protein_id="CAR41325.1"
FT                   /translation="MARVTSVTLGEHFNDFVGSMINSGRYGNTSEVIRDALRMMEIREE
FT                   RLQLVRKMVLDGVNSLESKNDMDDIFARAEKDLNV"
FT   misc_feature    591928..592167
FT                   /note="HMMPfam hit to PF03693, Uncharacterised protein
FT                   family (UPF0156), score 9.3e-21"
FT   CDS_pept        592163..592456
FT                   /transl_table=11
FT                   /locus_tag="PMI0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41329"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESP1"
FT                   /protein_id="CAR41329.1"
FT                   /translation="MYKLSKLAEEDIYQIARYTIQQFGVTQAKKYHNDLKQTFELLAKA
FT                   PWIGRECNWVCNGMRRFEFKKHSIYYLPKNDTLFITRLIHHSIDVDFVDFPK"
FT   misc_feature    592166..592432
FT                   /note="HMMPfam hit to PF05016, Plasmid stabilisation system
FT                   protein, score 9.8e-20"
FT   repeat_region   592574..592632
FT                   /note="repeated downstream of PMI0554"
FT   CDS_pept        592626..592784
FT                   /transl_table=11
FT                   /locus_tag="PMI0552"
FT                   /product="putative conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41331"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESP2"
FT                   /protein_id="CAR41331.1"
FT                   /translation="MLTDFRVSKPELSAIFRKLGHKNYRNCGDQLVRYFLKGLTETLRG
FT                   KGEVVKK"
FT   misc_feature    592629..592760
FT                   /note="HMMPfam hit to PF07308, Protein of unknown function
FT                   (DUF1456), score 1.8e-06"
FT   CDS_pept        592933..593265
FT                   /transl_table=11
FT                   /locus_tag="PMI0553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41333"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESP3"
FT                   /protein_id="CAR41333.1"
FT                   /translation="MSHAIEFIETSIFTQQIKLLATDKEIRILQNELISKPDKGDLIKG
FT                   TGGLRKIRMAVGNKGKSGGTRVIYFLATKEVIYLVMAYPKAIKISLTDSEKIELKKLTK
FT                   KLKGER"
FT   misc_feature    593095..593118
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        593267..593551
FT                   /transl_table=11
FT                   /locus_tag="PMI0554"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41336"
FT                   /db_xref="GOA:B4ESP4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESP4"
FT                   /protein_id="CAR41336.1"
FT                   /translation="MSFFNDLKASLEEAVEIKNGDKKASKVTRFEVADVKAIREQLNVS
FT                   QSEFAHALGTSIDTVKSWELKRRNPTGLTAKVLIAIHKNPNLFKELANI"
FT   misc_feature    593369..593530
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   2e-05"
FT   misc_feature    593396..593461
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1565.000, SD 4.52 at aa 48-69, sequence
FT                   VSQSEFAHALGTSIDTVKSWEL"
FT   repeat_region   593630..593688
FT                   /note="repeated upstream of PMI0552"
FT   repeat_region   593698..593727
FT                   /note="(GTTTTT)5"
FT   CDS_pept        593889..594095
FT                   /transl_table=11
FT                   /locus_tag="PMI0555"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41338"
FT                   /db_xref="GOA:B4ESP5"
