(data stored in ACNUC7421 zone)

EMBL: AM946016

ID   AM946016; SV 1; circular; genomic DNA; STD; PRO; 2007491 BP.
XX
AC   AM946016;
XX
PR   Project:PRJNA352;
XX
DT   07-JUL-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Streptococcus suis P1/7 complete genome
XX
KW   complete genome.
XX
OS   Streptococcus suis P1/7
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-2007491
RA   Holden M.T.G.;
RT   ;
RL   Submitted (10-MAR-2008) to the INSDC.
RL   Holden M.T.G., Pathogen Genomics, Sanger Institute Wellcome Trust, Wellcome
RL   Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1371/journal.pone.0006072.
RX   PUBMED; 19603075.
RA   Holden M.T.G., Hauser H., Sanders M., Ngo T.H., Cherevach I., Cronin A.,
RA   Goodhead I., Mungall K., Quail M.A., Price C., Rabbinowitsch E., Sharp S.,
RA   Croucher N.J., Chieu T.B., Mai N.T.H., Diep T.S., Chinh N.T., Kehoe M.,
RA   Leigh J.A., Ward P.N., Dowson C.G., Whatmore A.M., Chanter N., Iversen P.,
RA   Gottschalk M., Slater J.D., Smith H.E., Spratt B.G., Xu J., Ye C.,
RA   Bentley S.D., Barrell B.G., Schultsz C., Maskell D.J., Parkhill J.;
RT   "Rapid evolution of virulence and drug resistance in the emerging zoonotic
RT   pathogen Streptococcus suis";
RL   PLoS One 4(7):e6072-e6072(2009).
XX
DR   MD5; c52b2f0394e12013e2573e9a38f51031.
DR   BioSample; SAMEA3138299.
DR   EnsemblGenomes-Gn; EBG00000299167.
DR   EnsemblGenomes-Gn; EBG00000299168.
DR   EnsemblGenomes-Gn; EBG00000299169.
DR   EnsemblGenomes-Gn; EBG00000299170.
DR   EnsemblGenomes-Gn; EBG00000299171.
DR   EnsemblGenomes-Gn; EBG00000299172.
DR   EnsemblGenomes-Gn; EBG00000299173.
DR   EnsemblGenomes-Gn; EBG00000299174.
DR   EnsemblGenomes-Gn; EBG00000299175.
DR   EnsemblGenomes-Gn; EBG00000299176.
DR   EnsemblGenomes-Gn; EBG00000299177.
DR   EnsemblGenomes-Gn; EBG00000299178.
DR   EnsemblGenomes-Gn; EBG00000299179.
DR   EnsemblGenomes-Gn; EBG00000299180.
DR   EnsemblGenomes-Gn; EBG00000299181.
DR   EnsemblGenomes-Gn; EBG00000299182.
DR   EnsemblGenomes-Gn; EBG00000299183.
DR   EnsemblGenomes-Gn; EBG00000299184.
DR   EnsemblGenomes-Gn; EBG00000299185.
DR   EnsemblGenomes-Gn; EBG00000299186.
DR   EnsemblGenomes-Gn; EBG00000299187.
DR   EnsemblGenomes-Gn; EBG00000299188.
DR   EnsemblGenomes-Gn; EBG00000299189.
DR   EnsemblGenomes-Gn; EBG00000299190.
DR   EnsemblGenomes-Gn; EBG00000299191.
DR   EnsemblGenomes-Gn; EBG00000299192.
DR   EnsemblGenomes-Gn; EBG00000299193.
DR   EnsemblGenomes-Gn; EBG00000299194.
DR   EnsemblGenomes-Gn; EBG00000299195.
DR   EnsemblGenomes-Gn; EBG00000299196.
DR   EnsemblGenomes-Gn; EBG00000299197.
DR   EnsemblGenomes-Gn; EBG00000299198.
DR   EnsemblGenomes-Gn; EBG00000299199.
DR   EnsemblGenomes-Gn; EBG00000299200.
DR   EnsemblGenomes-Gn; EBG00000299201.
DR   EnsemblGenomes-Gn; EBG00000299202.
DR   EnsemblGenomes-Gn; EBG00000299203.
DR   EnsemblGenomes-Gn; EBG00000299204.
DR   EnsemblGenomes-Gn; EBG00000299205.
DR   EnsemblGenomes-Gn; EBG00000299206.
DR   EnsemblGenomes-Gn; EBG00000299207.
DR   EnsemblGenomes-Gn; EBG00000299208.
DR   EnsemblGenomes-Gn; EBG00000299209.
DR   EnsemblGenomes-Gn; EBG00000299210.
DR   EnsemblGenomes-Gn; EBG00000299211.
DR   EnsemblGenomes-Gn; EBG00000299212.
DR   EnsemblGenomes-Gn; EBG00000299213.
DR   EnsemblGenomes-Gn; EBG00000299214.
DR   EnsemblGenomes-Gn; EBG00000299215.
DR   EnsemblGenomes-Gn; EBG00000299216.
DR   EnsemblGenomes-Gn; EBG00000299217.
DR   EnsemblGenomes-Gn; EBG00000299218.
DR   EnsemblGenomes-Gn; EBG00000299219.
DR   EnsemblGenomes-Gn; EBG00000299220.
DR   EnsemblGenomes-Gn; EBG00000299221.
DR   EnsemblGenomes-Gn; EBG00000299222.
DR   EnsemblGenomes-Gn; EBG00000299223.
DR   EnsemblGenomes-Gn; EBG00000299224.
DR   EnsemblGenomes-Gn; EBG00000299225.
DR   EnsemblGenomes-Gn; EBG00000299226.
DR   EnsemblGenomes-Gn; EBG00000299227.
DR   EnsemblGenomes-Gn; EBG00000299228.
DR   EnsemblGenomes-Gn; EBG00000299229.
DR   EnsemblGenomes-Gn; EBG00000299230.
DR   EnsemblGenomes-Gn; EBG00000299231.
DR   EnsemblGenomes-Gn; EBG00000299232.
DR   EnsemblGenomes-Gn; EBG00000299233.
DR   EnsemblGenomes-Gn; EBG00000299234.
DR   EnsemblGenomes-Gn; EBG00001195176.
DR   EnsemblGenomes-Gn; EBG00001195177.
DR   EnsemblGenomes-Gn; EBG00001195178.
DR   EnsemblGenomes-Gn; EBG00001195179.
DR   EnsemblGenomes-Gn; EBG00001195180.
DR   EnsemblGenomes-Gn; EBG00001195181.
DR   EnsemblGenomes-Gn; EBG00001195182.
DR   EnsemblGenomes-Gn; EBG00001195183.
DR   EnsemblGenomes-Gn; EBG00001195184.
DR   EnsemblGenomes-Gn; EBG00001195185.
DR   EnsemblGenomes-Gn; EBG00001195186.
DR   EnsemblGenomes-Gn; EBG00001195187.
DR   EnsemblGenomes-Gn; EBG00001195188.
DR   EnsemblGenomes-Gn; EBG00001195189.
DR   EnsemblGenomes-Gn; EBG00001195190.
DR   EnsemblGenomes-Gn; EBG00001195191.
DR   EnsemblGenomes-Gn; EBG00001195192.
DR   EnsemblGenomes-Gn; EBG00001195193.
DR   EnsemblGenomes-Gn; EBG00001195194.
DR   EnsemblGenomes-Gn; EBG00001195195.
DR   EnsemblGenomes-Gn; EBG00001195196.
DR   EnsemblGenomes-Gn; EBG00001195197.
DR   EnsemblGenomes-Gn; EBG00001195198.
DR   EnsemblGenomes-Gn; EBG00001195199.
DR   EnsemblGenomes-Gn; EBG00001195200.
DR   EnsemblGenomes-Gn; EBG00001195201.
DR   EnsemblGenomes-Gn; EBG00001195202.
DR   EnsemblGenomes-Gn; EBG00001195203.
DR   EnsemblGenomes-Gn; EBG00001195204.
DR   EnsemblGenomes-Gn; EBG00001195205.
DR   EnsemblGenomes-Gn; EBG00001195206.
DR   EnsemblGenomes-Gn; EBG00001195207.
DR   EnsemblGenomes-Gn; EBG00001195208.
DR   EnsemblGenomes-Gn; EBG00001195209.
DR   EnsemblGenomes-Gn; EBG00001195210.
DR   EnsemblGenomes-Gn; EBG00001195211.
DR   EnsemblGenomes-Gn; EBG00001195212.
DR   EnsemblGenomes-Gn; EBG00001195213.
DR   EnsemblGenomes-Gn; EBG00001195214.
DR   EnsemblGenomes-Gn; EBG00001195215.
DR   EnsemblGenomes-Gn; EBG00001195216.
DR   EnsemblGenomes-Gn; EBG00001195217.
DR   EnsemblGenomes-Gn; EBG00001195218.
DR   EnsemblGenomes-Gn; EBG00001195219.
DR   EnsemblGenomes-Gn; EBG00001195220.
DR   EnsemblGenomes-Gn; EBG00001195221.
DR   EnsemblGenomes-Gn; EBG00001195222.
DR   EnsemblGenomes-Gn; EBG00001195223.
DR   EnsemblGenomes-Gn; EBG00001195224.
DR   EnsemblGenomes-Gn; EBG00001195225.
DR   EnsemblGenomes-Gn; EBG00001195226.
DR   EnsemblGenomes-Gn; EBG00001195227.
DR   EnsemblGenomes-Gn; EBG00001195228.
DR   EnsemblGenomes-Gn; EBG00001195229.
DR   EnsemblGenomes-Gn; EBG00001195230.
DR   EnsemblGenomes-Gn; EBG00001195231.
DR   EnsemblGenomes-Gn; EBG00001195232.
DR   EnsemblGenomes-Gn; EBG00001195233.
DR   EnsemblGenomes-Gn; EBG00001195234.
DR   EnsemblGenomes-Gn; EBG00001195235.
DR   EnsemblGenomes-Gn; EBG00001195236.
DR   EnsemblGenomes-Gn; EBG00001195237.
DR   EnsemblGenomes-Gn; EBG00001195238.
DR   EnsemblGenomes-Gn; EBG00001195239.
DR   EnsemblGenomes-Gn; EBG00001195240.
DR   EnsemblGenomes-Gn; EBG00001195241.
DR   EnsemblGenomes-Gn; EBG00001195242.
DR   EnsemblGenomes-Gn; EBG00001195243.
DR   EnsemblGenomes-Gn; EBG00001195244.
DR   EnsemblGenomes-Gn; EBG00001195245.
DR   EnsemblGenomes-Gn; EBG00001195246.
DR   EnsemblGenomes-Gn; EBG00001195247.
DR   EnsemblGenomes-Gn; EBG00001195248.
DR   EnsemblGenomes-Gn; EBG00001195249.
DR   EnsemblGenomes-Gn; EBG00001195250.
DR   EnsemblGenomes-Gn; EBG00001195251.
DR   EnsemblGenomes-Gn; EBG00001195252.
DR   EnsemblGenomes-Gn; EBG00001195253.
DR   EnsemblGenomes-Gn; EBG00001195254.
DR   EnsemblGenomes-Gn; EBG00001195255.
DR   EnsemblGenomes-Gn; EBG00001195256.
DR   EnsemblGenomes-Gn; EBG00001195257.
DR   EnsemblGenomes-Gn; SSU0068.
DR   EnsemblGenomes-Gn; SSU0087.
DR   EnsemblGenomes-Gn; SSU0111.
DR   EnsemblGenomes-Gn; SSU0121A.
DR   EnsemblGenomes-Gn; SSU0121B.
DR   EnsemblGenomes-Gn; SSU0125.
DR   EnsemblGenomes-Gn; SSU0171.
DR   EnsemblGenomes-Gn; SSU0189.
DR   EnsemblGenomes-Gn; SSU0207.
DR   EnsemblGenomes-Gn; SSU0207A.
DR   EnsemblGenomes-Gn; SSU0254.
DR   EnsemblGenomes-Gn; SSU0254A.
DR   EnsemblGenomes-Gn; SSU0256.
DR   EnsemblGenomes-Gn; SSU0316.
DR   EnsemblGenomes-Gn; SSU0321.
DR   EnsemblGenomes-Gn; SSU0339.
DR   EnsemblGenomes-Gn; SSU0341.
DR   EnsemblGenomes-Gn; SSU0365.
DR   EnsemblGenomes-Gn; SSU0414.
DR   EnsemblGenomes-Gn; SSU0425.
DR   EnsemblGenomes-Gn; SSU0429.
DR   EnsemblGenomes-Gn; SSU0452.
DR   EnsemblGenomes-Gn; SSU0454.
DR   EnsemblGenomes-Gn; SSU0503A.
DR   EnsemblGenomes-Gn; SSU0505A.
DR   EnsemblGenomes-Gn; SSU0505B.
DR   EnsemblGenomes-Gn; SSU0530.
DR   EnsemblGenomes-Gn; SSU0539.
DR   EnsemblGenomes-Gn; SSU0543.
DR   EnsemblGenomes-Gn; SSU0545.
DR   EnsemblGenomes-Gn; SSU0549.
DR   EnsemblGenomes-Gn; SSU0550.
DR   EnsemblGenomes-Gn; SSU0551.
DR   EnsemblGenomes-Gn; SSU0552.
DR   EnsemblGenomes-Gn; SSU0554.
DR   EnsemblGenomes-Gn; SSU0562.
DR   EnsemblGenomes-Gn; SSU0612.
DR   EnsemblGenomes-Gn; SSU0630.
DR   EnsemblGenomes-Gn; SSU0640.
DR   EnsemblGenomes-Gn; SSU0643.
DR   EnsemblGenomes-Gn; SSU0652.
DR   EnsemblGenomes-Gn; SSU0658.
DR   EnsemblGenomes-Gn; SSU0679.
DR   EnsemblGenomes-Gn; SSU0712.
DR   EnsemblGenomes-Gn; SSU0713.
DR   EnsemblGenomes-Gn; SSU0729A.
DR   EnsemblGenomes-Gn; SSU0756.
DR   EnsemblGenomes-Gn; SSU0761.
DR   EnsemblGenomes-Gn; SSU0822.
DR   EnsemblGenomes-Gn; SSU0823.
DR   EnsemblGenomes-Gn; SSU0871.
DR   EnsemblGenomes-Gn; SSU0880.
DR   EnsemblGenomes-Gn; SSU0896.
DR   EnsemblGenomes-Gn; SSU0904.
DR   EnsemblGenomes-Gn; SSU0928.
DR   EnsemblGenomes-Gn; SSU0961.
DR   EnsemblGenomes-Gn; SSU0963.
DR   EnsemblGenomes-Gn; SSU0965.
DR   EnsemblGenomes-Gn; SSU1050.
DR   EnsemblGenomes-Gn; SSU1126.
DR   EnsemblGenomes-Gn; SSU1152A.
DR   EnsemblGenomes-Gn; SSU1152B.
DR   EnsemblGenomes-Gn; SSU1249.
DR   EnsemblGenomes-Gn; SSU1250.
DR   EnsemblGenomes-Gn; SSU1264A.
DR   EnsemblGenomes-Gn; SSU1271.
DR   EnsemblGenomes-Gn; SSU1388.
DR   EnsemblGenomes-Gn; SSU1426.
DR   EnsemblGenomes-Gn; SSU1446.
DR   EnsemblGenomes-Gn; SSU1450.
DR   EnsemblGenomes-Gn; SSU1474.
DR   EnsemblGenomes-Gn; SSU1535.
DR   EnsemblGenomes-Gn; SSU1593.
DR   EnsemblGenomes-Gn; SSU1658.
DR   EnsemblGenomes-Gn; SSU1667.
DR   EnsemblGenomes-Gn; SSU1689.
DR   EnsemblGenomes-Gn; SSU1693.
DR   EnsemblGenomes-Gn; SSU1724.
DR   EnsemblGenomes-Gn; SSU1734.
DR   EnsemblGenomes-Gn; SSU1872A.
DR   EnsemblGenomes-Gn; SSU1873.
DR   EnsemblGenomes-Gn; SSU1886.
DR   EnsemblGenomes-Gn; SSU1889.
DR   EnsemblGenomes-Tr; EBG00000299167-1.
DR   EnsemblGenomes-Tr; EBG00000299168-1.
DR   EnsemblGenomes-Tr; EBG00000299169-1.
DR   EnsemblGenomes-Tr; EBG00000299170-1.
DR   EnsemblGenomes-Tr; EBG00000299171-1.
DR   EnsemblGenomes-Tr; EBG00000299172-1.
DR   EnsemblGenomes-Tr; EBG00000299173-1.
DR   EnsemblGenomes-Tr; EBG00000299174-1.
DR   EnsemblGenomes-Tr; EBG00000299175-1.
DR   EnsemblGenomes-Tr; EBG00000299176-1.
DR   EnsemblGenomes-Tr; EBG00000299177-1.
DR   EnsemblGenomes-Tr; EBG00000299178-1.
DR   EnsemblGenomes-Tr; EBG00000299179-1.
DR   EnsemblGenomes-Tr; EBG00000299180-1.
DR   EnsemblGenomes-Tr; EBG00000299181-1.
DR   EnsemblGenomes-Tr; EBG00000299182-1.
DR   EnsemblGenomes-Tr; EBG00000299183-1.
DR   EnsemblGenomes-Tr; EBG00000299184-1.
DR   EnsemblGenomes-Tr; EBG00000299185-1.
DR   EnsemblGenomes-Tr; EBG00000299186-1.
DR   EnsemblGenomes-Tr; EBG00000299187-1.
DR   EnsemblGenomes-Tr; EBG00000299188-1.
DR   EnsemblGenomes-Tr; EBG00000299189-1.
DR   EnsemblGenomes-Tr; EBG00000299190-1.
DR   EnsemblGenomes-Tr; EBG00000299191-1.
DR   EnsemblGenomes-Tr; EBG00000299192-1.
DR   EnsemblGenomes-Tr; EBG00000299193-1.
DR   EnsemblGenomes-Tr; EBG00000299194-1.
DR   EnsemblGenomes-Tr; EBG00000299195-1.
DR   EnsemblGenomes-Tr; EBG00000299196-1.
DR   EnsemblGenomes-Tr; EBG00000299197-1.
DR   EnsemblGenomes-Tr; EBG00000299198-1.
DR   EnsemblGenomes-Tr; EBG00000299199-1.
DR   EnsemblGenomes-Tr; EBG00000299200-1.
DR   EnsemblGenomes-Tr; EBG00000299201-1.
DR   EnsemblGenomes-Tr; EBG00000299202-1.
DR   EnsemblGenomes-Tr; EBG00000299203-1.
DR   EnsemblGenomes-Tr; EBG00000299204-1.
DR   EnsemblGenomes-Tr; EBG00000299205-1.
DR   EnsemblGenomes-Tr; EBG00000299206-1.
DR   EnsemblGenomes-Tr; EBG00000299207-1.
DR   EnsemblGenomes-Tr; EBG00000299208-1.
DR   EnsemblGenomes-Tr; EBG00000299209-1.
DR   EnsemblGenomes-Tr; EBG00000299210-1.
DR   EnsemblGenomes-Tr; EBG00000299211-1.
DR   EnsemblGenomes-Tr; EBG00000299212-1.
DR   EnsemblGenomes-Tr; EBG00000299213-1.
DR   EnsemblGenomes-Tr; EBG00000299214-1.
DR   EnsemblGenomes-Tr; EBG00000299215-1.
DR   EnsemblGenomes-Tr; EBG00000299216-1.
DR   EnsemblGenomes-Tr; EBG00000299217-1.
DR   EnsemblGenomes-Tr; EBG00000299218-1.
DR   EnsemblGenomes-Tr; EBG00000299219-1.
DR   EnsemblGenomes-Tr; EBG00000299220-1.
DR   EnsemblGenomes-Tr; EBG00000299221-1.
DR   EnsemblGenomes-Tr; EBG00000299222-1.
DR   EnsemblGenomes-Tr; EBG00000299223-1.
DR   EnsemblGenomes-Tr; EBG00000299224-1.
DR   EnsemblGenomes-Tr; EBG00000299225-1.
DR   EnsemblGenomes-Tr; EBG00000299226-1.
DR   EnsemblGenomes-Tr; EBG00000299227-1.
DR   EnsemblGenomes-Tr; EBG00000299228-1.
DR   EnsemblGenomes-Tr; EBG00000299229-1.
DR   EnsemblGenomes-Tr; EBG00000299230-1.
DR   EnsemblGenomes-Tr; EBG00000299231-1.
DR   EnsemblGenomes-Tr; EBG00000299232-1.
DR   EnsemblGenomes-Tr; EBG00000299233-1.
DR   EnsemblGenomes-Tr; EBG00000299234-1.
DR   EnsemblGenomes-Tr; EBT00001773390.
DR   EnsemblGenomes-Tr; EBT00001773391.
DR   EnsemblGenomes-Tr; EBT00001773392.
DR   EnsemblGenomes-Tr; EBT00001773393.
DR   EnsemblGenomes-Tr; EBT00001773394.
DR   EnsemblGenomes-Tr; EBT00001773395.
DR   EnsemblGenomes-Tr; EBT00001773396.
DR   EnsemblGenomes-Tr; EBT00001773397.
DR   EnsemblGenomes-Tr; EBT00001773398.
DR   EnsemblGenomes-Tr; EBT00001773399.
DR   EnsemblGenomes-Tr; EBT00001773400.
DR   EnsemblGenomes-Tr; EBT00001773401.
DR   EnsemblGenomes-Tr; EBT00001773402.
DR   EnsemblGenomes-Tr; EBT00001773403.
DR   EnsemblGenomes-Tr; EBT00001773404.
DR   EnsemblGenomes-Tr; EBT00001773405.
DR   EnsemblGenomes-Tr; EBT00001773406.
DR   EnsemblGenomes-Tr; EBT00001773407.
DR   EnsemblGenomes-Tr; EBT00001773408.
DR   EnsemblGenomes-Tr; EBT00001773409.
DR   EnsemblGenomes-Tr; EBT00001773410.
DR   EnsemblGenomes-Tr; EBT00001773411.
DR   EnsemblGenomes-Tr; EBT00001773412.
DR   EnsemblGenomes-Tr; EBT00001773413.
DR   EnsemblGenomes-Tr; EBT00001773414.
DR   EnsemblGenomes-Tr; EBT00001773415.
DR   EnsemblGenomes-Tr; EBT00001773416.
DR   EnsemblGenomes-Tr; EBT00001773417.
DR   EnsemblGenomes-Tr; EBT00001773418.
DR   EnsemblGenomes-Tr; EBT00001773419.
DR   EnsemblGenomes-Tr; EBT00001773420.
DR   EnsemblGenomes-Tr; EBT00001773421.
DR   EnsemblGenomes-Tr; EBT00001773422.
DR   EnsemblGenomes-Tr; EBT00001773423.
DR   EnsemblGenomes-Tr; EBT00001773424.
DR   EnsemblGenomes-Tr; EBT00001773425.
DR   EnsemblGenomes-Tr; EBT00001773426.
DR   EnsemblGenomes-Tr; EBT00001773427.
DR   EnsemblGenomes-Tr; EBT00001773428.
DR   EnsemblGenomes-Tr; EBT00001773429.
DR   EnsemblGenomes-Tr; EBT00001773430.
DR   EnsemblGenomes-Tr; EBT00001773431.
DR   EnsemblGenomes-Tr; EBT00001773432.
DR   EnsemblGenomes-Tr; EBT00001773433.
DR   EnsemblGenomes-Tr; EBT00001773434.
DR   EnsemblGenomes-Tr; EBT00001773435.
DR   EnsemblGenomes-Tr; EBT00001773436.
DR   EnsemblGenomes-Tr; EBT00001773437.
DR   EnsemblGenomes-Tr; EBT00001773438.
DR   EnsemblGenomes-Tr; EBT00001773439.
DR   EnsemblGenomes-Tr; EBT00001773440.
DR   EnsemblGenomes-Tr; EBT00001773441.
DR   EnsemblGenomes-Tr; EBT00001773442.
DR   EnsemblGenomes-Tr; EBT00001773443.
DR   EnsemblGenomes-Tr; EBT00001773444.
DR   EnsemblGenomes-Tr; EBT00001773445.
DR   EnsemblGenomes-Tr; EBT00001773446.
DR   EnsemblGenomes-Tr; EBT00001773447.
DR   EnsemblGenomes-Tr; EBT00001773448.
DR   EnsemblGenomes-Tr; EBT00001773449.
DR   EnsemblGenomes-Tr; EBT00001773450.
DR   EnsemblGenomes-Tr; EBT00001773451.
DR   EnsemblGenomes-Tr; EBT00001773452.
DR   EnsemblGenomes-Tr; EBT00001773453.
DR   EnsemblGenomes-Tr; EBT00001773454.
DR   EnsemblGenomes-Tr; EBT00001773455.
DR   EnsemblGenomes-Tr; EBT00001773456.
DR   EnsemblGenomes-Tr; EBT00001773457.
DR   EnsemblGenomes-Tr; EBT00001773458.
DR   EnsemblGenomes-Tr; EBT00001773459.
DR   EnsemblGenomes-Tr; EBT00001773460.
DR   EnsemblGenomes-Tr; EBT00001773461.
DR   EnsemblGenomes-Tr; EBT00001773462.
DR   EnsemblGenomes-Tr; EBT00001773463.
DR   EnsemblGenomes-Tr; EBT00001773464.
DR   EnsemblGenomes-Tr; EBT00001773465.
DR   EnsemblGenomes-Tr; EBT00001773466.
DR   EnsemblGenomes-Tr; EBT00001773467.
DR   EnsemblGenomes-Tr; EBT00001773468.
DR   EnsemblGenomes-Tr; EBT00001773469.
DR   EnsemblGenomes-Tr; EBT00001773470.
DR   EnsemblGenomes-Tr; EBT00001773471.
DR   EnsemblGenomes-Tr; SSU0068.
DR   EnsemblGenomes-Tr; SSU0087.
DR   EnsemblGenomes-Tr; SSU0111.
DR   EnsemblGenomes-Tr; SSU0121A.
DR   EnsemblGenomes-Tr; SSU0121B.
DR   EnsemblGenomes-Tr; SSU0125.
DR   EnsemblGenomes-Tr; SSU0171.
DR   EnsemblGenomes-Tr; SSU0189.
DR   EnsemblGenomes-Tr; SSU0207.
DR   EnsemblGenomes-Tr; SSU0207A.
DR   EnsemblGenomes-Tr; SSU0254.
DR   EnsemblGenomes-Tr; SSU0254A.
DR   EnsemblGenomes-Tr; SSU0256.
DR   EnsemblGenomes-Tr; SSU0316.
DR   EnsemblGenomes-Tr; SSU0321.
DR   EnsemblGenomes-Tr; SSU0339.
DR   EnsemblGenomes-Tr; SSU0341.
DR   EnsemblGenomes-Tr; SSU0365.
DR   EnsemblGenomes-Tr; SSU0414.
DR   EnsemblGenomes-Tr; SSU0425.
DR   EnsemblGenomes-Tr; SSU0429.
DR   EnsemblGenomes-Tr; SSU0452.
DR   EnsemblGenomes-Tr; SSU0454.
DR   EnsemblGenomes-Tr; SSU0503A.
DR   EnsemblGenomes-Tr; SSU0505A.
DR   EnsemblGenomes-Tr; SSU0505B.
DR   EnsemblGenomes-Tr; SSU0530.
DR   EnsemblGenomes-Tr; SSU0539.
DR   EnsemblGenomes-Tr; SSU0543.
DR   EnsemblGenomes-Tr; SSU0545.
DR   EnsemblGenomes-Tr; SSU0549.
DR   EnsemblGenomes-Tr; SSU0550.
DR   EnsemblGenomes-Tr; SSU0551.
DR   EnsemblGenomes-Tr; SSU0552.
DR   EnsemblGenomes-Tr; SSU0554.
DR   EnsemblGenomes-Tr; SSU0562.
DR   EnsemblGenomes-Tr; SSU0612.
DR   EnsemblGenomes-Tr; SSU0630.
DR   EnsemblGenomes-Tr; SSU0640.
DR   EnsemblGenomes-Tr; SSU0643.
DR   EnsemblGenomes-Tr; SSU0652.
DR   EnsemblGenomes-Tr; SSU0658.
DR   EnsemblGenomes-Tr; SSU0679.
DR   EnsemblGenomes-Tr; SSU0712.
DR   EnsemblGenomes-Tr; SSU0713.
DR   EnsemblGenomes-Tr; SSU0729A.
DR   EnsemblGenomes-Tr; SSU0756.
DR   EnsemblGenomes-Tr; SSU0761.
DR   EnsemblGenomes-Tr; SSU0822.
DR   EnsemblGenomes-Tr; SSU0823.
DR   EnsemblGenomes-Tr; SSU0871.
DR   EnsemblGenomes-Tr; SSU0880.
DR   EnsemblGenomes-Tr; SSU0896.
DR   EnsemblGenomes-Tr; SSU0904.
DR   EnsemblGenomes-Tr; SSU0928.
DR   EnsemblGenomes-Tr; SSU0961.
DR   EnsemblGenomes-Tr; SSU0963.
DR   EnsemblGenomes-Tr; SSU0965.
DR   EnsemblGenomes-Tr; SSU1050.
DR   EnsemblGenomes-Tr; SSU1126.
DR   EnsemblGenomes-Tr; SSU1152A.
DR   EnsemblGenomes-Tr; SSU1152B.
DR   EnsemblGenomes-Tr; SSU1249.
DR   EnsemblGenomes-Tr; SSU1250.
DR   EnsemblGenomes-Tr; SSU1264A.
DR   EnsemblGenomes-Tr; SSU1271.
DR   EnsemblGenomes-Tr; SSU1388.
DR   EnsemblGenomes-Tr; SSU1426.
DR   EnsemblGenomes-Tr; SSU1446.
DR   EnsemblGenomes-Tr; SSU1450.
DR   EnsemblGenomes-Tr; SSU1474.
DR   EnsemblGenomes-Tr; SSU1535.
DR   EnsemblGenomes-Tr; SSU1593.
DR   EnsemblGenomes-Tr; SSU1658.
DR   EnsemblGenomes-Tr; SSU1667.
DR   EnsemblGenomes-Tr; SSU1689.
DR   EnsemblGenomes-Tr; SSU1693.
DR   EnsemblGenomes-Tr; SSU1724.
DR   EnsemblGenomes-Tr; SSU1734.
DR   EnsemblGenomes-Tr; SSU1872A.
DR   EnsemblGenomes-Tr; SSU1873.
DR   EnsemblGenomes-Tr; SSU1886.
DR   EnsemblGenomes-Tr; SSU1889.
DR   EuropePMC; PMC2705793; 19603075.
DR   EuropePMC; PMC3227697; 22026465.
DR   EuropePMC; PMC3486358; 23105076.
DR   EuropePMC; PMC3623174; 23416996.
DR   EuropePMC; PMC4024642; 24759092.
DR   EuropePMC; PMC4389249; 25824154.
DR   EuropePMC; PMC4558774; 26336060.
DR   EuropePMC; PMC6265453; 30304532.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01776; RatA.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AM946016.
DR   SILVA-SSU; AM946016.
DR   StrainInfo; 493297; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2007491
FT                   /organism="Streptococcus suis P1/7"
FT                   /strain="P1/7"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:218494"
FT   CDS_pept        1..1374
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SSU0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44080"
FT                   /protein_id="CAR44080.1"
FT                   /translation="MNQEQLFWQRFIELAKVNFKPSIYDFYVADAKLLGINQQVANIFL
FT                   NRPFKKDFWEKNFEELMIAASFESYGEPLTIQYQFTEDEQEIRNTTNTRSSIVHQVQTL
FT                   EPATPQETFKPVHSDIKSQYTFANFVQGDNNHWAKAAALAVSDNLGELYNPLFIFGGPG
FT                   LGKTHILNAIGNKVLADNPQARIKYVSSETFINEFLEHLRLNDMESFKKTYRNLDLLLI
FT                   DDIQSLRNKATTQEEFFHTFNALHEKNKQIVLTSDRNPDHLDNLEERLVTRFKWGLTSE
FT                   ITPPDFETRIAILRNKCENLPYNFTNETLSYLAGQFDSNVRDLEGALKDIHLIATMRQL
FT                   SEISVEVAAEAIRSRKQTNPQNMVIPIEKIQTEVGNFYGVSLKELKGSKRVQHIVHARQ
FT                   VAMFLAREMTDNSLPKIGKEFGNRDHTTVMHAYNKIKTLLLDDENLEIEITSIKNKLR"
FT   misc_feature    358..1014
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SSU0001"
FT                   /note="HMMPfam hit to PF00308, Chromosomal replication
FT                   initiator, DnaA, score 6e-111"
FT                   /inference="protein motif:HMMPfam:PF00308"
FT   misc_feature    478..501
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    1096..1305
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SSU0001"
FT                   /note="HMMPfam hit to PF08299, Chromosomal replication
FT                   initiator, DnaA C-terminal, score 3.9e-33"
FT                   /inference="protein motif:HMMPfam:PF08299"
FT   misc_feature    1246..1305
FT                   /note="PS01008 DnaA protein signature."
FT                   /inference="protein motif:Prosite:PS01008"
FT   CDS_pept        1528..2664
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SSU0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44083"
FT                   /protein_id="CAR44083.1"
FT                   /translation="MIQFSINKNIFLQALSITKRAISTKNAIPILSTVKITVTSEGITL
FT                   TGSNGQISIEHFISIQDENAGLLISSPGSILLEAGFFINVVSSMPDLVLDFNEIEQKQI
FT                   VLTSGKSEITLKGKEAEQYPRLQEVPTSKPLVLETKVLKQTINETAFAASTQESRPILT
FT                   GVHFVLTENKNLKTVATDSHRMSQRKLVLDTSGDDFNVVIPSRSLREFTAVFTDDIETV
FT                   EVFFSNNQILFRSEHISFYTRLLEGTYPDTDRLIPTEFKTTAIFDTANLRHSMERARLL
FT                   SNATQNGTVKLEIANNVVSAHVNSPEVGRVNEELDTVEVSGEDLVISFNPTYLIEALKA
FT                   TTSEQVKISFISSVRPFTLIPNNEGEDFIQLVTPVRTN"
FT   misc_feature    1531..1908
FT                   /gene="dnaN"
FT                   /locus_tag="SSU0002"
FT                   /note="HMMPfam hit to PF00712, DNA polymerase III, beta
FT                   chain, score 1.1e-25"
FT                   /inference="protein motif:HMMPfam:PF00712"
FT   misc_feature    1933..2280
FT                   /gene="dnaN"
FT                   /locus_tag="SSU0002"
FT                   /note="HMMPfam hit to PF02767, DNA polymerase III, beta
FT                   chain, score 5e-39"
FT                   /inference="protein motif:HMMPfam:PF02767"
FT   misc_feature    2284..2655
FT                   /gene="dnaN"
FT                   /locus_tag="SSU0002"
FT                   /note="HMMPfam hit to PF02768, DNA polymerase III, beta
FT                   chain, score 3.8e-33"
FT                   /inference="protein motif:HMMPfam:PF02768"
FT   CDS_pept        2756..3637
FT                   /transl_table=11
FT                   /locus_tag="SSU0003"
FT                   /product="diacylglycerol kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44084"
FT                   /protein_id="CAR44084.1"
FT                   /translation="MTLYILANPNAGSHTAEHIIFKIKESYPQLAVNIFMTVGPEDEKS
FT                   QIEAILKEFVSSEDQLMILGGDGTLSKALRFWPASLPFAYYPTGSGNDFAKAMNITSLY
FT                   RSVDAILERKTSRIYVLNSSYGTVVNSMDFGFAAQVINGSTNSILKKILNKVKLGKLTY
FT                   LFFGIKTLFSKQAINLELTLDEKSYQLDNLFFISVANSLYFGGGIMIWPTASAKKKEVD
FT                   IVYFKNGNFYQRLQSLLALLTKRHESSHTIQHLTGVDVVLKSKEKLLLQIDGETCTANE
FT                   VTLTYQERSMYL"
FT   misc_feature    2759..3127
FT                   /locus_tag="SSU0003"
FT                   /note="HMMPfam hit to PF00781, Diacylglycerol kinase,
FT                   catalytic region, score 1.7e-11"
FT                   /inference="protein motif:HMMPfam:PF00781"
FT   misc_feature    3563..3598
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00070"
FT   CDS_pept        3647..3850
FT                   /transl_table=11
FT                   /locus_tag="SSU0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44085"
FT                   /protein_id="CAR44085.1"
FT                   /translation="MYQLGTFVEMKKPHACVIKSTGKKANKWEVIRLGADIKIRCTNCD
FT                   HVVMMSRHDFERKMKQVLPSEA"
FT   misc_feature    3647..3838
FT                   /locus_tag="SSU0004"
FT                   /note="HMMPfam hit to PF06107, Protein of unknown function
FT                   DUF951, bacterial, score 4e-44"
FT                   /inference="protein motif:HMMPfam:PF06107"
FT   CDS_pept        3954..4313
FT                   /transl_table=11
FT                   /locus_tag="SSU0005"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44086"
FT                   /protein_id="CAR44086.1"
FT                   /translation="MKQLAQQIRVLRTAKNLSQDELAEKLYISRQAVSKWENGEATPDI
FT                   DKLVQLAEIFGVSLDYLVLGKEPEKEIVVEQRGKMNGWEFLNEESKRPLTRGDVVLLIF
FT                   LAVMLLGGLFIKHYF"
FT   misc_feature    3975..4139
FT                   /locus_tag="SSU0005"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix type 3,
FT                   score 5.4e-21"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    4002..4067
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2317.000, SD 7.08 at aa 17-38, sequence
FT                   LSQDELAEKLYISRQAVSKWEN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    4248..4307
FT                   /locus_tag="SSU0005"
FT                   /note="1 probable transmembrane helix predicted for SSU0005
FT                   by TMHMM2.0 at aa 99-118"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        4399..5514
FT                   /transl_table=11
FT                   /locus_tag="SSU0006"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44087"
FT                   /protein_id="CAR44087.1"
FT                   /translation="MSLTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTELIIPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPIADIDTINLELILADLESINKRYARVEKMARTQKDKDS
FT                   VAEFAVLEKIKPVLEDGKSARTVEFTDEEQKIVKQLFLLTTKPVLYVANVDEDKVADPE
FT                   AISYVQQIRDFAATENAEVVVISARAEEEISELDDEDKGEFLEALGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGMKAPQCAGIIHSDFEKGFIRAVTMSYDDLMTYGS
FT                   EKAVKEAGRLREEGKEYVVQDGDIMEFRFNV"
FT   misc_feature    4405..4863
FT                   /locus_tag="SSU0006"
FT                   /note="HMMPfam hit to PF01926, GTP-binding protein,
FT                   HSR1-related, score 4.1e-34"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    4423..4446
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    5257..5508
FT                   /locus_tag="SSU0006"
FT                   /note="HMMPfam hit to PF06071, Protein of unknown function
FT                   DUF933, score 6.4e-62"
FT                   /inference="protein motif:HMMPfam:PF06071"
FT   CDS_pept        5672..6241
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SSU0007"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44088"
FT                   /protein_id="CAR44088.1"
FT                   /translation="MTRLIIGLGNPGDRYFETKHNVGFMLLDKIAKRENVTFNHDKIFQ
FT                   ADIATTFIDGEKIYLVKPTTFMNESGKAVHALMTYYGLDATDILVAYDDLDMAVGKIRF
FT                   RQKGSAGGHNGIKSIVKHIGTQEFDRIKIGIGRPKGKMSVVNHVLSGFDIEDRIEIDLA
FT                   LDKLDKAVNVYLEEDDFDTVMRKFNG"
FT   misc_feature    5681..6235
FT                   /gene="pth"
FT                   /locus_tag="SSU0007"
FT                   /note="HMMPfam hit to PF01195, Peptidyl-tRNA hydrolase,
FT                   score 4.1e-79"
FT                   /inference="protein motif:HMMPfam:PF01195"
FT   misc_feature    5996..6028
FT                   /note="PS01196 Peptidyl-tRNA hydrolase signature 2."