FT                   /db_xref="InterPro:IPR019663"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESP5"
FT                   /protein_id="CAR41338.1"
FT                   /translation="MPAYNEYTKKHVLARRTGAVALGIVAFPVMVFHPKRAQFYSYLHR
FT                   VWSKTSNKPVWLAKSEMALTSHK"
FT   misc_feature    593922..593990
FT                   /note="1 probable transmembrane helix predicted for PMI0555
FT                   by TMHMM2.0 at aa 17-39"
FT   CDS_pept        594319..595062
FT                   /transl_table=11
FT                   /locus_tag="PMI0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41341"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESP6"
FT                   /protein_id="CAR41341.1"
FT                   /translation="MKNTDLELIINEKLSIENFHDYAPNGLQVEGRPHIQKIVTGVTAC
FT                   QALLDEAVRLNADAVLVHHGYFWKNEPVVIRSMKRNRLKTLLCNDLNLYGYHLPLDAHP
FT                   ILGNNAQLALKMGVKVEGEIEPLVPKGIFDLPVTANELKTRLEKALQRNVLHCGDNAPD
FT                   VIRHIAWCTGGGQGFIQQAAEQGVDAFVTGEVSEQTIHIAREMGVHFFAAGHHATERYG
FT                   IKALGEWLAQTHHLDVTFVDIDNPA"
FT   misc_feature    594346..595047
FT                   /note="HMMPfam hit to PF01784, NIF3 (NGG1p interacting
FT                   factor 3), score 1.4e-101"
FT   CDS_pept        complement(595143..597218)
FT                   /transl_table=11
FT                   /locus_tag="PMI0557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41343"
FT                   /db_xref="GOA:B4ESP7"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESP7"
FT                   /protein_id="CAR41343.1"
FT                   /translation="MSWQTVYFHYDEDALTVFANAGLLRRARKDVDNEKVSVTDANTGQ
FT                   FSSDGQKVVLHEAGIQQASCDCSAAGCCKHILAAILWLQANNNSTDDINTDNPIETSAE
FT                   KIIAPVETPPLLPSLFTLDPELLIKKAGKPACRTAINLIEQWEDKTLVLEDTGTQLKIQ
FT                   LPDVDEPVIFLQASGYDGMLSPFSSSQKKAFHLAIVAKIFKQNTQPWTWPEDLIPLKSS
FT                   QRPLNDEEIALINTIEQFIDDLLRQGLSHISLSSATQLHLLNMSARAEGLPRLASYLRT
FT                   LSTQVKRLAERHFTMDESNVLRLLAHISAYLFQLSYATPEQLKTLRGQLRRQYDDKKTS
FT                   LALIPIDAHWWTAQSGALGTTFTFWDKETKQFLQATQARPNQLDTLFNRYSVWHSLSLW
FT                   KQTADKLMRRPFLLQAPRISDEGKLATIGDSFAQNQTDFLDVTDYHQLQTELGIHNWQD
FT                   LPNYFTDQPEGFLSPLVLHIKSYNPLIWHEVEQCVIWEVVDNNGNSAFLRLYWEGETQN
FT                   NLEELRFLTKRELEIVAITVQPVRRDFNIDLLPTTIWIKTEQGIEMFYLDFDQFPRKKK
FT                   QSGFISHIQEYMAKRKRQTAMHHSEPTLAQKFCRPILSVLEAQACTGREQLSAMQKEQL
FT                   ERSKQIADDLGMTLIANQLTRYLALTARDSQALLQLIWLCDNLQQLQSPLPIQLNE"
FT   misc_feature    complement(596967..597053)
FT                   /note="HMMPfam hit to PF04434, SWIM zinc finger, score
FT                   0.031"
FT   CDS_pept        complement(597215..598348)
FT                   /transl_table=11
FT                   /locus_tag="PMI0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41346"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESP8"
FT                   /protein_id="CAR41346.1"
FT                   /translation="MPKDKIQQAKRWRLILGQYADDALGQATFNADDLKIERTLDFLYR
FT                   REYQRRGLRQERGRHGSLDASQLTAVNWLNQARKLFPNSTFERMQSQAIERYQISSFLK
FT                   DPNTLKAMEPTKALAKTLLSLRGRMSEETRDAVKTIIRKVVEDILRQIRNNFRQSLTGR
FT                   RNRFRRSLVPNSRNFDWRATIAANLKHYDTQNRRLLIETPYFNSRMQQHFPWDVILCVD
FT                   QSASMSSSIMYAAVCASILASLPAVNVSLIVFDTQVVDLSHLADDPVEVLMTVQLGGGT
FT                   DIASAMQYCESLVNNPKRTVISLISDFEEGGSLTRLLDCTQRLNSQQVKLLGLAALDDE
FT                   AQPVYDSTIAQKLADRGMQVAALTPEHFAQWLAEVMQ"
FT   misc_feature    complement(597218..598057)
FT                   /note="HMMPfam hit to PF05762, VWA domain containing
FT                   CoxE-like protein, score 5.1e-57"
FT   CDS_pept        complement(598356..600938)
FT                   /transl_table=11
FT                   /locus_tag="PMI0559"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41348"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESP9"
FT                   /protein_id="CAR41348.1"
FT                   /translation="MTLPSISLPTRIDQARLKWTSLQQQHLYFAPVRHHSPACAYAVLS
FT                   LIDSVKPDYILIEGPDTFNSLIPSLTDKDTLPPIAIMGQAEYCHHDSGLEEREKSLHSA
FT                   YFPFCEYSPEWQALRGGLRINATTRFIDLPWAAQVNNEEYSDLQSRSLQKERYLAHSQF
FT                   IAQLAKQCHCRDHDDVWEHLFELRSIEALADWQTLFNDIFIWCALARLDYEPEVLASEG
FT                   SSQREAHMLTHIKTIKQYEPNAKILIVTGGAHTLALIEGLASSQPNSFAISSSEQKHFT
FT                   KMQKMGEKEQAWLIRYSFDRLDALNGYASGMPSPAFYQQAWQSLMQQHHDKLENNEAAK
FT                   QPTQVYRNKMGIAFLSSVAQTIREQQFDNPPSYLTVKLAAEQSLRLALLREHTGMGRYD
FT                   LLDGLQSAFIKGSLDDSQNELWDEIKTCFSGYLLGQIPLGTATPPLVNETYERAKAFRF
FT                   KLDDTLAKTTKCDVYRNPQHRLRSRFLHLLAFLEIHFAHRVNGPDFLSGHQLDLLFEEW
FT                   QYAWTPNVEGELISLSEKGSQLETIALNKLLAMEKQLAEQGQSRSSQSAVTLLIQAALI
FT                   GLHQRIPTLFKLLDSYIQQDFRLESLTQCGHKLIHLWRGRQYLDITDELTLENRLHQVI
FT                   PQAFFCLEQLAQGDEQQQESNLQALLSLRELIEFMPSLDHQYDYKSDFYQQLNRLDGQL
FT                   DTVPLLKGAVDALRYLGSYIDEKTLAAVLNATFSTGSAPEHAIGYFVGIMRTAPELVIR
FT                   LPLLVNHLNSLLQQWDEERFIQILPDLRFAFSQLNPKQNAELAQYIANDIGLDTQALSL
FT                   WQSEFSAKQMLEATKLNQKLQQRIKTQGMISWFEAKKTEKGDHTHGEA"
FT   CDS_pept        complement(601039..602148)
FT                   /transl_table=11
FT                   /locus_tag="PMI0560"
FT                   /product="putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41349"
FT                   /db_xref="GOA:B4ESQ0"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESQ0"
FT                   /protein_id="CAR41349.1"
FT                   /translation="MAKKTPKEQQAIRESAEVRFAEELERLTKADANNPKPQGWLRSPR
FT                   AVRQFILGDDTLGITPKFFGDDALVDRAIVTLLGKQGLMLVGEPGTAKSMLSELFAAAI
FT                   SGDSGLTIQGTAGTTEDHIKYSWNYALLLAEGPTERALVGSPIYQGMLQGKIVRFEEIT
FT                   RCPPEIQDVLVSLMSEKQLMIPEMGDGARISAKPGFNLIGTANLRDRGVHEMSAALKRR
FT                   FNFETVKPIRDPAFEISLIQSQLENELGALATEITIPMDVVELLVTTFQELRSGNTQDG
FT                   GNIKTPDAVMSTAEAVNIAYACALEAHYLGDGVMNAGAIARQLIGVVLKDNPDDIKRIR
FT                   YYMDNVARERARNSKEWKAFFDASKDFWQ"
FT   misc_feature    complement(601156..601905)
FT                   /note="HMMPfam hit to PF07728, ATPase family associated
FT                   with various cellul, score 1.1e-64"
FT   CDS_pept        complement(602174..605902)
FT                   /transl_table=11
FT                   /locus_tag="PMI0561"
FT                   /product="hypothetical protein"
FT                   /note="No similarity over the entire length of the CDS. The
FT                   listed similarity to Escherichia coli molybdate metabolism
FT                   regulator MolR is limited to the C-terminal region."