FT                   /inference="protein motif:Prosite:PS01196"
FT   CDS_pept        6241..9735
FT                   /transl_table=11
FT                   /gene="trcF"
FT                   /locus_tag="SSU0008"
FT                   /product="putative transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44089"
FT                   /protein_id="CAR44089.1"
FT                   /translation="MNILDLLHKNKQINQWQSGLNQSTRQLLLGLSGTSKSLIMATAYD
FT                   CLAEKIMIVTATQNDAEKLVADLTAIIGSENVYNFFTDDSPIAEFVFASKERTQSRIDS
FT                   LNFLTDSTSSGILVASIVACRVLLPSPETYKGSKIQLEVGQEIEVDKLVKNLVNIGYKK
FT                   VSRVLTQGEFSQRGDILDIFDMQSETPYRIEFFGDEIDGIRIFDVDSQKSLENLDEISI
FT                   SPASDIILSSEDYSRASQYIQTAIEQSTLEEQQSYLREVLADMQTEYRHPDLRKFLSCI
FT                   YEQSWTLLDYLPKSSPLFLDDFHKIADKQAQFEKEIADLLTDDLQKGKTVSSLKYFAST
FT                   YAELRKYKPATFFSSFQKGLGNVKFDALYQFTQHPMQEFFHQIPLLKDELTRYAKSNNT
FT                   VVIQASSDVSLQTLQKNLQEYDIHLPVHAADKLVEGQQQVTIGQLASGFHLMDEKLVFI
FT                   TEKEIFNKKMKRKTRRTNISNAERIKDYSELAVGDYVVHHVHGIGQYLGIETIEISGIH
FT                   RDYLTVQYQNSDRISIPVEQIDLLSKYLASDGKAPKVNKLNDGRFQRTKQKVQKQVEDI
FT                   ADDLIKLYAERSQLKGFAFSPDDENQVEFDNYFTHVETDDQLRSIDEIKKDMEKDSPMD
FT                   RLLVGDVGFGKTEVAMRAAFKAVNDGKQVAILVPTTVLAQQHYANFQERFAEFPVNVDV
FT                   MSRFKTKAEQEKTLEKLKKGQVDILIGTHRLLSKDVVFADLGLLVIDEEQRFGVKHKER
FT                   LKELKKKIDVLTLTATPIPRTLQMSMLGIRDLSVIETPPTNRYPVQTYVMETNPSVIRD
FT                   AMLREIDRGGQVYYLYNKVDTIEQKVSELKELVPEATIGYVHGQMSEIQLENTLYAFVE
FT                   GEYDILVTTTIIETGVDIPNANTLFIENADHMGLSTLYQLRGRVGRSSRIAYAYLMYRP
FT                   DKSLTEVAEKRLEAIKGFTELGSGFKIAMQDLSIRGAGNILGAAQSGFIDSVGYEMYSQ
FT                   LLEQAILEKQGKATQRQKSNSEVNLQIDAYLPSDYIGDQRQKIEIYKRIKNIDSRVNYQ
FT                   ELQEELIDRFGEYPDVVAYLLEIGLLKSFLDQVFCHTVLRRQHQVTVTFEPMAGQIFLT
FT                   QDYFEALSVTNLKAQITENKGKLAVVFNIQQKKEYEILEELISFAEKLKEIKARKAE"
FT   misc_feature    7702..7995
FT                   /gene="trcF"
FT                   /locus_tag="SSU0008"
FT                   /note="HMMPfam hit to PF02559, Transcription factor CarD,
FT                   score 2.4e-52"
FT                   /inference="protein motif:HMMPfam:PF02559"
FT   misc_feature    8080..8574
FT                   /gene="trcF"
FT                   /locus_tag="SSU0008"
FT                   /note="HMMPfam hit to PF00270, DNA/RNA helicase, DEAD/DEAH
FT                   box type, N-terminal, score 5.2e-41"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    8158..8181
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    8764..8997
FT                   /gene="trcF"
FT                   /locus_tag="SSU0008"
FT                   /note="HMMPfam hit to PF00271, DNA/RNA helicase,
FT                   C-terminal, score 2.4e-19"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   misc_feature    9277..9603
FT                   /gene="trcF"
FT                   /locus_tag="SSU0008"
FT                   /note="HMMPfam hit to PF03461, TRCF, score 5.3e-36"
FT                   /inference="protein motif:HMMPfam:PF03461"
FT   CDS_pept        9785..10057
FT                   /transl_table=11
FT                   /locus_tag="SSU0009"
FT                   /product="S4 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44096"
FT                   /protein_id="CAR44096.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVND
FT                   QVEIQFGNKLLTVKVLEMKDSTKKEDALKMYEIISEKRIEKDEEI"
FT   misc_feature    9785..9925
FT                   /locus_tag="SSU0009"
FT                   /note="HMMPfam hit to PF01479, RNA-binding S4, score
FT                   8.9e-10"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   CDS_pept        10044..10412
FT                   /transl_table=11
FT                   /locus_tag="SSU0010"
FT                   /product="putative septum formation initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44097"
FT                   /protein_id="CAR44097.1"
FT                   /translation="MKKSKILQLNNAFIQSERKKTQHQLAERQQKNRFMGAILILVIFL
FT                   FMLPAYNLVGTYTNIQQQEKKLAELEKNYEELTKEQKQEAEMVAKLKNEEYAAKYVRAK
FT                   YQYSKEGEFVYNIPGLPK"
FT   sig_peptide     10044..10229
FT                   /locus_tag="SSU0010"
FT                   /note="Signal peptide predicted for SSU0010 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.876) with cleavage site
FT                   probability 0.306 between residues 62 and 63"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    10155..10223
FT                   /locus_tag="SSU0010"
FT                   /note="1 probable transmembrane helix predicted for SSU0010
FT                   by TMHMM2.0 at aa 38-60"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    10167..10403
FT                   /locus_tag="SSU0010"
FT                   /note="HMMPfam hit to PF04977, Septum formation initiator,
FT                   score 3.6e-16"
FT                   /inference="protein motif:HMMPfam:PF04977"
FT   CDS_pept        10409..10522
FT                   /transl_table=11
FT                   /locus_tag="SSU0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44098"
FT                   /protein_id="CAR44098.1"
FT                   /translation="MTESIFKIVEQFLQHSDEKLEELNQKNRELKLEENES"
FT   CDS_pept        10535..11815
FT                   /transl_table=11
FT                   /locus_tag="SSU0012"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44103"
FT                   /protein_id="CAR44103.1"
FT                   /translation="MQKKLLVWLLPVLFGWQVVDSTEIPFELTAQEEYELTHTIYDQYF
FT                   QTIPQNPNVFQTENLYSDEELTIAGGQLQPNQHFSITDVLVNSKKELVFQIDDKGYILA
FT                   SRHLLFDDVIVTETTVEQTYWTKKGFTLLTSPIANEATEIKNDLQPYQAVMVSKIVTTS
FT                   LGDFAYVTDKGWIAVNNLSKTDNRVEAVQELLTNKYSKDTIGIYVKQLSTGQTAGVNQE
FT                   KLFYSASIAKLPILYYVQEQLNAGYIDLTTKVKYTAESISFPGAYVAGGSGSLSKTPDN
FT                   KDYSVEELINKTAKESDNVASNLLSYYVANKFDSNFYQVITAKTGSEWSMVTRETSAEI
FT                   AGKMMEALYIQNGYVLESLLSTQFDNQRISKDISVPVAHKIGDADDVKHDVAIVYAGSP
FT                   FVLSIFTDKSNYDEITQIANDIYRILK"
FT   CDS_pept        11816..13084
FT                   /transl_table=11
FT                   /locus_tag="SSU0013"
FT                   /product="PP-loop family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44104"
FT                   /protein_id="CAR44104.1"
FT                   /translation="MKDRFLKVTLDGHFFDKHKKVLVAVSGGLDSMNLFHLLYECKQVL
FT                   GIELGIAHINHGQREESVIEEKYLRQLAEESNVPFYLSYFEGVFSEEAARKWRYGFFAT
FT                   IMEKEGYTALVTAHHADDQAETVFMRLIRGGRLRHLSAIQPTQPFATGELIRPLLSFKK
FT                   ADFEKLFHFEDCSNADFKYFRNRVRNDYLPKLKQENPKIELTLNNLAVDTNNLFQALRD
FT                   LTQDLSVTDVMSFQQQTPAVQSYLLEEYLEKFPDLQLSRPQFNEVLHILRSKANYYHLL
FT                   KNDYMLEKDYHRFQIYKIGPETDSQPEKIMIESEGIFSYGSYIFSLNHPLEEADSILYF
FT                   PTENPIVVRRRQAGDTILINGVNKKLRRWFIDNKISQKVRQNALIIEQNGEIYGITNLV
FT                   SSDLSKSVKNDIIKATLYIKMKE"
FT   misc_feature    11873..12385
FT                   /locus_tag="SSU0013"
FT                   /note="HMMPfam hit to PF01171, PP-loop, score 1.4e-78"
FT                   /inference="protein motif:HMMPfam:PF01171"
FT   CDS_pept        13092..13634
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SSU0014"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44107"
FT                   /protein_id="CAR44107.1"
FT                   /translation="MLDKDIKKILVSEEEIVAKCKELGQILATDYADKNPILVGILKGS
FT                   IPFMAELMKHIDAHVETDYMVVSSYHGGTESCGTVKIIKDLDNSVAGRYIIFVEDIIDT
FT                   GRTLKELKELFALRQAASIKIATLLDKPEGRVVEIEPDYTCFTIPNEFVVGFGLDYDEN
FT                   YRNLPYVGVLKEEVYTK"
FT   misc_feature    13104..13538
FT                   /gene="hpt"
FT                   /locus_tag="SSU0014"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyltransferase,
FT                   score 1.6e-29"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   CDS_pept        13656..15629
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SSU0015"
FT                   /product="putative cell division protease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44108"
FT                   /protein_id="CAR44108.1"
FT                   /translation="MNNQPNKGFIKNPFLIILVIATIVTAFQFFNAGQQVATQEISYSQ
FT                   VVTELKNNNVSEITYQPNSSVIEITGKYKTEQEAKDELASSIKLFQVSSKVKYKNFKSL
FT                   ILPSETNLSELQALANENGVKVAIKPESSNGLWLNIIFNLLPLVIAGVFFMMMMNQGGG
FT                   GARGAMNFGRNKAKALEQSNIKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLGARIP
FT                   AGVLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAA
FT                   PAIIFIDEIDAVGRQRGVGMGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAATNRSDVL
FT                   DPALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAADVDLKLVAQQTPGFVGADLE
FT                   NVLNEAALVAARRNKTVIDASDIDEAEDRVIAGPSKKDRQVSAKEREIVAYHEAGHTIV
FT                   GLVLSNAREVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDMKEQLAGLMGGRVAEEIIF
FT                   NTQTTGASNDFEQATQMARAMVAEYGMSDKMGPMQYEGSHAMFGGQTTQKHISEQTAYE
FT                   LDNEVRDLLNEARNKAAEIIQSNRETHKLIAEALLKYETLDSVQIKSLYETGKMPENIE
FT                   RDDEDVHPLSYEEVKEKINTKE"
FT   sig_peptide     13656..13787
FT                   /gene="ftsH"
FT                   /locus_tag="SSU0015"
FT                   /note="Signal peptide predicted for SSU0015 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.319 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(13698..13754,14058..14126)
FT                   /gene="ftsH"
FT                   /locus_tag="SSU0015"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0015 by TMHMM2.0 at aa 15-33 and 135-157"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    13770..14249
FT                   /gene="ftsH"
FT                   /locus_tag="SSU0015"
FT                   /note="HMMPfam hit to PF06480, Peptidase M41, FtsH
FT                   extracellular, score 1.4e-30"
FT                   /inference="protein motif:HMMPfam:PF06480"
FT   misc_feature    14325..14888
FT                   /gene="ftsH"
FT                   /locus_tag="SSU0015"
FT                   /note="HMMPfam hit to PF00004, AAA ATPase, core, score
FT                   4.9e-98"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    14340..14363
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    14637..14693
FT                   /note="PS00674 AAA-protein family signature."
FT                   /inference="protein motif:Prosite:PS00674"
FT   misc_feature    14907..15527
FT                   /gene="ftsH"
FT                   /locus_tag="SSU0015"
FT                   /note="HMMPfam hit to PF01434, Peptidase M41, score
FT                   2.2e-104"
FT                   /inference="protein motif:HMMPfam:PF01434"
FT   CDS_pept        15967..16437
FT                   /transl_table=11
FT                   /gene="comX"
FT                   /locus_tag="SSU0016"
FT                   /product="putative competence-specific global transcription
FT                   modulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44110"
FT                   /protein_id="CAR44110.1"
FT                   /translation="MEFEKVYASVKGIVNKARKEFYIKLWDRDDWEQEGMMTLFELLEA
FT                   QPWLVDEQVQLYCYFKVKFRNRIKDRIRKQESQKRKFDRMPHEDIYELSHAIQSPGLIN
FT                   DELLMLRGALRDYRKNLSNDQLDKYEKLISGQCFNGRREMIRDLQIHLKDFR"
FT   rRNA            16977..18520
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            18572..18644
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:18605..18607,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            18924..21828
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            21906..22032
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            22035..22107
FT                   /gene="tRNA-Val"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:22068..22070,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 68.42"
FT   tRNA            22110..22182
FT                   /gene="tRNA-Asp"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:22143..22145,aa:Asp)"
FT                   /note="tRNA Asp anticodon GTC, Cove score 82.91"
FT   tRNA            22228..22300
FT                   /gene="tRNA-Lys"
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:22261..22263,aa:Lys)"
FT                   /note="tRNA Lys anticodon TTT, Cove score 81.85"
FT   tRNA            22304..22385
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:22338..22340,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAG, Cove score 45.48"
FT   tRNA            22400..22472
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:22433..22435,aa:Thr)"
FT                   /note="tRNA Thr anticodon TGT, Cove score 71.26"
FT   tRNA            22485..22556
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:22517..22519,aa:Gly)"
FT                   /note="tRNA Gly anticodon GCC, Cove score 77.41"
FT   tRNA            22564..22647
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:22598..22600,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAA, Cove score 51.48"
FT   tRNA            22666..22739
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:22700..22702,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 72.48"
FT   tRNA            22787..22860
FT                   /gene="tRNA-Pro"
FT                   /product="transfer RNA-Pro"
FT                   /anticodon="(pos:22821..22823,aa:Pro)"
FT                   /note="tRNA Pro anticodon TGG, Cove score 61.18"
FT   tRNA            22873..22946
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:22907..22909,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 69.60"
FT   tRNA            22963..23036
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:22997..22999,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 81.31"
FT   tRNA            23043..23132
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:23079..23081,aa:Ser)"
FT                   /note="tRNA Ser anticodon TGA, Cove score 37.00"
FT   tRNA            23143..23216
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:23177..23179,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 63.79"
FT   tRNA            23232..23304
FT                   /gene="tRNA-Phe"
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:23265..23267,aa:Phe)"
FT                   /note="tRNA Phe anticodon GAA, Cove score 64.99"
FT   tRNA            23336..23409
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:23370..23372,aa:Ile)"
FT                   /note="tRNA Ile anticodon GAT, Cove score 80.63"
FT   tRNA            23422..23509
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:23456..23458,aa:Ser)"
FT                   /note="tRNA Ser anticodon GCT, Cove score 31.75"
FT   CDS_pept        23569..24405
FT                   /transl_table=11
FT                   /locus_tag="SSU0018"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44113"
FT                   /protein_id="CAR44113.1"
FT                   /translation="MNKFSKLVVVVSIFLLLSFSLLFVTFSKGLQVPYLNNIVRVVVTP
FT                   IQSVISVPTRFFSEQKDVLTDLMNAYEENKQLKETIMSLEGMAAENTSLKEENASLRSS
FT                   LGVVSDFPEKQLIPGSVLVRTPSSWSEHISINIGETSGVTYNALVVANGGLVGIVSSLS
FT                   SDSAVVTLFTNSDEFTKLPVKISVDSKEIYGILSGYDADTNSFIINQLNSADEIAVGSN
FT                   VVTSDLAGETPANVQIGKVLSVKSNSNSLNREVYVEPTASFSNIYSVLVVGQTNAQ"
FT   sig_peptide     23569..23655
FT                   /locus_tag="SSU0018"
FT                   /note="Signal peptide predicted for SSU0018 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.659 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    23587..23646
FT                   /locus_tag="SSU0018"
FT                   /note="1 probable transmembrane helix predicted for SSU0018
FT                   by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    23923..24396
FT                   /locus_tag="SSU0018"
FT                   /note="HMMPfam hit to PF04085, Rod shape-determining
FT                   protein MreC, score 1.4e-31"
FT                   /inference="protein motif:HMMPfam:PF04085"
FT   CDS_pept        24395..24910
FT                   /transl_table=11
FT                   /locus_tag="SSU0019"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44116"
FT                   /protein_id="CAR44116.1"
FT                   /translation="MRNKMIEIFMFPILFFILLLDGQISTLVTNWSVGLFTISSHLVLM
FT                   LAIFYANYVSLGFSLFIFTLLGLVYDISYLNLIGIATTTLPLVLYCIYFFFQGAVSKRG
FT                   INILILLVAIFQFEFISYSFARIFHITNLSVFIFVFNKLLPSLLFNLVLFFVLQPLFER
FT                   LFGITNKT"
FT   misc_feature    join(24407..24475,24533..24601,24614..24682,24710..24778,
FT                   24797..24865)
FT                   /locus_tag="SSU0019"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0019 by TMHMM2.0 at aa 5-27, 47-69, 74-96, 106-128 and
FT                   135-157"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        24995..26251
FT                   /transl_table=11
FT                   /locus_tag="SSU0020"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44118"
FT                   /protein_id="CAR44118.1"
FT                   /translation="MKKKILATIMLSTVVLSNANYVAVISANDVDSQIATKNQQISELT
FT                   AQQAEAQQQVDAIQGQVDAIVSEQAKLTEENTRLEAESQTLAADIERLSADIVSRDGAL
FT                   KEQARSAQVDGSASSYINTILDSKSIIDAVSRVNAMREIISANNRMLEQQKADKEAIVE
FT                   KQKANQEAITTLAANRQKLEDDAQVLQVRQAELEAAKLNLAVQKATAEDEKNSLLVQKA
FT                   AAEEAARQAAARQAEYQAQQAALAQQQVASVSAPVVSTLVETTVTETVAAPTQTVSQST
FT                   PTVSTPTTSTSSGSGSSAAANNARYDASSYPVGECTWGVKSQLSWVGPYWGDAKQWLAS
FT                   ARAEGFSTGSTPQVGAIAVWTGGYYGHVAVVTAVQSSTSIQVVESNYMGRRYIGNHRGG
FT                   YFNPTTTSEGAVYYIYPPY"
FT   sig_peptide     24995..25075
FT                   /locus_tag="SSU0020"
FT                   /note="Signal peptide predicted for SSU0020 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.459 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    25880..26239
FT                   /locus_tag="SSU0020"
FT                   /note="HMMPfam hit to PF05257, Cysteine,
FT                   histidine-dependent amidohydrolase/peptidase, score 8e-36"
FT                   /inference="protein motif:HMMPfam:PF05257"
FT   CDS_pept        26354..27322
FT                   /transl_table=11
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SSU0021"
FT                   /product="ribose-phosphate pyrophosphokinase 1"
FT                   /note="Similar to SSU0918, 52.077% identity (52.751%
FT                   ungapped) in 313 aa overlap (5-317:9-317)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44121"
FT                   /protein_id="CAR44121.1"
FT                   /translation="MAFTDLKLFALSSNQKLAEQVSKKIGIPLGKSSVRQFSDGEIQVN
FT                   IEESIRGTHVYILQSTSSPVNDNLMEILIMVDALKRASAESVNVVMPYYGYARQDRKAR
FT                   AREPITSKLVANMLQTAGVNRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERRGMV
FT                   GDGYVVVSPDHGGVTRARKLAQFLKTPIAIIDKRRSVDKMNTSEVMNIIGDIKDKTCIL
FT                   IDDMIDTAGTICHAADALADAGATAVYASCTHPVLSGPAMDNISKSAIKKLVVLDTIEI
FT                   AEDRLIDKIEHISTAELLAEAIIRIHEKRPLSPLFEASRVK"
FT   misc_feature    26741..26788
FT                   /note="PS00114 Phosphoribosyl pyrophosphate synthetase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00114"
FT   misc_feature    26774..27175
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SSU0021"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyltransferase,
FT                   score 5.3e-31"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   misc_feature    27011..27049
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS_pept        27409..28587
FT                   /transl_table=11
FT                   /locus_tag="SSU0022"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44122"
FT                   /protein_id="CAR44122.1"
FT                   /translation="MDLLNRFNKNLNRIEVSMIRQFDQSISDVPGILKLTLGEPDFTTP
FT                   DHVKEAAKAAIDADQSYYTGMAGLLELRQAAAEFVAEKYNLHYNPENEILSTIGATEAL
FT                   SASLVAILEAGDTVLLPAPAYPGYEPIVNMVGADIVEIDTTANDFVLTPEMLEEAIIEQ
FT                   GDKLKAVILNYPANPTGVTYSREQIQAFADVLRNYPVFVLSDEVYAELTYTGQPHTSIA
FT                   EFLPEQTILIQGLSKSHAMTGWRIGLIMSQAPIIAQIIKSHQYLVTAASTAMQYGAVEA
FT                   LKNGKDDALPMRAEYVKRRDYIIEKMTDLGFKIIKPDGAFYIFAKIPAGYNQDSFSFLQ
FT                   DFARKKAVAFIPGAAFGQYGEGYVRISYAASMEKIQTAMARLKEYLEENGTN"
FT   misc_feature    27496..28554
FT                   /locus_tag="SSU0022"
FT                   /note="HMMPfam hit to PF00155, Aminotransferase, class I
FT                   and II, score 2.6e-56"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   misc_feature    28108..28149
FT                   /note="PS00105 Aminotransferases class-I
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00105"
FT   CDS_pept        28574..29356
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="SSU0023"
FT                   /product="DNA repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44123"
FT                   /protein_id="CAR44123.1"
FT                   /translation="MERIETRGLVLYNRNFREDDKLVKIFTEKAGKRMFFVKHASKSKL
FT                   VASIQPLTYADFIVKINDDGLSYIEDFHQVQPFKNINGDIFKLSYATYILALADAALQD
FT                   KVYDPALFAFLVKTLDLMESGLDYEVLTNIFEIQLLGRFGISLNFHECAFCHRVGLPFD
FT                   YSYKYSGVLCPQHYQQDERRAYLDPNVPYLLDQFQAISFDELETISIKPEMKRKLRFFI
FT                   DQLYEEYVGIHLKSKKFIDDLSSWGQIMKPRTENEETE"
FT   misc_feature    28574..29311
FT                   /gene="recO"
FT                   /locus_tag="SSU0023"
FT                   /note="HMMPfam hit to PF02565, Recombination protein O,
FT                   RecO, score 1.8e-19"
FT                   /inference="protein motif:HMMPfam:PF02565"
FT   misc_feature    29027..29044
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS_pept        29353..30360
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SSU0024"
FT                   /product="fatty acid/phospholipid synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44125"
FT                   /protein_id="CAR44125.1"
FT                   /translation="MKRIAVDAMGGDHAPQAVVEGVNQALAAFPDIEIQLYGDEAKIKQ
FT                   YLTATERVSIVHTTEKINSDDEPVKAIRRKKEASMVLATKAVKDGQADAVLSAGNTGAL
FT                   LAAGVFVVGRIKNIDRPGLMSTLPTMDGKGFDMMDLGANAENIAHHLYQYGILGSFYAE
FT                   HVRGVKQPRVGLLNNGTEDTKGTPVHQEAYKLLAEDKSINFIGNVEARELLNSVADVVV
FT                   TDGFTGNAVLKTIEGTAKSIVGQLTGSIKNGGLRAKLGGLLVKPTLKKALGAMDYKTAG
FT                   GAVLLGLKAPVIKAHGSSDAQSIFYTIKQTRSILEAGIVEKSVAKFSVVEESHD"
FT   misc_feature    29356..30318
FT                   /gene="plsX"
FT                   /locus_tag="SSU0024"
FT                   /note="HMMPfam hit to PF02504, Fatty acid synthesis plsX
FT                   protein, score 4.9e-135"
FT                   /inference="protein motif:HMMPfam:PF02504"
FT   CDS_pept        30353..30601
FT                   /transl_table=11
FT                   /locus_tag="SSU0025"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44126"
FT                   /protein_id="CAR44126.1"
FT                   /translation="MTREQVYQRVVELIQDEKGEDFQVQPESTLADNIAADSVEIMEFV
FT                   LNLEDEFHVDVPDAAIEHFEVLSDIVDFIYKEVKKRS"
FT   CDS_pept        30719..31426
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SSU0026"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44127"
FT                   /protein_id="CAR44127.1"
FT                   /translation="MKTDLLYSGKAKDIYATADSDQIVAVYKDQATAFNGGKKEQIVGK
FT                   GRLNNLISSLIFEKLNEAGVPTHFIKRLSDSEQLNKKVEIIPLEVVLRNVTAGSFSKRF
FT                   GVEEGITLSTPIVEFYYKKDELDDPFINDEHIAFLELASQDQIAYIKEETRRINEFLKD
FT                   LFAQIGLTLVDFKLEFGIDSSGQILLADEFSPDNCRLWDADGNHLDKDVFRRGLGELTE
FT                   VYEVVLAKLQEVK"
FT   misc_feature    30722..31423
FT                   /gene="purC"
FT                   /locus_tag="SSU0026"
FT                   /note="HMMPfam hit to PF01259, SAICAR synthetase, score
FT                   5e-118"
FT                   /inference="protein motif:HMMPfam:PF01259"
FT   misc_feature    30971..31015
FT                   /note="PS01057 SAICAR synthetase signature 1."
FT                   /inference="protein motif:Prosite:PS01057"
FT   misc_feature    31232..31258
FT                   /note="PS01058 SAICAR synthetase signature 2."
FT                   /inference="protein motif:Prosite:PS01058"
FT   misc_feature    31250..31297
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   CDS_pept        31439..35158
FT                   /transl_table=11
FT                   /locus_tag="SSU0027"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44130"
FT                   /protein_id="CAR44130.1"
FT                   /translation="MAKRIFVEKKAAFQIKAEALRKELTHNLQLTSLSSLRLVQVYDVF
FT                   NLEEDLLEQAIKHIFTEQVTDKVLSDEELGLEGAVYFAIEALPGQFDQRAASSQEALLL
FT                   LGSRQEVRVNTGQLYILNGDVQEEELVAIKNYLLNPVDSRFKDMDAPLVAQEFSVSDTV
FT                   IPSLDFFDSYGVEEFASYKREAGLAMEVEDLLFIQDYFKSIGRVPTETELKVLDTYWSD
FT                   HCRHTTFETELRSIDFSASKFQKQLQATYDKYLAMRTELGRTDKPQTLMDMATIFGRYE
FT                   RANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNETHNHPTEIEPFGGAATCIG
FT                   GAIRDPLSGRSYVYQAMRISGAGDITQPLTATRSGKLPQQIISKTAAHGYSSYGNQIGL
FT                   ATTYVREYFHPGFVAKRMELGAVVGAAPKENVVREKPVAGDVVILLGGKTGRDGIGGAT
FT                   GSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRNGAVTRLIKKSNDFGAGGVCVAIGE
FT                   LADGLEIDLDKVPLKYAGLNGTEIAISESQERMSVVVRPEDVDAFIAACRQENIHAVVV
FT                   AKVTEKPNLVMTWNGQTIVDLERSFLDTNGVRVVVDAKVVDSPVNLPETRTTSAQTLRE
FT                   DLKDLLSDLNHASQKGLQTIFDSSVGRSTVNHPLGGRHQLTPTESSVQKLPVQQGVTTT
FT                   ASVMAQGYHPYLADWSPYHGAAYAVIEATARLVATGANWSKARFSYQEYFQRMDKQAER
FT                   FGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEDLTVPPTLVAFGVTTADSCKVLSPE
FT                   FKATGEHIYYLPGQILSEDIDFTLIKSNFKAFEKWQSDYVITAASAVKYGGVLESLALM
FT                   SFGNQVGARVELADFETSLTGQLGGFVFTSQEDIPDAVKIGQTTTDFTLVVNGVNLSGQ
FT                   DLQVAFEGKLEEVYPTEFEQATELQDVPAVTSSAVIKAKETVEVPVVYIPVFPGTNSEY
FT                   DSAKAFEQAGAKVNLVPFVTLDAESIENSVDTMVDNIAKANILFFAGGFSAADEPDGSA
FT                   KFIVTILRNAKVRSAIDQFIEKRGLIIGICNGFQALVKSGLLPYGNFEEAGDTSPTLFY
FT                   NDANQHIAKMVETRIANVNSPWLAGVQVGDIHAIPVSHGEGKFVVTDEEFATLRDNGQI
FT                   FSQYVDFTGQPSMDSKYNPNGSSHAIEGITSRNGQIIGKMGHSERYEDGLFQNIPGKKD
FT                   QGLFVSAVRYFTGK"
FT   misc_feature    32372..32473
FT                   /locus_tag="SSU0027"
FT                   /note="HMMPfam hit to PF00586, AIR synthase related
FT                   protein, score 5.1e-05"
FT                   /inference="protein motif:HMMPfam:PF00586"
FT   misc_feature    32747..33208
FT                   /locus_tag="SSU0027"
FT                   /note="HMMPfam hit to PF02769, AIR synthase related
FT                   protein, C-terminal, score 5e-35"
FT                   /inference="protein motif:HMMPfam:PF02769"
FT   misc_feature    33635..33709
FT                   /note="PS01159 WW/rsp5/WWP domain signature."
FT                   /inference="protein motif:Prosite:PS01159"
FT   CDS_pept        35161..36615
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SSU0028"
FT                   /product="putative amidophosphoribosyltransferase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44133"
FT                   /protein_id="CAR44133.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPQAAQVTYFGLHSLQHRGQEGAGIL
FT                   ANDGGQLCRHRGTGLIAEVFKNPADLEALTGTAAIGHVRYATSGSASINNIQPFLFDFA
FT                   DMQVGLAHNGNLTNAVSLKAELEKNGSIFSSSSDTEILMHLIRRSHNPDFMGKIKEALN
FT                   TVKGGFAYLILLEDKLVAALDPNGFRPLSIGKMKNGAWVVASETCAFEVVGADWVRDVE
FT                   PGEIVVIDDSGIQYDSYTRDTQLAVCSMEYVYFARPDSVIHGVNVHTARKNMGRRLAQE
FT                   FKHEADIVVGVPNSSLSAAMGFAEESGLPNEMGLIKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSSVVKGKRVVMIDDSIVRGTTSRRIVQLLRDAGAKEVHVAIGSPELKYPCFYGID
FT                   IQTRRELISANHTVEEVCEIIGADSLTYLSLEGMIEAIGIETDAPKGGLCVAYFDGEFP
FT                   TPLYDYEEEYLRSLEEKTSFYIENVK"
FT   misc_feature    35161..35208
FT                   /note="PS00443 Glutamine amidotransferases class-II active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00443"
FT   misc_feature    35194..35781
FT                   /gene="purF"
FT                   /locus_tag="SSU0028"
FT                   /note="HMMPfam hit to PF00310, Glutamine amidotransferase,
FT                   class-II, score 9.9e-43"
FT                   /inference="protein motif:HMMPfam:PF00310"
FT   misc_feature    35926..36363
FT                   /gene="purF"
FT                   /locus_tag="SSU0028"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyltransferase,
FT                   score 2.7e-07"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   misc_feature    36217..36255
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS_pept        36671..37693
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SSU0029"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44135"
FT                   /protein_id="CAR44135.1"
FT                   /translation="MTNKNAYAQSGVDVEAGYEVVERIKKHVARTERLGVMGALGGFGG
FT                   MFDLTKLDVKEPVLVSGTDGVGTKLMLAIQYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYIATGKNEPAKLEQVVAGVAEGCVQAGCGLIGGETAEMPGMYGEDDYDLAGFAVGIA
FT                   EKSQIIDGSKVQEGDILLGLASSGIHSNGYSLVRRVFADVSGDALLPELNGRALKDVLL
FT                   EPTRIYVQQVLPLVKAGLVNGIAHITGGGFIENVPRMFADNLAAEIEEDKIPVLPIFTA
FT                   LETYGQIKHEEMFEIFNMGIGMVLAVSPGKVEKVRELVGEEVYEIGRIITKEDKSVVIK
FT                   "
FT   misc_feature    36677..37162
FT                   /gene="purM"
FT                   /locus_tag="SSU0029"
FT                   /note="HMMPfam hit to PF00586, AIR synthase related
FT                   protein, score 2.4e-70"
FT                   /inference="protein motif:HMMPfam:PF00586"
FT   misc_feature    37193..37690
FT                   /gene="purM"
FT                   /locus_tag="SSU0029"
FT                   /note="HMMPfam hit to PF02769, AIR synthase related
FT                   protein, C-terminal, score 1.8e-46"
FT                   /inference="protein motif:HMMPfam:PF02769"
FT   CDS_pept        37690..38241
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SSU0030"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44136"
FT                   /protein_id="CAR44136.1"
FT                   /translation="MKRIAVFASGNGSNFQVIAEQFEVAFVFSDRRNAYVLERAEKLGV
FT                   PTFAFELKEFADKQAYEEAIIQLLDQHQIDLVVLAGYMKIVGPTLLAQYEGRIINIHPA
FT                   YLPEFPGAHGIEDAWNAGVAESGVTVHWVDSGIDTGQIIKQVRVPRLADDILETFEARI
FT                   HEAEYQLYPAVLEELGAVKK"
FT   misc_feature    37693..38214
FT                   /gene="purN"
FT                   /locus_tag="SSU0030"
FT                   /note="HMMPfam hit to PF00551, Formyl transferase,
FT                   N-terminal, score 1.4e-60"
FT                   /inference="protein motif:HMMPfam:PF00551"
FT   CDS_pept        38251..39798
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SSU0031"
FT                   /product="bifunctional purine biosynthesis protein PurH
FT                   [includes: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase; IMP cyclohydrolase]"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44137"
FT                   /protein_id="CAR44137.1"
FT                   /translation="MTKRALISVSDKNGIVEFAQELTKLGWEIISTGGTKVALDNAGVA
FT                   TIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDVDSHLQAAKDHEIGLIDLVVVNLYP
FT                   FKETILRPDVTYDLAVENIDIGGPSMLRSAAKNHASVTVVVDPADYPTVLGEIAEQGQT
FT                   TYPTRQRLAAKVFRHTAAYDALIADYFTKQVGEDKPEKLTITYDLNQPMRYGENPQQNA
FT                   DFYQNALPTDYSIAAAKQLNGKELSFNNIRDADAAIRIIRDFKDRPTVVALKHMNPCGI
FT                   GQAETIEKAWDYAYEADPVSIFGGIVVLNREVDAATAEKMHPIFLEIIIAPSYSAEALA
FT                   ILTNKKKNLRILELAFDAQDASEVEKEFTGVVGGLLVQDQDVVVESPADWQVVTERQPS
FT                   EQEWAAMEFAWKSSKYVKSNGIIITNDKMTLGVGPGQTNRVASVRIAIEQAKDRLEGAV
FT                   LASDAFFPFADNVEEIAAAGIKAIIQPGGSVRDQDSIDMANKYGLTMVFTGVRHFRH"
FT   misc_feature    38290..38637
FT                   /gene="purH"
FT                   /locus_tag="SSU0031"
FT                   /note="HMMPfam hit to PF02142, MGS-like, score 4.4e-56"
FT                   /inference="protein motif:HMMPfam:PF02142"
FT   misc_feature    38650..39600
FT                   /gene="purH"
FT                   /locus_tag="SSU0031"
FT                   /note="HMMPfam hit to PF01808, AICARFT/IMPCHase bienzyme,
FT                   formylation region, score 4.8e-148"
FT                   /inference="protein motif:HMMPfam:PF01808"
FT   CDS_pept        39924..41186
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SSU0032"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44139"
FT                   /protein_id="CAR44139.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLESEQVEQVFVAPGNDGMTLDGIELV
FT                   NIGISEHSAIINFAKENDVAWTFVGPDDALAAGIVDDFEQAGLKAFGPSRLAAELEWSK
FT                   DFAKQIMVKYGIPTAAFGTFSNFEEAKAYIEEQGAPIVVKADGLALGKGVVVAETVEQA
FT                   VEAAREMLLDNKFGDSGARVVIEEFLAGEEFSLFALVNGDQFYILPTAQDHKRAFDGDQ
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVDTIVKPILEGMIADGRSYLGVLYAGLILTDQGPK
FT                   VIEFNARFGDPETQIILPRLTSDFAQNIDDILHKRPTQLTWLDSGVTLGVVVASNGYPL
FT                   DYEKGVELPAKTEGDITTYYAGARFAENSRALLSNGGRVYMLVTTADTVQDAQEKIYSE
FT                   LKNQDTTGLFYRTDIGSKAVK"
FT   misc_feature    39924..40226
FT                   /gene="purD"
FT                   /locus_tag="SSU0032"
FT                   /note="HMMPfam hit to PF02844, Phosphoribosylglycinamide
FT                   synthetase, score 8.4e-44"
FT                   /inference="protein motif:HMMPfam:PF02844"
FT   misc_feature    40230..40805
FT                   /gene="purD"
FT                   /locus_tag="SSU0032"
FT                   /note="HMMPfam hit to PF01071, Phosphoribosylglycinamide
FT                   synthetase, score 4e-119"
FT                   /inference="protein motif:HMMPfam:PF01071"
FT   misc_feature    40785..40808
FT                   /note="PS00184 Phosphoribosylglycinamide synthetase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00184"
FT   misc_feature    40902..41180
FT                   /gene="purD"
FT                   /locus_tag="SSU0032"
FT                   /note="HMMPfam hit to PF02843, Phosphoribosylglycinamide
FT                   synthetase, score 3.2e-14"
FT                   /inference="protein motif:HMMPfam:PF02843"
FT   CDS_pept        41212..41700
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SSU0033"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44142"
FT                   /protein_id="CAR44142.1"
FT                   /translation="MNIPISIIMGSSSDWKTMKKAADMLDKFGVAYEKKVVSAHRTPDL
FT                   MFRHAEEARGHGFKVIIAGAGGAAHLPGMVAAKTTLPVIGVPVQSRALSGVDSLYSIVQ
FT                   MPGGVPVATMAIGEAGATNAALTALRILSIEDQTIAAQLADFAKEQEKIAEAMTDDLI"
FT   misc_feature    41218..41694
FT                   /gene="purE"
FT                   /locus_tag="SSU0033"
FT                   /note="HMMPfam hit to PF00731,
FT                   1-(5-Phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase, score 1.7e-87"
FT                   /inference="protein motif:HMMPfam:PF00731"
FT   CDS_pept        41687..42766
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SSU0034"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44143"
FT                   /protein_id="CAR44143.1"
FT                   /translation="MTSSKTIGIIGGGQLGQMMAISAIYMGHKVITLDPAADCPASKVS
FT                   EVIVAPYHDVAALKQLAERCDVLTYEFENVDADGLDAVIKDGQLPQGTDLLRISQNRIF
FT                   EKDFLAKKAGVQVAPYKVVTSSLDLEGLDLSKNYVLKTATGGYDGHGQKVIREEADLVE
FT                   ASQLANSAECVLEEFVNFDLEISVLVSGNGSDYTVFPVQENIHRNNILYKTIVPARIFD
FT                   ELAEKAKTMALQIADKLHLVGTLCVEMFVAGQEILVNEIAPRPHNSGHYSIEACDFSQF
FT                   DTHIRGILGEPLPPIRLLSPAVMINVLGQDMETVQTFLQENPTAHPHFYGKLEAKHNRK
FT                   MGHVTVLGEDAESVEEFEN"
FT   misc_feature    41987..42514
FT                   /gene="purK"
FT                   /locus_tag="SSU0034"
FT                   /note="HMMPfam hit to PF02222, ATP-grasp fold,
FT                   ATP-dependent carboxylate-amine ligase-type, score 1.6e-66"
FT                   /inference="protein motif:HMMPfam:PF02222"
FT   CDS_pept        42810..43571
FT                   /transl_table=11
FT                   /locus_tag="SSU0035"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44146"
FT                   /protein_id="CAR44146.1"
FT                   /translation="MPLPQKIQEEIKRYCNNHLPNNDWYEKEFDFIHDVSLKNRIIREF
FT                   KSIRYAYKLYEGITAEEEHLIFEIRSQILAYASIYEAVVEYVLETYYSDTQVYDDLVHQ
FT                   NNVMTKIDIPEEKRKKLERELIHLVDNGTKNIEIHTFFYQRKRKASTSIRFDAKCRAAE
FT                   ELNIISKIYQKGNKVVADLPSDIIEIYEYRNAIHLIAEQRKNIDYELELSQRAYRRMKP
FT                   FIEQIKDRLITDNKLIIKNTKDTLTDSSIKN"
FT   CDS_pept        43644..44870
FT                   /transl_table=11
FT                   /locus_tag="SSU0036"
FT                   /product="hypothetical protein"
FT                   /note="N-terminal region is similar to Bacillus
FT                   thuringiensis serovar konkukian str. 97-27 hypothetical
FT                   protein. UniProt:Q5LK81 (EMBL:CP000047) (325 aa) fasta
FT                   scores: E()=2.6e-22, 31.858% id in 339 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44148"
FT                   /protein_id="CAR44148.1"
FT                   /translation="MLNKEWYFKNFNMVSELDISGEFIYTGISIVNNMDRIAPEMPTEL
FT                   FLALYNISVGVERLQKIILVLWEFDEVDSIEDFSESLKIHNQVELHSRIEKAINKKIFS
FT                   KQECQFLELLKEFYSNARYDRFSAVGNRWEYELISKFFSNNQISYEESVSDSQVILIND
FT                   SIRKLIGRVLSRIVKNYYLLVEEGSNKSGTYSYELRNDSKAQKIFLHMENRRGLSSIKI
FT                   DERIALSEILIYLRNTSDKSSYLKFIEGIYPLDFDKMEISRYLSIILLEDRIPQDLIDE
FT                   IEYIYAEKDIKVGERIENLDLLTKNNMQVTFDYPYLKEVYIILEEVKKQESINDDTISR
FT                   LEESNCYIDDSDTQEIIESIIAVARQYRNNKILKEEFIKEFSSHYKTLEDNYTLSYISN
FT                   LMQLEVRSK"
FT   CDS_pept        44872..46164
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SSU0037"
FT                   /product="adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44150"
FT                   /protein_id="CAR44150.1"
FT                   /translation="MIERYSRPEMAAIWSEENKYEAWLEVEILADEAWAELGEIPKEDV
FT                   ALIREKATFDIDRILEIEEETRHDVVAFTRAVSESLSEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTTIIADKAREHKYTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NMERFDVAAKGVEAGKISGAVGNFANIPPFVEEYVCGKLGIRPQEISTQVLPRDLHAEY
FT                   FSALALIATSIERMATEIRGLQKSEQREVEEYFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVVRGHLVTAFENVALWHERDISHSSAERIITPDTTILINYMLNRFGNIVKNLTVFPEN
FT                   MKRNMESTFGLIYSQRVMLSLIEKGMTREEAYDLVQPKTAQSWDNQVDFKPLLEADERV
FT                   TAKLSQEEIDELFNPDYYAKRVDDIFERLGL"
FT   misc_feature    44878..45729
FT                   /gene="purB"
FT                   /locus_tag="SSU0037"
FT                   /note="HMMPfam hit to PF00206, Fumarate lyase, score
FT                   8.8e-91"
FT                   /inference="protein motif:HMMPfam:PF00206"
FT   misc_feature    45652..45681
FT                   /note="PS00163 Fumarate lyases signature."