FT                   /db_xref="EnsemblGenomes-Gn:PMI0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41351"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESQ1"
FT                   /protein_id="CAR41351.1"
FT                   /translation="MIKKILDILPIFGKKDVDITEQYLQGSLVLLAIFDKSLPKRALDY
FT                   VLTGTNPEILFELNKLDAAKAAVYFHRAGTLEWWYASNVDTGKYGKVITQGLNARHKLY
FT                   SKVGESFSLEQVARFAKVIAAACQDINIKVTTTQVPTWVIYLLVDAFYTTYDNARNLNL
FT                   EHRKHWSMEFIANMVEAEANIGGENALFAIFDRKDVSEYYAANLKRIYELCDLKDYLLS
FT                   HQEFVRKELVEKLSANGLVELINYLNKNTILRDTFADIIVLLATSSLRTVKKTAEPILN
FT                   TLPAEIVKENLTHVLMNGTPKQRTQAADLFARQGENRDVLAEALKHETSKAVIKSIESA
FT                   LQRFCVADNANTVEAIKAPDFTPLEDTPLPDSARDILVNNFNEMLVKAKENAEREIEEN
FT                   KTSKHSYNWAQRHYKDLSKIDEKQCRALVDKLNSGQGTIQVNEIQIIKHKNRIPNLPEY
FT                   TFFHAVRVITNNRQHADHFSSHYFNSDIPERLLSDIELRHVENVLERCHFKRATRITAA
FT                   LCLESYQDGLRRFRKPEQVWPFFSQHTDYIAEALNLMPNQSEHRYRQFETSQGIEVLSR
FT                   FPTIPAQFVPRIMELALGENKTHRVSAQKLLETLPNIHLSAQEGLTSSKQEIRVTAIEW
FT                   LARLNNPDSLPALNALLKKEKREVVRAALLTALEQLGEDISSYLSPKTLLAEAEKGLKA
FT                   KPPASLAWFNFEAIPALTWENKKAVDPAIIRWWIILAVKLKMPGGNALLQRYISLLCVD
FT                   SQHKLSSFILHTFVAQDIKGPTLEEAMAEAQQNAPSRLTQYKDWAKRYPEYYAKYETYT
FT                   LEQVVEEIKNEVLRRYLGSAISDKGMLALICGIEGHIAVSVLRNYMRDHYQRRAQIEAM
FT                   IDAVASSNDPIIIQLLLSLSRRYRTASVQEKARNLVTQIAERNGWSADELADRTIPTAG
FT                   FDDSGTLVLEYGERTFTAKMDAKQKIVLFNPEGKEVKSLPAARKNDDPELIKEAKKLFT
FT                   SSKKELKQVIELQSVRLYEAMCAQRQWLSADWQEYILAHPIMHKLIEQLVWQEVKEGEV
FT                   INTFRPSDDGALLNLEDDEVTLQNDSLIQLAHAALVNEDERKAWIAHFKDYKVKFLFSQ
FT                   MEHKIPDLDLTQTEVEDRKGWITDTFTLRGILTKMGYQRGPAEDGGSFSHYYKFFSSLN
FT                   YYVNIGFSGSYVPEENIPAVLFDLSFEKDQQNYWDRNNIELKQVPPILLAESYADYLKV
FT                   AEACAGFDPEWEKKTPW"
FT   CDS_pept        complement(606290..607420)
FT                   /transl_table=11
FT                   /locus_tag="PMI0562"
FT                   /product="MFS-family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41354"
FT                   /db_xref="GOA:B4ESQ2"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESQ2"
FT                   /protein_id="CAR41354.1"
FT                   /translation="MNRKLSLWLAIALMMFPQIAETIYSPALTDISNGFRVSANEAGQT
FT                   LSLYFFAFALGVIIWGRLCDVIGRRPTMLAGLFIYAIACIGVFMTDNFSVLLILRMLSA
FT                   FGAAVGSVGTQTIMRDVYSGEELAKVFSVMGAAIALSPAIGMLSGSLLVSYAGYQGVFS
FT                   GLALLAVVLLLWSTIALPESRPATIKTAPLAETAIKMLKDKQIAKTILLIAFFNISLFA
FT                   YYQLAPFMFDNQGYSASTFGYSGIVLAIGVGIGSYINKALLSHHWQCEKLVLLASIIAV
FT                   ISAVGVYLLRNHISFIIPMMTSVVAYGIAIPNILATALAQYKDRLGTAGALLGLFYYLL
FT                   IGGGLALAGWGQSLAITLLICSIGALLLSFSRQTAK"
FT   misc_feature    complement(join(606308..606361,606371..606439,
FT                   606473..606541,606551..606607,606632..606700,
FT                   606728..606796,606884..606952,606965..607033,
FT                   607070..607138,607151..607210,607229..607297,
FT                   607340..607408))
FT                   /note="12 probable transmembrane helices predicted for
FT                   PMI0562 by TMHMM2.0 at aa 5-27, 42-64, 71-90, 95-117,
FT                   130-152, 157-179, 209-231, 241-263, 272-290, 294-316,
FT                   328-350 and 354-371"
FT   misc_feature    complement(606362..607402)