FT                   /inference="protein motif:Prosite:PS00163"
FT   CDS_pept        47101..47829
FT                   /transl_table=11
FT                   /locus_tag="SSU0039"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44153"
FT                   /protein_id="CAR44153.1"
FT                   /translation="MNMFRSIFKSVIHRRDVALFYAFAGLPILVPILSKFLVGVKAEYT
FT                   DNFLDFLGAALATQDGIVLPVLLLSLIISAVFRDEIDSGILFLYKDLNRTRLFNAKIIS
FT                   LVVMYASYVLLTVLTSAIAYFGFLNASGKVVSDDWSNVQSTFLSIFATISINVIGILLV
FT                   STVSIKAKSLQAVLAGVFWSLFTTTAPLLIGVRYVVPNGYAKMSLDQPLLAWSLVVAIT
FT                   TFYTVATYLKGRSNFEKLEF"
FT   sig_peptide     47101..47226
FT                   /locus_tag="SSU0039"
FT                   /note="Signal peptide predicted for SSU0039 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.966) with cleavage site
FT                   probability 0.916 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(47149..47217,47260..47328,47410..47478,47536..47604,
FT                   47623..47691,47734..47793)
FT                   /locus_tag="SSU0039"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0039 by TMHMM2.0 at aa 17-39, 54-76, 104-126, 146-168,
FT                   175-197 and 212-231"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        47839..48417
FT                   /transl_table=11
FT                   /locus_tag="SSU0040"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44162"
FT                   /protein_id="CAR44162.1"
FT                   /translation="MVVRYMRPVALSLALIVLASISYLLATSLVLFSSSQFLQLAYLFS
FT                   IMVGMPIGFILLPSMITKRYQLCQELSEVKFSWKSFVLLAIAIFLVNFWFIQSDEYVNQ
FT                   FIIATCEEFLFRYLIYRILKSEYPTWLAMLVTSLLFGVLLHMNYSLLDNLIIRTPLGLL
FT                   FSVLATRFGLQYAIGGHWIYNLLVSRFPF"
FT   sig_peptide     47839..47937
FT                   /locus_tag="SSU0040"
FT                   /note="Signal peptide predicted for SSU0040 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.763 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(47863..47931,47941..48009,48067..48126,48223..48291,
FT                   48316..48384)
FT                   /locus_tag="SSU0040"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0040 by TMHMM2.0 at aa 9-31, 35-57, 77-96, 129-151 and
FT                   160-182"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    48130..48411
FT                   /locus_tag="SSU0040"
FT                   /note="HMMPfam hit to PF02517, Abortive infection protein,
FT                   score 1.9e-12"
FT                   /inference="protein motif:HMMPfam:PF02517"
FT   CDS_pept        48429..48860
FT                   /transl_table=11
FT                   /locus_tag="SSU0041"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44165"
FT                   /protein_id="CAR44165.1"
FT                   /translation="MMIFILLLSLFYICLTVASSQLLLSLSVPVLLLLTYLLPPIVNSI
FT                   CMGLQKDKSWKAWSAGIFPTMSMIFYAAFAYITSSNGQWEQFAQLHTVSDDVMSVELAG
FT                   ELLVPSQMLFVAVLYYGTAIATYFIQQAGRKKEKGATYA"
FT   sig_peptide     48429..48503
FT                   /locus_tag="SSU0041"
FT                   /note="Signal peptide predicted for SSU0041 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.784) with cleavage site
FT                   probability 0.163 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(48432..48500,48510..48578,48597..48665,48747..48815)
FT                   /locus_tag="SSU0041"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSU0041 by TMHMM2.0 at aa 2-24, 28-50, 57-79 and 107-129"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        48853..49725
FT                   /transl_table=11
FT                   /locus_tag="SSU0042"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44167"
FT                   /protein_id="CAR44167.1"
FT                   /translation="MLKINHLSKQFAGNEFYSLKDVSLEINKGEIVGLIGKNGAGKSTL
FT                   MKLMAKSLKPSSGTITYKGTDIFSQDNLLADFGIMIDPVFYPEMTVMDNLKFYLDLHGK
FT                   KDLYPNIEKTLKLVELWDARNRKPKGFSFGMKQRTALAIALVAEPDFLILDEPFVGLDP
FT                   IGVQKLIDILKQWSSERQISMLISSHQLGELEALCSRYVYIESGELADAFEGKSHPSVL
FT                   VQLDTTKNLDSVKDLLNDHVVLEGEVLEISTATPTSELNQIFGVLTRQELIVKLEVKEN
FT                   HLKEIFTKG"
FT   misc_feature    48937..49473
FT                   /locus_tag="SSU0042"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 1.8e-47"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    48958..48981
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    49480..49503
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        49731..50504
FT                   /transl_table=11
FT                   /locus_tag="SSU0043"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44170"
FT                   /protein_id="CAR44170.1"
FT                   /translation="MKQIFPAVFRTIWKRKETQVYLLFTLFPFIYLVTSFIEGSNFMQI
FT                   HAGEGYKVSLVAFTNMMVSSADSFILPSLTLYFLAISVFRKEVDEHTMFLYRDLGRKQI
FT                   FWSKYLGLLATIVIFYGLFFVTSAFVHYVRVIHLPFGSPAVFEASLAESLSNVFCIVAY
FT                   LLKDILSISLATALCLYLKNITTMITGFLVTITMMILAIVGGPVAMLFPTSYMTLASEG
FT                   LTGAGLAYLGAICVTIIYVLVFTKIAAKKFKNLEF"
FT   misc_feature    join(49788..49856,49914..49982,50040..50108,50205..50273,
FT                   50292..50360,50403..50462)
FT                   /locus_tag="SSU0043"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0043 by TMHMM2.0 at aa 20-42, 62-84, 104-126, 159-181,
FT                   188-210 and 225-244"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        50507..52219
FT                   /transl_table=11
FT                   /locus_tag="SSU0044"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44172"
FT                   /protein_id="CAR44172.1"
FT                   /translation="MNKRLVGVLLKSLNKTMFLFGIVLSALGVGMGLFLPQFIGKLLDQ
FT                   TYLSNLLTRPELLAGFILFFVSVYAVQALSNYFIGRSGSNALKQLQQYIYESLLTTSVK
FT                   DLDQYQSGDLASRLTNDMSVVLNFITVILPNFLMNGLMVMGSIYFLWTISPWLTGLSLF
FT                   LLPLLSMVMIPMNQRLEGYYSAYQEGLGQVSSRISHKFTTIRLMKAFQGEKHEQREMGK
FT                   SFQYLSQTFEKMIGLSAVQHTLVSSLMTGFIILMLLIAGIEVTKGVMTMATLTTFVLYM
FT                   MQLIDPVTDIAASLNELTEFHAVSKRLVELLELNKEEQVDTELVDATSIQLEKVRFSYH
FT                   TDPILNGVSVRIPEGAHVAIVGPSGAGKSTIFALLMKYYQDYKGKIRIGQQCLSDISTK
FT                   EMRRLISFIPQDNTLFHGTIRENLLYGKNESVSEERIAYILKELGLSPLVAELEDGLDT
FT                   RISENGTGLSEGQKQRFSIARALLLEHPIYLLDEATASLDTVTERVISKAIDRLTAGKT
FT                   RLTIAHRLHTVREADAILVLDKNGQVADYGHHQQLVERNHLYQDFLRGLPQAS"
FT   sig_peptide     50507..50626
FT                   /locus_tag="SSU0044"
FT                   /note="Signal peptide predicted for SSU0044 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.939) with cleavage site
FT                   probability 0.564 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(50555..50623,50675..50743,50876..50935,50945..51013,
FT                   51233..51301)
FT                   /locus_tag="SSU0044"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0044 by TMHMM2.0 at aa 17-39, 57-79, 124-143, 147-169
FT                   and 243-265"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    50558..51370
FT                   /locus_tag="SSU0044"
FT                   /note="HMMPfam hit to PF00664, ABC transporter,
FT                   transmembrane region, score 6.8e-21"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    51569..52129
FT                   /locus_tag="SSU0044"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 7.5e-54"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    51590..51613
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        52789..53790
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SSU0046"
FT                   /product="Holliday junction DNA helicase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44174"
FT                   /protein_id="CAR44174.1"
FT                   /translation="MTNRILDMEQMQDEEYVERTLRPQKLNEYIGQDKVKDQLKIFIEA
FT                   AKLRDEALDHTLLFGPPGLGKTTMAFVIANELGVNIKQTSGPVIEKAGDLVALLNDLEP
FT                   GDVLFIDEIHRMPMAVEEILYSAMEDFYIDIMIGAGEASRSVHLELPPFTLIGATTRAG
FT                   MLSNPLRARFGITGHMEYYELADLTEIVERTADIFDMEITHEAAIELARRSRGTPRIAN
FT                   RLLKRVRDFAQIMGDGLIDDSITDKALTMLDVDREGLDYVDQKILRTMIEMYGGGPVGL
FT                   NTLSVNIAEERETVEDMYEPYLIQQGFLMRTRTGRVATAKAYEHLGYPYTEK"
FT   misc_feature    52795..52950
FT                   /gene="ruvB"
FT                   /locus_tag="SSU0046"
FT                   /note="HMMPfam hit to PF05496, DNA helicase, Holliday
FT                   junction RuvB type, N-terminal, score 5.7e-28"
FT                   /inference="protein motif:HMMPfam:PF05496"
FT   misc_feature    52951..53490
FT                   /gene="ruvB"
FT                   /locus_tag="SSU0046"
FT                   /note="HMMPfam hit to PF00004, AAA ATPase, core, score
FT                   7.1e-28"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    52966..52989
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    53539..53775
FT                   /gene="ruvB"
FT                   /locus_tag="SSU0046"
FT                   /note="HMMPfam hit to PF05491, DNA helicase, Holliday
FT                   junction RuvB type, C-terminal, score 1.5e-53"
FT                   /inference="protein motif:HMMPfam:PF05491"
FT   CDS_pept        53790..54536
FT                   /transl_table=11
FT                   /locus_tag="SSU0047"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44178"
FT                   /protein_id="CAR44178.1"
FT                   /translation="MAEQMRQAARLFGDWPETIIWTCLEGVMGDIYVDDSQLPQSALAL
FT                   YGRQSFFGFLAGQPHRDLLKICEGKDMILVPQNQNWSDLIEGTYGDGIRSFTRYATKKD
FT                   TEFDLGHLQKLVDDLPESFDMKRIDRNLYEACLVEEWSRDLVGNYIDVEQFLDLGLGYV
FT                   ILHKGQVVSGASSYASYSAGIEIEVDTREDYRGLGLAKACAAQLILACLDRGLYPSWDA
FT                   HTLTSLKLAEKLGYQLDKPYQAYEWR"
FT   misc_feature    54273..54500
FT                   /locus_tag="SSU0047"
FT                   /note="HMMPfam hit to PF00583, GCN5-related
FT                   N-acetyltransferase, score 1.5e-05"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        54538..55173
FT                   /transl_table=11
FT                   /locus_tag="SSU0048"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44180"
FT                   /protein_id="CAR44180.1"
FT                   /translation="MTPTFIWDLDGTLLDSYEAILAGIQETYQEYVLPFDRAEVRKFIL
FT                   RYSVKDLLVRDADKYGLDSDELNRVRATSLKEKNTQIPLMAGAVEILNWTAEQGIQNFV
FT                   YTHKSDNAFQVLEDLGVRHHFTEILTSDSGFARKPSPEALLFLIEKYGLDKENTYYIGD
FT                   RLLDVETAVNAGIHSINLQIDGVEQNWKIVSLLDIKQILTDKSSHNNL"
FT   misc_feature    54541..55074
FT                   /locus_tag="SSU0048"
FT                   /note="HMMPfam hit to PF00702, Haloacid dehalogenase-like
FT                   hydrolase, score 8.8e-21"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   CDS_pept        55420..56319
FT                   /transl_table=11
FT                   /locus_tag="SSU0049"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44181"
FT                   /protein_id="CAR44181.1"
FT                   /translation="MNDKEFGQRVRQLRESASMTREQFCDDELELSVRQLTRIEAGASK
FT                   PTFSKIQYIATRLGMGLYELMPDYVSLPERYSKLKFDVLRTPTYGNEDLAEKRDAMMTE
FT                   IYDDYYDELPEEEKIAIDAIQSRIDTLESGTAGFGKEILEDYFEQIFRKRKYELNDLLI
FT                   VRLHLEYVRLSSCDSEIFRQFLKIIEHLHEQINIINSNDLFVLRDTLLSCVNILGSKKY
FT                   YEPIPKIFDSVDKIIQSTQDFQKKPIVSVLKWKYALFVDKDRDEAEKHYLDAVLFAKLI
FT                   ENRELEQKIEEDWRVDNQ"
FT   misc_feature    55447..55614
FT                   /locus_tag="SSU0049"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix type 3,
FT                   score 7.6e-06"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   repeat_region   56474..57993
FT                   /note="putative IS element, novel IS"
FT   CDS_pept        56724..57887
FT                   /transl_table=11
FT                   /locus_tag="SSU0051"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44183"
FT                   /protein_id="CAR44183.1"
FT                   /translation="MDVLYQSCAGIDVHQANIVVCILHGPLTSTRPKREMATFDTTTKG
FT                   LRACHDFLSQFHVEAVGMESTGVYWRPVWHALCDDFELILAQPAHMKAIPGQKTDKKDA
FT                   HWIAKLTRIGLLPRSFVPDETIQELRELTRQRKHYVESRNRETNRIHKFLQSGGIKLTT
FT                   YIEDIMGLSGRNLLQLLVDGTPITPRIVHQSVYTSLKKKVPQLLEALDGYFSDHHRFML
FT                   KQSLEIYDFYQKQIELLEERITVYLSQYENHVETLDSIPGIDVITASVIISEVGVDMSQ
FT                   FPTSGHLASWAGLCPGNNESAGKKRSTKIRHGNSYLKKCLCQAAFAARNQKGSTLADRF
FT                   YQIQSRRGSQKATIALAHQLLKIAYILLKEQMTYPEFLAQKRLLGTS"
FT   misc_feature    56997..57224
FT                   /locus_tag="SSU0051"
FT                   /note="HMMPfam hit to PF01548, Transposase,
FT                   IS111A/IS1328/IS1533, score 1.6e-11"
FT                   /inference="protein motif:HMMPfam:PF01548"
FT   misc_feature    57486..57746
FT                   /locus_tag="SSU0051"
FT                   /note="HMMPfam hit to PF02371, Transposase,
FT                   IS116/IS110/IS902, score 5.9e-24"
FT                   /inference="protein motif:HMMPfam:PF02371"
FT   CDS_pept        complement(58139..58237)
FT                   /transl_table=11
FT                   /locus_tag="SSU0052"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44184"
FT                   /protein_id="CAR44184.1"
FT                   /translation="MVDLFVFYTPNLTITTDANRVRLISNLQQSLL"
FT   repeat_region   complement(58290..59452)
FT                   /note="IS element, novel IS"
FT   repeat_region   58290..58310
FT                   /note="Inverted repeat"
FT   CDS_pept        complement(58425..59363)
FT                   /transl_table=11
FT                   /locus_tag="SSU0053"
FT                   /product="transposase"
FT                   /product="putative transposase"
FT                   /note="CDS is possibly truncated in comparison to some
FT                   proteins. Similar to the C-terminal region of Lactococcus
FT                   lactis subsp. lactis (Streptococcus lactis) putative
FT                   transposase UniProt:O34116 (EMBL:U91581) (439 aa) fasta
FT                   scores: E()=6e-31, 37.456% id in 283 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44187"
FT                   /protein_id="CAR44187.1"
FT                   /translation="MLDQIKAHLLDSINDIVSTANQFLLHPKKDFSRKSQLTRNLDERA
FT                   AFIDMLKTSSFKQALVIMDRGYESYNVMVHCQERNWSYIIRIRVGNHSMKSGFNLPDTP
FT                   CFDEAFDLNICRKQTNEMKQLYRDFPNHYRCLPNHTSFDFLPNSSRKRDPLQFYDLHFR
FT                   MVRLEIKPGFFETLVTNTDYSPEKLKDLYAYRWGIETSFRDLKYSIGLTHFHAKKKEGI
FT                   LQEIYARFINFNVCKWLTSHVTIKTSKLKQTYKICFSDAVYACRKFLREELTSFQLETY
FT                   IAKHLSIIRPNRTFQRKIKSQAPVSFTYRIS"
FT   misc_feature    complement(58659..59345)
FT                   /locus_tag="SSU0053"
FT                   /note="HMMPfam hit to PF01609, Transposase, IS4-like, score
FT                   1.7e-05"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   repeat_region   complement(59432..59452)
FT                   /note="Inverted repeat"
FT   CDS_pept        59503..60723
FT                   /transl_table=11
FT                   /locus_tag="SSU0054"
FT                   /product="putative folylpolyglutamate synthase"
FT                   /note="Weakly similar to SSU0136, 35.680% identity (37.789%
FT                   ungapped) in 412 aa overlap (5-402:9-411)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44188"
FT                   /protein_id="CAR44188.1"
FT                   /translation="MLENWLNTKQGQVFHYKMEKIEYALELLGNPQFAVPVIHVAGTNG
FT                   KGSTIAFMRKLFQAHGMRVGSFVSPHMVSVHDRICIDSQPISDHDFQHYLQKVYDLEQE
FT                   IATRYEPFRYFEVMVLIMFLYFEAQQPDVALVEVGIGGLLDTTNVVAPALSVITSIGMD
FT                   HQDLLGSTLREIAEQKAGIIKESVPVVLGPLSPETTAICRQIAQDNQAPVYQFGQEFTY
FT                   KAGQFSNPDIDLSELVLGLAGHHQEENAAVALQTFLLYMTNIQKDIQPQLIQQALAQTS
FT                   WPGRLELVVQEPKIYLDGAHNVPAIERLLEFIQVQEEPVTILFSALRRKDFQEMLELLE
FT                   EKLPHTPLVLTSFAYDGALAEENRQGRDYVENYQQFIEDWQSSKQGILIVTGSLYFISE
FT                   VRRIFKK"
FT   misc_feature    59614..60273
FT                   /locus_tag="SSU0054"
FT                   /note="HMMPfam hit to PF08245, Mur ligase, central, score
FT                   0.00013"
FT                   /inference="protein motif:HMMPfam:PF08245"
FT   misc_feature    59905..59952
FT                   /note="PS01012 Folylpolyglutamate synthase signature 2."
FT                   /inference="protein motif:Prosite:PS01012"
FT   misc_feature    60346..60603
FT                   /locus_tag="SSU0054"
FT                   /note="HMMPfam hit to PF02875, Mur ligase, C-terminal,
FT                   score 5.2e-05"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   CDS_pept        60748..60861
FT                   /transl_table=11
FT                   /locus_tag="SSU0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44191"
FT                   /protein_id="CAR44191.1"
FT                   /translation="MTHAEKVAFLKEFQENKRHTFRQLEQFAKISRTPDRK"
FT   CDS_pept        60914..62437
FT                   /transl_table=11
FT                   /locus_tag="SSU0056"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44194"
FT                   /protein_id="CAR44194.1"
FT                   /translation="MTELDVVSDVVTHPEETYRRSRRASRRQQVQLNGEFHERVLKTKY
FT                   WPALVWSLVLSVFSVANPLLMPFATNIQTQNLYAGMAMANGQIPYGDFFGTSGLLFYLL
FT                   AFLGHLGGTFIIFGILQFIALLIAGVYFYKIVAYFSQSEHLAISSSHWFYVFIFALGFG
FT                   GMYAEMFALPFLLTSVWFLVRYFENAVRDEAFILYGIDAALVFLIYPKSLILWLVAGLV
FT                   LFIFNIQHRQVTRGIYQLLATIFGFLLILYAVGYYAFEAQILGTAIQQTFLYNLQLDFH
FT                   HSYLYLALAIVSVFLLLSGFFKSFIQMVFSFKQGRHTYIKVLLLLTFLVQCVFIIGNAN
FT                   FQWSQLILLLPYGFAMSVVYLRDEDVEDYSGYLRRQFFLPLAICLGIIAQPVYLYLVQG
FT                   DLRTDREQVANYIDEQTKDSDKIYVWDNSASIYLSSQRLSAATITTAEPYLNTDDNKNS
FT                   LMYDINKNEAKFVVVNKNLPILDEIKTNLESQYQSVQTTDYFTIYQKNE"
FT   misc_feature    join(61052..61120,61181..61249,61262..61330,61367..61462,
FT                   61520..61588,61622..61690,61763..61831,61868..61936,
FT                   62045..62104)
FT                   /locus_tag="SSU0056"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SSU0056 by TMHMM2.0 at aa 47-69, 90-112, 117-139, 152-183,
FT                   203-225, 237-259, 284-306, 319-341 and 378-397"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        62555..64492
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="SSU0057"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44195"
FT                   /protein_id="CAR44195.1"
FT                   /translation="MSHIIELPEILANQIAAGEVIERPASVVKELVENSIDAGASQIEI
FT                   SVEEAGLKMIQITDNGEGIAPDEVALALRRHATSKIKNQSDLFRIRTLGFRGEALPSIA
FT                   SVSHMIIETATADSAHGLHLEAKGGVIEKEEPVSRPVGTQITVSDLFYNTPARLKYVRS
FT                   QQAELSHIVDVVNRLSLAHPEIAFVLVNEGRELIRTAGTGKLRQAISGIYGIASAKKMV
FT                   EIEAEDLDFQISGYVSLPELTRANRNYISIFINGRYIKNFLLNRAILEGYGSKLMVGRF
FT                   PLAVISIEIDPYLADVNVHPTKQEVRISKEKELMTLIREAISQALKEQDLIPDALENLA
FT                   QSSTRPKVKAEQGTLPLREPKIYYDTIKQDFFLKPDVVAEDVKPLEEDRQEIVESPVEN
FT                   RPTSVQFAERQSVESEDQEHPNLSAKELAKLADKLDREETSTFPELEYFGQMHGTYLFA
FT                   QGKTGLYIIDQHAAQERVKYEYYREKIGQVDNSAQQLLVPYIFEFPQNDALDLVHKMDA
FT                   LRQVGVNLEEYGSNQFILREHPIWMKEEEIESGIYEMCDMLLLTDQVSIKQYRAELAIM
FT                   MSCKRSIKANHALDDYSARDLLRQLSYCQNPYNCPHGRPVLVHFSKSDMEKMFRRIQEN
FT                   HTSLRELGKY"
FT   misc_feature    62609..62794
FT                   /gene="mutL"
FT                   /locus_tag="SSU0057"
FT                   /note="HMMPfam hit to PF02518, ATP-binding region,
FT                   ATPase-like, score 4.9e-10"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    62834..62854
FT                   /note="PS00058 DNA mismatch repair proteins mutL / hexB /
FT                   PMS1 signature."
FT                   /inference="protein motif:Prosite:PS00058"
FT   misc_feature    63194..63535
FT                   /gene="mutL"
FT                   /locus_tag="SSU0057"
FT                   /note="HMMPfam hit to PF01119, DNA mismatch repair protein,
FT                   C-terminal, score 9.7e-47"
FT                   /inference="protein motif:HMMPfam:PF01119"
FT   misc_feature    63893..64321
FT                   /gene="mutL"
FT                   /locus_tag="SSU0057"
FT                   /note="HMMPfam hit to PF08676, MutL, C-terminal,
FT                   dimerisation, score 2.6e-54"
FT                   /inference="protein motif:HMMPfam:PF08676"
FT   CDS_pept        64531..65121
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="SSU0058"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44199"
FT                   /protein_id="CAR44199.1"
FT                   /translation="MYDYIKGILTKITAKYIVVETQGVGYILQVANPYAYSGQVQQEVT
FT                   VYTHQVIREDAHLLYGFATENEKSVFLSLISVSGIGPTTALAIIAVDDNDGLVRAIEQK
FT                   NITYLTKFPKIGKKTAQQMILDLEGKFVMSEEAGPVQQVAPSSENIALEEAMEAMEALG
FT                   YRPAELKKIKKFFEGTNDTAENYIKSALKMLMK"
FT   misc_feature    64531..64713
FT                   /gene="ruvA"
FT                   /locus_tag="SSU0058"
FT                   /note="HMMPfam hit to PF01330, DNA helicase, Holliday
FT                   junction RuvA type, domain I, bacterial, score 1.3e-29"
FT                   /inference="protein motif:HMMPfam:PF01330"
FT   misc_feature    64978..65115
FT                   /gene="ruvA"
FT                   /locus_tag="SSU0058"
FT                   /note="HMMPfam hit to PF07499, DNA helicase, Holliday
FT                   junction RuvA type, C-terminal domain III, score 4.1e-08"
FT                   /inference="protein motif:HMMPfam:PF07499"
FT   CDS_pept        complement(65278..65685)
FT                   /transl_table=11
FT                   /locus_tag="SSU0059"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44201"
FT                   /protein_id="CAR44201.1"
FT                   /translation="MSLRRSHNEISCKISVRPSIFSLSFTPFVSGHDMSHKNRHYFCGE
FT                   LVRYLGKSQIAIAVVGAGKNSTGRKRIRLPAPAQLIRPDLMCGTRTNLPINHCAEMLTQ
FT                   TLSNKTKLFNHHTGTLVEHGYDTLKNCQTES"
FT   CDS_pept        65846..66415
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="SSU0060"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44202"
FT                   /protein_id="CAR44202.1"
FT                   /translation="MSRCAWVNPNNPLYIAYHDEEWGKPLHDEQSLFELLCLESYQAGL
FT                   SWEIVLNKRQAFRSAFFNYDIQKVAAMTDSELDSLLTNPDIIRHKAKLYATRANAQAFL
FT                   RVQEEFGTFDTYLWEWVNFTSIDNPVKSFRELPTKNDLSERISKDLKKRGFKFVGPVCI
FT                   YSYLQAAGLLNEHEETCEIGKKLRTN"
FT   misc_feature    65861..66400
FT                   /gene="tag"
FT                   /locus_tag="SSU0060"
FT                   /note="HMMPfam hit to PF03352, Methyladenine glycosylase,
FT                   score 5.6e-93"
FT                   /inference="protein motif:HMMPfam:PF03352"
FT   CDS_pept        66452..67633
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="SSU0061"
FT                   /product="CinA-like protein"
FT                   /note="CDS contains internal deletions relative to
FT                   orthologues, residues 240 to 310"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44205"
FT                   /protein_id="CAR44205.1"
FT                   /translation="MKAELIAVGTEILTGQIINTNAQFLSEKCAELGIDVYFHTAVGDN
FT                   EGRLLSTLEVASKRSNMVVLCGGLGPTEDDLTKQTLATFLGRNLVFDELAMAKLDRFFA
FT                   SRPGRVRTPNNERQAQIVEGSQALQNPAGLAVGGMIEQDGVTYIVLPGPPSELKAMFSE
FT                   SLLPLLSQSQQQLYSRVLRFFGIGESQLVTVLADVIDKQTDPTLAPYAKVGEVTLRLST
FT                   KATSQEEANLRLNQLEEDILQHDKLADYFYAYGEDNSLVKTVATRLAEKRQTIAIVEQG
FT                   TGGLLQAELSLALADQPYFSGGKVVGQLGIESGWLSEEADCIRQELQADLGLAVSVLIK
FT                   PESTEDNVLAKVYLTLATPSGISQKEIDLGGYSWQYLRQLACLQAWDFVRNTL"
FT   misc_feature    66461..66964
FT                   /gene="cinA"
FT                   /locus_tag="SSU0061"
FT                   /note="HMMPfam hit to PF00994, Molybdopterin binding, score
FT                   2.6e-51"
FT                   /inference="protein motif:HMMPfam:PF00994"
FT   misc_feature    67220..67630
FT                   /gene="cinA"
FT                   /locus_tag="SSU0061"
FT                   /note="HMMPfam hit to PF02464, CinA, C-terminal, score
FT                   0.00013"
FT                   /inference="protein motif:HMMPfam:PF02464"
FT   CDS_pept        67685..68836
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="SSU0062"
FT                   /product="RecA recombinase (recombinase A)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44208"
FT                   /protein_id="CAR44208.1"
FT                   /translation="MAKKPGKKLEDITKKFGDERKKALDDALKSIEKDFGKGAVMRLGE
FT                   RAEQKVQVMSSGSLSIDIALGAGGYPKGRIIEIYGPESSGKTTVALHAVAQAQKDGGIA
FT                   AFIDAEHALDPAYAAALGVNIDELLLSQPDSGEQGLEIAGKLIDSGAVDLVVVDSVAAL
FT                   VPRAEIDGDIGDSHVGLQARMMSQAMRKLGASINKTKTVAIFINQLREKVGVMFGNPET
FT                   TPGGRALKFYASVRMDVRGNTQIKGTGDKKDQNVGKETKVKIVKNKVAPPFKEAVVEIM
FT                   YGEGISRTGELIEIGSNLGIIQKAGAWYSYNGEKIGQGSENAKKFLADNPAIFDEIDRK
FT                   IRVHYGLIEADGVEEVATEEAPVVAEEIQDVILDLDGGIELED"
FT   misc_feature    67748..68725
FT                   /gene="recA"
FT                   /locus_tag="SSU0062"
FT                   /note="HMMPfam hit to PF00154, RecA, score 1.5e-239"
FT                   /inference="protein motif:HMMPfam:PF00154"
FT   misc_feature    67922..67945
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    68366..68392
FT                   /note="PS00321 recA signature."
FT                   /inference="protein motif:Prosite:PS00321"
FT   CDS_pept        69072..69470
FT                   /transl_table=11
FT                   /locus_tag="SSU0063"
FT                   /product="regulatory protein Spx"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44209"
FT                   /protein_id="CAR44209.1"
FT                   /translation="MIKIYTVSSCTSCKKAKNWLNAHQLSYNEHNLAKEAITKEEILNI
FT                   LTKTENGIASIVSSKNRYAKSLDFDIEELSVNEVIDLITSNPRILKSPILIDEKRLQVG
FT                   YKEDDIRAFLPRAVRNVENAQARMRAAL"
FT   misc_feature    69084..69416
FT                   /locus_tag="SSU0063"
FT                   /note="HMMPfam hit to PF03960, Arsenate reductase and
FT                   related, score 3.8e-49"
FT                   /inference="protein motif:HMMPfam:PF03960"
FT   CDS_pept        69570..69836
FT                   /transl_table=11
FT                   /locus_tag="SSU0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44211"
FT                   /protein_id="CAR44211.1"
FT                   /translation="MGFTEETVRFRLDDTDKQEISKTLTSVYRSLEEKGYNPINQIIGY
FT                   VLSGDPAYIPRYNDARNQIRKHERDEIIEELVRYYLKGNGIDL"
FT   misc_feature    69579..69815
FT                   /locus_tag="SSU0064"
FT                   /note="HMMPfam hit to PF06135, Protein of unknown function
FT                   DUF965, bacterial, score 1.9e-50"
FT                   /inference="protein motif:HMMPfam:PF06135"
FT   CDS_pept        69836..70255
FT                   /transl_table=11
FT                   /locus_tag="SSU0065"
FT                   /product="putative Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44214"
FT                   /protein_id="CAR44214.1"
FT                   /translation="MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIDEEKGEFGLERL
FT                   TELVEQYKVDKFVVGLPKNMNNTSGPRVEASQAYGDLLTERYKLPVDYQDERLTTVAAE
FT                   RMLIEQADISRGKRKKVIDKLAAQLILQNYLDRTF"
FT   misc_feature    69836..70246
FT                   /locus_tag="SSU0065"
FT                   /note="HMMPfam hit to PF03652, Resolvase, holliday
FT                   junction-type, YqgF-like, score 2.2e-50"
FT                   /inference="protein motif:HMMPfam:PF03652"
FT   CDS_pept        70267..70587
FT                   /transl_table=11
FT                   /locus_tag="SSU0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44215"
FT                   /protein_id="CAR44215.1"
FT                   /translation="MAHHHDHEHDHNHDERELITLVDDQGNETLFEILLTIDGQEEFGK
FT                   NYVLLIPASAEEDENGEVEIQAYSYIENENGTEGDLQPIPEDATAEWDMIEEVFNSFME
FT                   EE"
FT   misc_feature    70312..70581
FT                   /locus_tag="SSU0066"
FT                   /note="HMMPfam hit to PF06949, Protein of unknown function
FT                   DUF1292, score 2.6e-50"
FT                   /inference="protein motif:HMMPfam:PF06949"
FT   CDS_pept        70795..71373
FT                   /transl_table=11
FT                   /locus_tag="SSU0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44216"
FT                   /protein_id="CAR44216.1"
FT                   /translation="MKDSFTERSKKLSEELERCLLADKNILVILDIMDRLNLSDCWLCA
FT                   GTIRNFIWNQYSFDEETDVDLVFFDENISYEETMEIESNLYQNYPAYQWELKNQVYMHI
FT                   HSPNTKPYQSSRDAIEKFPERCTAIGICRTERNKLEIFAPFGLDDIYAYQVRPTPHFLA
FT                   DPNRMELYRQRILKKQWKKRWLSLTVKEI"
FT   misc_feature    70882..71367
FT                   /locus_tag="SSU0067"
FT                   /note="HMMPfam hit to PF06042, Protein of unknown function
FT                   DUF925, bacterial, score 2.3e-77"
FT                   /inference="protein motif:HMMPfam:PF06042"
FT   CDS_pept        71446..71712
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0068"
FT                   /product="putative competence-specific global transcription
FT                   modulator (fragment)"
FT                   /note="Probable gene remnant. Weakly similar to an internal
FT                   region of Streptococcus pneumoniae transcriptional
FT                   regulator ComX2 UniProt:Q97CV2 (EMBL:AE007319) (159 aa)
FT                   fasta scores: E()=0.0002, 35.802% id in 81 aa. Similar to
FT                   an internal region of SSU0016, 68.421% identity (71.233%
FT                   ungapped) in 76 aa overlap (15-87:55-130)"
FT                   /db_xref="PSEUDO:CAR44219.1"
FT   CDS_pept        72036..72344
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SSU0069"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44221"
FT                   /protein_id="CAR44221.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAAKIVETATRTGAQVAGPVPLPTE
FT                   RSFYTIIRATHKYKDSREQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL"
FT   misc_feature    72048..72335
FT                   /gene="rpsJ"
FT                   /locus_tag="SSU0069"
FT                   /note="HMMPfam hit to PF00338, Ribosomal protein S10, score
FT                   1.4e-60"
FT                   /inference="protein motif:HMMPfam:PF00338"
FT   misc_feature    72120..72167
FT                   /note="PS00361 Ribosomal protein S10 signature."
FT                   /inference="protein motif:Prosite:PS00361"
FT   CDS_pept        72441..73067
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SSU0070"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44223"
FT                   /protein_id="CAR44223.1"
FT                   /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YAAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGQEITVETFAAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLAGRMG
FT                   GNRVTIQNLEVVQVVPEKNVILIKGNVPGAKKSLITIKSAVKAGK"
FT   misc_feature    72465..73043
FT                   /gene="rplC"
FT                   /locus_tag="SSU0070"
FT                   /note="HMMPfam hit to PF00297, Ribosomal protein L3, score
FT                   3.1e-94"
FT                   /inference="protein motif:HMMPfam:PF00297"
FT   misc_feature    72738..72809
FT                   /note="PS00474 Ribosomal protein L3 signature."
FT                   /inference="protein motif:Prosite:PS00474"
FT   CDS_pept        73092..73715
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SSU0071"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44224"
FT                   /protein_id="CAR44224.1"
FT                   /translation="MANVTLFDQTGKQAGEVVLNDAIFGIEPNQAVVFDVIISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYAYKLPQK
FT                   VRRLALKSVYSEKVAENKFVAVNSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFA
FT                   ALSARNIPGVKVATATTASVLDIANADKLLVTQAAISKIEEVLA"
FT   misc_feature    73137..73706
FT                   /gene="rplD"
FT                   /locus_tag="SSU0071"
FT                   /note="HMMPfam hit to PF00573, Ribosomal protein L4/L1e,
FT                   score 5.7e-76"
FT                   /inference="protein motif:HMMPfam:PF00573"
FT   CDS_pept        73715..74014
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SSU0072"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44226"
FT                   /protein_id="CAR44226.1"
FT                   /translation="MNLYDVIKKPVITESSMGQLEAGKYVFEVDTRAHKLLIKQAVEAA
FT                   FEGVKVANVNTINVKPKTKRVGRYVGRTNKVKKAIITLAADSKAIELFATADAE"
FT   misc_feature    73724..73999
FT                   /gene="rplW"
FT                   /locus_tag="SSU0072"
FT                   /note="HMMPfam hit to PF00276, Ribosomal protein L25/L23,
FT                   score 2.1e-31"
FT                   /inference="protein motif:HMMPfam:PF00276"
FT   misc_feature    73943..73990
FT                   /note="PS00050 Ribosomal protein L23 signature."
FT                   /inference="protein motif:Prosite:PS00050"
FT   CDS_pept        74032..74865
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SSU0073"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44229"
FT                   /protein_id="CAR44229.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRNN
FT                   NGRITVRHQGGGHKRFYRLVDFKRNKDGVEAIVKTIEYDPNRSANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTVVHNIELKPGRGGELVRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATVGTVGNEQHGLVNLGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNQK"
FT   misc_feature    74155..74385
FT                   /gene="rplB"
FT                   /locus_tag="SSU0073"
FT                   /note="HMMPfam hit to PF00181, Ribosomal protein L2, score
FT                   2.6e-47"
FT                   /inference="protein motif:HMMPfam:PF00181"
FT   misc_feature    74401..74790
FT                   /gene="rplB"
FT                   /locus_tag="SSU0073"
FT                   /note="HMMPfam hit to PF03947, Ribosomal protein L2, score
FT                   1.3e-86"
FT                   /inference="protein motif:HMMPfam:PF03947"
FT   misc_feature    74683..74718
FT                   /note="PS00467 Ribosomal protein L2 signature."
FT                   /inference="protein motif:Prosite:PS00467"
FT   CDS_pept        75116..75397
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SSU0074"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44230"
FT                   /protein_id="CAR44230.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK"
FT   misc_feature    75122..75364
FT                   /gene="rpsS"
FT                   /locus_tag="SSU0074"
FT                   /note="HMMPfam hit to PF00203, Ribosomal protein S19/S15,
FT                   score 3.2e-51"
FT                   /inference="protein motif:HMMPfam:PF00203"
FT   misc_feature    75272..75346
FT                   /note="PS00323 Ribosomal protein S19 signature."
FT                   /inference="protein motif:Prosite:PS00323"
FT   CDS_pept        75415..75759
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SSU0075"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44232"
FT                   /protein_id="CAR44232.1"
FT                   /translation="MAEITSAKATARTVRVSPRKSRLVLDNIRGKSVADAIAILKFTPN
FT                   KAAGIIEGVLNSAIANAENNFGLEKANLVVSEAFANEGPTLKRFRPRAKGSASPINKRT
FT                   AHITVVVAEK"
FT   misc_feature    75439..75753
FT                   /gene="rplV"
FT                   /locus_tag="SSU0075"
FT                   /note="HMMPfam hit to PF00237, Ribosomal protein L22/L17,
FT                   score 1.3e-59"
FT                   /inference="protein motif:HMMPfam:PF00237"
FT   misc_feature    75673..75747
FT                   /note="PS00464 Ribosomal protein L22 signature."
FT                   /inference="protein motif:Prosite:PS00464"
FT   CDS_pept        75772..76425
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SSU0076"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44234"
FT                   /protein_id="CAR44234.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRNFIKKE
FT                   LADASTSTIEIERAVNKVIVSIHTAKPGMVIGKAGSNVDALRAQLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGESIARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEALTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   misc_feature    75775..75954
FT                   /gene="rpsC"
FT                   /locus_tag="SSU0076"
FT                   /note="HMMPfam hit to PF00417, Ribosomal protein S3,
FT                   N-terminal, score 3.8e-28"
FT                   /inference="protein motif:HMMPfam:PF00417"
FT   misc_feature    75955..76119
FT                   /gene="rpsC"
FT                   /locus_tag="SSU0076"
FT                   /note="HMMPfam hit to PF07650, K Homology, type 2, score
FT                   1.4e-22"
FT                   /inference="protein motif:HMMPfam:PF07650"
FT   misc_feature    76123..76374
FT                   /gene="rpsC"
FT                   /locus_tag="SSU0076"
FT                   /note="HMMPfam hit to PF00189, Ribosomal protein S3,
FT                   C-terminal, score 1e-50"
FT                   /inference="protein motif:HMMPfam:PF00189"
FT   misc_feature    76255..76359
FT                   /note="PS00548 Ribosomal protein S3 signature."
FT                   /inference="protein motif:Prosite:PS00548"
FT   CDS_pept        76429..76842
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SSU0077"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44237"
FT                   /protein_id="CAR44237.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKQVDFGQYGLQATTSSWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EVAGVSEEIAREAFRLAGHKLPVKVKFVKREAE"
FT   misc_feature    76429..76824
FT                   /gene="rplP"
FT                   /locus_tag="SSU0077"
FT                   /note="HMMPfam hit to PF00252, Ribosomal protein L16, score
FT                   2.6e-80"
FT                   /inference="protein motif:HMMPfam:PF00252"
FT   misc_feature    76603..76638
FT                   /note="PS00586 Ribosomal protein L16 signature 1."
FT                   /inference="protein motif:Prosite:PS00586"
FT   misc_feature    76672..76707
FT                   /note="PS00701 Ribosomal protein L16 signature 2."
FT                   /inference="protein motif:Prosite:PS00701"
FT   CDS_pept        76852..77058
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SSU0078"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44240"
FT                   /protein_id="CAR44240.1"
FT                   /translation="MKLQEIKDFVKELRGLSQEELAKKENELKKELFELRFQAAAGQLE
FT                   QTARLNEVKKQIARIKTVQSETK"
FT   misc_feature    76879..77052
FT                   /gene="rpmC"
FT                   /locus_tag="SSU0078"
FT                   /note="HMMPfam hit to PF00831, Ribosomal protein L29, score
FT                   1.2e-28"
FT                   /inference="protein motif:HMMPfam:PF00831"
FT   CDS_pept        77082..77342
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SSU0079"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44244"
FT                   /protein_id="CAR44244.1"
FT                   /translation="MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
FT   misc_feature    77112..77318
FT                   /gene="rpsQ"
FT                   /locus_tag="SSU0079"
FT                   /note="HMMPfam hit to PF00366, Ribosomal protein S17, score
FT                   6.2e-37"
FT                   /inference="protein motif:HMMPfam:PF00366"
FT   misc_feature    77250..77288
FT                   /note="PS00056 Ribosomal protein S17 signature."
FT                   /inference="protein motif:Prosite:PS00056"
FT   CDS_pept        77367..77735
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SSU0080"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44245"
FT                   /protein_id="CAR44245.1"
FT                   /translation="MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDIIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKTGARRADGSYIKFDENAAVIIREDKNPRGTRIFGPVAR
FT                   ELRDGGFMKIVSLAPEVL"
FT   misc_feature    77367..77732
FT                   /gene="rplN"
FT                   /locus_tag="SSU0080"
FT                   /note="HMMPfam hit to PF00238, Ribosomal protein L14b/L23e,
FT                   score 7e-77"
FT                   /inference="protein motif:HMMPfam:PF00238"
FT   misc_feature    77544..77624
FT                   /note="PS00049 Ribosomal protein L14 signature."
FT                   /inference="protein motif:Prosite:PS00049"
FT   CDS_pept        77874..78179
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SSU0081"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44247"
FT                   /protein_id="CAR44247.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGVEAVVVTALPKVNKVIVEGVNIVKKHQ
FT                   KSNSENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
FT   misc_feature    77880..77981
FT                   /gene="rplX"
FT                   /locus_tag="SSU0081"
FT                   /note="HMMPfam hit to PF00467, KOW, score 5.5e-08"
FT                   /inference="protein motif:HMMPfam:PF00467"
FT   misc_feature    77889..77942
FT                   /note="PS01108 Ribosomal protein L24 signature."
FT                   /inference="protein motif:Prosite:PS01108"
FT   CDS_pept        78203..78745
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SSU0082"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44249"
FT                   /protein_id="CAR44249.1"
FT                   /translation="MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGDAV
FT                   SNAKNLEKAAQELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VTVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGMDIVIVTTANT
FT                   DEESRALLTGLGMPFAK"
FT   misc_feature    78275..78445
FT                   /gene="rplE"
FT                   /locus_tag="SSU0082"
FT                   /note="HMMPfam hit to PF00281, Ribosomal protein L5, score
FT                   7.5e-30"
FT                   /inference="protein motif:HMMPfam:PF00281"
FT   misc_feature    78374..78424
FT                   /note="PS00358 Ribosomal protein L5 signature."
FT                   /inference="protein motif:Prosite:PS00358"
FT   misc_feature    78455..78739
FT                   /gene="rplE"
FT                   /locus_tag="SSU0082"
FT                   /note="HMMPfam hit to PF00673, Ribosomal protein L5, score
FT                   2.1e-52"
FT                   /inference="protein motif:HMMPfam:PF00673"
FT   CDS_pept        78760..78945
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SSU0083"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44251"
FT                   /protein_id="CAR44251.1"
FT                   /translation="MAKKSMIAKNKRPAKFSTQAYTRCEKCGRPHSVYRKFKLCRVCFR
FT                   DLAYLGQIPGVTKASW"
FT   misc_feature    78772..78939
FT                   /gene="rpsN"
FT                   /locus_tag="SSU0083"
FT                   /note="HMMPfam hit to PF00253, Ribosomal protein S14, score
FT                   3.6e-18"
FT                   /inference="protein motif:HMMPfam:PF00253"
FT   misc_feature    78826..78894
FT                   /note="PS00527 Ribosomal protein S14 signature."
FT                   /inference="protein motif:Prosite:PS00527"
FT   CDS_pept        79076..79246
FT                   /transl_table=11
FT                   /locus_tag="SSU0084"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44254"
FT                   /protein_id="CAR44254.1"
FT                   /translation="MTDKVKIGTLAKNACVLDRVIFFTQAVARVQMLGCNSIILANSNF
FT                   ALPIRHTLTSK"
FT   CDS_pept        79282..79680
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SSU0085"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44257"
FT                   /protein_id="CAR44257.1"
FT                   /translation="MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIATILKNEGF
FT                   VKNVEFIEDDKQGIIRVFLKYGPNGEKVITNLKRVSKPGLRVYSKREDIPKVLNGLGIA
FT                   IISTSEGLLTDKQARQKNVGGEVIAYVW"
FT   misc_feature    79294..79677
FT                   /gene="rpsH"
FT                   /locus_tag="SSU0085"
FT                   /note="HMMPfam hit to PF00410, Ribosomal protein S8, score
FT                   5.8e-75"
FT                   /inference="protein motif:HMMPfam:PF00410"
FT   misc_feature    79585..79638
FT                   /note="PS00053 Ribosomal protein S8 signature."
FT                   /inference="protein motif:Prosite:PS00053"
FT   CDS_pept        79824..79964
FT                   /transl_table=11
FT                   /locus_tag="SSU0086"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44260"
FT                   /protein_id="CAR44260.1"
FT                   /translation="MFKSDLLIIWYHATKLEQDSLIEHAYNSLKKVKSVSEILTLFVVN
FT                   V"
FT   CDS_pept        80012..80059
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0087"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   (fragment)"
FT                   /note="Possible gene remnant. N-terminus is similar to the
FT                   N-terminal region of Streptococcus pyogenes (serotype M3)
FT                   pure putative phosphoribosylaminoimidazole carboxylase I
FT                   UniProt:Q8K8Y3 (EMBL:AE014136) (203 aa) fasta scores:
FT                   E()=0.041, 81.250% id in 16 aa"
FT   CDS_pept        80146..80682
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SSU0088"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44263"
FT                   /protein_id="CAR44263.1"
FT                   /translation="MSRIGNKVITLPAGVELAQNNGVVTVKGPKGELTREFPTAIEIRV
FT                   EGAEVTLHRPNDSKEMKTIHGTSRANLNNMVVGVSEGFKKELEMRGVGYRAQLAGNKLT
FT                   LAVGKSHPDEVVAPEGITFEVPTPTQIVVSGINKEVVGQTAAYIRSLRAPEPYKGKGIR
FT                   YVGEFVRRKEGKTGK"
FT   misc_feature    80176..80391
FT                   /gene="rplF"
FT                   /locus_tag="SSU0088"
FT                   /note="HMMPfam hit to PF00347, Ribosomal protein L6, score
FT                   8.3e-24"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    80413..80640
FT                   /gene="rplF"
FT                   /locus_tag="SSU0088"
FT                   /note="HMMPfam hit to PF00347, Ribosomal protein L6, score
FT                   1.8e-29"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    80605..80631
FT                   /note="PS00525 Ribosomal protein L6 signature 1."
FT                   /inference="protein motif:Prosite:PS00525"
FT   CDS_pept        80771..81127
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SSU0089"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44266"
FT                   /protein_id="CAR44266.1"
FT                   /translation="MISKPDKNKIRQKRHRRVRGKISGTAARPRLNIFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKEVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYHGRV
FT                   KALAESARENGLKF"
FT   misc_feature    80786..81124
FT                   /gene="rplR"
FT                   /locus_tag="SSU0089"
FT                   /note="HMMPfam hit to PF00861, Ribosomal protein L18/L5,
FT                   score 1.3e-54"
FT                   /inference="protein motif:HMMPfam:PF00861"
FT   CDS_pept        81146..81640
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SSU0090"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44267"
FT                   /protein_id="CAR44267.1"
FT                   /translation="MAFKDNAVEIEERVVAINRVTKVVKGGRRLRFAALVVVGDRNGRV
FT                   GFGTGKAQEVPEAIRKAVESAKKNMIEVPMVGTTIPHEVRSEFGGARVLLKPASEGSGV
FT                   AAGGATRAVIELAGIADVTSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDL
FT                   A"
FT   misc_feature    81170..81370
FT                   /gene="rpsE"
FT                   /locus_tag="SSU0090"
FT                   /note="HMMPfam hit to PF00333, Ribosomal protein S5,
FT                   N-terminal, score 1.2e-40"
FT                   /inference="protein motif:HMMPfam:PF00333"
FT   misc_feature    81224..81322
FT                   /note="PS00585 Ribosomal protein S5 signature."
FT                   /inference="protein motif:Prosite:PS00585"
FT   misc_feature    81395..81616
FT                   /gene="rpsE"
FT                   /locus_tag="SSU0090"
FT                   /note="HMMPfam hit to PF03719, Ribosomal protein S5,
FT                   C-terminal, score 4.3e-34"
FT                   /inference="protein motif:HMMPfam:PF03719"
FT   CDS_pept        81655..81837
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SSU0091"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44270"
FT                   /protein_id="CAR44270.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNPAILG
FT                   MVNAISHLVTVEEVK"
FT   misc_feature    81658..81816
FT                   /gene="rpmD"
FT                   /locus_tag="SSU0091"
FT                   /note="HMMPfam hit to PF00327, Ribosomal protein L30, score
FT                   5.9e-16"
FT                   /inference="protein motif:HMMPfam:PF00327"
FT   misc_feature    81718..81816
FT                   /note="PS00634 Ribosomal protein L30 signature."
FT                   /inference="protein motif:Prosite:PS00634"
FT   CDS_pept        81973..82413
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SSU0092"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44273"
FT                   /protein_id="CAR44273.1"
FT                   /translation="MKLHELQPATGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRPGFEGGQTPLFRRLPKRGFTNINAKEYAIVNLDQLNAFEDGAEVTPVVLIEAGIVKA
FT                   EKSGIKILGNGELTKKLTVKAAKFSKSAEEAITSKGGSVEVI"
FT   misc_feature    81973..82278
FT                   /gene="rplO"
FT                   /locus_tag="SSU0092"
FT                   /note="HMMPfam hit to PF01305, Ribosomal protein L15, score
FT                   6.1e-61"
FT                   /inference="protein motif:HMMPfam:PF01305"
FT   misc_feature    82300..82395
FT                   /gene="rplO"
FT                   /locus_tag="SSU0092"
FT                   /note="HMMPfam hit to PF00256, Ribosomal protein L15, score
FT                   3e-11"
FT                   /inference="protein motif:HMMPfam:PF00256"
FT   misc_feature    82300..82392
FT                   /note="PS00475 Ribosomal protein L15 signature."
FT                   /inference="protein motif:Prosite:PS00475"
FT   CDS_pept        82427..83737
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SSU0093"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44276"
FT                   /protein_id="CAR44276.1"
FT                   /translation="MFFKLLKDALKVKLVRSKILFTIFILFVFRVGTHITVPGVNAKSL
FT                   EALSNLPFLNMLSLVSGNAMRNFSVFALGVSPYITASIIVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYISLVLAFVQSIGITAGFNALSGAKLTNMPLNWQTYLLIGAILTTGSI
FT                   IVTWLGEQISEKGYGNGTSMIIFAGIISSLPGTFHEIYIDRFVNIESSRLGESAIFVAA
FT                   LVVLIFFVVYFTTFVQQAEYKLPIQYTKRAQGAPSSSYLPLKLNPAGVIPVIFAGSITA
FT                   VPTSLIQYFASQNKSAGWLLTVQEYFDYSTAKGMIVYAGLIIAFTFFYTFVQVNPEKTA
FT                   ESLQKSAAYIHGVRPGNGTEQFLSKLLTRLAVIGALFLSFVALLPILAQNLFGLSSSIA
FT                   FLGTSLIIVISTSIEGIKQLEGYLLKRKYVGFLEITE"
FT   sig_peptide     82427..82552
FT                   /gene="secY"
FT                   /locus_tag="SSU0093"
FT                   /note="Signal peptide predicted for SSU0093 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.976) with cleavage site
FT                   probability 0.886 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(82484..82552,82622..82690,82772..82840,82868..82933,
FT                   82952..83020,83078..83137,83231..83299,83369..83422,
FT                   83522..83590,83618..83674)
FT                   /gene="secY"
FT                   /locus_tag="SSU0093"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSU0093 by TMHMM2.0 at aa 20-42, 66-88, 116-138, 148-169,
FT                   176-198, 218-237, 269-291, 315-332, 366-388 and 398-416"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    82631..83680
FT                   /gene="secY"
FT                   /locus_tag="SSU0093"
FT                   /note="HMMPfam hit to PF00344, SecY protein, score
FT                   5.8e-152"
FT                   /inference="protein motif:HMMPfam:PF00344"
FT   misc_feature    82631..82690
FT                   /note="PS00755 Protein secY signature 1."
FT                   /inference="protein motif:Prosite:PS00755"
FT   CDS_pept        83831..84472
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SSU0094"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44279"
FT                   /protein_id="CAR44279.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEKFNVAHISTGDMFRAAMANQTEM
FT                   GILAKSYIDKGDLVPDEVTNGIVKERLVQDDIKEKGFLLDGYPRTIEQAHALDENLADL
FT                   GIELQGVINIEIDPSKLVERLSGRIIHKETGETFHKVFNPPVGDYKEEDFYQREDDKPE
FT                   SVKRRLEVNIAQGQPIIDHYRAKGLVHDIEGDQDIDLVFQAIDTVLSKLQ"
FT   misc_feature    83843..84394
FT                   /gene="adk"
FT                   /locus_tag="SSU0094"
FT                   /note="HMMPfam hit to PF00406, Adenylate kinase, score
FT                   1.1e-89"
FT                   /inference="protein motif:HMMPfam:PF00406"
FT   misc_feature    84074..84109
FT                   /note="PS00113 Adenylate kinase signature."
FT                   /inference="protein motif:Prosite:PS00113"
FT   misc_feature    84212..84265
FT                   /gene="adk"
FT                   /locus_tag="SSU0094"
FT                   /note="HMMPfam hit to PF05191, Adenylate kinase, lid
FT                   region, score 0.0003"
FT                   /inference="protein motif:HMMPfam:PF05191"
FT   CDS_pept        84594..84812
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SSU0095"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44283"
FT                   /protein_id="CAR44283.1"
FT                   /translation="MAKEDVIEIEGKVVDTMPNAMFTVELENGHQVLATVSGKIRKNYI
FT                   RILVGDRVTVELSPYDLTRGRITYRFK"
FT   misc_feature    84606..84803
FT                   /gene="infA"
FT                   /locus_tag="SSU0095"
FT                   /note="HMMPfam hit to PF01176, S1, IF1 type, score 1.1e-34"
FT                   /inference="protein motif:HMMPfam:PF01176"
FT   CDS_pept        84837..84953
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SSU0096"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44287"
FT                   /protein_id="CAR44287.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG"
FT   misc_feature    84837..84950
FT                   /gene="rpmJ"
FT                   /locus_tag="SSU0096"
FT                   /note="HMMPfam hit to PF00444, Ribosomal protein L36, score
FT                   3.1e-17"
FT                   /inference="protein motif:HMMPfam:PF00444"
FT   misc_feature    84867..84947
FT                   /note="PS00828 Ribosomal protein L36 signature."
FT                   /inference="protein motif:Prosite:PS00828"
FT   CDS_pept        84973..85338
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SSU0097"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44290"
FT                   /protein_id="CAR44290.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDVRV
FT                   KDLTSDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   misc_feature    84979..85296
FT                   /gene="rpsM"
FT                   /locus_tag="SSU0097"
FT                   /note="HMMPfam hit to PF00416, Ribosomal protein S13, score
FT                   4.2e-55"
FT                   /inference="protein motif:HMMPfam:PF00416"
FT   misc_feature    85231..85272
FT                   /note="PS00646 Ribosomal protein S13 signature."
FT                   /inference="protein motif:Prosite:PS00646"
FT   CDS_pept        85356..85739
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SSU0098"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44292"
FT                   /protein_id="CAR44292.1"
FT                   /translation="MAKPTRKRRVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSA
FT                   GALGFKGSRKSTPFAAQMASEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   misc_feature    85404..85733
FT                   /gene="rpsK"
FT                   /locus_tag="SSU0098"
FT                   /note="HMMPfam hit to PF00411, Ribosomal protein S11, score
FT                   5.4e-72"
FT                   /inference="protein motif:HMMPfam:PF00411"
FT   misc_feature    85638..85706
FT                   /note="PS00054 Ribosomal protein S11 signature."
FT                   /inference="protein motif:Prosite:PS00054"
FT   CDS_pept        85784..86722
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SSU0099"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44293"
FT                   /protein_id="CAR44293.1"
FT                   /translation="MIEFEKPTITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLAS
FT                   LPGAAVTSIKIDGVLHEFDTVPGVREDVMQIILNIKGIAVKSYVEDEKKIELDVVGPAE
FT                   VTAGDILTDSDIEIVNPDHYLFTIADGATFKAVLTVNSGRGYVPAEDNKKDDAPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTLEINTNGTIIPEDALGLSARILMEHLGLF
FT                   TDLTEVAKSAEVMKEAEVASDDRMLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKTEP
FT                   EMMKVRNLGRKSLEEVKVKLADLGLGLKKDK"
FT   misc_feature    85823..86455
FT                   /gene="rpoA"
FT                   /locus_tag="SSU0099"
FT                   /note="HMMPfam hit to PF01193, RNA polymerase,
FT                   dimerisation, score 3.3e-26"
FT                   /inference="protein motif:HMMPfam:PF01193"
FT   misc_feature    85943..86290
FT                   /gene="rpoA"
FT                   /locus_tag="SSU0099"
FT                   /note="HMMPfam hit to PF01000, RNA polymerase, insert,
FT                   score 1.1e-56"
FT                   /inference="protein motif:HMMPfam:PF01000"
FT   misc_feature    86489..86692
FT                   /gene="rpoA"
FT                   /locus_tag="SSU0099"
FT                   /note="HMMPfam hit to PF03118, RNA polymerase, alpha
FT                   subunit, C-terminal, score 2e-30"
FT                   /inference="protein motif:HMMPfam:PF03118"
FT   CDS_pept        86737..87123
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SSU0100"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44295"
FT                   /protein_id="CAR44295.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSATALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   misc_feature    86782..87120
FT                   /gene="rplQ"
FT                   /locus_tag="SSU0100"
FT                   /note="HMMPfam hit to PF01196, Ribosomal protein L17, score
FT                   3.2e-62"
FT                   /inference="protein motif:HMMPfam:PF01196"
FT   misc_feature    86824..86892
FT                   /note="PS01167 Ribosomal protein L17 signature."
FT                   /inference="protein motif:Prosite:PS01167"
FT   rRNA            87774..89317
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            89369..89441
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:89402..89404,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            89721..92625
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            92703..92829
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            92832..92904
FT                   /gene="tRNA-Val"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:92865..92867,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 68.42"
FT   tRNA            92910..92980
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:92942..92944,aa:Gly)"
FT                   /note="tRNA Gly anticodon TCC, Cove score 69.41"
FT   tRNA            93011..93084
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:93045..93047,aa:Ile)"
FT                   /note="tRNA Ile anticodon GAT, Cove score 80.63"
FT   tRNA            93091..93162
FT                   /gene="tRNA-Glu"
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:93124..93126,aa:Glu)"
FT                   /note="tRNA Glu anticodon TTC, Cove score 66.12"
FT   tRNA            93171..93260
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:93207..93209,aa:Ser)"
FT                   /note="tRNA Ser anticodon TGA, Cove score 37.00"
FT   tRNA            93270..93343
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:93304..93306,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 63.79"
FT   tRNA            93359..93431
FT                   /gene="tRNA-Phe"
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:93392..93394,aa:Phe)"
FT                   /note="tRNA Phe anticodon GAA, Cove score 64.99"
FT   tRNA            93452..93532
FT                   /gene="tRNA-Tyr"
FT                   /product="transfer RNA-Tyr"
FT                   /anticodon="(pos:93486..93488,aa:Tyr)"
FT                   /note="tRNA Tyr anticodon GTA, Cove score 55.83"
FT   tRNA            93540..93610
FT                   /gene="tRNA-Trp"
FT                   /product="transfer RNA-Trp"
FT                   /anticodon="(pos:93572..93574,aa:Trp)"
FT                   /note="tRNA Trp anticodon CCA, Cove score 50.14"
FT   tRNA            93618..93690
FT                   /gene="tRNA-His"
FT                   /product="transfer RNA-His"
FT                   /anticodon="(pos:93651..93653,aa:His)"
FT                   /note="tRNA His anticodon GTG, Cove score 60.96"
FT   tRNA            93702..93773
FT                   /gene="tRNA-Gln"
FT                   /product="transfer RNA-Gln"
FT                   /anticodon="(pos:93734..93736,aa:Gln)"
FT                   /note="tRNA Gln anticodon TTG, Cove score 49.54"
FT   tRNA            93785..93868
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:93819..93821,aa:Leu)"
FT                   /note="tRNA Leu anticodon CAA, Cove score 62.17"
FT   repeat_region   93816..93904
FT                   /note="Direct repeat region flanking genomic island"
FT   misc_feature    93905..99896
FT                   /note="Putative genomic island"
FT   CDS_pept        complement(93955..95088)
FT                   /transl_table=11
FT                   /locus_tag="SSU0101"
FT                   /product="putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44300"
FT                   /protein_id="CAR44300.1"
FT                   /translation="MTVKKAKNGTWTVDISDGFHPVTKKRIRIIRKGFKTKKEALELEQ
FT                   YIRVVELKEKRFDFLVTTDMLFDILEEEDRQNNRKISYISTQRNNYERHIKPYFINTNL
FT                   NKLSYEHIFEFREYLKIKPKKQNDSSTLSHNTVNKIMILLKKIFDTGVRKSLIDKNPVE
FT                   NIRKLPISKPTINFWNVEEFNEFRKLITSDEISYDLFFTIAFFTGMRLGEIVALTWYDI
FT                   NLITNSIHITKTAYFVNGTNHINSTKTRAGTRRITINHKLARMLADWKEKQKDLLKEFT
FT                   TDTENLQVIQSTPLPMTKNMIDKKFKQILARNDYLKKIRIHDLRHSHASLLINQGEDYL
FT                   VVKERLGHASITTTIDTYSHLYPSKQKTLANKLDDIF"
FT   misc_feature    complement(93985..94542)
FT                   /locus_tag="SSU0101"
FT                   /note="HMMPfam hit to PF00589, Integrase, catalytic core,
FT                   phage, score 1.6e-23"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   CDS_pept        complement(95078..95284)
FT                   /transl_table=11
FT                   /locus_tag="SSU0102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44303"
FT                   /protein_id="CAR44303.1"
FT                   /translation="MIATVNKNDLVALGFSEGTSKRIIRQGKELLIARGFRVYQNKRVG
FT                   TIPASIATELLGFDVSLGAHHDS"
FT   CDS_pept        complement(95345..96361)
FT                   /transl_table=11
FT                   /locus_tag="SSU0103"
FT                   /product="replication initiation factor"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44305"
FT                   /protein_id="CAR44305.1"
FT                   /translation="MNTVRIDYFAVTVKNIPPESVLTDILLIPLEDFTLNNWGINKYQR
FT                   HYACSEIKVYFNEDRPSMGVFIELKGQGCRQYEEFLDGNENNWIALIGRLYQYSVNFTR
FT                   LDIAHDIFDGSLDVQRVYDYCKKGLCISKAKHFEYHEKSVLENGERVGETVAIGSRGNQ
FT                   QWCIYNKRMEQLSKQELVEYPSWIRAELRCWQDKANIIAEQLFLKRPLSSIYFEAINGH
FT                   YRFVKPNATDTNRWRRKKVKWWLDYLKTENQTVLSVERTKPTLRQSEAWTEKQVAKTLA
FT                   KVYTAKYQAYDVQKAEDYIQGLLKEGLSRLTDNDEKDIEQYIREQNSSPLWGQKKTT"
FT   misc_feature    complement(95393..96064)
FT                   /locus_tag="SSU0103"
FT                   /note="HMMPfam hit to PF02486, Replication initiation
FT                   factor, score 4.4e-11"
FT                   /inference="protein motif:HMMPfam:PF02486"
FT   CDS_pept        complement(96366..96785)
FT                   /transl_table=11
FT                   /locus_tag="SSU0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44306"
FT                   /protein_id="CAR44306.1"
FT                   /translation="MTYNMTDTTLKIGQLDLDMTQFEVPKKIVILSAKVNNRYNEVNGE
FT                   KIKTEEVTKITCTALDADKVKVLTEMGISTDDLKAINLEIVGNVDKVATLAQNESLLNV
FT                   PIELVKPKVRLAWNMARSNWAGVKLVCEDIKILGA"
FT   CDS_pept        complement(96837..96974)
FT                   /transl_table=11
FT                   /locus_tag="SSU0105"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44309"
FT                   /protein_id="CAR44309.1"
FT                   /translation="MHTYMKCTLIGGAHIHEMYSKPLIRKGLRLVGYTEVIETLVGEGI
FT                   "
FT   CDS_pept        complement(97121..98443)
FT                   /transl_table=11
FT                   /locus_tag="SSU0106"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44313"
FT                   /protein_id="CAR44313.1"
FT                   /translation="MRFNPYIITSKRLFLSRVGMDLFLGMLLINTWVSPYSIPIKSVLS
FT                   LIFIGIICSIEKFFKSVFISKIQNILYVRESLFDMLIGLNLYEESDNVVTNSATLNFEI
FT                   LPNDIVMVEVPLFGNKFLKLLKNLEEYLVPTLGLPLLSKYEFPDHVIYKLGKIEEIEQY
FT                   IFNSQTLTRDFFEDIPTPIVKLSNTQQFSLKQNTNLGVYGRTGTGKTIALQWYLFNALA
FT                   KGCGIDTYLAIVDGKGADLYALGALLQEELGKQISVGSSPTSLAKLSRQFVKIMDERFE
FT                   VIKQNSSLNADAYDLGMTPNFLFIDELASIRDSCGSSKQGKELWNEILQNLGLIARKGR
FT                   QAGCHLCLSTQDPNAENIPVELRNQISAVLYLGNIGDDRLKMAFSMCELENVPTISDRK
FT                   GEALFYADGLNSVEPVLTIVPFVDVKTKQDFLQVVRNILPN"
FT   misc_feature    complement(97154..97189)
FT                   /note="PS00327 Bacterial rhodopsins retinal binding site."
FT                   /inference="protein motif:Prosite:PS00327"
FT   misc_feature    complement(97379..97969)
FT                   /locus_tag="SSU0106"
FT                   /note="HMMPfam hit to PF01580, Cell divisionFtsK/SpoIIIE,
FT                   score 3.5e-06"
FT                   /inference="protein motif:HMMPfam:PF01580"
FT   misc_feature    complement(97814..97837)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(98339..98407)
FT                   /locus_tag="SSU0106"
FT                   /note="1 probable transmembrane helix predicted for SSU0106
FT                   by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(98433..98669)
FT                   /transl_table=11
FT                   /locus_tag="SSU0107"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44315"
FT                   /protein_id="CAR44315.1"
FT                   /translation="MKIYKFMFNITYPALVISLYIIFQMKGTMSPWFDTLFVAGGFLVI
FT                   PLLLLLLGYLSENDHGGTDNEANQAESCSTSEV"
FT   misc_feature    complement(join(98505..98573,98601..98657))
FT                   /locus_tag="SSU0107"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0107 by TMHMM2.0 at aa 5-23 and 33-55"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(98724..99044)
FT                   /transl_table=11
FT                   /locus_tag="SSU0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44319"
FT                   /protein_id="CAR44319.1"
FT                   /translation="MKTFKDIFLSEGMEMPNINGIKRVQSFNSDKSVNFTLDDESRDFL
FT                   KENLPIEGVIYEPTLKKLAENIIILNRQKHRISDEFRISLMNKEIYQGYRETSFYTSII
FT                   EA"
FT   CDS_pept        complement(99223..99744)
FT                   /transl_table=11
FT                   /locus_tag="SSU0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44321"
FT                   /protein_id="CAR44321.1"
FT                   /translation="MCISNTTKLIIGVKMRSHLGVRLSYEAKYWLESIQAVIQEKLDAK
FT                   INEQDIENLEHATKSYLKEVDNELGATSVTLILKASASSVLEEAFEKTKSLSLKDWHKL
FT                   DNEMKHSISSIPKDKDVGTLSVRFFLENSIITSLESYQKEFMTSEMVRQVRLSYVLKLV
FT                   IFAYYKEIMQ"
FT   repeat_region   99888..99976
FT                   /note="Direct repeat flanking genomic island, partial tRNA"
FT   CDS_pept        100072..100854
FT                   /transl_table=11
FT                   /locus_tag="SSU0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44322"
FT                   /protein_id="CAR44322.1"
FT                   /translation="MKTLYHYTTVETLLLILNYKTLRFKSLLYVDDPLEPSTSDFGNLG
FT                   GFKYVSCWTDTPNSIPQWTMYSDNMTGVCIGISFDKETDVFLTEKFSLSESSEPIDMVN
FT                   ALHPLKSGLLVTNNKYVPSLEQIRYTDDVSLITPRVVSSDDKSTTINLASNGIYKTTDW
FT                   SFQNEQRFSFQIFPLPIDLVLELMNANKGDLTEIINSFISVKPKEYFDLDLNPTIFSNM
FT                   TITFGKRCSAEDKLKVSKFLEDNKFHIPLFDSTVNIKP"
FT   CDS_pept        complement(join(100851..101189,101220..101366,
FT                   101370..101492))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0111"
FT                   /product="putative integrase (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus mutans tyrosine recombinase XerC
FT                   UniProt:O69155 (EMBL:AE014942) (356 aa) fasta scores:
FT                   E()=0.00011, 27.717% id in 184 aa"
FT                   /db_xref="PSEUDO:CAR44323.1"
FT   misc_feature    complement(join(100881..101189,101220..101366,
FT                   101370..101447))
FT                   /locus_tag="SSU0111"
FT                   /note="HMMPfam hit to PF00589, Integrase, catalytic core,
FT                   phage, score 5.3e-10"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   CDS_pept        101575..102018
FT                   /transl_table=11
FT                   /locus_tag="SSU0112"
FT                   /product="MarR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44325"
FT                   /protein_id="CAR44325.1"
FT                   /translation="MNRIALEIEKYLHEIVLSSENQLEILVGSCQSTVKLTNTQEHILM
FT                   LIEKAAYTNTEIAKELNVSQAAITKATKSLVAQGLLVAVRDDKDARIVRFSLTEAAKPI
FT                   AAEHAHHHAHTLEAYEELLENYSLEEQESIARFLSELVEKIRK"
FT   misc_feature    101680..101886
FT                   /locus_tag="SSU0112"
FT                   /note="HMMPfam hit to PF01047, Bacterial regulatory
FT                   protein, MarR, score 1.5e-13"
FT                   /inference="protein motif:HMMPfam:PF01047"
FT   misc_feature    101728..101793
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1850.000, SD 5.49 at aa 54-75, sequence
FT                   YTNTEIAKELNVSQAAITKATK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        102019..102723
FT                   /transl_table=11
FT                   /locus_tag="SSU0113"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44326"
FT                   /protein_id="CAR44326.1"
FT                   /translation="MRYITVEDLSFYYDKEPVLEHIHYYLDSGEFVTLTGENGAAKTTL
FT                   IKATLGILKPKQGKVSIAEKSIKGKKLRMAYLPQQIASFNAGFPSTVYEFVKSGRYPRQ
FT                   GWFRRLTAHDEEHVRISLESVGMWEHRDKRLGALSGGQKQRAVIARMFASDPDIFILDE
FT                   PTTGMDAGTKDAFYQLMHHSAKKHGKSVLMITHDPDELNKYADRNIHLVRDQQSPWRCF
FT                   NVHEADEEVAHV"
FT   misc_feature    102103..102663
FT                   /locus_tag="SSU0113"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 3.7e-45"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    102430..102474
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        102716..103528
FT                   /transl_table=11
FT                   /locus_tag="SSU0114"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44328"
FT                   /protein_id="CAR44328.1"
FT                   /translation="MFDLSVFHYDFMQRAFLAIIAMSLFSPILGVFLILRRQSLMSDTL
FT                   SHVSLAGVAFGLVLGISPTLSTVLVVIVAAVFLEYLRTIYKNFMEIGTAILMSTGLAIS
FT                   LIVMNKSGGKSGLSLEQYLFGSIVTISQEQVIALFTIAVIVIVLTLLFLRPMYILTFDE
FT                   DTAFVDGLPVRAMSIAFNVVTGVAIALMIPAAGALLVSTIMVLPASIALRLGKSFKAVI
FT                   FTGMGIGFFGMVMGLLTSYYAETPASASITLIFISIFLLVNVVQKFKK"
FT   misc_feature    102737..103513
FT                   /locus_tag="SSU0114"
FT                   /note="HMMPfam hit to PF00950, ABC-3, score 2.3e-102"
FT                   /inference="protein motif:HMMPfam:PF00950"
FT   misc_feature    join(102758..102820,102881..102949,102977..103036,
FT                   103121..103189,103247..103315,103376..103444,
FT                   103457..103510)
FT                   /locus_tag="SSU0114"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SSU0114 by TMHMM2.0 at aa 15-35, 56-78, 88-107, 136-158,
FT                   178-200, 221-243 and 248-265"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        103538..105049
FT                   /transl_table=11
FT                   /gene="adcA"
FT                   /locus_tag="SSU0115"
FT                   /product="zinc-binding protein AdcA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44329"
FT                   /protein_id="CAR44329.1"
FT                   /translation="MKKVGLLFLSVSALLLGACGNSTASEDGKLNIVTTFYPVYEFTKQ
FT                   VAGDEANVDLLVKAGTEVHGYEPSAKDIARIQEADAFVYENENMETWVHDVEKSLDTTK
FT                   VNVISATEGMLLLPGGEEEHEGHDHSEEGHSHAYDPHVWLSPERAITLVENIRDSLVAK
FT                   YPEKKDAFETNAAAYIEKLDALDAKYSETLSAAKQKYFVTQHTAFAYLALDYGLKQVSI
FT                   TGVAADEDPTPSRLAELTEYINKYGIKYIYFEENASKSVAETLAKETGVQLDVLNPLES
FT                   LTDEDMKNGKDYISVMEDNLIALEKTTSQEGSEILPEEGAETAQTVYNGYFEDSAVKDR
FT                   TLSDYAGEWQSVYPYLLDGTLDQVWDYKAKIKGGMTAEEYKTYYDTGYKTDVDQINITD
FT                   NTMEFVVGDKKEKFTYKYVGYKILTYKKGNRGVRFLFEATDANAGNYKYVQFSDHNIAP
FT                   VKTGHFHIYFGGESQEKLLEELENWPTYYPVGLTGLEIGQEMLAH"
FT   sig_peptide     103538..103615
FT                   /gene="adcA"
FT                   /locus_tag="SSU0115"
FT                   /note="Signal peptide predicted for SSU0115 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.612 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    103559..104464
FT                   /gene="adcA"
FT                   /locus_tag="SSU0115"
FT                   /note="HMMPfam hit to PF01297, Periplasmic solute binding
FT                   protein, score 9.6e-101"
FT                   /inference="protein motif:HMMPfam:PF01297"
FT   misc_feature    103562..103594
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    104501..105046
FT                   /gene="adcA"
FT                   /locus_tag="SSU0115"
FT                   /note="HMMPfam hit to PF09223, YodA, score 2e-136"
FT                   /inference="protein motif:HMMPfam:PF09223"
FT   CDS_pept        105134..105622
FT                   /transl_table=11
FT                   /gene="copY"
FT                   /locus_tag="SSU0116"
FT                   /product="putative negative regulator of copper transport
FT                   operon"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44332"
FT                   /protein_id="CAR44332.1"
FT                   /translation="MLGGECVEQTISAAEWQVMRVLWAHPGATSQEIIQALQEGFDWQA
FT                   TTIKTLLGRLRKKNYLRMAKETSKYHYYPLISEEEHLQGQVELLLAAICSTKQGQLVEK
FT                   LLDTGTFSKKSLENLASKISQLQRTAPEQIACRCLAGQCTCGHHHTLRKSTSDVVDLT"
FT   misc_feature    105164..105508
FT                   /gene="copY"
FT                   /locus_tag="SSU0116"
FT                   /note="HMMPfam hit to PF03965, Penicillinase repressor,
FT                   score 5e-36"
FT                   /inference="protein motif:HMMPfam:PF03965"
FT   CDS_pept        105639..105806
FT                   /transl_table=11
FT                   /locus_tag="SSU0117"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44336"
FT                   /protein_id="CAR44336.1"
FT                   /translation="MELYSLLPENAKVVGFYLLLEKRRRSLYFQPSKVPRTFEASLNLI
FT                   FIEYKKGERT"
FT   CDS_pept        105803..106012
FT                   /transl_table=11
FT                   /gene="copZ"
FT                   /locus_tag="SSU0118"
FT                   /product="putative copper chaperone CopZ"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44338"
FT                   /protein_id="CAR44338.1"
FT                   /translation="MKQTLKLKNLSCQNCVKHVTNHLLDLDGVEEVKIQLEEQLAEVAT
FT                   SVAYDLERYQEVLEDTIYEVEELV"
FT   misc_feature    105812..106003
FT                   /gene="copZ"
FT                   /locus_tag="SSU0118"
FT                   /note="HMMPfam hit to PF00403, Heavy metal
FT                   transport/detoxification protein, score 4.9e-08"
FT                   /inference="protein motif:HMMPfam:PF00403"
FT   misc_feature    105821..105910
FT                   /note="PS01047 Heavy-metal-associated domain."