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 3.1e-48"
FT   misc_feature    complement(607361..607420)
FT                   /note="Signal peptide predicted for PMI0562 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.985 between residues 20 and 21"
FT   CDS_pept        607523..608284
FT                   /transl_table=11
FT                   /locus_tag="PMI0563"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41356"
FT                   /db_xref="GOA:B4ESQ3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESQ3"
FT                   /protein_id="CAR41356.1"
FT                   /translation="MAWLNQYDHFVPEEHLASVVGIAAEMGKHDSGFHSHDRGQLLFTQ
FT                   SGCMRITLASRVSVLPPMRIAWIPPKLEHRVEMYAAVGYRSVYIADKFHHRFPTESEIL
FT                   TISPLLREILERIAIADFDTQWEVGRYANLLAVFLDEIQQAKRQPNHLSMPSDRRLRKL
FT                   SFDELPPPLQELAQYIGASEKTITRLFYKETGLSYQQWRQQWRLMKAIELLATHHRYLE
FT                   ISQLLGFASDSAFITFFKKMTGQTPQEYLRN"
FT   misc_feature    608000..608131
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 0.22"
FT   misc_feature    608030..608095
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1422.000, SD 4.03 at aa 171-192, sequence
FT                   PPLQELAQYIGASEKTITRLFY"
FT   misc_feature    608147..608278
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 2.1e-05"
FT   CDS_pept        complement(608354..609637)
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="PMI0564"
FT                   /product="citrate synthase GltA"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41359"
FT                   /db_xref="GOA:B4ESQ4"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESQ4"
FT                   /protein_id="CAR41359.1"
FT                   /translation="MADNKAKLTIGETSVDLDVLSPTLGSKVIDIRTLGSKGYYTYDPG
FT                   FTSTASCESKITYIDGNNGILLHRGFPIGQLATESTYLEVCYILLYGEAPTQEQYDKFK
FT                   TTVTRHTMIHEQITRLFHGFRRDSHPMAVLCGVTGALAAFYHDALDVSNPVHRDITAYR
FT                   LLSKMPTVAAMCYKYSIGQPFVYPRNDLSYAGNFLHMMFATPCEEYVVNPVLERAMDRI
FT                   FILHADHEQNASTSTVRTAGSSGANPFACIAAGIASLWGPAHGGANEACLRMLEEIKTV
FT                   EHIPEFIKRAKDKNDSFRLMGFGHRVYKNYDPRATVMRETCHEVLKELNLNDSLLEVAM
FT                   ELERIALNDPYFIEKKLYPNVDFYSGIILKALGIPSNMFTVIFAIARTIGWIAHWNEMH
FT                   EDGLKIARPRQLYTGYNERKFHSELKNK"
FT   misc_feature    complement(608414..609505)
FT                   /note="HMMPfam hit to PF00285, Citrate synthase, score
FT                   1.7e-232"
FT   misc_feature    complement(608696..608734)
FT                   /note="PS00480 Citrate synthase signature."
FT   CDS_pept        610272..610649
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="PMI0565"
FT                   /product="succinate dehydrogenase cytochrome b-556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41360"
FT                   /db_xref="GOA:B4ESQ5"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESQ5"
FT                   /protein_id="CAR41360.1"
FT                   /translation="MKKQRPVNLDLQTIQFPLPAIASILHRVSGVIMLVAVGILLWLLG
FT                   TSLSSPEGFQQAADIMTGFFAKFILWGILTALAYHICGGIRHMLMDFGFIDETLVVGRR
FT                   SAAISMIITVILSILAGVLVW"
FT   misc_feature    610272..610625
FT                   /note="HMMPfam hit to PF01127, Succinate dehydrogenase
FT                   cytochrome b subunit, score 3.5e-35"
FT   misc_feature    610284..610358
FT                   /note="PS01000 Succinate dehydrogenase cytochrome b subunit
FT                   signature 1."