FT                   /inference="protein motif:Prosite:PS01047"
FT   CDS_pept        complement(106040..106417)
FT                   /transl_table=11
FT                   /locus_tag="SSU0119"
FT                   /product="putative histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44340"
FT                   /protein_id="CAR44340.1"
FT                   /translation="MTCIFCHQIEEIDILYQTEYFKVVWDIDPIQTGHLLIISKDHYDT
FT                   LSQVPPTIRYELSDLEVFLTEKLCQTLAIDGVTTACNDRLFNAGTHFHVHLIPRFRSDG
FT                   FWDQISLAQAQLDLTHFLKAL"
FT   misc_feature    complement(106112..106393)
FT                   /locus_tag="SSU0119"
FT                   /note="HMMPfam hit to PF01230, Histidine triad (HIT)
FT                   protein, score 5e-06"
FT                   /inference="protein motif:HMMPfam:PF01230"
FT   misc_feature    complement(106394..106411)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS_pept        complement(106475..107731)
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="SSU0120"
FT                   /product="putative tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44342"
FT                   /protein_id="CAR44342.1"
FT                   /translation="MNIFEELKARGLVFQTTDEEALVKALTEGQVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKDTVDGWVTKIQGQ
FT                   LSRFLDFENGDNKAEMVNNYDWFSDISFIDFLRDVGKYYTVNYMMSKDSVKKRIETGIS
FT                   YTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLRRKADKSGHVMTVPLI
FT                   TDSTGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDDDAVRFLKIFTFLSLDEIAEIE
FT                   KQFDAARHERLAQKILAKEVVTLVHGEEAYNQALNITEQLFAGNIKNLSAKELKQGLSN
FT                   VPNYAVQAEDNLNIVELLVTSGIVNSKRQAREDVQNGAIYVNGERVQDLDYTLSDSDKI
FT                   DGELTVIRRGKKKYSVLTY"
FT   misc_feature    complement(106535..106678)
FT                   /gene="tyrS"
FT                   /locus_tag="SSU0120"
FT                   /note="HMMPfam hit to PF01479, RNA-binding S4, score
FT                   4.9e-10"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   misc_feature    complement(106736..106777)
FT                   /note="PS00287 Cysteine proteases inhibitors signature."
FT                   /inference="protein motif:Prosite:PS00287"
FT   misc_feature    complement(106763..107656)
FT                   /gene="tyrS"
FT                   /locus_tag="SSU0120"
FT                   /note="HMMPfam hit to PF00579, Aminoacyl-tRNA synthetase,
FT                   class Ib, score 2.6e-110"
FT                   /inference="protein motif:HMMPfam:PF00579"
FT   misc_feature    complement(107585..107617)
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00178"
FT   CDS_pept        107885..110308
FT                   /transl_table=11
FT                   /gene="pbp1B"
FT                   /locus_tag="SSU0121"
FT                   /product="putative penicillin-binding protein 1B"
FT                   /note="CDS is truncated at the N-terminus in comparison to
FT                   orthologues, for example Streptococcus pneumoniae Pbp1B
FT                   penicillin-binding protein 1B UniProt:Q75YI4
FT                   (EMBL:AB119810) (820 aa) fasta scores: E()=2.5e-164,
FT                   57.755% id in 793 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44344"
FT                   /protein_id="CAR44344.1"
FT                   /translation="MATKSDKQDFKKKISALGLGDVVGVFLRTLKLLFNSVAVLVFLFG
FT                   LFGAGIGIGFVVSLFDDVKIPKTEELVAKVSEVSRISTVTYSDGSLVSEVNSDLLRVPI
FT                   TSEEVSNYLKQAVIATEDETFETHNGVVPKAVLRAALGSVGLGSSSGGSTLTQQLIKQQ
FT                   LVGDAPTFTRKANEIVSALALERNMTKEEILTIYLNVSPFGRNNQGRNIAGVEAAAQGI
FT                   FGKPAKDLTVPQAAFIAGLPQSPIVYSPYASDGTRKSDEDMVYGIERYQDVLFNMYRAS
FT                   FLTKEEYETYKAYDIKQDFIAPAPVMADTKDYLYYKVMEEAQEVMFDYLVKRDKVSKND
FT                   LKNDETKASYEELAKQELSQGGYTIKSTVDQKIYAAMQSVVANYGSVLDDGNEYVETGS
FT                   VLIDNATGAILGFVGGRDYATNQNNHAFDTLRSPASTIKPLLAYGIAIDQGLIGSASIL
FT                   SDYPTNFSSGQPIMYGSGRGTGMMNLQTAIDRSVNIPAFWTYKMMRNAGVDAKAYMDKM
FT                   NYHIPMYDIESVPLGGGVEISVLTNTNAYQTLANGGVYNKHYIVESITASDGTVVYQHE
FT                   ATPVQVYSKATASIMNQLLRQVVNSGYTTTFKSRLSGLNPQAASSDFVGKTGTSNEVND
FT                   VWLMLSTPRVTLGTWAGNDDNSEMYVWTGYHNNSQYVAHMVDALYNVNADMFAGKFELD
FT                   SSVIASSVVASTGQRAGTTQVNGRQVTVGGAMTTSYWAKNGAPVTSYNFMVGGTDSDRA
FT                   QAWNTIIGSQTATSSSSTQRSSSTRSSTSSSANNTNQSSETQTATSEQANNDSP"
FT   misc_feature    107993..108061
FT                   /gene="pbp1B"
FT                   /locus_tag="SSU0121"
FT                   /note="1 probable transmembrane helix predicted for SSU0121
FT                   by TMHMM2.0 at aa 37-59"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    108128..108646
FT                   /gene="pbp1B"
FT                   /locus_tag="SSU0121"
FT                   /note="HMMPfam hit to PF00912, Glycosyl transferase, family
FT                   51, score 2.8e-79"
FT                   /inference="protein motif:HMMPfam:PF00912"
FT   misc_feature    109073..109771
FT                   /gene="pbp1B"
FT                   /locus_tag="SSU0121"
FT                   /note="HMMPfam hit to PF00905, Penicillin-binding protein,
FT                   transpeptidase, score 1.8e-24"
FT                   /inference="protein motif:HMMPfam:PF00905"
FT   misc_feature    109316..109366
FT                   /note="PS00237 G-protein coupled receptors signature."
FT                   /inference="protein motif:Prosite:PS00237"
FT   CDS_pept        complement(110574..110681)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0121A"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   (fragment)"
FT                   /note="Possible gene remnant. Similar to an internal region
FT                   of Streptococcus pyogenes (serotype M3) pure putative
FT                   phosphoribosylaminoimidazole carboxylase I UniProt:Q8K8Y3
FT                   (EMBL:AE014136) (203 aa) fasta scores: E()=0.041, 81.250%
FT                   id in 16 aa"
FT   CDS_pept        complement(110767..110886)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0121B"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus pyogenes (serotype M6) hypothetical
FT                   protein UniProt:Q5XCE9 (EMBL:CP000003) (95 aa) fasta
FT                   scores: E()=9.1e-06, 71.875% id in 32 aa"
FT   CDS_pept        110943..114515
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="SSU0122"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44349"
FT                   /protein_id="CAR44349.1"
FT                   /translation="MAGHEVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDYGL
FT                   KEVFEDVLPVSNFTDTMELEFVGYELKEPKYTLEEARAHDANYSAPIYVTFRLVNKETG
FT                   EIKTQEVFFGEFPIMTEMGTFIINGAERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIFDIFGDSELVRNTIE
FT                   KDIHKNPADSRTDEALKEIYERLRPGEPKTAESSRSLLTARFFDPRRYDLAPVGRYKIN
FT                   KKLNLRTRLLNQTLAEHVINGETGEIVLEAGTVLSRDVLEKVEAQFDELNLVEYIPNDN
FT                   AVLLEPVLLQKFKIVAPKDPERVVTVIGNANPAENVRTVTPADILAEMSYFLNLAEGLG
FT                   RVDDIDHLGNRRIRAVGELLANQVRIGLTRMERNLRERMSVQDNEVLTPQQIINIRPVT
FT                   AAIKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRM
FT                   CPIETPEGPNIGLINNLSSYGHLNKYGFIQTPYRKIDRATGTVTNEIVWLTADEEDAYI
FT                   VAQSTSPLDENNRFVDKIVMGRHQGNNQEFPADSADFMDVSPKQVVAVATACIPFLEND
FT                   DSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAIIAQHDGKVVYADADKVE
FT                   VRREDGSLDVYHISKFRRSNSGTAYNQRTLVKLGDIVEKGDFIADGPSMENGEMALGQN
FT                   PIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVG
FT                   EDALRNLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTS
FT                   LRVPHGADGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVV
FT                   SRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFDG
FT                   ASSEDLWSTVKEAGMDSDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSV
FT                   GPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYEA
FT                   ITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDNNEVELRDLDEGEDDDIIHVDDL
FT                   EKARAKAAADAAAAFAAEEAEGKE"
FT   misc_feature    111024..112346
FT                   /gene="rpoB"
FT                   /locus_tag="SSU0122"
FT                   /note="HMMPfam hit to PF04563, RNA polymerase, beta
FT                   subunit, protrusion, score 1e-49"
FT                   /inference="protein motif:HMMPfam:PF04563"
FT   misc_feature    111360..111920
FT                   /gene="rpoB"
FT                   /locus_tag="SSU0122"
FT                   /note="HMMPfam hit to PF04561, RNA polymerase Rpb2, domain
FT                   2, score 2.1e-15"
FT                   /inference="protein motif:HMMPfam:PF04561"
FT   misc_feature    112047..112181
FT                   /gene="rpoB"
FT                   /locus_tag="SSU0122"
FT                   /note="HMMPfam hit to PF04561, RNA polymerase Rpb2, domain
FT                   2, score 1.4e-13"
FT                   /inference="protein motif:HMMPfam:PF04561"
FT   misc_feature    112356..112565
FT                   /gene="rpoB"
FT                   /locus_tag="SSU0122"
FT                   /note="HMMPfam hit to PF04565, RNA polymerase Rpb2, domain
FT                   3, score 4.7e-40"
FT                   /inference="protein motif:HMMPfam:PF04565"
FT   misc_feature    112968..114134
FT                   /gene="rpoB"
FT                   /locus_tag="SSU0122"
FT                   /note="HMMPfam hit to PF00562, RNA polymerase Rpb2, domain
FT                   6, score 9e-215"
FT                   /inference="protein motif:HMMPfam:PF00562"
FT   misc_feature    113691..113729
FT                   /note="PS01166 RNA polymerases beta chain signature."
FT                   /inference="protein motif:Prosite:PS01166"
FT   misc_feature    114138..114368
FT                   /gene="rpoB"
FT                   /locus_tag="SSU0122"
FT                   /note="HMMPfam hit to PF04560, RNA polymerase Rpb2, domain
FT                   7, score 2.9e-49"
FT                   /inference="protein motif:HMMPfam:PF04560"
FT   CDS_pept        114693..118340
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="SSU0123"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44351"
FT                   /protein_id="CAR44351.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPERDG
FT                   LFDEVIFGPTKDWECSCGKYKRIRYKGITCDRCGVEVTRAKVRRERMGHIELKAPISHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPKDTPLEHKSIMTEREYRERLREYG
FT                   YGSFVAKMGAEAIQDLLKQVDLPKEIAALKEELKTASGQKRIKAVRRLDVLDAFYKSGN
FT                   KPEWMILNILPVIPPDLRPMVQLDGGRFAASDLNELYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARDIAGNVKAAKRLIERGDDRIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMVF
FT                   KDADEAVMAYRNGYVHLHTRVGIATDSLDKPWKDNQKHKVMMTTVGKILFNAIMPEGLP
FT                   YLQEPNNANLTEGTPDKYFLEPGSDIKAAIAELPINPPFKKKNLGNIIAEIFKRFRTTE
FT                   TSALLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIEESHERVEQIKKQFRRGMITD
FT                   DERYAAVTDEWRSAKEKLEKRLVEKQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMSA
FT                   PNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVI
FT                   IREDDCGTDRGLDIRSITDGKEMIEPLEERLQGRYTKKTVKHPETGAVIIGPNQLITED
FT                   IAREIVNAGVEQVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEP
FT                   GTQLTMRTFHTGGVASNSDITQGLPRVQEIFEARNPKGEAVITEVKGEVIAIEEDASTR
FT                   TKKVFVKGKTGEGEYVVPFTARMKVEVGDQVARGAALTEGSIQPKRLLEVRDVLAVETY
FT                   LLSEVQKVYRSQGVEIGDKHIEVMVRQMLRKVRVMDPGDTDLLMGTLMDITDFTDANAE
FT                   VVIAGGIPATARPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKRDNLLGLKEN
FT                   VIIGKIIPAGTGMARYRNLEPQAINEVEIIEDTVAEELAAEAELEAVTE"
FT   misc_feature    114702..115688
FT                   /gene="rpoC"
FT                   /locus_tag="SSU0123"
FT                   /note="HMMPfam hit to PF04997, RNA polymerase Rpb1, domain
FT                   1, score 1e-150"
FT                   /inference="protein motif:HMMPfam:PF04997"
FT   misc_feature    115692..116120
FT                   /gene="rpoC"
FT                   /locus_tag="SSU0123"
FT                   /note="HMMPfam hit to PF00623, RNA polymerase, alpha
FT                   subunit, score 3.3e-83"
FT                   /inference="protein motif:HMMPfam:PF00623"
FT   misc_feature    116127..116681
FT                   /gene="rpoC"
FT                   /locus_tag="SSU0123"
FT                   /note="HMMPfam hit to PF04983, RNA polymerase Rpb1, domain
FT                   3, score 1.8e-68"
FT                   /inference="protein motif:HMMPfam:PF04983"
FT   misc_feature    116766..116996
FT                   /gene="rpoC"
FT                   /locus_tag="SSU0123"
FT                   /note="HMMPfam hit to PF05000, RNA polymerase Rpb1, domain
FT                   4, score 1e-25"
FT                   /inference="protein motif:HMMPfam:PF05000"
FT   misc_feature    117000..118106
FT                   /gene="rpoC"
FT                   /locus_tag="SSU0123"
FT                   /note="HMMPfam hit to PF04998, RNA polymerase Rpb1, domain
FT                   5, score 4.1e-79"
FT                   /inference="protein motif:HMMPfam:PF04998"
FT   CDS_pept        118490..118855
FT                   /transl_table=11
FT                   /locus_tag="SSU0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44352"
FT                   /protein_id="CAR44352.1"
FT                   /translation="MYQVIKMYGDFEPWWFLDGWEEDVTSRAAFDRYEDALNAFQKEWV
FT                   RLSEDFPMKKSKNGTMVAFWDESDQHWCEECDEYLQRYHSLMLVEARENLPAGFIKQPT
FT                   QPRVRPCKLKQNNCVNE"
FT   misc_feature    118490..118837
FT                   /locus_tag="SSU0124"
FT                   /note="HMMPfam hit to PF06279, Protein of unknown function
FT                   DUF1033, score 8.7e-58"
FT                   /inference="protein motif:HMMPfam:PF06279"
FT   CDS_pept        complement(join(118890..119222,119222..119833))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0125"
FT                   /product="putative microcin immunity protein (pseudogene)"
FT                   /note="CDS contains a frameshift after codon 204. Similar
FT                   to Escherichia coli MccF microcin C7 self-immunity protein
FT                   MccF UniProt:Q47511 (EMBL:ECPMC7A) (344 aa) fasta scores:
FT                   E()=1.2e-10, 31.776% id in 321 aa"
FT                   /db_xref="PSEUDO:CAR44353.1"
FT   misc_feature    complement(join(118920..119222,119222..119806))
FT                   /locus_tag="SSU0125"
FT                   /note="HMMPfam hit to PF02016, Peptidase S66,
FT                   LD-carboxypeptidase A, score 6e-99"
FT                   /inference="protein motif:HMMPfam:PF02016"
FT   misc_feature    complement(119759..119788)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        119919..120869
FT                   /transl_table=11
FT                   /locus_tag="SSU0126"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44354"
FT                   /protein_id="CAR44354.1"
FT                   /translation="MIQEKARKMIEEAVADRVSDIYLVPRGECYQVYHRIMDDREFVQD
FT                   LAEEEVTAIISHFKFLAGLNVGEKRRSQQGSCDYDYGSGEISLRLSTVGDYRGKESLVI
FT                   RLLYDNDKELKFWFEAAERLAEEIKGRGLYLFSGPVGSGKTTLMYHLARLKFPDKQILT
FT                   IEDPVEIKQEDMLQLQLNEAIGATYDNLIKLSLRHRPDLLIIGEIRDAETARAVIRASL
FT                   TGATVFSTVHARSISGVYARMLELGVGPEELNNALQGIAYQRLIGGGGVVDFAKGNYQN
FT                   HSADQWNAQIDRLFAAGHISLRQAETEKITLGSPA"
FT   misc_feature    119919..120725
FT                   /locus_tag="SSU0126"
FT                   /note="HMMPfam hit to PF00437, Bacterial type II secretion
FT                   system protein E, score 2.5e-38"
FT                   /inference="protein motif:HMMPfam:PF00437"
FT   misc_feature    120330..120353
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    120504..120548
FT                   /note="PS00662 Bacterial type II secretion system protein E
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00662"
FT   CDS_pept        120790..121818
FT                   /transl_table=11
FT                   /locus_tag="SSU0127"
FT                   /product="putative competence protein"
FT                   /product="competence protein"
FT                   /note="CDS differs in the length of the N-terminus in
FT                   comparison to orthologues, for example, similar to Bacillus
FT                   subtilis ComG operon protein 2 UniProt:P25954
FT                   (EMBL:BSJH6421) (323 aa) fasta scores: E()=5.6e-08, 25.000%
FT                   id in 324 aa. Possible alternative translational start site
FT                   after codons 5 and 22"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44355"
FT                   /protein_id="CAR44355.1"
FT                   /translation="MIGFLQQDISVFGRQKQKKLPLARQRKVIELFNNLFASGFHLGEI
FT                   VDFLKRSQLLADPYTQVLSDGLLAGKPFSSLLADLRFSDAVVTQVALAEVHGNTSLSLI
FT                   HIQSYLENVSKVRKKLIEVATYPIILLGFLLLIMLGLKNYLLPQLEEGNAATVLINHLP
FT                   TIFLSLSGLSLVAVLAGMVWFRKTNKIKVFSCLAALPFFGKLIQTYLTAYYAREWGSLI
FT                   GQGLDLPQIVGLMQEQQSQLFREIGQDLEQSLSNGQSFHEHIKTYAFFKRELSLIVEYG
FT                   QVKSKLGSELTVYAAECWEDFFSRVNRAMQLIQPLVFLFVALMVVLIYAAMLLPIYQNM
FT                   EL"
FT   misc_feature    120871..121230
FT                   /locus_tag="SSU0127"
FT                   /note="HMMPfam hit to PF00482, Bacterial type II secretion
FT                   system protein, score 4.6e-13"
FT                   /inference="protein motif:HMMPfam:PF00482"
FT   misc_feature    join(121147..121215,121273..121341,121732..121800)
FT                   /locus_tag="SSU0127"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSU0127 by TMHMM2.0 at aa 99-121, 141-163 and 294-316"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    121429..121794
FT                   /locus_tag="SSU0127"
FT                   /note="HMMPfam hit to PF00482, Bacterial type II secretion
FT                   system protein, score 3.8e-19"
FT                   /inference="protein motif:HMMPfam:PF00482"
FT   CDS_pept        121820..122101
FT                   /transl_table=11
FT                   /gene="comYC"
FT                   /locus_tag="SSU0128"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44356"
FT                   /protein_id="CAR44356.1"
FT                   /translation="MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQKK
FT                   GDAAVVKVVESQMELYELEHDEEATVADLQAKGYITEKQAKQYATAKK"
FT   sig_peptide     121820..121933
FT                   /gene="comYC"
FT                   /locus_tag="SSU0128"
FT                   /note="Signal peptide predicted for SSU0128 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993) with cleavage site
FT                   probability 0.567 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    121847..121918
FT                   /gene="comYC"
FT                   /locus_tag="SSU0128"
FT                   /note="HMMPfam hit to PF07963, Prepilin-type
FT                   cleavage/methylation, N-terminal, score 7.4e-07"
FT                   /inference="protein motif:HMMPfam:PF07963"
FT   misc_feature    121847..121909
FT                   /note="PS00409 Prokaryotic N-terminal methylation site."
FT                   /inference="protein motif:Prosite:PS00409"
FT   misc_feature    121856..121924
FT                   /gene="comYC"
FT                   /locus_tag="SSU0128"
FT                   /note="1 probable transmembrane helix predicted for SSU0128
FT                   by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        122082..122489
FT                   /transl_table=11
FT                   /locus_tag="SSU0129"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44360"
FT                   /protein_id="CAR44360.1"
FT                   /translation="MLRRKNKAFTLFESLLTLLVVSFLAVSLSGTVQTVFRSVQEEIFL
FT                   WEFEAIYKDSQKLAASSHKKVNLAIGGQEVTNGYQAVEVPRNVEVLEEKTIQFEEDGGN
FT                   SSLTKIRFHLSQKIVTYQLYIGSGRYKKTEE"
FT   sig_peptide     122082..122192
FT                   /locus_tag="SSU0129"
FT                   /note="Signal peptide predicted for SSU0129 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.775) with cleavage site
FT                   probability 0.744 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        122461..122754
FT                   /transl_table=11
FT                   /locus_tag="SSU0130"
FT                   /product="putative membrane protein"
FT                   /note="Possible alternative translational start site after
FT                   codon 13"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44364"
FT                   /protein_id="CAR44364.1"
FT                   /translation="MVAIRKQKNKAYILLESLVALATLVTICSLILSAVDAGRRRQVWE
FT                   LEQQEVFNLAQMAVQTKQDDLALNGVAVQVQRTAERVAVFHEGKEVLSVVKK"
FT   sig_peptide     122500..122577
FT                   /locus_tag="SSU0130"
FT                   /note="Signal peptide predicted for SSU0130 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.979) with cleavage site
FT                   probability 0.350 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    122512..122565
FT                   /locus_tag="SSU0130"
FT                   /note="1 probable transmembrane helix predicted for SSU0130
FT                   by TMHMM2.0 at aa 5-22"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        122741..123175
FT                   /transl_table=11
FT                   /locus_tag="SSU0131"
FT                   /product="putative membrane protein"
FT                   /note="Possible upstream alternative translational start
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44366"
FT                   /protein_id="CAR44366.1"
FT                   /translation="MLKSKIPAFTLLECLVVLVILSGSLLIFEGLSKLLVQEAHYQGQT
FT                   VQKEWLVFSSQLRSEWDQAELVKVENGKVYVNKGEQALAFGKSWSDDFRKTNDRGQGYQ
FT                   PMLYQVDSAAISQENQLVRIDFSFKNGEERTFIYAFKEKS"
FT   CDS_pept        123153..123563
FT                   /transl_table=11
FT                   /locus_tag="SSU0132"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44367"
FT                   /protein_id="CAR44367.1"
FT                   /translation="MLLKKKVKAGILLYALLMLAVFSLLLQFYLHRQEAESRLVQVARQ
FT                   ETTAYIMAQMVLDKVEQDLQVEKIVTGAVVNEKEANLTTGSKQKENRGRVSFQEGQARY
FT                   QLKGDQLLVTVELTSDGLYTYQFPFGLSSEGG"
FT   sig_peptide     123153..123248
FT                   /locus_tag="SSU0132"
FT                   /note="Signal peptide predicted for SSU0132 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993) with cleavage site
FT                   probability 0.434 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    123177..123245
FT                   /locus_tag="SSU0132"
FT                   /note="1 probable transmembrane helix predicted for SSU0132
FT                   by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        123620..124573
FT                   /transl_table=11
FT                   /locus_tag="SSU0133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44368"
FT                   /protein_id="CAR44368.1"
FT                   /translation="MNFEKIEQAYDLLLENVQTIQNQLGTNIYDAMIEQNATYVAGQHE
FT                   TDLVVKNNQTLKQLDLTKEEWRRAYQFLLIKANQTEPMQYNHQFTPDSIGFILSFLVDQ
FT                   LVPTQKVTVLEIGSGTGNLAQTILNASQKELDYLGIEVDDLLIDLSASIADVMQADISF
FT                   AQGDAVRPQILKESQVILGDLPIGYYPDDQIASRYQVASPKEHTYAHHLLMEQSLKYLE
FT                   KDGFAILLAPNDLLTSPQSDLLKGWLQEQANIVAMIALPPNLFGKTAMAKSIFVLQKKA
FT                   ARSLTPFVYPLQSLQEPEAIQKFMLNFKNWKQENAI"
FT   misc_feature    124106..124150
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        124623..125810
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="SSU0134"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44370"
FT                   /protein_id="CAR44370.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYQMPEETVLAAGIIERIGLNDSISTVK
FT                   YDGKKESEVLDIPNHTVAVKILLEDLLKHNIIAAYEEITGIGHRVVAGGEYFKESAVIS
FT                   QQEIEQIEELSALAPLHNPAHVAAMRAFEEVLPEVLNVAVFDTAFHTTMPKHAYLYPIP
FT                   QKYYTDYKVRKYGAHGTSHYYVAHEAAKVLGRPIEELKLITAHIGNGVSITANYHGESV
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYLIANVEELKDAADVVNMLNKQSGLFGVSGFS
FT                   SDMRDIEAGIQAHNPDAVLAYNIFIDRIKKFIGQYLAVLNGADAIVFTAGMGENAPLMR
FT                   NDVVEGLSWFGIELDLEKNVFGNYGDISTAESKVRVLVIPTDEELVIAREVERLK"
FT   misc_feature    124629..125789
FT                   /gene="ackA"
FT                   /locus_tag="SSU0134"
FT                   /note="HMMPfam hit to PF00871, Acetate and butyrate kinase,
FT                   score 8.3e-199"
FT                   /inference="protein motif:HMMPfam:PF00871"
FT   misc_feature    125226..125279
FT                   /note="PS01076 Acetate and butyrate kinases family
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS01076"
FT   CDS_pept        126125..126676
FT                   /transl_table=11
FT                   /locus_tag="SSU0135"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44372"
FT                   /protein_id="CAR44372.1"
FT                   /translation="MEKKIPKLTVQLLAAIAMTLALVMIVENYFSIRISDTLQVQFTFI
FT                   PNTILGAIAGPVWAAVFAAISDPVFVLFSGQTVLFTWILIEAVSAFIYGWFFYRKPLDT
FT                   KNKADWLYVAGVVVLIQVVISFIMTPIALHFHFGTPWIVLYSSRLIKAVFEIPLRIVVT
FT                   MLVLPSLQKIPELAKLMGIK"
FT   sig_peptide     126125..126301
FT                   /locus_tag="SSU0135"
FT                   /note="Signal peptide predicted for SSU0135 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.955) with cleavage site
FT                   probability 0.359 between residues 59 and 60"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(126152..126220,126254..126322,126350..126418,
FT                   126452..126520)
FT                   /locus_tag="SSU0135"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSU0135 by TMHMM2.0 at aa 10-32, 44-66, 76-98 and 110-132"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        126732..127988
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="SSU0136"
FT                   /product="folypolyglutamate synthase"
FT                   /note="Weakly similar to SSU0054, 35.680% identity (37.789%
FT                   ungapped) in 412 aa overlap (9-411:5-402)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44373"
FT                   /protein_id="CAR44373.1"
FT                   /translation="MNYQETRRWLSSRPASDLENGVARVNWILERLDNPQLQVPTVHFV
FT                   GTNGKGSTLNALQSILQSSDYTVGRFTSPSIIDFREQIVYQQEMISEEDFARIVTDLQP
FT                   LIEDLDQTAGLDAISEFEIVVVAMFVYFAHYQRPDILLVEAGMGGLQDATNVLAPLAVV
FT                   CPSIGLDHQAFLGETHAAIARHKVAVLREGVPLIYATDQPEVETVFEEHACQLQSPTYA
FT                   VGREILLENSRAGFAVSSPLGRVEELTLQMQGRHQEVNAALAVTTAQLIKPHFPTITNE
FT                   TIRQGLSQAIWPGRLELIRPNLMIDGAHNNESIAVLTQLLEEKYADRDIEILFAAINTK
FT                   PVDQMLSQLSQFGPVSVTTFDDFRAVQLEDYPSGYERVQTYQEWVEQADLDNPKKLYLI
FT                   TGSLYFITYVRKYILEELV"
FT   misc_feature    127155..127202
FT                   /note="PS01012 Folylpolyglutamate synthase signature 2."
FT                   /inference="protein motif:Prosite:PS01012"
FT   misc_feature    127605..127835
FT                   /gene="folC"
FT                   /locus_tag="SSU0136"
FT                   /note="HMMPfam hit to PF02875, Mur ligase, C-terminal,
FT                   score 0.0047"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   CDS_pept        complement(128035..129096)
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="SSU0137"
FT                   /product="putative glutamyl-aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44375"
FT                   /protein_id="CAR44375.1"
FT                   /translation="MTLFGKIKEVTELQSLPGFEGQVRNHIRQKITPHVDRIETDGLGG
FT                   IFGIKDTAVENAPRILVVAHMDEVGFMISQIKPDGTFRVVELGGWNPLVVSSQAFTLQL
FT                   QDGRTIPAISGSVPPHLSRGANAPGMPAIADIIFDAGFANYDEAWAFGVRPGDVLVPKN
FT                   ETILTANGKNVISKAWDNRFGVLMVTELLESLSGHALPNQLIAGANVQEEVGLRGAHAS
FT                   TTKFNPDIFLAVDCSPAGDIYGDQGKIGDGTLLRFYDPGHIMLKNMKDFLLTTAEEAGV
FT                   KFQYYCGKGGTDAGAAHLKNHGVPSTTIGVCARYIHSHQTLYSMDDFLEAQAFLQTIVK
FT                   KLDRSTVDLIKNY"
FT   misc_feature    complement(128095..128967)
FT                   /gene="pepA"
FT                   /locus_tag="SSU0137"
FT                   /note="HMMPfam hit to PF05343, Peptidase M42, score 8e-128"
FT                   /inference="protein motif:HMMPfam:PF05343"
FT   CDS_pept        129914..130198
FT                   /transl_table=11
FT                   /locus_tag="SSU0139"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44376"
FT                   /protein_id="CAR44376.1"
FT                   /translation="MKKKKTALLAGLLGAGVLTASAQFYRKIQEDRKKAQALQEVRDFF
FT                   ADLGEIATVYVDETASTQTTLIGGVVMEAGQVFLFENTKGSIQYREEER"
FT   sig_peptide     129914..129979
FT                   /locus_tag="SSU0139"
FT                   /note="Signal peptide predicted for SSU0139 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.739 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    129932..129988
FT                   /locus_tag="SSU0139"
FT                   /note="1 probable transmembrane helix predicted for SSU0139
FT                   by TMHMM2.0 at aa 7-25"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        130195..130515
FT                   /transl_table=11
FT                   /locus_tag="SSU0140"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44377"
FT                   /protein_id="CAR44377.1"
FT                   /translation="MIFPTNHEEVAALIEDGKPTVFLFVTTWCGDCHYIKPHVPAIEEA
FT                   FPDLRFVQLDRDDFMPLAQEWAILGIPSLVVLENGKEIGRFVDKNRKTKEEIMNFLSGL
FT                   GR"
FT   misc_feature    130195..130506
FT                   /locus_tag="SSU0140"
FT                   /note="HMMPfam hit to PF00085, Thioredoxin domain, score
FT                   3e-05"
FT                   /inference="protein motif:HMMPfam:PF00085"
FT   CDS_pept        130560..131516
FT                   /transl_table=11
FT                   /locus_tag="SSU0141"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44380"
FT                   /protein_id="CAR44380.1"
FT                   /translation="MKKSLGKILLAPVVLGLSLSLAPLVQAEIQTDVINEKWGKPTLVY
FT                   GGGLSDAQATEVNNLFGISDVNNVSRQVVVGTDMDQYLGTSEADTASLYSSVLVQKQDA
FT                   GKGVVVDIKTPQNITLITETQYANAAITAGATDVLIDVASPIQVTGESALTGVYKALAA
FT                   NGETVDTARTEVAQQELETVNEVATAHTGDTNFDSSALDKAVAEIKTALADYKKSNGQV
FT                   ASEADINTIINDVLAQNGLENVITADEVSKLVTFAKAYQETSAIDSAEVAAQLNQFKQQ
FT                   AEQQISEAYKNLQDSGILEKIGAFFENLWKGLTGLFA"
FT   sig_peptide     130560..130640
FT                   /locus_tag="SSU0141"
FT                   /note="Signal peptide predicted for SSU0141 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.993 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    130692..131396
FT                   /locus_tag="SSU0141"
FT                   /note="HMMPfam hit to PF06207, Protein of unknown function
FT                   DUF1002, score 4.5e-47"
FT                   /inference="protein motif:HMMPfam:PF06207"
FT   CDS_pept        131535..132158
FT                   /transl_table=11
FT                   /locus_tag="SSU0142"
FT                   /product="putative tRNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44385"
FT                   /protein_id="CAR44385.1"
FT                   /translation="MIFTYNKEHVGDVLMVIVAEDKGQAVQFERKGQVARVFLEETGKT
FT                   VAWNIFEASSLVELDGNGQVFLTDEQVATLNAELAKEGFTESLVNDNAPKFVVGQIVEL
FT                   VPHPDSDHLNICQVNVGDKTVQIVAGAPNAAQGLKTIVALPGAMMPSGSLIFPGKLRGE
FT                   DSFGMMCSPRELALPNAPQVRGIIELDDSAVVGEAFDPAKHWKG"
FT   misc_feature    131820..132128
FT                   /locus_tag="SSU0142"
FT                   /note="HMMPfam hit to PF01588, tRNA-binding region, score
FT                   3.8e-22"
FT                   /inference="protein motif:HMMPfam:PF01588"
FT   CDS_pept        complement(132191..132970)
FT                   /transl_table=11
FT                   /locus_tag="SSU0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44387"
FT                   /protein_id="CAR44387.1"
FT                   /translation="MKEFLMEKIQTSQPYTNAELDWLLENIGHPDPTIRDELVYASFCH
FT                   IFLEGLITREQAQSLLQFSQETKPFSLEGPTQKRSFTCLLYCLLLSVDNEPESIYHAFL
FT                   STDDHELLFQQALDYLTIENDWSGYDEKLGWIHTAAHGADFLLATSCHDQFPAEKSKEV
FT                   WQTIVTCLTKQSKVFSAGEEIRLAQIPVYLLLNEKVSSQELTEWISKLDFPNQEPVDYF
FT                   RWLNLQHFLSSLYFQLKSQQASTEEIEQAIEGKIEPA"
FT   CDS_pept        133025..133420
FT                   /transl_table=11
FT                   /locus_tag="SSU0144"
FT                   /product="putative single stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44389"
FT                   /protein_id="CAR44389.1"
FT                   /translation="MYNKTILIGRLTAQPELTQTPTGKNLTRVTVAVNRRFKTENGERE
FT                   ADFLNVIFWGKLAETLVSYGSKGSLISIDGELRTRKYEKDGSNHYVTEILGQSFQLLES
FT                   RAQRAMRENNTGDDLADLVLEEEELPF"
FT   misc_feature    133028..133330
FT                   /locus_tag="SSU0144"
FT                   /note="HMMPfam hit to PF00436, Primosome PriB/single-strand
FT                   DNA-binding, score 1.1e-26"
FT                   /inference="protein motif:HMMPfam:PF00436"
FT   CDS_pept        complement(133539..133685)
FT                   /transl_table=11
FT                   /locus_tag="SSU0145"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44390"
FT                   /protein_id="CAR44390.1"
FT                   /translation="MGKMIFAYLLWLVWWLLFSHPHYIIFFFYGVLLLSLIIMLIEWWK
FT                   YRK"
FT   misc_feature    complement(133554..133622)
FT                   /locus_tag="SSU0145"
FT                   /note="1 probable transmembrane helix predicted for SSU0145
FT                   by TMHMM2.0 at aa 22-44"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        133982..134263
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /gene_synonym="groS"
FT                   /locus_tag="SSU0146"
FT                   /product="10 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44392"
FT                   /protein_id="CAR44392.1"
FT                   /translation="MLKPLGDRIAVKIEEKEQTVGGFVLAGASQEKTKEASVLAIGQGI
FT                   RTLNGDLVAPAVAVGDTVLIDAHAGLEVKDGDQNVHIIRETDILAIVE"
FT   misc_feature    133982..134257
FT                   /gene="groES"
FT                   /gene_synonym="groS"
FT                   /locus_tag="SSU0146"
FT                   /note="HMMPfam hit to PF00166, Chaperonin Cpn10, score
FT                   5.2e-28"
FT                   /inference="protein motif:HMMPfam:PF00166"
FT   misc_feature    133985..134056
FT                   /note="PS00681 Chaperonins cpn10 signature."
FT                   /inference="protein motif:Prosite:PS00681"
FT   CDS_pept        134274..135896
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /gene_synonym="groL"
FT                   /locus_tag="SSU0147"
FT                   /product="60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44396"
FT                   /protein_id="CAR44396.1"
FT                   /translation="MAKEIKFAADARESMVRGVDILADTVKVTLGPKGRNVVLEKAYGS
FT                   PLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLK
FT                   NVTAGANPIGIRRGIEAAVATAVEALKAQASPVSNKAEIAQVAAVSSRSEKVGEYISEA
FT                   MERVGTDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDNEKMVAELENPFILITD
FT                   KKISHIQDILPLLESILQANRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGD
FT                   RRKAMLEDIAILTGGTVITEDLGLDLKDATIEALGQAAKVVVDKDGATIVEGAGNPEAI
FT                   ANRVAVIKSQIEVTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALN
FT                   ATRAAVEEGIVAGGGTALVNVIDSVAKLELKGDDETGRNIVLRALEEPVRQIAYNAGYE
FT                   GSVIIDKLKNSELGTGFNAATGEWVNMMDAGIIDPVKVTRSALQNAASVASLILTTEAV
FT                   VANKPEPAAPAMPQGMDGMGMGY"
FT   misc_feature    134337..135839
FT                   /gene="groEL"
FT                   /gene_synonym="groL"
FT                   /locus_tag="SSU0147"
FT                   /note="HMMPfam hit to PF00118, Chaperonin Cpn60/TCP-1,
FT                   score 7.5e-197"
FT                   /inference="protein motif:HMMPfam:PF00118"
FT   misc_feature    135480..135515
FT                   /note="PS00296 Chaperonins cpn60 signature."
FT                   /inference="protein motif:Prosite:PS00296"
FT   CDS_pept        136128..136541
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SSU0148"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44398"
FT                   /protein_id="CAR44398.1"
FT                   /translation="MPTINQLVRKPRKSKVEKSKSPALNVGYNSRKKVQTNVSSPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLP
FT                   GVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKG"
FT   misc_feature    136131..136535
FT                   /gene="rpsL"
FT                   /locus_tag="SSU0148"
FT                   /note="HMMPfam hit to PF00164, Ribosomal protein S12/S23,
FT                   score 3e-65"
FT                   /inference="protein motif:HMMPfam:PF00164"
FT   misc_feature    136293..136316
FT                   /note="PS00055 Ribosomal protein S12 signature."
FT                   /inference="protein motif:Prosite:PS00055"
FT   CDS_pept        136558..137028
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SSU0149"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44400"
FT                   /protein_id="CAR44400.1"
FT                   /translation="MSRKNQAPKREVLPDPLYNSKLVTRLINRVMLDGKRGTAASIVYG
FT                   AFDQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VTIARNRGEHTMIDRLAKEIMDAANNTGAAVKKREDTHKMAEANRAFAHFRW"
FT   misc_feature    136558..137004
FT                   /gene="rpsG"
FT                   /locus_tag="SSU0149"
FT                   /note="HMMPfam hit to PF00177, Ribosomal protein S7, score
FT                   1.8e-82"
FT                   /inference="protein motif:HMMPfam:PF00177"
FT   misc_feature    136615..136695
FT                   /note="PS00052 Ribosomal protein S7 signature."
FT                   /inference="protein motif:Prosite:PS00052"
FT   CDS_pept        137585..139666
FT                   /transl_table=11
FT                   /gene="fus"
FT                   /locus_tag="SSU0151"
FT                   /product="elongation factor G (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44401"
FT                   /protein_id="CAR44401.1"
FT                   /translation="MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHERLQANAHPIQ
FT                   LPIGSEDEFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLEQAEEYREKLVEAVAETD
FT                   EELMMKYLEGEEITNDELKAAIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSP
FT                   LDIPAIKGVNPDTDAEEERHASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYV
FT                   LNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKIILES
FT                   IHVPEPVIQLMVEPKSKADQDKMGIALSKLAEEDPTFRVETNVETGETVISGMGELHLD
FT                   VLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPIVDVKAKLYDGSYHDVDSS
FT                   ETAFKVAASLALKEAAKSAQPTILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAR
FT                   GNTQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQDEIIKKNGGNA"
FT   misc_feature    137606..138430
FT                   /gene="fus"
FT                   /locus_tag="SSU0151"
FT                   /note="HMMPfam hit to PF00009, Protein synthesis factor,
FT                   GTP-binding, score 1.1e-114"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    137633..137656
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    137735..137782
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    138548..138751
FT                   /gene="fus"
FT                   /locus_tag="SSU0151"
FT                   /note="HMMPfam hit to PF03144, Translation elongation
FT                   factor EFTu/EF1A, domain 2, score 2.7e-18"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    139013..139372
FT                   /gene="fus"
FT                   /locus_tag="SSU0151"
FT                   /note="HMMPfam hit to PF03764, Translation elongation
FT                   factor EFG/EF2, domain IV, score 6.3e-66"
FT                   /inference="protein motif:HMMPfam:PF03764"
FT   misc_feature    139376..139639
FT                   /gene="fus"
FT                   /locus_tag="SSU0151"
FT                   /note="HMMPfam hit to PF00679, Translation elongation
FT                   factor EFG/EF2, C-terminal, score 2.9e-48"
FT                   /inference="protein motif:HMMPfam:PF00679"
FT   repeat_region   complement(139743..139846)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        140655..142646
FT                   /transl_table=11
FT                   /locus_tag="SSU0152"
FT                   /product="putative endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44405"
FT                   /protein_id="CAR44405.1"
FT                   /translation="MRKKLKFSLVAVACATFLTACGTSNSSAPKAGEATPQTDFHSYIN
FT                   AQWLKNTKLGAGESQIDNLSQLSEKTQEAIQEMIDQLDMDYSKLQAGSDEKKLIDFYRL
FT                   AADFDTRNKLGLEPIKPYLEEIKKASTMEELNKILVALYGKNIRNLLHINVTQDIKDSN
FT                   KNTIYVDPHELSFPKENYDGTDEFSLKNQKAFKAYLQEVFSLSGETSKEASSKADLLFN
FT                   LEKEMAAVQRPKEEANNFEAMYNEKTWDEVKALVPNLPIAELVSELGLQNAPTTVVSDP
FT                   DALKNLNELYQEKNLDALKALLQYRVIAHYNAYLSSNLIEAKAKYDGVATGAVDTPSQK
FT                   EVAQAAIDANFSDMIGKVYVKHHFSEESKANILSMVQEIKATYAERIKAVQWMSEETKM
FT                   RALKKLDTLVVKIGYPDQWKDYSQLAIQSKEEGGSLLSNFDMVKTLELREEMGQFGKPF
FT                   DKSQFGMPSHTVNAYYSPTNNEIVFPAGILQAPLYDPKASPEENLGGIGAVIGHEISHA
FT                   FDKAGSQFDEKGNLVNWWKPEDLEKFNKKVQQAADIYSKLEVAPGYYVNGEISTGEIMA
FT                   DLGGLTVAIDIAQKKGYDTKKVFESYGKAWREVTTKEFAIANISDEHPPAKYRVNNIVN
FT                   QIDQFYTDFNVKEGDPMYVKPEDRLRVW"
FT   sig_peptide     140655..140753
FT                   /locus_tag="SSU0152"
FT                   /note="Signal peptide predicted for SSU0152 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.451 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    140685..140717
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    140757..141899
FT                   /locus_tag="SSU0152"
FT                   /note="HMMPfam hit to PF05649, Peptidase M13, score
FT                   9.3e-83"
FT                   /inference="protein motif:HMMPfam:PF05649"
FT   misc_feature    142065..142634
FT                   /locus_tag="SSU0152"
FT                   /note="HMMPfam hit to PF01431, Peptidase M13, neprilysin,
FT                   score 3e-66"
FT                   /inference="protein motif:HMMPfam:PF01431"
FT   misc_feature    142179..142208
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00142"
FT   CDS_pept        143013..144023
FT                   /transl_table=11
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SSU0153"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44407"
FT                   /protein_id="CAR44407.1"
FT                   /translation="MVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPVMLAHLL
FT                   KYDTTQGRFDGTVEVKDGGFEVNGKFVKVSAEREPGNIDWATDGVDIVLEATGFFASKE
FT                   KAEQHIHANGAKKVVVTAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKA
FT                   LHDAFGVQKGLMTTIHGYTGDQMVLDGPHRGGDLRRARAAAANIVPNSTGAAKAIGLVI
FT                   PELNGKLDGAAQRVPVPTGSVTELVATLDKKVTAEEVNAAMKAAATESFGYTEDQLVSS
FT                   DIVGISFGSLFDATQTKVIEVDGEQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK"
FT   misc_feature    143019..143468
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SSU0153"
FT                   /note="HMMPfam hit to PF00044, Glyceraldehyde 3-phosphate
FT                   dehydrogenase, score 1.6e-79"
FT                   /inference="protein motif:HMMPfam:PF00044"
FT   misc_feature    143460..143483
FT                   /note="PS00071 Glyceraldehyde 3-phosphate dehydrogenase
FT                   active site."
FT                   /inference="protein motif:Prosite:PS00071"
FT   misc_feature    143481..143954
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SSU0153"
FT                   /note="HMMPfam hit to PF02800, Glyceraldehyde 3-phosphate
FT                   dehydrogenase, score 1e-100"
FT                   /inference="protein motif:HMMPfam:PF02800"
FT   CDS_pept        144279..145478
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SSU0154"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44408"
FT                   /protein_id="CAR44408.1"
FT                   /translation="MAKLTVKDVELKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIK
FT                   YILEQGGRAILFSHLGRVKEEADKEGKSLAPVAADLAAKLGQDVAFIAGATRGAELEAA
FT                   INALEDGQVLLVENTRFEDVDGKKESKNDEELGKYWASLGDGIFVNDAFGTAHRSHASN
FT                   VGISANVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEKADK
FT                   VLIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKTLLEKANGKLILPVDSKEANAFAGYT
FT                   EVRDTDGEAVSEGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQAGTIGVM
FT                   DAIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPGLAALTEK
FT                   "
FT   misc_feature    144279..145466
FT                   /gene="pgk"
FT                   /locus_tag="SSU0154"
FT                   /note="HMMPfam hit to PF00162, Phosphoglycerate kinase,
FT                   score 6.6e-177"
FT                   /inference="protein motif:HMMPfam:PF00162"
FT   misc_feature    144321..144353
FT                   /note="PS00111 Phosphoglycerate kinase signature."
FT                   /inference="protein motif:Prosite:PS00111"
FT   CDS_pept        146285..146800
FT                   /transl_table=11
FT                   /locus_tag="SSU0155"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44409"
FT                   /protein_id="CAR44409.1"
FT                   /translation="MFKKYTFDPKKFRLGMRTFKSGLAVFLVILLFGFMGWQGIQIAAL
FT                   TAVFSLREDFDQSVHFGASRILGNSIGGFYALLFFILDRLFLDHFWVTAVFVPIFVMLT
FT                   IMTNVAMNNKAGIIGGVSALLIITLSIPAGDTIQYVFIRVFETFIGVFIAILVNYDVNV
FT                   IKKRFQDK"
FT   misc_feature    join(146360..146428,146471..146530,146549..146617,
FT                   146627..146686,146699..146767)
FT                   /locus_tag="SSU0155"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0155 by TMHMM2.0 at aa 13-35, 50-69, 76-98, 102-121 and
FT                   126-148"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        146876..147247
FT                   /transl_table=11
FT                   /gene="glnR"
FT                   /locus_tag="SSU0156"
FT                   /product="MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44410"
FT                   /protein_id="CAR44410.1"
FT                   /translation="MREKEFRRSLAIFPIGSVMKLTDLTARQIRYYEDQGLIKPDRNEG
FT                   NRRLYSLNDMDLLLEIKDFLDEGLNIAAIKKEYANREAKAKVQKQQKTLTDEDVRRILH
FT                   DEFSRQGRFSSPSSIFRSS"
FT   misc_feature    146915..147025
FT                   /gene="glnR"
FT                   /locus_tag="SSU0156"
FT                   /note="HMMPfam hit to PF00376, Bacterial regulatory
FT                   protein, MerR, score 5.5e-11"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   misc_feature    146921..146989
FT                   /note="PS00552 Bacterial regulatory proteins, merR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00552"
FT   CDS_pept        147276..148622
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="SSU0157"
FT                   /product="putative glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44412"
FT                   /protein_id="CAR44412.1"
FT                   /translation="MTFTVADIKRDIKEKNVTFLRLMFTDIMGVMKNVEIPATDEQVEK
FT                   VLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWTIFPWGDENGRVAGLICDIYTTDAKP
FT                   FAGDPRGNLKKSLRHMEEAGFSSFNLGPEPEFFLFKMDEQGNPTLEVNDKGGYFDLAPT
FT                   DLADNTRREIVNVLTEMGFEVEASHHEVAVGQHEIDFKYADVLKACDNIQIFKLVVKTI
FT                   ARKHGMYATFMAKPKFGIAGSGMHCNMSLFDKDGNNAFFDPEDPRGMQLSQTAYHFLGG
FT                   LIKHAYNYTAITNPTVNSYKRLVPGFEAPVYIAWAGKNRSPLVRVPASRGMGTRLELRS
FT                   VDPTANPYLAMAVLLEVGLEGIQNKIEAPAPVESNIYAMSDEERREAGITDLPSTLHNA
FT                   LKALREDEVVRAALGDHIYTNFLEAKKIEWASYATYVSQWEIDNYLDMY"
FT   misc_feature    147321..147575
FT                   /gene="glnA"
FT                   /locus_tag="SSU0157"
FT                   /note="HMMPfam hit to PF03951, Glutamine synthetase,
FT                   beta-Grasp, score 1e-15"
FT                   /inference="protein motif:HMMPfam:PF03951"
FT   misc_feature    147432..147488
FT                   /note="PS00180 Glutamine synthetase signature 1."
FT                   /inference="protein motif:Prosite:PS00180"
FT   misc_feature    147591..148361
FT                   /gene="glnA"
FT                   /locus_tag="SSU0157"
FT                   /note="HMMPfam hit to PF00120, Glutamine synthetase,
FT                   catalytic region, score 1.3e-149"
FT                   /inference="protein motif:HMMPfam:PF00120"
FT   CDS_pept        complement(148845..150524)
FT                   /transl_table=11
FT                   /locus_tag="SSU0158"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44414"
FT                   /protein_id="CAR44414.1"
FT                   /translation="MSSVNLKPHEVGVFAIGGLGEIGKNTYGIEYKDEILIVDAGIKFP
FT                   EDDLLGIDYVIPDYSYIVENLDRVKGLVITHGHEDHIGGIPFLLKQANVPIYAGPLALA
FT                   LIRGKLEEHGLLRDATLHEINHNTELTFKHLKVSFFRTTHSIPEPLGIVVDTPQGKIVC
FT                   TGDFKFDFTPVGEPADLHRMAALGEEGVLCLLSDSTNAEVPTFTNSEKVVGQSIMKLIE
FT                   GIHGRIIFASFASNIFRLQQAADAAVKTGRKIAVFGRSMEKAIVNGIELGYIKVPKDTF
FT                   IEPNEIKEYPASEIMILCTGSQGEPMAALSRIAHGTHRQVQLQPGDTVIFSSSPIPGNT
FT                   TGVNKLINILIEAGVDVIHGKINNIHTSGHGGQQEQKLMLRLIKPKYFMPVHGEYRMQK
FT                   IHASLAVDTGVPKDNIFIMENGDVLALTKDSARLAGQFNAQDIYVDGNRIGEIGAAVLK
FT                   DRRDLSEDGVVLAVATVDFNSKMILAGPDILSRGFIYMRESGELIRESQRVLFNAIRIA
FT                   MRNKDANIQTVNGAIVNALRPFLYEKTEREPIIIPMILTPDR"
FT   misc_feature    complement(149337..149459)
FT                   /locus_tag="SSU0158"
FT                   /note="HMMPfam hit to PF07521, RNA-metabolising
FT                   metallo-beta-lactamase, score 3.7e-16"
FT                   /inference="protein motif:HMMPfam:PF07521"
FT   misc_feature    complement(149343..149429)
FT                   /note="PS01292 Uncharacterized protein family UPF0036
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01292"
FT   misc_feature    complement(149853..150458)
FT                   /locus_tag="SSU0158"
FT                   /note="HMMPfam hit to PF00753, Beta-lactamase-like, score
FT                   3.6e-30"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS_pept        complement(150528..150758)
FT                   /transl_table=11
FT                   /locus_tag="SSU0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44419"
FT                   /protein_id="CAR44419.1"
FT                   /translation="MIYKVFYQESKISPRREQTRALYLDIDAASELEGRIIARELVETN
FT                   RPEYNIEFIDLLSDNHLEYEKEHADFKITEF"
FT   misc_feature    complement(150531..150755)
FT                   /locus_tag="SSU0159"
FT                   /note="HMMPfam hit to PF07288, Protein of unknown function
FT                   DUF1447, score 4.5e-39"
FT                   /inference="protein motif:HMMPfam:PF07288"
FT   CDS_pept        151365..152048
FT                   /transl_table=11
FT                   /locus_tag="SSU0160"
FT                   /product="glycoprotease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44423"
FT                   /protein_id="CAR44423.1"
FT                   /translation="MKILALDSSNQALSVALVEDGRLQAETLLAVKKNHSISLMPVVDF
FT                   LVAQVGWTPKDLDRIVVAQGPGSYTGLRVAVATAKTLAYTLKIDLVGLSSLQSLVPPSL
FT                   TGLVVPLIDARRNCVYAGVYENGRAVEPDRYWSFEDLLSSLSGKENITFVGEVENFMEQ
FT                   IEQALPTAQYQASLPSAYQLAVIGQDLPAVDVTSFEPNYLKHVEAEENWLKDNQVGSES
FT                   YIKRV"
FT   misc_feature    151428..152000
FT                   /locus_tag="SSU0160"
FT                   /note="HMMPfam hit to PF00814, Peptidase M22,
FT                   glycoprotease, score 1.4e-53"
FT                   /inference="protein motif:HMMPfam:PF00814"
FT   CDS_pept        152045..152485
FT                   /transl_table=11
FT                   /locus_tag="SSU0161"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44425"
FT                   /protein_id="CAR44425.1"
FT                   /translation="MIEIKHYDGQENLAEAVLAVMQSVYDQSPWTLEQIVSSMTSQYED
FT                   YYLAYEGQELVGFLAVQTVLDEMEILQIAVKTDFQRLGIASQLMAAVMDWDGDIFLEVR
FT                   ESNSAAQALYTRQHFTKIGKRKDYYRHPVEDAVIMKRERDER"
FT   misc_feature    152183..152404
FT                   /locus_tag="SSU0161"
FT                   /note="HMMPfam hit to PF00583, GCN5-related
FT                   N-acetyltransferase, score 3.1e-17"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        152475..153482
FT                   /transl_table=11
FT                   /locus_tag="SSU0162"
FT                   /product="putative glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44427"
FT                   /protein_id="CAR44427.1"
FT                   /translation="MKDRLILAIETSCDETSVAVLRNDAELLSNVIASQIASHQRFGGV
FT                   VPEVASRHHVEVITACIEEALLEAEVTAEDLTAVAVTYGPGLVGALLVGISAAKAFAWA
FT                   NGLPLIPVNHMAGHLMAARAVKELEFPLLALLVSGGHTELVYVSEAGDYKIVGETRDDA
FT                   VGEAYDKVGRVMGLPYPAGRVIDELAHEGQDIYDFPRAMIKEDNLEFSFSGLKSAFINL
FT                   YHNAQQKGETLSNADLSASFQACVMDILMAKTKKALEQYPVKTLVVAGGVAANQGLRER
FT                   LAAEITDVEVIIPPLRLCGDNAGMIALAAVSEYNKENLAGWDLNAKPSLAFENL"
FT   misc_feature    152550..153398
FT                   /locus_tag="SSU0162"
FT                   /note="HMMPfam hit to PF00814, Peptidase M22,
FT                   glycoprotease, score 3.1e-77"
FT                   /inference="protein motif:HMMPfam:PF00814"
FT   CDS_pept        complement(153519..154355)
FT                   /transl_table=11
FT                   /locus_tag="SSU0163"
FT                   /product="AraC-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44429"
FT                   /protein_id="CAR44429.1"
FT                   /translation="MKIQPEFYVFNNRSYVDFYPIQFGMEACKPLHSFGPTMKQHYLFH
FT                   YIISGSGTFYDTSDQREYHLTAGQGFLISPDAICSYEADEKDPWTYIWLEFDGLKTEHF
FT                   LRQAGLSKEQPIFSQREMPTSSPVYHEMKQILALHHQKSALVLGHLYLFISCLIDCSLT
FT                   KTSSKHDENKEFYIREAINFVERNYEKAISVDDLAQVCNLNRHYFSRLFKEQMNISPQQ
FT                   FIIQYRLSEACELLKNTTKTLQEIAEEIGYSNQFNFSTAFKRHYQISPNRWRKIHK"
FT   misc_feature    complement(153531..153665)
FT                   /locus_tag="SSU0163"
FT                   /note="HMMPfam hit to PF00165, Helix-turn-helix, AraC type,
FT                   score 2.5e-12"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(153546..153674)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    complement(153681..153821)
FT                   /locus_tag="SSU0163"
FT                   /note="HMMPfam hit to PF00165, Helix-turn-helix, AraC type,
FT                   score 2.8e-11"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(153717..153782)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1250.000, SD 3.44 at aa 192-213, sequence
FT                   ISVDDLAQVCNLNRHYFSRLFK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(153876..154301)
FT                   /locus_tag="SSU0163"
FT                   /note="HMMPfam hit to PF02311, AraC protein,
FT                   arabinose-binding/dimerisation, score 4.4e-22"
FT                   /inference="protein motif:HMMPfam:PF02311"
FT   CDS_pept        154570..155844
FT                   /transl_table=11
FT                   /locus_tag="SSU0164"
FT                   /product="extracellular solute-binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44431"
FT                   /protein_id="CAR44431.1"
FT                   /translation="MKKIGRYVTLLAAAGLLAACSTSTESSKTTGGSSSGKTEISYAIW
FT                   DSGQEPGLRKIADEFEKKNPDIKINIQVSDWDSYWTMLEAGATGGSLPDTFWMHSNEIY
FT                   RYGSNEMLLPLDEYLAKSEDAKLANFPDGLNEIYNINGKQYAIPKDFDTIGLWYNKKLF
FT                   DEAGIPYPDDTWDWNKLKEVAKKLTKPDGSQYGFGAGLSNQEGYYNFIYQNGGKVITDD
FT                   LKSGYADPKTIEALDYYFSFVKEKISPAITVDKERAEAFQNGQVAMSVFGSWNLSGFTA
FT                   NDYIRENADVAVLPKGPDGTRATIFNGLGHAIAATTKHPDAAWKWVEYLSSKEAQEMQA
FT                   TLGVAISAYKGAADTWVDSNKNFTIKNYVDMVDYAQIRPYSQTTIKWEDKAYELLKPAY
FT                   LGEKATEEAAKETADMMNAELATEK"
FT   sig_peptide     154570..154650
FT                   /locus_tag="SSU0164"
FT                   /note="Signal peptide predicted for SSU0164 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.873 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    154588..155580
FT                   /locus_tag="SSU0164"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding protein, family 1, score 1.4e-40"
FT                   /inference="protein motif:HMMPfam:PF01547"
FT   misc_feature    154597..154629
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    154660..154683
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        155913..156806
FT                   /transl_table=11
FT                   /locus_tag="SSU0165"
FT                   /product="binding-protein-dependent transport system
FT                   membrane protein"
FT                   /note="Possible alternative upstream translational start
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44432"
FT                   /protein_id="CAR44432.1"
FT                   /translation="MFRKKGSLNEAIWGWGMVAPTIIGLIVLNIIPIFQTMKMSFHKSG
FT                   DFGKGDIFVGLANYQRMLGDAQVWQATWNTLKYTILVVPATVALAMLLAVLLNSKIKGK
FT                   HIYRTIFFLPMVAAPAAVTMVWKWLYNTDFGLINYILRRLGLGAVNWIEDPKIALYSIA
FT                   LIGIWSTVGYSMILILAGLQEIPTDFYEAARIDGASPAKQFFSITLPLVSPTLFFVVVT
FT                   SVIQSMQVFDVIYMMEDVRSPAYDKTVSLVYLFYNNSFKYSDKGYGSTIVMLLLLIILV
FT                   ITFVQMKVQKKWVHYR"
FT   misc_feature    join(155946..156014,156144..156203,156240..156299,
FT                   156390..156458,156519..156587,156708..156767)
FT                   /locus_tag="SSU0165"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0165 by TMHMM2.0 at aa 12-34, 78-97, 110-129, 160-182,
FT                   203-225 and 266-285"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    156114..156797
FT                   /locus_tag="SSU0165"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 2.3e-12"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    156456..156542
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        156817..157647
FT                   /transl_table=11
FT                   /locus_tag="SSU0166"
FT                   /product="putative transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44436"
FT                   /protein_id="CAR44436.1"
FT                   /translation="MKQSAFKSTIWMHAFLILVAMGMLIPFVWMVLTSFKTVTESTQMN
FT                   PFHFLPSNWMVSNYTEAIRTNNFPILYLNTILMMLWRIFSSVMFSAMAAYAFARLEFPG
FT                   RNFLFGLVLFQMMVPPQLFVIPQYLMIDQLGMRNTIFALVFPGIVSAFGTFLLRQFFMG
FT                   LPKELEESAKLDGCNIGQTFFKVMLPLAKSGLIALAIFTALFAFKDLLWPLIINSEADK
FT                   ATLSSALSKIQGAYAVNYPQLMAASVLAIWPMLVLYVIFQKQFIQGIATSGGKL"
FT   sig_peptide     156817..156924
FT                   /locus_tag="SSU0166"
FT                   /note="Signal peptide predicted for SSU0166 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.834) with cleavage site
FT                   probability 0.542 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(156853..156921,157048..157116,157135..157203,
FT                   157231..157299,157360..157428,157531..157599)
FT                   /locus_tag="SSU0166"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0166 by TMHMM2.0 at aa 13-35, 78-100, 107-129, 139-161,
FT                   182-204 and 239-261"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    157030..157629
FT                   /locus_tag="SSU0166"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 3.9e-17"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    157297..157383
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        157657..159858
FT                   /transl_table=11
FT                   /locus_tag="SSU0167"
FT                   /product="putative alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44441"
FT                   /protein_id="CAR44441.1"
FT                   /translation="MGIIFHEKTKEFHLYNEFISYVLTVLPNGHIGSLYYGKRVTETAS
FT                   YQYVREDEYRALTSFVEDDDRFFSLQYANPEFACYGTTDYFSPTFELVQKDGSSLSHFV
FT                   YQGHAIYAGRSALKGLPHLYLDEEGQADSLDIYLLDEDSQTRLVLSYTIFRDYPAVTRS
FT                   ARFEQLGEKSVCLNRALSMTLCLPDMDYDWLHLDGAWGRERHLQLSPLHQGCQSIYSLK
FT                   GASSAEHNPFMALKRPTADEQQGEVLGFSLVYSGNFLAQVDVSSFQKTRVSMGIHPERF
FT                   SWTLDKGEEFQTPEVVMVYSEHGLNGMSQTYHRLFQKHLVRGYWRDRERPVLLNNWEAM
FT                   SFDFDEETILSLAKEAAGLGVELFVMDDGWFGKRNHDRAGLGDWTVNREKLPSGLTGII
FT                   DQVHAMGMKFGLWIEPEMVNRDSELYRAHPDWIFHHPQHSQSHGRHQYTLDLSREDVYQ
FT                   NIHDQLHRLLAEHDIDYIKWDMNRYMTEVFTCTREADRQGETFHRYILNLYRLYDSLIA
FT                   AFPTVLFESCSSGGARFDPGMLYYAPQTWVSDDTDAMERLKIQYGTSMVYPLNSMGCHV
FT                   SASPNQQLGRATPLNTRANVAFFGSFGYELDLFECSQEELEEMKEQIAFYKTHRKIFQQ
FT                   GIFTRLKSPFDGEITAWQVQSSDGQQVIVGYYRRLTTANLSYQRLYLQGLEEEAVYHLD
FT                   GEVYTGSQLMHTGLSIRHGDHVGDNKDFTSCLMVLQKQQ"
FT   misc_feature    158524..159720
FT                   /locus_tag="SSU0167"
FT                   /note="HMMPfam hit to PF02065, Glycoside hydrolase, clan
FT                   GH-D, score 1.8e-233"
FT                   /inference="protein motif:HMMPfam:PF02065"
FT   misc_feature    158734..158781
FT                   /note="PS00512 Alpha-galactosidase signature."