FT   misc_feature    join(610338..610406,610449..610517,610575..610643)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PMI0565 by TMHMM2.0 at aa 23-45, 60-82 and 102-124"
FT   misc_feature    610509..610550
FT                   /note="PS01001 Succinate dehydrogenase cytochrome b subunit
FT                   signature 2."
FT   CDS_pept        610643..610987
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="PMI0566"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor protein"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41361"
FT                   /db_xref="GOA:B4ESQ6"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESQ6"
FT                   /protein_id="CAR41361.1"
FT                   /translation="MVSNSSTLGRTGIQDWLFLRATAIIIFLYVLYFVGFVATTDITYE
FT                   VWRGFFSSSLTKVFTLLTLLSILIHAWIGMWQVLTDYIKPIALRLTLQLIIVIALLVYL
FT                   IYGTIVVWGV"
FT   misc_feature    join(610685..610753,610814..610882,610910..610978)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PMI0566 by TMHMM2.0 at aa 15-37, 58-80 and 90-112"
FT   CDS_pept        610987..612753
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="PMI0567"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41363"
FT                   /db_xref="GOA:B4ESQ7"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESQ7"
FT                   /protein_id="CAR41363.1"
FT                   /translation="MNLPVREFDAVVIGAGGAGMRAALQISQMGLSCALISKVFPTRSH
FT                   TVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGL
FT                   PFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSE
FT                   WYSLDLVKNQDGDVVGCTAICIETGEVVYFKANATILATGGAGRIYQSTTNAHINTGDG
FT                   VGMAVRAGVPLQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAK
FT                   DLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKEVLESRLPGILDLSRTFAHV
FT                   DPVKEPIPVIPTCHYMMGGIPTKVTGQAIRMNEKGEDEVIPGLFAVGEIACVSVHGANR
FT                   LGGNSLLDLVVFGRSAGVHLKESLMEQGTMRDASDSDVEAALTRLHRWENNRSGEDPVE
FT                   IRKALQSCMQHNFSVFREGDAMAKGLEELKVIRERLQNARLDDNSSEFNTQRIECLELD
FT                   NLMETAYATAVSANFRTESRGAHSRFDFPDRDDENWLCHTLYQPQTETMTRRKVNMQPK
FT                   LREAFPPKVRTY"
FT   misc_feature    611053..611085
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    611113..611142
FT                   /note="PS00504 Fumarate reductase / succinate dehydrogenase
FT                   FAD-binding site."
FT   misc_feature    611308..612306
FT                   /note="HMMPfam hit to PF00890, FAD binding domain, score
FT                   1.3e-216"
FT   misc_feature    612364..612750
FT                   /note="HMMPfam hit to PF02910, Fumarate reductase/succinate
FT                   dehydroge, score 1.5e-67"
FT   CDS_pept        612788..613504
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="PMI0568"
FT                   /product="succinate dehydrogenase iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41365"
FT                   /db_xref="GOA:B4ESQ8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESQ8"
FT                   /protein_id="CAR41365.1"
FT                   /translation="MKLEFSIYRYNPDVDNAPRMQDYTLEVPEGRDMMLLDALIQLKEK
FT                   DPTLSFRRSCREGVCGSDGVNMNGKNGLACITPISSLQKGSKKIVIRPLPGLPVIRDLI
FT                   VDMTQFYTQYEKIRPYVINDDKNPPARENLQSPEQREKLDGLYECILCACCSTSCPSFW
FT                   WNPDKFIGPAGLLAAYRFLIDSRDTETESRLDDLSDAFSVFRCHGIMNCVSVCPKGLNP
FT                   TKAIGHIKSMLLKHSA"
FT   misc_feature    612839..613030
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding domain, score 0.022"
FT   misc_feature    613232..613267
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT   CDS_pept        613789..616593
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="PMI0569"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41366"