FT                   /inference="protein motif:Prosite:PS00512"
FT   repeat_region   complement(159938..160041)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        160133..160834
FT                   /transl_table=11
FT                   /locus_tag="SSU0168"
FT                   /product="AzlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44443"
FT                   /protein_id="CAR44443.1"
FT                   /translation="MKKYAFREGMRDAIPTVLGYASIGLACGVVSVNSGISTVEMGLMS
FT                   LLIYAGSAQFVMCAMIFAGAPLLSIAVTVFFVNLRNFLMCLHATTIFQGNRLGSNILIG
FT                   SFVTDESYAVLLRKQIEHHTITPEWMYGNNFASYASWVTFTTLGNLIGGLIPNPEQFGL
FT                   DFALVAMFVGIFAGQLEAMVRTIPLKKIGLILLAVGLAYIGLSMMVSSYVAVLLATLLG
FT                   CFVGVMIDDKN"
FT   misc_feature    join(160169..160237,160295..160363,160532..160600,
FT                   160628..160696,160715..160819)
FT                   /locus_tag="SSU0168"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0168 by TMHMM2.0 at aa 13-35, 55-77, 134-156, 166-188
FT                   and 195-229"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    160172..160600
FT                   /locus_tag="SSU0168"
FT                   /note="HMMPfam hit to PF03591, AzlC-like, score 3.4e-60"
FT                   /inference="protein motif:HMMPfam:PF03591"
FT   CDS_pept        160821..161144
FT                   /transl_table=11
FT                   /locus_tag="SSU0169"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44445"
FT                   /protein_id="CAR44445.1"
FT                   /translation="MIKTNILLIILMAALVTWVPRVLPFVLTQNKSLPPKLVKFLSFLP
FT                   ITIIFALTLSSIMDEKVGSLPSFLPVESLAILPTFFVVLKTKNILLAVLVGVVTTALLR
FT                   LIF"
FT   sig_peptide     160821..160904
FT                   /locus_tag="SSU0169"
FT                   /note="Signal peptide predicted for SSU0169 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.907) with cleavage site
FT                   probability 0.490 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(160833..160901,160938..160991,161004..161072,
FT                   161085..161138)
FT                   /locus_tag="SSU0169"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSU0169 by TMHMM2.0 at aa 5-27, 40-57, 62-84 and 89-106"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    160836..161135
FT                   /locus_tag="SSU0169"
FT                   /note="HMMPfam hit to PF05437, Branched-chain amino acid
FT                   transport, score 3.8e-31"
FT                   /inference="protein motif:HMMPfam:PF05437"
FT   CDS_pept        161154..162176
FT                   /transl_table=11
FT                   /locus_tag="SSU0170"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44446"
FT                   /protein_id="CAR44446.1"
FT                   /translation="MVKENAKGVGLCFLLALVGQWLGHLFPLVGGPVFALLIGMGLYPY
FT                   FSSKNAFQSGLTFTSKKILQYAVICLGFGLNLSAVLAVGRQSLPIILSTISFALILAFL
FT                   MWKILPISSHLATLIGVGTSICGGSAIAATAPIIQADDEDVAQAISVIFLFNVLAALVF
FT                   PSLATWLGFSTDSGQAFGMFAGTAVNDTSSVTAAASTWDSLYGLGSQTLDTAVTVKLTR
FT                   TLAIIPITTVLAIWQTRGKGLKADKKSLLAGFPTFILYFILASLITTIAGGFGIGADWF
FT                   APLKSLSKFFICMAMVAIGLRTNVFALVKNGRAALMVGLVCWLGVTVLTLVWQAILGIW
FT                   "
FT   misc_feature    161172..162110
FT                   /locus_tag="SSU0170"
FT                   /note="HMMPfam hit to PF03601, Conserved hypothetical
FT                   protein CHP00698, score 2.7e-90"
FT                   /inference="protein motif:HMMPfam:PF03601"
FT   misc_feature    join(161214..161282,161340..161399,161412..161471,
FT                   161499..161567,161604..161672,161793..161861,
FT                   161898..161966,162009..162077,162096..162164)
FT                   /locus_tag="SSU0170"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SSU0170 by TMHMM2.0 at aa 21-43, 63-82, 87-106, 116-138,
FT                   151-173, 214-236, 249-271, 286-308 and 315-337"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        join(162639..165134,165134..165736,165740..166333)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="epf"
FT                   /locus_tag="SSU0171"
FT                   /product="putative surface-anchored protein (pseudogene)"
FT                   /note="N-terminal region is highly similar to previously
FT                   sequenced as Streptococcus suis extracellular protein
FT                   factor EF UniProt:Q07290 (EMBL:SSEPFAA) (1822 aa) fasta
FT                   scores: E()=0, 75.041% id in 1222 aa. CDS contains a
FT                   frameshift after codon 832, and a nonsense mutation (ochre)
FT                   after codon 1033"
FT                   /db_xref="PSEUDO:CAR44448.1"
FT   sig_peptide     162639..162770
FT                   /gene="epf"
FT                   /locus_tag="SSU0171"
FT                   /note="Signal peptide predicted for SSU0171 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.964 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    162657..162737
FT                   /gene="epf"
FT                   /locus_tag="SSU0171"
FT                   /note="HMMPfam hit to PF04650, YSIRK Gram-positive signal
FT                   peptide, score 1.4e-08"
FT                   /inference="protein motif:HMMPfam:PF04650"
FT   misc_feature    162696..162764
FT                   /gene="epf"
FT                   /locus_tag="SSU0171"
FT                   /note="1 probable transmembrane helix predicted for SSU0171
FT                   by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    164955..165131
FT                   /gene="epf"
FT                   /locus_tag="SSU0171"
FT                   /note="HMMPfam hit to PF07564, Protein of unknown function
FT                   DUF1542, score 1.2e-13"
FT                   /inference="protein motif:HMMPfam:PF07564"
FT   misc_feature    165242..165454
FT                   /gene="epf"
FT                   /locus_tag="SSU0171"
FT                   /note="HMMPfam hit to PF07564, Protein of unknown function
FT                   DUF1542, score 4.7e-13"
FT                   /inference="protein motif:HMMPfam:PF07564"
FT   misc_feature    166199..166318
FT                   /locus_tag="SSU0172"
FT                   /note="HMMPfam hit to PF00746, Surface protein from
FT                   Gram-positive cocci, anchor region, score 1.4e-08"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   misc_feature    166223..166240
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        complement(166553..168175)
FT                   /transl_table=11
FT                   /locus_tag="SSU0173"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44451"
FT                   /protein_id="CAR44451.1"
FT                   /translation="MKTILRYSWYQEKYNLHRSVNGFFYYLRKLPLVGKCIPESIFKSY
FT                   SFKSSLFLVLHILSIPSRFLIKGFWLLFHFYHASFWMNMLVNGELTFWKILPNTWLLGF
FT                   MFWLLFVGLSYRLGKSLDPVISKADREFMQNFSLSQSSFLQSQLFIEPILTTIYYLPAS
FT                   TIFCMITKEWLVFPIGLMTVLAGHLAGHALNRLLFERRIFSRRNSWHAWLWIAFVFVLY
FT                   VLAIVFRNQLSSGMLVPILLVQPFLIWFSYGYLKQQTNHLDYLSYCMDESLQMDKKLFE
FT                   MTKGNEYTRQGLQMQAKLNAKTGKDLSHLSGMTYLNALLFDRYKKVLYKKVQNWVLAVV
FT                   VILAALEGIRYFLDPFTFTEAYLLQFLPLSFMIMYVASSGKVVAQMVFVNCDISMLHYP
FT                   FYREAKTIIAGFNYRFLQTCKLNLIFATSLFLAIMVLGRFAFSLETILLTALLLISLTA
FT                   LFSFHDLFIYYILQPFTNDMDVVNPLYKFLSGALYWVAYLNTRINVGSHTYILLVSLAM
FT                   IAYVSIGYWILLKKAPQTFRLKA"
FT   misc_feature    complement(join(166589..166657,166685..166738,
FT                   166775..166843,166856..166915,167027..167095,
FT                   167123..167182,167411..167479,167492..167551,
FT                   167585..167653,167666..167734,167831..167899,
FT                   167957..168025))
FT                   /locus_tag="SSU0173"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SSU0173 by TMHMM2.0 at aa 51-73, 93-115, 148-170, 175-197,
FT                   209-228, 233-255, 332-351, 361-383, 421-440, 445-467,
FT                   480-497 and 507-529"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(168185..168883)
FT                   /transl_table=11
FT                   /locus_tag="SSU0174"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44453"
FT                   /protein_id="CAR44453.1"
FT                   /translation="MQLKLSSISKKFDHKSILEDASFQFEQGKIYGLLGRNGAGKTTLF
FT                   NCIARNLTLDNGSIQFVKGEETLDYDNTDIGFTQTYPQLPAFMTAYEFVRFYMDIHKDK
FT                   LKSPRSPEEWLNLVGIGEEDQHRLLKDFSHGMQNKVQLLLSLIVQPPVLLLDEPLTSFD
FT                   PVAAHEFKQLIREAKKDSVIIFSTHILQLAQDLCDEIVLLHHQELQAVPSDKLHDPDFE
FT                   QEVVALLTAD"
FT   misc_feature    complement(168266..168802)
FT                   /locus_tag="SSU0174"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 9.8e-38"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(168446..168490)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(168758..168781)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(169239..170414)
FT                   /transl_table=11
FT                   /locus_tag="SSU0175"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44455"
FT                   /protein_id="CAR44455.1"
FT                   /translation="MNTVDTIIIGAGPAGMMAAISSSFYGKKTLLLEKNKRLGKKLSGT
FT                   GGGRCNVTNNGTLEDLLAGIPGNGRFLYSVFSQFDNHDIMNFFQENGVKLKVEDHGRVF
FT                   PTTDRSQTIIKCLEMKMLENGVDIRTGTEVVSVRKMDDLFHVKTSEEVFTAPQLIVTTG
FT                   GKTYPSTGSTGFGHDIARHFKLEVTEIEAAESPVLTDFPHKKLQGISLDDVTLTYGKHV
FT                   ITHDLLFTHFGLSGPAALRLSSFVKGGETAFLDVLPTHSDQDLFEHLEKNREKSVKNTL
FT                   SELMPDRLADFFAENYDSKVKQVSQKDLTELVTLLKVLPIKITGKMSLAKSFVTKGGVD
FT                   LKEINPKTLESKKVPGLHFAGEVLDINAHTGGFNITYCLATGWVAGSSYSS"
FT   misc_feature    complement(169251..170405)
FT                   /locus_tag="SSU0175"
FT                   /note="HMMPfam hit to PF03486, HI0933-like protein, score
FT                   1.8e-203"
FT                   /inference="protein motif:HMMPfam:PF03486"
FT   misc_feature    complement(170337..170396)
FT                   /locus_tag="SSU0175"
FT                   /note="1 probable transmembrane helix predicted for SSU0175
FT                   by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        170652..172052
FT                   /transl_table=11
FT                   /locus_tag="SSU0176"
FT                   /product="putative beta-glucosidase"
FT                   /note="Similar to SSU1861, 74.464% identity (74.464%
FT                   ungapped) in 466 aa overlap (1-466:1-466)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44460"
FT                   /protein_id="CAR44460.1"
FT                   /translation="MVTEQREYRFPEGFLWGSSTSGPQSEGSVAGDGKGWNNWDYWYSQ
FT                   EPELFHQQIGPEQTSTFYEHFQSDLDLLVETCHSIFRTSIQWSRLIPEGIGEVNPQAVE
FT                   FYRAVFAGIRERGIKLLVNLYHFDLPYVLQEKGGWENKEIVWAYEAYARQCFSLFGDLV
FT                   DHWITFNEPIVPVECGYLGSYHYPCKVDAKAAVVVAYHTQLASSLAVRACHQLHPDHKI
FT                   SIVLNLTPAYPRSQSPEDLQAARIAELFQTRSFLDPSVLGQYPRELVDILEKHGLRPET
FT                   TEEELTIIKENRVDFLGVNYYQPLRVQAPSEDGWNGEPTFLSQYFQPYDKPDKKINPHR
FT                   GWEIYEEGLYDIAKNIQENYGNIEWLVTENGMGVEGEGVFEENGMIQDDYRIHFMEDHL
FT                   IQLHRGIDEGANCKGYMVWTFIDCWSWLNTYKNRYGLVSLDLQTQKRTVKKSGYWFKQV
FT                   SAKNGFIR"
FT   misc_feature    170667..172043
FT                   /locus_tag="SSU0176"
FT                   /note="HMMPfam hit to PF00232, Glycoside hydrolase, family
FT                   1, score 6.9e-113"
FT                   /inference="protein motif:HMMPfam:PF00232"
FT   CDS_pept        172222..172716
FT                   /transl_table=11
FT                   /locus_tag="SSU0177"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44462"
FT                   /protein_id="CAR44462.1"
FT                   /translation="MGIEKTVSELAEILGVSRQAMNNRVKSLPEEFVDKNDKGVTVVNR
FT                   AGLIKLEEIYKTTIFEDEPISDEVKHRELMEILVDEKNAEIIRLYSQLKAKDKQLAEKD
FT                   EQLKVKDVQIAEKDKQLDQQQQLTLKAMADKEVLKLELDEVKAQAEEVQAKGFFARLFG
FT                   K"
FT   misc_feature    172234..172299
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1683.000, SD 4.92 at aa 29-50, sequence
FT                   KTVSELAEILGVSRQAMNNRVK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    172519..172662
FT                   /locus_tag="SSU0177"
FT                   /note="HMMPfam hit to PF04394, Protein of unknown function
FT                   DUF536, score 2.1e-11"
FT                   /inference="protein motif:HMMPfam:PF04394"
FT   CDS_pept        172984..175026
FT                   /transl_table=11
FT                   /locus_tag="SSU0178"
FT                   /product="putative PTS multi-domain regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44465"
FT                   /protein_id="CAR44465.1"
FT                   /translation="MVDNRTMAILMELFATRKESLYELSIQTGIEKEQLHSNLELVNQL
FT                   LQEHSFPQIQYKDSEFVISTELYNQKESVFSLFRNRQIYLSQEERQLLIYLYTFIRKEF
FT                   VSNVHYQELLSVSRNTTLTDIKNVKELCLDFQVRLEYTRAKGYHLIGREEDKHRLALYA
FT                   LSNCLQSSIGVWALDYILKSWGEENPIEELKIVSQQACNYYKVSALEERLDEYLYFLIF
FT                   LFIRQARVGNRINWNFEGKGGFVKDFLQRLWKLLRLKSTSTLELNAATQEYLSHLLQGC
FT                   LEGESGEKDDLFYHLTVEIVEEMERLSLITFEHRSEMIEGLQRHLIPAYYRLTSRLVNV
FT                   NSYTETIKEEHADLFYLVKKALRPLEEHLGFTIPDSEVSYFVIHFGGYIEAGQQRSYRY
FT                   RALVVCPNGVSSSLIVKENLRQLFPNIYFADTHSLQDWKMLDMTDYDMVFGTIKLNIEL
FT                   PFFLVSQLMTSNHKKELFHLVNQHFPNAAYFPIEIEQLLSLVGKHATIHQEQALKYELV
FT                   QFLNQRSHEQRGRSPMLEELITKETFQWSEEVLDWQKAVALAARPLVDKGAIETRYIDA
FT                   MIAKVEEFGPFIDLGKGIAIPHARPEDGVNEVGMSMLVLDKPVYLLDDPSHEIRLFICI
FT                   AAVDNQTHLRALSHLTKILREEENIQQLVGTKEFADVQHLLKEEQ"
FT   misc_feature    173875..174147
FT                   /locus_tag="SSU0178"
FT                   /note="HMMPfam hit to PF00874, PRD, score 4.8e-15"
FT                   /inference="protein motif:HMMPfam:PF00874"
FT   misc_feature    174589..175020
FT                   /locus_tag="SSU0178"
FT                   /note="HMMPfam hit to PF00359, Phosphotransferase system,
FT                   phosphoenolpyruvate-dependent sugar EIIA 2, score 4.6e-28"
FT                   /inference="protein motif:HMMPfam:PF00359"
FT   misc_feature    174730..174780
FT                   /note="PS00372 PTS EIIA domains phosphorylation site
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00372"
FT   CDS_pept        175028..175312
FT                   /transl_table=11
FT                   /locus_tag="SSU0179"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   lactose/cellobiose-specific family, IIB subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44475"
FT                   /protein_id="CAR44475.1"
FT                   /translation="MLRIGTACGSGLGSSFMVQMNIESILRDLGVSDVHVEHYDLGGAN
FT                   PSEADVWIVGRDLADSATHLGDVRILNSIIDMNELRELVTAICQEKGLV"
FT   misc_feature    175034..175294
FT                   /locus_tag="SSU0179"
FT                   /note="HMMPfam hit to PF02302, Phosphotransferase system,
FT                   lactose/cellobiose-specific IIB subunit, score 1.3e-24"
FT                   /inference="protein motif:HMMPfam:PF02302"
FT   CDS_pept        175366..176712
FT                   /transl_table=11
FT                   /locus_tag="SSU0180"
FT                   /product="putative sugar-specific permease, SgaT/UlaA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44478"
FT                   /protein_id="CAR44478.1"
FT                   /translation="MILDFLIDIAKTPAILVALIAILGLALQKKPAADLVKGGLKTFVG
FT                   FIVVGGGANIIVGSLEPFGQMFEQAFNLKGVVPNNEAIVAMALDKYGTATSLIMLLGMV
FT                   FNIAIARFTRFKYIFLTGHHTLYMACMIAVIMSVAGFTSVGLIVMGGLALGLIMTLSPA
FT                   FVQKYMIQLTGNDHVALGHFSALGYWLSGVVGGLVGDKSKSTEDINFPKGLAFLRDSTV
FT                   SIAISMSLIYMIVALFAGGDYIKENLSGGTNSMIYALTLGGTFAAGVFVILSGVRLILA
FT                   EIVPAFKGISEKLVPNSKPALDCPVVYPYAPNAVLIGFISSFAGGIVSMIILALTGGVV
FT                   ILPGVVPHFFCGATAGVMGNASGGVRGAVCGAFMQGVLISFLPVFLLPVLGDLGFAGST
FT                   FSDADFGLSGIFLGVLAKNGGILTVSVGIFAVLALMLGLSLVKKEQKEG"
FT   misc_feature    175366..176589
FT                   /locus_tag="SSU0180"
FT                   /note="HMMPfam hit to PF04215, Putative sugar-specific
FT                   permease, SgaT/UlaA, score 1.6e-120"
FT                   /inference="protein motif:HMMPfam:PF04215"
FT   misc_feature    join(175378..175446,175480..175548,175636..175695,
FT                   175714..175782,175792..175860,176029..176097,
FT                   176140..176208,176302..176370,176380..176448,
FT                   176467..176535,176620..176688)
FT                   /locus_tag="SSU0180"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SSU0180 by TMHMM2.0 at aa 5-27, 39-61, 91-110, 117-139,
FT                   143-165, 222-244, 259-281, 313-335, 339-361, 368-390 and
FT                   419-441"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        176714..177562
FT                   /transl_table=11
FT                   /locus_tag="SSU0181"
FT                   /product="putative transketolase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44479"
FT                   /protein_id="CAR44479.1"
FT                   /translation="MTSGTADLKRFAKEIRYHTLATLNQLGFGHYGGSLSIVEVLAALY
FT                   GEILDIRVQNFSSKERDHFILSKGHAGPALYSTLYLKGFFDRDFLLSLNQNGTHLPSHP
FT                   DRNLTPGVDMTTGSLGQGMSVATGVAYGKKIEQSPYYTYTLVGDGELNEGQCWEAAQFA
FT                   AHHELSKMILFVDDNKKQLDGRTHDICQTFDFVEKFQAFGWESVRVNGADIDAIINAIL
FT                   TMKSSKSPQPKCIVLDTTKGQGVTFLEELESNHHLRLSGQLREDLEQVTLVLARELEVT
FT                   E"
FT   misc_feature    176732..177478
FT                   /locus_tag="SSU0181"
FT                   /note="HMMPfam hit to PF00456, Transketolase, N-terminal,
FT                   score 1.4e-37"
FT                   /inference="protein motif:HMMPfam:PF00456"
FT   CDS_pept        177559..178485
FT                   /transl_table=11
FT                   /locus_tag="SSU0182"
FT                   /product="putative transketolase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44481"
FT                   /protein_id="CAR44481.1"
FT                   /translation="MRQTKEMRLVYSDFLAQVGQEDTTIAAIEADLSSSMATNKLSSVL
FT                   GGRYVNVGIMEQEMVGVAAGLSLLGYKPYIHTFGPFASRRVYDQVFISLAYAQLNATIV
FT                   GSDAGVSAEMNGGTHMPFEELGLMRLIPKARVYEVSDDVLFQAVLKETIKVDGLKYIRT
FT                   IRKAPTPIYQGGEDFSKGYCVLRQGEDMTLLASGIMVEQALKAADQLEAQGVSVQVIDL
FT                   FRIKPIHEDISALLSGRPVLTVENHNRIGGLGSSICELMATDLTTPVHRIGIEESFGQV
FT                   GQQAYLMDVYGLTAEYIVKQAQLMLQQ"
FT   misc_feature    177565..177966
FT                   /locus_tag="SSU0182"
FT                   /note="HMMPfam hit to PF02779, Transketolase, central
FT                   region, score 3.5e-17"
FT                   /inference="protein motif:HMMPfam:PF02779"
FT   misc_feature    178099..178452
FT                   /locus_tag="SSU0182"
FT                   /note="HMMPfam hit to PF02780, Transketolase, C-terminal,
FT                   score 5.9e-21"
FT                   /inference="protein motif:HMMPfam:PF02780"
FT   CDS_pept        178676..180436
FT                   /transl_table=11
FT                   /locus_tag="SSU0183"
FT                   /product="putative glycerophosphodiester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44482"
FT                   /protein_id="CAR44482.1"
FT                   /translation="MKKIQREFQKIYYNLDKILLLFFTLFTFMEFVWIPLNSWISEGLL
FT                   AMTGHAYLSPTNLLSVFAENLLVTGLFILLFFVNIAIAYLELALLFTGVWQLLDEKVKH
FT                   LTDYLRDVRDSMVAIIRHSSLPKVLFLLFYSVILLPFLRRVLNIYYFNKIVVPQFIVDY
FT                   LSNTVWLGILILIFLLLFFWLAARFMYALPNIYFEHRGVKESIAYSWEKTRGRKQIGSL
FT                   FRLIWLVTFPVLLFTGVGGLFYLVQLLAEHFVPSASYWLAVVCYALLKLAYYGVVALFM
FT                   MGFVSLLTGKQLPIYRRKRLRHHLRLAILLVSGLVFGTQGALALYFPFDTLPVTISHRG
FT                   VDDGNAVQNSIEALEKTSQLKPDYIEMDVQETKDGQFIVMHDTDLLALTGNPGGTHDYT
FT                   LAELTGMTASENGMAAPVPSFDEYLEKADELGQKLLVEIKVTKADSPKLTQNFLKKYGQ
FT                   RLIAKGHQMQSLDYRTIIEIKQYSEKLVSFFILPFNSIYPTTVADGYTMEYTSLDQNFM
FT                   TKSWIRGKSVYAWTPNEEESMTKMLLLQVDGIITDNMTDLQSLMEEMKENRRYPDLFFQ
FT                   QFQSLIYNFE"
FT   misc_feature    join(178730..178798,178856..178924,179057..179116,
FT                   179174..179233,179339..179407,179450..179518,
FT                   179594..179662)
FT                   /locus_tag="SSU0183"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SSU0183 by TMHMM2.0 at aa 19-41, 61-83, 128-147, 167-186,
FT                   222-244, 259-281 and 307-329"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    179687..180343
FT                   /locus_tag="SSU0183"
FT                   /note="HMMPfam hit to PF03009, Glycerophosphoryl diester
FT                   phosphodiesterase, score 5.4e-15"
FT                   /inference="protein motif:HMMPfam:PF03009"
FT   CDS_pept        complement(180480..180779)
FT                   /transl_table=11
FT                   /locus_tag="SSU0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44484"
FT                   /protein_id="CAR44484.1"
FT                   /translation="MMNMQNMMRQAQKLQKQMEKSQAELAATQFTGSSVQDLVTATFTG
FT                   DKKLVSIDFKADVVDADDLETLQEMTIQAVNAALTKVDEATQKKLGAFAGKLPF"
FT   misc_feature    complement(180483..180758)
FT                   /locus_tag="SSU0184"
FT                   /note="HMMPfam hit to PF02575, Conserved hypothetical
FT                   protein CHP00103, score 4.9e-33"
FT                   /inference="protein motif:HMMPfam:PF02575"
FT   CDS_pept        181046..182215
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="SSU0185"
FT                   /product="putative tagatose-6-phosphate aldose/ketose
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44485"
FT                   /protein_id="CAR44485.1"
FT                   /translation="MFRLAKEELEKLGAIITATEIYQQPGLWKEAYQLYFDQLEKIESF
FT                   LKSIKEKHDFVHVVFTGAGTSDFVGQSIANYLNQVNDLKHIRFSAIGTVELVSRPHDYL
FT                   QADVPTVLVSFARSGNSPESVAAVEVAKQLVDKLYQVTITCAPEGKLALAAEGDAENLL
FT                   LLQPAGSNDKGFAMTGSYSCMALTALLVFSSASQEEKAAWVEIIARLGQDVLDREDYVQ
FT                   DLINLDFERVIYLGSGGFYGLAHEAQLKILELTAGKIATMYESPLGFRHGPKSFINEKT
FT                   LIFLFASNDAYTRQYDVDLLNEVHGDGIAERIVALSADKLVGTEAANFVLAEGGADLPD
FT                   VFLTFPYILFAQTVSIMAAIKCNNLPDTPSPTGTVNRVVQGVIIHPLEK"
FT   misc_feature    181196..181636
FT                   /gene="agaS"
FT                   /locus_tag="SSU0185"
FT                   /note="HMMPfam hit to PF01380, Sugar isomerase (SIS), score
FT                   0.0063"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   misc_feature    181718..182128
FT                   /gene="agaS"
FT                   /locus_tag="SSU0185"
FT                   /note="HMMPfam hit to PF01380, Sugar isomerase (SIS), score
FT                   0.0065"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   CDS_pept        182345..184030
FT                   /transl_table=11
FT                   /locus_tag="SSU0186"
FT                   /product="putative surface-anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44487"
FT                   /protein_id="CAR44487.1"
FT                   /translation="METANKKFRYSIRKFKVGVGSVLIATCLLGAGVSTPTAFATTETS
FT                   TATQVEAMAKVEEVQKLVKELEKELGELDKVPSYGDAQDYSYQKALWEEFLRIGKDNMD
FT                   YASKMKADDKFFHKVKGDLNDFKYQIKVENYIRQVAELRKKYPGDNTIEEEYNAHLKQD
FT                   EGKSIASQEGATLRDYVDREASEAMGRIKQRVAELEKSKQPQPSPADEPAPAPKEEETP
FT                   APKEEDTPAPDAAPAPAPTPEVDPAPTPIPDTPKAEEEAPTPVPDTPAPKEDEVPAPIP
FT                   DAPTPKVEEETQEPKTEEKAPETKEETPTPVPDTPAPKEDEVPAPMPDAPAPKAEEEVP
FT                   APTPMPETPMDKPKTDKVESDKQMPEAKQPEMEQPKAEDMPKEEMPKSEQPKAEDSAPK
FT                   TAVPEVAPKTAEKPKLDFTTKERKVEEALPIKEEIRYDASLPLGKSYLLQEGKAGKKVS
FT                   VYQDVIVDGKVVATNLLSETVVEGQNRILVKGSLEMKKEEVKTTPSVQSNPTLSHKGAP
FT                   SANKATLPATGEQRNNLALVGLGLAGISLAVVATAINKKSKDQI"
FT   sig_peptide     182345..182464
FT                   /locus_tag="SSU0186"
FT                   /note="Signal peptide predicted for SSU0186 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.978 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    182354..182434
FT                   /locus_tag="SSU0186"
FT                   /note="HMMPfam hit to PF04650, YSIRK Gram-positive signal
FT                   peptide, score 7.3e-11"
FT                   /inference="protein motif:HMMPfam:PF04650"
FT   misc_feature    join(182393..182461,183944..184003)
FT                   /locus_tag="SSU0186"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0186 by TMHMM2.0 at aa 17-39 and 534-553"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    183590..183823
FT                   /locus_tag="SSU0186"
FT                   /note="HMMPfam hit to PF07501, G5, score 1.6e-14"
FT                   /inference="protein motif:HMMPfam:PF07501"
FT   misc_feature    183656..183679
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    183890..184012
FT                   /locus_tag="SSU0186"
FT                   /note="HMMPfam hit to PF00746, Surface protein from
FT                   Gram-positive cocci, anchor region, score 0.00033"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   misc_feature    183914..183931
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        complement(184307..186574)
FT                   /transl_table=11
FT                   /gene="pepXP"
FT                   /locus_tag="SSU0187"
FT                   /product="Xaa-Pro dipeptidyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44490"
FT                   /protein_id="CAR44490.1"
FT                   /translation="MRFNQFSFIKKETSVYLQELDTLGFQLIPDASSKTNLETFVRKCH
FT                   FLTANTDFALSNMIAEWDTDLLTFFQSDRELTDQIFYQVAFQLLGFVPGMDYTDVMDFV
FT                   EKSNFPIVYGDIIDNLYQLLNTRTKSGNTLIDQLVSDDLIPEDNHYHFFNGKSMATFST
FT                   KNLIREVVYVETPVDTAGTGQTDIVKLSILRPHFDGKIPAVITNSPYHQGVNDVASDKA
FT                   LHKMEGELAEKQVGTIQVKQASITKLDLDQRNLPVSPATEKLGHITSYSLNDYFLARGF
FT                   ASLHVSGVGTLGSTGYMTSGDYQQVEGYKAVIDWLNGRTKAYTDHTRSLEVKADWANGK
FT                   VATTGLSYLGTMSNALATTGVDGLEVIIAEAGISSWYDYYRENGLVTSPGGYPGEDLDS
FT                   LTALTYSKSLQAGDFLRNKAAYEKGLAAERAALDRTSGDYNQYWHDRNYLLHADRVKCE
FT                   VVFTHGSQDWNVKPIHVWNMFHALPSHIKKHLFFHNGAHVYMNNWQSIDFRESMNALLS
FT                   QKLLGYENNYQLPTVIWQDNSGEQTWTTLDTFGGENETVLPLGTGSQTVANQYTQEDFE
FT                   RYGKSYSAFHQDLYAGKANQISIELPVTEGLLLNGQVTLKLRVASSVAKGLLSAQLLDK
FT                   GNKKRLAPIPAPKARLSLDNGRYHAQENLVELPYVEMPQRLVTKGFMNLQNRTDLMTVE
FT                   EVVPGQWMNLTWKLQPTIYQLKKGDVLELILYTTDFECTVRDNSQWQIHLDLSQSQLIL
FT                   PH"
FT   misc_feature    complement(184319..185038)
FT                   /gene="pepXP"
FT                   /locus_tag="SSU0187"
FT                   /note="HMMPfam hit to PF08530, Peptidase S15/CocE/NonD,
FT                   C-terminal, score 1.7e-85"
FT                   /inference="protein motif:HMMPfam:PF08530"
FT   misc_feature    complement(184568..184600)
FT                   /note="PS00133 Zinc carboxypeptidases, zinc-binding region
FT                   2 signature."
FT                   /inference="protein motif:Prosite:PS00133"
FT   misc_feature    complement(184784..184831)
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   misc_feature    complement(185078..186031)
FT                   /gene="pepXP"
FT                   /locus_tag="SSU0187"
FT                   /note="HMMPfam hit to PF02129, Peptidase S15, score
FT                   2.3e-130"
FT                   /inference="protein motif:HMMPfam:PF02129"
FT   misc_feature    complement(186146..186574)
FT                   /gene="pepXP"
FT                   /locus_tag="SSU0187"
FT                   /note="HMMPfam hit to PF09168, X-Prolyl dipeptidyl
FT                   aminopeptidase PepX, N-terminal, score 7.7e-82"
FT                   /inference="protein motif:HMMPfam:PF09168"
FT   CDS_pept        186756..187490
FT                   /transl_table=11
FT                   /locus_tag="SSU0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44500"
FT                   /protein_id="CAR44500.1"
FT                   /translation="MLRKNEAIVPILRINNRAINQGFLEENLGMKTKLEDGPFADFGDR
FT                   TSPEAKLVLTESPGNRTRAVEGLKKLNKIVIKVDNASEIEALLAQGSQYSKLYQGKNGY
FT                   GFEALSPEGDTFLLHAEASVDDLKAILPPVPFKVQDDFSGLTAFTVESVWINTPQASIS
FT                   QDYYEAILPQQAFLRFVGAEGKDLLTPAEQVWDLEGLRFPVEQDFDWAHLESRLERPFF
FT                   KDKKASFIQTVDPSGIELWFEK"
FT   CDS_pept        join(187487..187564,187564..188433)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0189"
FT                   /product="putative beta-lactamase (pseudogene)"
FT                   /note="CDS contains a frameshift after codon 24. Frameshift
FT                   occurs at a poly T heptamer. Similar to Streptococcus
FT                   pneumoniae hypothetical protein sp1448 UniProt:Q97PZ0
FT                   (EMBL:AE007441) (311 aa) fasta scores: E()=3.2e-69, 60.526%
FT                   id in 304 aa"
FT                   /db_xref="PSEUDO:CAR44501.1"
FT   misc_feature    187630..188388
FT                   /locus_tag="SSU0190"
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   1.2e-27"
FT                   /inference="protein motif:HMMPfam:PF00144"
FT   repeat_region   complement(188432..188537)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        complement(188840..191185)
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SSU0191"
FT                   /product="formate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44504"
FT                   /protein_id="CAR44504.1"
FT                   /translation="MSTKVKTKNVAEDIFAQAWEGFKGTDWQDKASVTHFVQANYTPYD
FT                   GDESFLAGPTERSLHIKKIIEETKAGYEDTRFPMDVDRATSIADIPAGFIDKENELIFG
FT                   IQNDELFKLNFMPRGGIRMAETTLIENGYTPDPLLHEIYTKHATTVNDGIFRAYTADIR
FT                   RARHSHHVSGLPDAYSRGRIIGMYARLALYGADYLMEEKVADWNAITEIDEESIRLREE
FT                   INMQYQALQQVVRLGDHYGVDVRKPAMNTKEAIQWTNIAFMAVCRVINGAATSLGRVPI
FT                   VLDIYAERDLARGTFTEAEIQEFVDDFVLKLRTVKFARTKAFDEIYSGDPTFLTTSMAG
FT                   MGNDGRHRVTKMDYRFLNTLDNIGNSPEPNLTVLWSDQLPYSFRRYCMAMSHKHSSIQY
FT                   EGVTTMAKDGYGEMSCISCCVSPLDPESEDQRHNIQYFGARVNVLKALLSSWNNGYDDV
FT                   HKDYKVFDGVEPNTSEVFDYDQVVKNFEIALDWLTDTYVDAMNIIHYMTDKYNYEAVQM
FT                   AFLPTHLRANMGFGICGFANTVDSLSAIKYAQVKPIRDEDGFIYDYEVTGDFPRYGEDD
FT                   DRVDDIAKWLMEAFFTRLNKHKLYKNAEATVSILTITSNVAYSKQTGNSPVHRGVFLNE
FT                   DGSVNTTKVEFFPPGANPTSKARGGWLQNLNTLSKLNFKHANDGISLTTQVSPKALGKT
FT                   FDEQVNNLVTILDGYFEQGGQHVNLNVMDLNDVYEKIMAGEDVIVRISGYCVNTKYLTK
FT                   EQKTELTQRVFHEVLSMDDHAAEVSGQA"
FT   misc_feature    complement(188939..189247)
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SSU0191"
FT                   /note="HMMPfam hit to PF01228, Formate C-acetyltransferase
FT                   glycine radical, score 6.7e-41"
FT                   /inference="protein motif:HMMPfam:PF01228"
FT   misc_feature    complement(188948..188974)
FT                   /note="PS00850 Glycine radical signature."
FT                   /inference="protein motif:Prosite:PS00850"
FT   misc_feature    complement(189329..191134)
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SSU0191"
FT                   /note="HMMPfam hit to PF02901, Pyruvate formate-lyase, PFL,
FT                   score 7.5e-297"
FT                   /inference="protein motif:HMMPfam:PF02901"
FT   CDS_pept        191501..192568
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="SSU0192"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44505"
FT                   /protein_id="CAR44505.1"
FT                   /translation="MLIFPLINDLSRKIIHVDMDAFFAAIEVRDSPALKGKPVIIGADP
FT                   RLSGGRGVVSTCNYEARAFGIHSAMSSKEAYERCPQAIFISGNYEKYQEVGRQVREIFH
FT                   RYTDLVEPMSIDEAYLDVTENKLGISSAVKIAKLIQYDIWNELHLTASAGVSYNKFLAK
FT                   IASDMEKPHGLTLILPEDAVGILASLPVEKFHGVGKKTVERLHEMGVYTGQDLLDVPEM
FT                   VLIDRFGRFGFDLYRKARGISNSPVKVDRVRKSSGKERTYRKLLYREEDVLKELISLCQ
FT                   RVAASLKRNGKKGRTIVLKVRYGDFSTLTKRHSLEVYTDQTETIEKEVRQLIEEIGKIE
FT                   KGIRLLGVTVTNFQT"
FT   misc_feature    191549..192565
FT                   /gene="dinB"
FT                   /locus_tag="SSU0192"
FT                   /note="HMMPfam hit to PF00817, UMUC-like DNA-repair
FT                   protein, score 1e-103"
FT                   /inference="protein motif:HMMPfam:PF00817"
FT   CDS_pept        192611..193030
FT                   /transl_table=11
FT                   /locus_tag="SSU0193"
FT                   /product="putative transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44507"
FT                   /protein_id="CAR44507.1"
FT                   /translation="MQISSRFTIASHILVLLALEGEKEKQTSTSIAGSVGVNPVIIRNI
FT                   LSQLKEAGLVEVARGIGGARLAQGPDQITLLHVYQAVELFGEKGQLFAFHEQPNPSCQV
FT                   GRNIHPLLDSRLENAQSALENELAKTRLADLLAEL"
FT   misc_feature    192611..192991
FT                   /locus_tag="SSU0193"
FT                   /note="HMMPfam hit to PF02082, Transcriptional regulator,
FT                   Rrf2, score 4.4e-42"
FT                   /inference="protein motif:HMMPfam:PF02082"
FT   CDS_pept        193269..193895
FT                   /transl_table=11
FT                   /locus_tag="SSU0194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44509"
FT                   /protein_id="CAR44509.1"
FT                   /translation="MKIAIIAANGQAGQTIAKEAVERGHQVTAIVRSENKSVAQEVIQK
FT                   DAFALTKEDLAGFDVVVNAFGAWTPETLPDHARLAEHLATILAGSPTRLLVVGGAGSLY
FT                   LDESQTAMLKDTPDFPAEYLPIAEAMGTGLDLYRQATAVNWTYISPAADFDAEGQKSGA
FT                   YTLAGEVFQVNAQGESYISYADYAVALVDIAEKGGYQQERISVLA"
FT   CDS_pept        193997..194917
FT                   /transl_table=11
FT                   /locus_tag="SSU0195"
FT                   /product="putative tagatose-6-phosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44511"
FT                   /protein_id="CAR44511.1"
FT                   /translation="MIHLICPNPALDRTLLVEKIEKNIPLRPTEVRDYPGGKSFNVAYA
FT                   LRENGVTDYTIHTILGGQIGRYIQELNADGGNALRVVENSQNTRTCNIYVETSTGDVVL
FT                   FYEKGFELTEDLLNQFTQQIENSLQAGDILVFSGSLMKGMSDDYIQRFIEKYPEVLTIV
FT                   DTSGPALRAAYQARPALIKINNEELKDIYPELDEESPEAILGILKEVTPHENIIITMGD
FT                   KGSLAKIGQRFFRIQSPKKETRNPIAAGDFYLGLLVKGISQGQAPEIFLKEAAAFATAN
FT                   CLNYFPEVEAEQFEAIVDTIVLEEL"
FT   misc_feature    194471..194842
FT                   /locus_tag="SSU0195"
FT                   /note="HMMPfam hit to PF00294, Carbohydrate/purine kinase,
FT                   score 8e-11"
FT                   /inference="protein motif:HMMPfam:PF00294"
FT   CDS_pept        194983..195603
FT                   /transl_table=11
FT                   /locus_tag="SSU0196"
FT                   /product="HhH-GPD superfamily base excision DNA repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44515"
FT                   /protein_id="CAR44515.1"
FT                   /translation="MEQLTVLYQNLKRRYGEFHWWNDENPIKDLVSMILIQQTTEANAK
FT                   RALEQLEGRLTIHSLLEMPVEDLQECIRPAGFFKQKSLYIRSVVEWANQFDGDFSRLDR
FT                   VETAVLRKELLSLKGVGNETADVILLYLCRRSVFVADQYALRLFNRLGLSQSQDYLSLR
FT                   QEFTEQIKDWSVKDAQELHALIDEHGKQFRLTKGQLDESWLMI"
FT   misc_feature    195073..195498
FT                   /locus_tag="SSU0196"
FT                   /note="HMMPfam hit to PF00730, HhH-GPD, score 1.8e-09"
FT                   /inference="protein motif:HMMPfam:PF00730"
FT   misc_feature    195313..195375
FT                   /locus_tag="SSU0196"
FT                   /note="HMMPfam hit to PF00633, Helix-hairpin-helix motif,
FT                   score 3.2e-05"
FT                   /inference="protein motif:HMMPfam:PF00633"
FT   CDS_pept        complement(195604..195702)
FT                   /transl_table=11
FT                   /locus_tag="SSU0197"
FT                   /product="hypothetical protein"
FT                   /note="Similar to SSU0385, 62.500% identity (62.500%
FT                   ungapped) in 32 aa overlap (1-32:1-32);SSU1880, 59.375%
FT                   identity (59.375% ungapped) in 32 aa overlap
FT                   (1-32:1-32);SSU1884, 54.839% identity (56.667% ungapped) in
FT                   31 aa overlap (2-32:1-30); and to an internal region of
FT                   SSU0853, 53.125% identity (53.125% ungapped) in 32 aa
FT                   overlap (1-32:43-74)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44517"
FT                   /protein_id="CAR44517.1"
FT                   /translation="MKIKIKLGDANADRTEVHQIMSTTSDFDFRRV"
FT   CDS_pept        complement(195886..197085)
FT                   /transl_table=11
FT                   /locus_tag="SSU0198"
FT                   /product="putative repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44519"
FT                   /protein_id="CAR44519.1"
FT                   /translation="MGKKEETIRNISGNILKTLFRHQKSSRTRISKSLKITPATITNMI
FT                   SYLVAEKKVIETGDEVRDYIGSGRSRRLITVNSQYRHYIGIEINANGIYLAVTDTIGNL
FT                   ITNSNIKITEYDSKQINEIIIQLVTETLDKFSYLEFGALGIAVPGHFDSKSGHIISNNV
FT                   KWIYFDLAVIKQSISIPIFLENNINCMAIGSYLFHPESSPEQFLFIHIGPGLFCSFFDS
FT                   EHILQNKNFYIGEIGHTVVDLNGPSCECGKRGCLQTYISDTWLINNARFLFENVQGSII
FT                   KTLVEKPEDITLDVVYNAYRLGDGFIIEKIESGIDFLTTSIANTLIIYDSKKIFINSQL
FT                   LNYPGFSEKVNNLVDNQLQFIPSKNNLDIEFLSFNIFRGAIGAASLAVYNHFILENNSN
FT                   "
FT   misc_feature    complement(196291..196386)
FT                   /locus_tag="SSU0198"
FT                   /note="HMMPfam hit to PF00480, ROK, score 8.3e-09"
FT                   /inference="protein motif:HMMPfam:PF00480"
FT   misc_feature    complement(196948..197013)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1405.000, SD 3.97 at aa 25-46, sequence
FT                   SSRTRISKSLKITPATITNMIS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        197278..198606
FT                   /transl_table=11
FT                   /locus_tag="SSU0199"
FT                   /product="sugar phosphotransferase system (PTS), IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44520"
FT                   /protein_id="CAR44520.1"
FT                   /translation="MNGLMHFLEHKLAPFGTKVGNQRHLKAVRDGFMMAMPLVLVGSFF
FT                   LLLISWPDQASGGFSVVGFLEQIGLLGILNRLNQSTMAIISLIATFGIAYRLSESYETD
FT                   GPSAGVIALSSFILLAPRFSTMVFNESGEQINQVFAGAIPFGSLNASALFVAIAVGLVS
FT                   AEIYRFFIQRGITIKMPKNVPDVVGKSFAALLPALTTLIFWACVFQGLEAAGVEGGLGA
FT                   VLGLIVGKPLGLIAGSLGGMVLVVLVNSLFWFTGVNGGQVLNAFVDPVWLQFTEANQLA
FT                   AAAGEKLPHIITLPFKDLFVFMGGGGATVGLALCLLVFSKSRTFKSLGRISFIPSLFNI
FT                   NTAILFSFPTVLNPIMMIPFILTPTVNAIITYFAMATGLVPMTTGVVLPWTMPPILGGF
FT                   LATGGSIQGAILQIILIGVSFIIYYPFFKVADNKNLELEESGE"
FT   misc_feature    197362..198369
FT                   /locus_tag="SSU0199"
FT                   /note="HMMPfam hit to PF02378, Phosphotransferase system,
FT                   EIIC, score 1.2e-86"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    join(197368..197436,197494..197562,197596..197664,
FT                   197722..197790,197848..197916,197974..198042,
FT                   198172..198237,198295..198363,198382..198450,
FT                   198493..198558)
FT                   /locus_tag="SSU0199"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSU0199 by TMHMM2.0 at aa 31-53, 73-95, 107-129, 149-171,
FT                   191-213, 233-255, 299-320, 340-362, 369-391 and 406-427"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        198611..200497
FT                   /transl_table=11
FT                   /locus_tag="SSU0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44523"
FT                   /protein_id="CAR44523.1"
FT                   /translation="MKLTIFDKVQNKTSQFAIDELTYYLKAIFDFELGKTTVEEDANVL
FT                   LSKEYLDNNDTIGIEMKNGNAILTGNSDVSILIAVYRLLSEFGAVFTRPGRKHELIPSL
FT                   TITDWNEKELSIHETASYKHRGVCIEGADSYQNTKEFLDWLPKINMNSFFIQFENPYSF
FT                   LKRWYEHEFNPYADKEDFNTEIAQQMSDLLDEELSKRGLIHHRVGHGWTGEVLGYSSKY
FT                   GWESGLKLPEEKKPLVAELNGKRELFNTAPILTSLCFSNPDVGERMCELIVNYAKERKD
FT                   VDYLHVWLSDARNNICECEKCKQEIPSDQYVRILNQLDRKLSEEGLNTKICFLLYHELL
FT                   FAPKHEVLENPERFTMMFAPITRTFEMSYADVDYENDVPLPNEYSRNNIVLPNSLEENL
FT                   SYLFSWQKVFNGDSFVYDYPLGRAHYGDLGYMKISKVIFRDVVYLKKLGLNGYISCQEL
FT                   RAGFPHNFPNFVMGQMLWNRNLEYDELKALYFSSLYGSEWKSVVTYLEKLSDYSSCDYF
FT                   NSIGDRQNAELSMKYNISSKLAFNFINTLEENVAKNNGIQRDAWRQLGYHREYVVKLAN
FT                   ALHLMASGDHLDGQIRWKDFLDYIRNHEPDFQQYLDVYRIIEVAKNYAGFKL"
FT   CDS_pept        200617..204333
FT                   /transl_table=11
FT                   /locus_tag="SSU0201"
FT                   /product="putative surface-anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44524"
FT                   /protein_id="CAR44524.1"
FT                   /translation="MNKKIFLKSAIILLSVTCLINAIKALDSSGVSSSTGEIVNQDRIY
FT                   NITLKVKTDGVYNDLGGNVISENNVLSGISGTKINLKVSTNSGYRFVGYQSFLESGNST
FT                   DGLLPIENDSFEISDKTGNVTVVAMFEKIPIDETIYFSDEFSTENINNYLLSENLIGKI
FT                   AVSNGKLNIHAPGVSSIKPILSRQIDESSTLGYEIQFSIQQIGEVKQWNTFRVVFKENS
FT                   DGSVYALEFTGKAVSIKKLSSIDAPNQTGEKYAETGHNLGSEEHRIRLVVRGDTVTVSD
FT                   NEIPLLSYSSPENWEGATASIVFTPISNRSVSLDDIIIRQTRALRSLLVVSRIDGQEVT
FT                   DIQPGSIRGNTSQVFVGDSLPLEVIEKPGYQFIGFKDEFGNVVDLSTFSVPNDESDLVI
FT                   YADFQTAEVVNRETKTFYIDSIEGNDTNSGESETNAWKTLEQLRKNTLIAGDRVLLKRG
FT                   SRFVGEDAALTFKGSGLEDAPILISSYGEGELPLLEAQGKIESVIKLYNQEYITIENLE
FT                   ITNLDPNFSTSFELNSNNNRSKILRGVHVIAEDYGVVHDIVLRNMYLHDINGNLNSKWN
FT                   GGIFFDVYGTTVPTKYDGILIENNYLERVDRSGIKLVGSTWANQNLKNNKNIPLNWYPS
FT                   TNVVVRGNRIEKAGGDSITVRDTDGALIEYNISADARYQDTGYNAGIWPFQASNTVIQY
FT                   NESFRTHGVQDGQGLDLDHVSNNSVMQYNYSHDNEGGFMLIMNWYEQTSPTVRYNISQN
FT                   DKDKIFELARGGAQGTAIYNNTIFSDSKLTGRAGVIDMPSTSGGTGVKDIFLFNNIFYF
FT                   TDGEKMFVEASDAGKYKDSIHFYNNAYVGVEVPDDPKAITEGITLKGVGTGPTENKSMI
FT                   ANAGKFLTGQLDGYRLPENSSLAKLGVSKEEAISYFYKKLGVQPTIDFQDNGSLTMSPT
FT                   EAFALARQTNSVDAIARVYPAIEGVTYDTDFFGETLSSENLSVGAAQEKKSVFEEKISD
FT                   IEISDVKTGIGMRYKRSNQLADVNLSIRLINKDELQYTINANNPTFSYEIQLQKNFGEY
FT                   MDLSESVTITIPIEADKKILNVLKINKNEQTESVKELPYRIENNKIILETDELGSFIIE
FT                   YQMEKIKKENNTNATISESGKSSLGLQNKENSDVQAVGDKDYFSGLELSNKGEELSRED
FT                   SKLMGNSINNLQTIKESESIFEGNLGRNKELSDMYQKSLPKTGESNQAYIVLIGLFSLF
FT                   VVLICQIFKKSID"
FT   sig_peptide     200617..200691
FT                   /locus_tag="SSU0201"
FT                   /note="Signal peptide predicted for SSU0201 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.403 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    204229..204246
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    204256..204315
FT                   /locus_tag="SSU0201"
FT                   /note="1 probable transmembrane helix predicted for SSU0201
FT                   by TMHMM2.0 at aa 1214-1233"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        204352..205113
FT                   /transl_table=11
FT                   /locus_tag="SSU0202"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44527"
FT                   /protein_id="CAR44527.1"
FT                   /translation="MTKKIIFILLFFVVCVYFYSFIPLVQTVPSVFQTPYRTLVQSEFE
FT                   AIYKYNGIEISERNFWNKPINGRKPQDTLNEKATILFKKYNLLEKEAKKHEYKKEALDF
FT                   NKVDWKTVSNRYIELKQIVIDEKIKDINQDEIERYYLANTENFERQDFISGNISIWNDG
FT                   IIISTESVDITEETVRNITERYPDLELELKNIEVGHQVSWGQNGVYYTFTCLSREEKGI
FT                   IPLSEITDAVAMQCAEELVDNWLNKEIDSLK"
FT   sig_peptide     204352..204450
FT                   /locus_tag="SSU0202"
FT                   /note="Signal peptide predicted for SSU0202 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.978) with cleavage site
FT                   probability 0.566 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    204364..204432
FT                   /locus_tag="SSU0202"
FT                   /note="1 probable transmembrane helix predicted for SSU0202
FT                   by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        205330..206094
FT                   /transl_table=11
FT                   /locus_tag="SSU0203"
FT                   /product="binding-protein-dependent transport system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44529"
FT                   /protein_id="CAR44529.1"
FT                   /translation="MKMKSNKEQKYFWLTFSLIVALMIWWFLSNYDRTSRSFPNIILVW
FT                   NALLIMIDKGFIFEDIFSSLTSVFFGFTSGFLLSAPNALLMAWYSPYRNIVKPWIQFIR
FT                   NIPPLAYVPLVVISAGVGLLPQVIVIAIATFLTMTVTIYQGIINIDPNLIKAARILGAS
FT                   DFEIFKRILVPSSIPFIMTAVRLGTSISLTTIIAAESTGATSGMGMRIRSLNNSFDSSG
FT                   MLLYIILIGVIGLLLNKLVDLIERKLTGWQQK"
FT   sig_peptide     205330..205440
FT                   /locus_tag="SSU0203"
FT                   /note="Signal peptide predicted for SSU0203 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.674) with cleavage site
FT                   probability 0.221 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(205363..205416,205531..205599,205633..205701,
FT                   205711..205770,205855..205923,205993..206061)
FT                   /locus_tag="SSU0203"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0203 by TMHMM2.0 at aa 12-29, 68-90, 102-124, 128-147,
FT                   176-198 and 222-244"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    205510..206079
FT                   /locus_tag="SSU0203"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 6.2e-29"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS_pept        206079..206861
FT                   /transl_table=11
FT                   /locus_tag="SSU0204"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44530"
FT                   /protein_id="CAR44530.1"
FT                   /translation="MATEVKKIKVKIEDVSKSFQTNHGEVVALNQINLEIFENEIVTVV
FT                   GPSGCGKSTLLNLVAGLEPVTSGKIYCDDNEIVGIGVERGVVFQQYALFPWMSVLQNVM
FT                   FGPEMQGKSKLEASEIANKYIKMVGLQEFSNHYPKELSGGMKQRVAIARAYAVNPSILL
FT                   MDEPFGALDALTRIQLQEELIEMLGQEQKTCFFITHDIEEAVLLGNRVIVMSPRPGEIK
FT                   EIVNVDLPFPRNQLTKFEKNFMDIKNHIWSLVYKDFLI"
FT   misc_feature    206193..206729
FT                   /locus_tag="SSU0204"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 5.5e-56"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    206214..206237
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    206394..206417
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    206499..206543
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        206900..207931
FT                   /transl_table=11
FT                   /locus_tag="SSU0205"
FT                   /product="extracellular solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44533"
FT                   /protein_id="CAR44533.1"
FT                   /translation="MAKYMKYKNFIWFICSIITLIFLSSCSSIQTSSSGHSAKVDTIRI
FT                   AYMPNFASLHDIITGINSGIFKEEGLEVELIEFADGPTIIASLESGSIDIGNIGPGAHK
FT                   LAIEGRAEVVAFSQLGNADELIARSDRGIDSIEDLRGKKIGTASGTSAETILKLALLEA
FT                   DLSEKDVEIIDMDASAIVTAMLSGSIDVAATWSPNTTFIKRELKEKVVVLADNSRYREQ
FT                   SPAIASYVTFPGYSEKNNEKISKFLKGLYRAMDYRAEHMKEVSKWVATQIGSDITAVQD
FT                   QLQDGEWLTSRQMIQLINTGILQQYYEKQQKNLIESEIVDTSRNINEYVLIDQMNSILM
FT                   EIK"
FT   sig_peptide     206900..207001
FT                   /locus_tag="SSU0205"
FT                   /note="Signal peptide predicted for SSU0205 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.474 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    206924..206992
FT                   /locus_tag="SSU0205"
FT                   /note="1 probable transmembrane helix predicted for SSU0205
FT                   by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    206945..206977
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    207041..207691
FT                   /locus_tag="SSU0205"
FT                   /note="HMMPfam hit to PF09084, NMT1/THI5 like, score
FT                   3.7e-18"
FT                   /inference="protein motif:HMMPfam:PF09084"
FT   CDS_pept        208025..208834
FT                   /transl_table=11
FT                   /locus_tag="SSU0206"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44536"
FT                   /protein_id="CAR44536.1"
FT                   /translation="MIEYYNFSKSELENHSRIPLIIKKNNEEIFISLALEMVELIKENN
FT                   KKNEKTVIICPVGPVGHYPHFVRLVNQFKIDLSDVWFINMDEYLSEDLHWIDVVHPLSF
FT                   RGFMQKTVYSQIHPTLIMPEEQRIFPDPLDIDLISNKIKELGKIDLCIGGIGLNGHIAF
FT                   NEPDSTLTVQEFLKLESRVLPISVETKVMNCLTELKGAVEEVPNYCVTIGMSEIFQAKK
FT                   IRLAVFRDWHHAVIRKTVCSKPDTGFPSTLMQIHTNCSIYLNESLAN"
FT   misc_feature    208121..208825
FT                   /locus_tag="SSU0206"
FT                   /note="HMMPfam hit to PF01182,
FT                   Glucosamine/galactosamine-6-phosphate isomerase, score
FT                   1.1e-09"
FT                   /inference="protein motif:HMMPfam:PF01182"
FT   misc_feature    208448..208504
FT                   /note="PS01161 Glucosamine/galactosamine-6-phosphate
FT                   isomerases signature."