FT                   /db_xref="GOA:B4ESQ9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESQ9"
FT                   /protein_id="CAR41366.1"
FT                   /translation="MQNGAMKDWLDSTFLAGENQSYIEEIYEDYLTDPNSVDESWREIF
FT                   QQLPVSQGAEQSHSQTRDYFRRLAKESTRYHTSVSDPAMDSKQVKVLQLINAFRFRGHQ
FT                   NANLDPLGLWKRESVPDLDPAFHNLTKEDFEETFNVGSFAIGKETMKLGDIYEALKRIY
FT                   CGSIGAEYMHITNTEEKRWIQQRLESVNVADQFTKEEKIRFLAELTAAEGLERYLGAKF
FT                   PGAKRFSLEGGDALIPMLKDLIRHAGKQDTREVVLGMAHRGRLNVLVNILGKKPADLFD
FT                   EFAGIHKEHLGTGDVKYHQGFSSDFATEGAQVHLALAFNPSHLEIVSPVVIGSVRARRD
FT                   RLDEARSNMVLPITIHGDAAVTGQGVVQETLNMSQARGYEVGGTVRIVINNQVGFTTSN
FT                   PKDARSTEYCTDIVKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVMIDLVCYRR
FT                   HGHNEADEPNATQPLMYQKIKKHPTPRKIYADKLVEQGLIEANDVTELVNLYRDALDRG
FT                   DCVVEEYRPMGLHSYTWEPYLNHEWNEEYPHKVEKSRLQDLARRVSTVPSEIAMQSRVE
FT                   KIYADRAVMAEGEKLLDWGAAETLAYATLVDQGITIRLSGEDAGRGTFFHRHAVIHNQT
FT                   NGSVYVPLANIHNAQGQFNVWDSVLTEEAVLAFEYGYATTEPRGLTIWEAQFGDFANVA
FT                   QVVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQVCVPS
FT                   TPAQVYHMLRRQALRGMRRPLIVMSPKSLLRHPLAVSSLDELADGKFLPVIGELDELNP
FT                   ADVKRVVMCSGKVYYDLLEQRRANGQTDVAIIRIEQLYPFPHDDMAQILAPYAHVKDFI
FT                   WCQEEPLNQGAWYCSQHNFRDAIPTGATLRYAGRPASASPAVGYTSVHQEQQKALVEDA
FT                   LKVE"
FT   misc_feature    614404..615378
FT                   /note="HMMPfam hit to PF00676, Dehydrogenase E1 component,
FT                   score 1.3e-26"
FT   misc_feature    615562..616146
FT                   /note="HMMPfam hit to PF02779, Transketolase, pyridine
FT                   binding domain, score 3.7e-70"
FT   CDS_pept        616607..617815
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="PMI0570"
FT                   /product="dihydrolipoamide succinyltransferase component of
FT                   2-oxoglutarate dehydrogenase complex"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41368"
FT                   /db_xref="GOA:B4ESR0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:B4ESR0"
FT                   /protein_id="CAR41368.1"
FT                   /translation="MSSVDILVPDLPESVADATVATWHKKPGDSIQRDEVLVEIETDKV
FT                   VLEVPASEAGVLDSILEEEGATVGSRQLLGRIRLGDSTGIPADVKPAQDTTPAQRQSAD
FT                   IVAKESNDALSPTARRLVAEHDINPADVKGSGVGGRLTRQDIESHVANNKSAAAATAEV
FT                   SQAPLSHRSEKRVPMTRLRKRVAERLLEAKNTTAMLTTFNEINMQPIKNLRAQYGEAFE
FT                   KRHGVRLGFMSFYIKAVVEALKRYPEVNASIDGTDVVYHNYFDISIAVSTPRGLVTPVL
FT                   RDADAMSMADIEKNIKALAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQS
FT                   AILGMHAIKDRPMAVDGQVVILPMMYLALSYDHRLIDGRESVGFLVTVKEMLEDPARLL
FT                   LDV"
FT   misc_feature    616616..616837
FT                   /note="HMMPfam hit to PF00364, Biotin-requiring enzyme,
FT                   score 3.8e-24"
FT   misc_feature    616688..616777
FT                   /note="PS00189 2-oxo acid dehydrogenases acyltransferase
FT                   component lipoyl binding site."
FT   misc_feature    616946..617056
FT                   /note="HMMPfam hit to PF02817, e3 binding domain, score
FT                   1.9e-14"
FT   misc_feature    617114..617806
FT                   /note="HMMPfam hit to PF00198, 2-oxoacid dehydrogenases
FT                   acyltransferas, score 7.9e-141"
FT   CDS_pept        617977..619143
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="PMI0571"
FT                   /product="succinyl-CoA synthetase beta chain"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:PMI0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41369"
FT                   /db_xref="GOA:B4ESR1"
FT                   /db_xre