FT                   /inference="protein motif:Prosite:PS01161"
FT   CDS_pept        join(208996..209166,209165..209920,209920..210120,
FT                   210124..210903)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0207"
FT                   /product="copper-transporting P-type ATPase CopA
FT                   (fragment)"
FT                   /note="Probable gene remnant. CDS contains frameshifts
FT                   after codons 57 and 309, and a nonsense mutation (amber)
FT                   after codon 376. Similar to an internal region of Bacillus
FT                   subtilis copper-transporting P-type ATPase CopA
FT                   UniProt:O32220 (EMBL:BSUB0018) (803 aa) fasta scores:
FT                   E()=1.2e-88, 43.396% id in 636 aa"
FT   misc_feature    209008..209169
FT                   /locus_tag="SSU0207"
FT                   /note="HMMPfam hit to PF00403, Heavy metal
FT                   transport/detoxification protein, score 0.0022"
FT                   /inference="protein motif:HMMPfam:PF00403"
FT   misc_feature    209017..209106
FT                   /note="PS01047 Heavy-metal-associated domain."
FT                   /inference="protein motif:Prosite:PS01047"
FT   misc_feature    join(209357..209425,209483..209551)
FT                   /locus_tag="SSU0208"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0208 by TMHMM2.0 at aa 15-37 and 57-79"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    209606..209887
FT                   /locus_tag="SSU0208"
FT                   /note="HMMPfam hit to PF00122, E1-E2 ATPase-associated
FT                   region, score 2.1e-43"
FT                   /inference="protein motif:HMMPfam:PF00122"
FT   misc_feature    209935..210120
FT                   /locus_tag="SSU0209"
FT                   /note="HMMPfam hit to PF00122, E1-E2 ATPase-associated
FT                   region, score 1.4e-20"
FT                   /inference="protein motif:HMMPfam:PF00122"
FT   misc_feature    210040..210108
FT                   /locus_tag="SSU0209"
FT                   /note="1 probable transmembrane helix predicted for SSU0209
FT                   by TMHMM2.0 at aa 36-58"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    210124..210270
FT                   /locus_tag="SSU0210"
FT                   /note="HMMPfam hit to PF00122, E1-E2 ATPase-associated
FT                   region, score 7.2e-16"
FT                   /inference="protein motif:HMMPfam:PF00122"
FT   sig_peptide     210124..210225
FT                   /locus_tag="SSU0210"
FT                   /note="Signal peptide predicted for SSU0210 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.817 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    210142..210210
FT                   /locus_tag="SSU0210"
FT                   /note="1 probable transmembrane helix predicted for SSU0210
FT                   by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    210280..210903
FT                   /locus_tag="SSU0210"
FT                   /note="HMMPfam hit to PF00702, Haloacid dehalogenase-like
FT                   hydrolase, score 4.9e-27"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    210298..210318
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT                   /inference="protein motif:Prosite:PS00154"
FT   misc_feature    210595..211080
FT                   /locus_tag="SSU0210"
FT                   /note="HMMPfam hit to PF08534, Redoxin, score 0.002"
FT                   /inference="protein motif:HMMPfam:PF08534"
FT   CDS_pept        210907..211086
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="SSU0207A"
FT                   /product="probable thiol peroxidase (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus parasanguis Tpx probable thiol
FT                   peroxidase UniProt:P31307 (EMBL:SSSTRA) (163 aa) fasta
FT                   scores: E()=8.6e-16, 72.881% id in 59 aa"
FT                   /db_xref="PSEUDO:CAR44539.1"
FT   CDS_pept        complement(211125..213614)
FT                   /transl_table=11
FT                   /locus_tag="SSU0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44540"
FT                   /protein_id="CAR44540.1"
FT                   /translation="MNEVYFTGTIDRIIFENPSNFYKILLLEIEETDADYDDYEIIVTG
FT                   TIADVIEGEDYRFYGNLVTHPKYGQQLQISRYERSKPTSAGLVKYFSSEHFKGIGRKTA
FT                   EKIVELYGEDTIDKILAEPEKLTQITGLSSKNMQAFVEKLRLNYGTELILAKLAEYGIP
FT                   NKLAFQIQDQYKEKTLQIIEENPYQLVEDVQGLGFTIADRIAENLGIASDSPQRFRAGM
FT                   LFSLIHRSMETGDTYVEARDLLEATLELLEKSRHTELDPAAVAKELTGLIADDKVQQEG
FT                   TKIFDNSLYFAEHGIHTNLTRLMGKNGFKPFPRADVEAAIAELESISSLTYDNIQKEAI
FT                   VQAITNPLFILTGGPGTGKTTVINGIIAVYAILHKIDLTRNREECPVLLAAPTGRATRR
FT                   MNELTGLPSATIHRHLGLVEGQEESYRDDYLDADFIIVDEFSMVDTWLANQLFQNISSQ
FT                   TQVLIVGDAEQLPSVSPGQVLADLLKIDKLPSITLERIYRQSDDSTIVTLASQIRQGAL
FT                   PSDFREKKADRSYFEAQNEQIPALIERIVGAAIKSGIPANEVQILAPMYRGAAGIDQLN
FT                   TMTQALLNPLEEGELEFLHNEQAFRQGDRVIHLVNDAEANVFNGDLGYITDLLPAKYTD
FT                   SKQDEITINFDGSEVTYPRNEWYKITLAYAMSIHKSQGSEFQVVILPITRTSHRMLQRN
FT                   LVYTAITRSKSKLILLGEISAFDYAVKNAGTVRKTYLVPRFQGEMAEQESKESLIKKDE
FT                   SKTATTTQTQPPTQPDRKEQVKVVKENNQQLSLLDQDQPEKTSPQPTEYILTVDNLLTI
FT                   DPMIGIEQADIEEFFKA"
FT   misc_feature    complement(212535..212558)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(213855..214484)
FT                   /transl_table=11
FT                   /locus_tag="SSU0212"
FT                   /product="putative signal peptidase I 4"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44542"
FT                   /protein_id="CAR44542.1"
FT                   /translation="MGAIQKTKRSPLVAFLAEWGIFLLFMAAFFASRYFIWNPVSVDGH
FT                   SMDPTLQHQEKLIMLKTSSIDRFDIVVASETDSDGKEKLIVKRVIGMPGDTIRYENDVL
FT                   YVNDQKVDEPYLDEYLAAFQKDKLQEVYSYNKQFQAVAQSAEAFTQDANGYVDFTVTVP
FT                   EGQYYLMGDDRLVSLDSRSVGTFSRENIKGEVVFRMWPLNRIGTVD"
FT   misc_feature    complement(214158..214364)
FT                   /locus_tag="SSU0212"
FT                   /note="HMMPfam hit to PF00717, Peptidase S24, S26A and
FT                   S26B, C-terminal, score 3.1e-19"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   misc_feature    complement(214188..214226)
FT                   /note="PS00760 Signal peptidases I lysine active site."
FT                   /inference="protein motif:Prosite:PS00760"
FT   misc_feature    complement(214272..214301)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   misc_feature    complement(214332..214355)
FT                   /note="PS00501 Signal peptidases I serine active site."
FT                   /inference="protein motif:Prosite:PS00501"
FT   sig_peptide     complement(214392..214484)
FT                   /locus_tag="SSU0212"
FT                   /note="Signal peptide predicted for SSU0212 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.828) with cleavage site
FT                   probability 0.777 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(214392..214451)
FT                   /locus_tag="SSU0212"
FT                   /note="1 probable transmembrane helix predicted for SSU0212
FT                   by TMHMM2.0 at aa 12-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(214494..215384)
FT                   /transl_table=11
FT                   /locus_tag="SSU0213"
FT                   /product="ribonuclease HIII"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44544"
FT                   /protein_id="CAR44544.1"
FT                   /translation="MNTVVLKASAQQKQAMMAHYDRYRQTSKNPYIEAFFKLTGASLSI
FT                   YTSGKVVFQGEMAEQEASRWGYEPESSGQATIPGQNLPMIGTDEVGNGSYFGGLAVVAG
FT                   FVRPEDHSFLKSLGVDDSKKMTDQKICQIAPLLKEKIPHQALLLSPKKYNEVIEQGYNA
FT                   VSVKVALHNQAIFLLLQKGVQPEKIVIDAFTSSQNYQKYLKKEANQFANPVTLEEKAEG
FT                   RYLAVAVSSIIARSMFLENLVQLGQLVGMHLPSGAGSKSDQVAASILKQYGMAGLNQTA
FT                   KLHFANTQKAQKLLK"
FT   misc_feature    complement(214521..215132)
FT                   /locus_tag="SSU0213"
FT                   /note="HMMPfam hit to PF01351, Ribonuclease HII/HIII, score
FT                   4.6e-64"
FT                   /inference="protein motif:HMMPfam:PF01351"
FT   CDS_pept        215469..216452
FT                   /transl_table=11
FT                   /locus_tag="SSU0214"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44547"
FT                   /protein_id="CAR44547.1"
FT                   /translation="MEVQMKYKWATLGTGVIANELVQALQAMGGNLYSVANRTYDKGVE
FT                   FAQKYGIEKVYREIDEVFEDPEVDIIYISTPHNTHINYLRKALKAGKHVLCEKSITLNS
FT                   EELAEAIQLAEENQVVLAEAMTIFHMPIYRQLSEVVASGKLGELKMIQMNFGSYKEYDM
FT                   TNRFFNKNLAGGALLDIGVYALSFVRWFMIEKPNQVLSQVKLAPTGVDEQVGILLSNDA
FT                   GEMATIALTLHAKQPKRGTIAYDKGYIELYEYPRGQKAVITYTEDGSQEVIEAGETAKA
FT                   LSYEVADMEKAVAGIENTMHLAYTQDVMEIMTQLRKEWGLVYPEEM"
FT   misc_feature    215487..215843
FT                   /locus_tag="SSU0214"
FT                   /note="HMMPfam hit to PF01408, Oxidoreductase, N-terminal,
FT                   score 3.5e-25"
FT                   /inference="protein motif:HMMPfam:PF01408"
FT   misc_feature    215877..216209
FT                   /locus_tag="SSU0214"
FT                   /note="HMMPfam hit to PF02894, Oxidoreductase, C-terminal,
FT                   score 0.011"
FT                   /inference="protein motif:HMMPfam:PF02894"
FT   misc_feature    215979..216047
FT                   /locus_tag="SSU0214"
FT                   /note="1 probable transmembrane helix predicted for SSU0214
FT                   by TMHMM2.0 at aa 171-193"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        216861..217832
FT                   /transl_table=11
FT                   /locus_tag="SSU0215"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44549"
FT                   /protein_id="CAR44549.1"
FT                   /translation="MKNNKKMLYTSSLALSLFSTGMISTNVLAIEWAPRTVSEISPEIV
FT                   QEEGMMTYTVQYGDTLSAIASAMNIDMDLLAKINQIADINLIFPDTVLTTTVDQNNQVT
FT                   QVEIEAPVQGNTNETVQATVDLTTNQVTVEDTVVPLDQISSVTDSAPVEEVVEQPVAEA
FT                   PVVEAPVEEVVEQPVVEAPVEEVVEQPVVETPQVTALSTTTTSTSAYDVGLQPQVAAFR
FT                   AEVANAFGITSFSGYRPGDSGDHGKGLAIDFMVPESSALGDQVAAYAVANLASKNINYI
FT                   IWKQRFYAPYDSIYGPAYTWNLMPDRGSITENHYDHVHVSFN"
FT   sig_peptide     216861..216947
FT                   /locus_tag="SSU0215"
FT                   /note="Signal peptide predicted for SSU0215 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.773 between residues 49 and 50"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    216882..216950
FT                   /locus_tag="SSU0215"
FT                   /note="1 probable transmembrane helix predicted for SSU0215
FT                   by TMHMM2.0 at aa 28-50"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    217017..217148
FT                   /locus_tag="SSU0215"
FT                   /note="HMMPfam hit to PF01476, Peptidoglycan-binding LysM,
FT                   score 3.6e-11"
FT                   /inference="protein motif:HMMPfam:PF01476"
FT   CDS_pept        complement(218246..219871)
FT                   /transl_table=11
FT                   /gene="treA"
FT                   /gene_synonym="treC"
FT                   /locus_tag="SSU0216"
FT                   /product="putative trehalose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44551"
FT                   /protein_id="CAR44551.1"
FT                   /translation="MTIDKRKVVYQIYPKSYKDTTGNGVGDLRGIIEKLPYLKELGIDM
FT                   IWLNPFYPSPQRDNGYDISDYTAVNPDFGTMADFEEMVTVGKELGIEFMLDMVLNHCST
FT                   DHEWFQKALAGDKYYQDFFILRDQPTDWVSKFGGNAWAPFGDTGKYYLHLFDVTQADLN
FT                   WRNPHIREELFKVVNFWKDKGVKGFRFDVINLIGKDEVLEDCPINDGKPAYTDRPITHD
FT                   YLKMMNNATFGSEKGFMTVGEMSATTIENCILYTAPERKELSMAFNFHHLKVDYKDGQK
FT                   WTIMDFDFEELKHLFHTWGEEMSVGNGWNALFYNNHDQPRALNRFVDVENFRKEGATML
FT                   AASIHLSRGTPYIYMGEEIGMIDPDYDSMDDYVDVESINAYQMLLDQGHTPKQAFKIIQ
FT                   AKSRDNSRTPMQWDASDNAGFSTGTPWLKAGKSYQTINVEQEKTGPIFTFYQELIRLRK
FT                   ELPLISEGDYKAAYKDSQKVYAFERLLNDEKLLVLNNFFAEEVELDLADDYAHGQVLIS
FT                   NYPDNKLGKKIILKPYQALAIQVK"
FT   misc_feature    complement(218651..219841)
FT                   /gene="treA"
FT                   /gene_synonym="treC"
FT                   /locus_tag="SSU0216"
FT                   /note="HMMPfam hit to PF00128, Glycosyl hydrolase, family
FT                   13, catalytic region, score 1.8e-107"
FT                   /inference="protein motif:HMMPfam:PF00128"
FT   CDS_pept        complement(219952..221946)
FT                   /transl_table=11
FT                   /locus_tag="SSU0217"
FT                   /product="sugar phosphotransferase system (PTS), IIABC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44554"
FT                   /protein_id="CAR44554.1"
FT                   /translation="MGKFEKEAKQLLEAIGGKENVNAVTHCATRMRFVLADEKKANVKV
FT                   IEDIPAVKGTFTNAGQFQVIIGNDVPIFYNDFTAVSGIEGVSKEAAKSAAKSNQNAIQR
FT                   VMTMLAEIFTPIIPALIVGGLILGFRNVLEGVQMEWLGQAMKDGQLVFDADGNPVWNTI
FT                   VQVSPFWNGVNHFLWLPGEAIFHFLPVGITWSVSRKMGTSQILGIVLGICLVSPQLLNA
FT                   YAVPGTDAATIASDWSWNFGAFSIARIGYQAQVIPALLAGLALSYLEIFWRKVVPEVVS
FT                   MIFVPFLSLLPAIILAHTVLGPIGWTIGQWLSTVVLAGLTGPLKWLFGAVFGALYAPFV
FT                   ITGLHHMTNAIDTQLIADAGGTGLWPMIALSNIAQGSAVFAYFLMNRKNEKEAQVSLPA
FT                   TISAYLGVTEPALFGVNVKYIYPFVAAMIGSSIAGLLSVTFNIQAASIGIGGLPGILSI
FT                   KAEYWGAFFMTMVVAIVVPMILTAVFKRTGAFSKKEETVEEVVAPTEAVVETGAAIELI
FT                   SPLTGQTKELSQATDPVFASGVMGQGVLIDPSEGILVAPVDGEVSVLFPTNHAVGITAT
FT                   NGVELLMHIGMDTVGLEGKGFTAHVKQGDKVKAGDKLISFDIDVIKAAGLIAETPVIVT
FT                   NQTDFDTQVIGNLPRAISQGEAILTVTKN"
FT   misc_feature    complement(220018..220416)
FT                   /locus_tag="SSU0217"
FT                   /note="HMMPfam hit to PF00358, Phosphotransferase system,
FT                   sugar-specific permease EIIA 1 domain, score 1.9e-61"
FT                   /inference="protein motif:HMMPfam:PF00358"
FT   misc_feature    complement(220177..220215)
FT                   /note="PS00371 PTS EIIA domains phosphorylation site
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00371"
FT   misc_feature    complement(join(220495..220563,220621..220689,
FT                   220702..220770,220798..220866,220903..220971,
FT                   221029..221097,221134..221202,221266..221334,
FT                   221353..221421,221560..221628))
FT                   /locus_tag="SSU0217"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSU0217 by TMHMM2.0 at aa 107-129, 176-198, 205-227,
FT                   249-271, 284-306, 326-348, 361-383, 393-415, 420-442 and
FT                   462-484"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(220657..221619)
FT                   /locus_tag="SSU0217"
FT                   /note="HMMPfam hit to PF02378, Phosphotransferase system,
FT                   EIIC, score 3.2e-38"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    complement(221821..221925)
FT                   /locus_tag="SSU0217"
FT                   /note="HMMPfam hit to PF00367, Phosphotransferase system,
FT                   EIIB, score 3.1e-16"
FT                   /inference="protein motif:HMMPfam:PF00367"
FT   misc_feature    complement(221836..221889)
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT                   /inference="protein motif:Prosite:PS01035"
FT   CDS_pept        222180..222893
FT                   /transl_table=11
FT                   /locus_tag="SSU0218"
FT                   /product="GntR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44557"
FT                   /protein_id="CAR44557.1"
FT                   /translation="MKKYQEIYNDLKEKIRTNVYPAESSLPTEQQLQEIYGVSRDTVRK
FT                   ALAILTEGGLIQKVQGRGSMVLKQEILNFPVSGLTSYQELTNVLQLSTKTDVVSLDMIT
FT                   VNSSLSHLTGFEPYSKVWKVVRTRSIDGKVSVVDTDYLAVDVVPELTTAIAEKSIYEYL
FT                   ENKLGLDIAYAQKEITVEPTNREERELMQSKDDYLVLIKSRVYLGDTQQFQYTESKHKI
FT                   DKFRFVDFARRKHSL"
FT   misc_feature    222186..222377
FT                   /locus_tag="SSU0218"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory protein
FT                   GntR, HTH, score 6.9e-22"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    222255..222329
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00043"
FT   misc_feature    222258..222323
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1371.000, SD 3.86 at aa 27-48, sequence
FT                   PTEQQLQEIYGVSRDTVRKALA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    222441..222857
FT                   /locus_tag="SSU0218"
FT                   /note="HMMPfam hit to PF07702, UbiC transcription
FT                   regulator-associated, score 6.8e-30"
FT                   /inference="protein motif:HMMPfam:PF07702"
FT   CDS_pept        222951..223262
FT                   /transl_table=11
FT                   /locus_tag="SSU0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44560"
FT                   /protein_id="CAR44560.1"
FT                   /translation="MANLNRYKFTFGEKQLTLTTEHDNLFMEEIERIAQEKYQAIKEKM
FT                   PTADPETLALLLAINALSVQLTREMAFEQKEQELASVKEKVLKKNVTLIDLDELEDKV"
FT   CDS_pept        223259..223807
FT                   /transl_table=11
FT                   /locus_tag="SSU0220"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44561"
FT                   /protein_id="CAR44561.1"
FT                   /translation="MISLAIILILAWSFYIGYSRGLVLQAFYSMGSIIALVVATATYKK
FT                   LASFLYLWVPFANATQGSSNYYFDEKYLFDLDMVFYAGLAFLLIYVLVYAIVRFIGIFV
FT                   HLLEAFNPDTKTTNLISGALAVLVTFISLQIVMVLLSTIPLAMIQDKLHSSFLANIMIQ
FT                   YTPFTSSFLKSLWLSNIAG"
FT   misc_feature    223259..223780
FT                   /locus_tag="SSU0220"
FT                   /note="HMMPfam hit to PF02674, Colicin V production
FT                   protein, score 9.3e-36"
FT                   /inference="protein motif:HMMPfam:PF02674"
FT   misc_feature    join(223319..223387,223490..223549,223610..223678,
FT                   223721..223789)
FT                   /locus_tag="SSU0220"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSU0220 by TMHMM2.0 at aa 21-43, 78-97, 118-140 and
FT                   155-177"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        223958..226291
FT                   /transl_table=11
FT                   /gene="mutS2"
FT                   /locus_tag="SSU0221"
FT                   /product="putative DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44564"
FT                   /protein_id="CAR44564.1"
FT                   /translation="MNNKIIETLEFHKVRQKIEPYLLTEQGFEELRQLEPMVEVHRIQQ
FT                   AFDELTDIAQIFVENPYFSLAATSDIGPAMRRLELDTDLNIAELLAVKKVLEVSKSLLD
FT                   FYGNLENVSLSQLDKLFEKIELFPHLQGSLQSINDAGFVEDFASEKLARIRRKIREAED
FT                   QVRQVMQDILKTKGDMLSDSILASRNGRNVLPVKNTYRNKIAGVVHDISASGSTVYIEP
FT                   RAVVTLNEEISHLRAEERHELNRILQELSDMLRPHGGVIRNNAWLIGHIDFVRAKHLFA
FT                   RDHQAVVPKLSEKQDIALLNVRHPLIAKPVPNDLYFGSQLTAIVITGPNTGGKTIMLKT
FT                   LGLTHLMAQSGLPILADKGSRVAIFKEIFADIGDEQSIEQSLSTFSSHMTHTVEILRAA
FT                   DQDSLILFDELGAGTDPQEGASLAMAILDDLRLRGIKTMATTHYPELKAYGIETSGIEN
FT                   ASMEFDSNSLRPTYKFMQGVPGRSNAFEIARRLGLSDIIIQSAQSWTDTDSDVNRIIEK
FT                   LESQTVESRQRLDKIRDVEQENYKMNRALRKLYDELNRERENELNKARLEAKEIVDMAL
FT                   AESEDILKNLHAAASLKPHQIIEAKAELKKLAPEVVDLSKNKVLKKAKIKREAKVGDDI
FT                   IVTAYGQRGTLTNQLKDGRWEAQVGLIKMTLAKDEFELVKAEKAEQPKKRQVHTVKRAN
FT                   VRGPKARLDLRGKRYEEAMMELDEFIDQALLNNLAQVDIVHGIGTGVIREGVTKYLRRN
FT                   KQIKEFGYAPQNAGGSGCTIVTFK"
FT   misc_feature    224813..225520
FT                   /gene="mutS2"
FT                   /locus_tag="SSU0221"
FT                   /note="HMMPfam hit to PF00488, DNA mismatch repair protein
FT                   MutS, C-terminal, score 5e-16"
FT                   /inference="protein motif:HMMPfam:PF00488"
FT   misc_feature    224939..224962
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    226061..226288
FT                   /gene="mutS2"
FT                   /locus_tag="SSU0221"
FT                   /note="HMMPfam hit to PF01713, Smr protein/MutS2
FT                   C-terminal, score 2.9e-33"
FT                   /inference="protein motif:HMMPfam:PF01713"
FT   CDS_pept        226315..226968
FT                   /transl_table=11
FT                   /locus_tag="SSU0222"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44566"
FT                   /protein_id="CAR44566.1"
FT                   /translation="MIIRKYQTSDEKGWVYCKALSYLFSPFFDDRETEKPELMTDVYDH
FT                   RVEWVAEVDGQIVGLIDIDIYTEECSQSYIYAPSKRTAYFTNLAVHPDFQGQGIAQALF
FT                   EKAEQELRAQGVEKLAIFTREDDAANHLYQKWGGEVVCSDYLVVGAPQDVPTFRFGIDL
FT                   ERGRLSFSDMEGQPVPYYLREGVYVVSEEAGLDLFDIEDVYQELTYVVDLTEKS"
FT   misc_feature    226459..226731
FT                   /locus_tag="SSU0222"
FT                   /note="HMMPfam hit to PF00583, GCN5-related
FT                   N-acetyltransferase, score 1.1e-19"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        227175..227489
FT                   /transl_table=11
FT                   /locus_tag="SSU0223"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44567"
FT                   /protein_id="CAR44567.1"
FT                   /translation="MVQVITDANFEVETQEGVVLVDFWAPWCGPCRMQAPILEQLADEV
FT                   DEDELRIYKMDVDENPNTARQFGIMSIPTLLFKKDGQVVKQVAGVHTKDQIKAILAEIG
FT                   "
FT   misc_feature    227175..227483
FT                   /locus_tag="SSU0223"
FT                   /note="HMMPfam hit to PF00085, Thioredoxin domain, score
FT                   2.5e-36"
FT                   /inference="protein motif:HMMPfam:PF00085"
FT   misc_feature    227232..227288
FT                   /note="PS00194 Thioredoxin family active site."
FT                   /inference="protein motif:Prosite:PS00194"
FT   CDS_pept        227757..229286
FT                   /transl_table=11
FT                   /locus_tag="SSU0224"
FT                   /product="AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44569"
FT                   /protein_id="CAR44569.1"
FT                   /translation="MSTISYKPLNLYRQFKTAAQEFPNVAIYFDKPYASFPELGLENTY
FT                   QTVFEAIQKRAAQFAAAGIGYGDKVILYKSPAFDTYLLAVAVTALGAVPVMISYHLPSS
FT                   NLDVFAERLEKSFIVYDQETEERVAGMTRTDLVTKIFLPQVLVQEAVAFEENLLPEDVI
FT                   QYMTHTSGTTGVPKLICHTAQTMGWRVAWQQTIFDKMTERGLLAFHISPVHSRYNIGVS
FT                   SAIGLGFPLYPLSSARKDDVERALALHRPSALETHPNNFVQWARLAKEKPEVFSSIRYY
FT                   HSTFDAINIGTLRAFLEASKEQDPVFMQVYGQSECGPMILRYHRLENLGTVSGRDMGIG
FT                   LEGYTEARITDAQGNPLPAGENGHIQFLSKGRAVTYYKEDARFQDNVYGAWWDSGDYGC
FT                   MTPEGTLLLKDRQVDLIEHIDSNLALEDLLLDKLDFLSEVVIIRDVNGAPQPIIALAED
FT                   AEMNWEAWWAMVADLPLLKEPILMAYDDIPRTATMKVQRLKMEAEMKEKNL"
FT   misc_feature    227886..228989
FT                   /locus_tag="SSU0224"
FT                   /note="HMMPfam hit to PF00501, AMP-dependent synthetase and
FT                   ligase, score 3.6e-32"
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   misc_feature    228252..228287
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        229326..230264
FT                   /transl_table=11
FT                   /gene="msrAB"
FT                   /locus_tag="SSU0225"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44571"
FT                   /protein_id="CAR44571.1"
FT                   /translation="MKEIYLAGGCFWGMEGYFSQIDGILDTSVGYANGQVETTNYQLLK
FT                   QTDHAETLYLAYDETRINLREILLYYFRVIDPFSVNQQGPDKGRQYRTGIYYTDEADLP
FT                   TIEQVMTEQSQLFGGRPLAVEVEPLAHYIPAEDYHQDYLKKNPQGYCHIDLGQAKIPLI
FT                   DVADYQKPDQQVLKDSLTDLQYQVTQEAATERPFENEFWNSEQAGIYVDITTGEPLFLS
FT                   TDKFDSGCGWPSFTKPISKEVATYFQDKSHGMNRIEVRSRAGHAHLGHVFDDGPRDKGG
FT                   LRYCINSAALRFIPREEMEEAGYGLFLDLLK"
FT   misc_feature    229329..229793
FT                   /gene="msrAB"
FT                   /locus_tag="SSU0225"
FT                   /note="HMMPfam hit to PF01625, Methionine sulphoxide
FT                   reductase A, score 7.1e-82"
FT                   /inference="protein motif:HMMPfam:PF01625"
FT   misc_feature    229842..230213
FT                   /gene="msrAB"
FT                   /locus_tag="SSU0225"
FT                   /note="HMMPfam hit to PF01641, Methionine sulphoxide
FT                   reductase B, score 6.1e-85"
FT                   /inference="protein motif:HMMPfam:PF01641"
FT   CDS_pept        230403..231260
FT                   /transl_table=11
FT                   /locus_tag="SSU0226"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44574"
FT                   /protein_id="CAR44574.1"
FT                   /translation="MILSKRFKNRRKELGFTQKELAEGICEQSLISRVEKLGVAPTSDI
FT                   LFALSQRLQVSMDYFFDESVSDKAPDITVFKRLVDKALFTRSYDQLAYLVEAEKQKEAV
FT                   HSQESSEYLTYLACIVDFHHYHKEDIAIGCMEELSHRISKKSSFYLDVYNSLVNFYALA
FT                   SRDEDLDGLYEGISEKLSHLDISNTECFHKYIKIRYNHAHYLFKRKRQSQAIDELTDLI
FT                   ETLRDKKSCYFLADMLCLIANVGEGFLSKDEILSYYREAECLFKFFGPQNSYLSLKEYL
FT                   SKVI"
FT   misc_feature    230421..230582
FT                   /locus_tag="SSU0226"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix type 3,
FT                   score 9e-11"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   CDS_pept        231444..233429
FT                   /transl_table=11
FT                   /locus_tag="SSU0227"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44576"
FT                   /protein_id="CAR44576.1"
FT                   /translation="MKKVFTYLSTFSVCLFCIWLVSLQLDSLIYHYYPSVSILSRGEEV
FT                   TYEEVSDALTNLAEKENSLIAKTITETDDSGRTTTSYDVFGKGELPQGLVKADRLVASQ
FT                   ANLAENYYVVKGNLDIKVVENVLQSLGLVDSYIYRPTLLNSLSLFLGRGAPSLGLIIFI
FT                   LTNLALTVVGQIVYLRSAGIEMLSGVRSWQIASRFLRVDGRDIALATGGALVFGLIAIL
FT                   ILGWPMVYYRFVAIGIAFYACLLFFLSLSTSIGFMIALNISQLQKLIKGALPLKAIFAI
FT                   LLVGQCLAVCIISIGASRTLTYVGVLHTLTIGEKAWQERQDVFSLSLNREAFIADEAMA
FT                   QQQRMAWSHVILESYAKNNVMLVQHHLRHNTIKEHTIIESSKEIPLERVLYVTPNYIQS
FT                   EGGLYDFNQLEEIKQLGKGEIALLLPKSLQNDASVYQAYFEDMVGKLLADGEGSISLHS
FT                   NVYYISDEKRWFIYNHTPINYEQFLQAPLIVVLSPESFEETSYFWENALPDFVFFKDKE
FT                   MLEQLLDKYNLQNTIGSLLSSKQHYNTLRKNVQLEILMTLSPTILGIFTSILLFNTMNL
FT                   LYFETFKREIAIKRIAGMGFIELHGSYLGEQVGSALIGMGLAMFMTKSVIVSLGVVVAL
FT                   LINSWMLLNNQAKREEKIQLSVLNGR"
FT   sig_peptide     231444..231518
FT                   /locus_tag="SSU0227"
FT                   /note="Signal peptide predicted for SSU0227 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.775) with cleavage site
FT                   probability 0.508 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(231462..231530,231909..231977,232059..232127,
FT                   232155..232223,232260..232328,233112..233180,
FT                   233238..233306,233316..233375)
FT                   /locus_tag="SSU0227"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSU0227 by TMHMM2.0 at aa 7-29, 156-178, 206-228, 238-260,
FT                   273-295, 557-579, 599-621 and 625-644"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    233124..233423
FT                   /locus_tag="SSU0227"
FT                   /note="HMMPfam hit to PF07242, Bacteriocin-associated
FT                   integral membrane protein, score 1.1e-25"
FT                   /inference="protein motif:HMMPfam:PF07242"
FT   CDS_pept        233449..235434
FT                   /transl_table=11
FT                   /locus_tag="SSU0228"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44577"
FT                   /protein_id="CAR44577.1"
FT                   /translation="MKGKFVLVSTIILAVFMIWLGVSQKETMLVHYYPSVTTLSVSEDV
FT                   TYSDVRQRLEDYSQQTDSVIARRVIEPSKSGGRTFSYDNFSQSPLPRGLEEFQASEKVE
FT                   SALLTKYFIFQGKATVEELRSLLVSLGLDEVQIRKPSTIATLLVFLTQGGQFLAVLVFL
FT                   ITYMALVVIANVRQLRTAGIRLIAGDSRWHLFLLSLQENAKEIALTIPFAVLPAVGLAY
FT                   LVGLDGYSVYYLVAALVGYHFLLGLIVLFFAATFTLAIRTYHFLPLLKGKMPLQGILTI
FT                   MVMGQMLALLVVSFGMAQTVYYSGIWQEYQAGAQQWENEGDYYSLAWNISADGRSGLNS
FT                   PENWYPLLRQALEEDGALFVKSNLNAYLMGFQLEDGTRLDSYHPAGNTLYVSPNYLQIQ
FT                   DVDLAEGEVALPLQEGEFQLLLPEKLRPESDAYLHLYQDYINRMVRPANQARSATIKGK
FT                   VAYLKNGQKQFIYNHRSGQHVQYLTDPILVVLAPSSLGKESADFWLNEVDSSMLFKNRD
FT                   KLLRELKARNLFQFVNEVRSSSSLFTELLDRIRIETISTSMGAILGIVTSIVLFNTMNL
FT                   LYFEEFKREIVIKEIAGMGFLGIHKKYLTLQLLSLLLALGASMVVTGHIFISSISFALF
FT                   MVNALCLLRWQARKEGAWNVRILKGA"
FT   sig_peptide     233449..233523
FT                   /locus_tag="SSU0228"
FT                   /note="Signal peptide predicted for SSU0228 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.982) with cleavage site
FT                   probability 0.544 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(233461..233514,233884..233952,234064..234123,
FT                   234160..234228,234271..234339,235117..235185,
FT                   235306..235374)
FT                   /locus_tag="SSU0228"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SSU0228 by TMHMM2.0 at aa 5-22, 146-168, 206-225, 238-260,
FT                   275-297, 557-579 and 620-642"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    235129..235428
FT                   /locus_tag="SSU0228"
FT                   /note="HMMPfam hit to PF07242, Bacteriocin-associated
FT                   integral membrane protein, score 5.4e-25"
FT                   /inference="protein motif:HMMPfam:PF07242"
FT   CDS_pept        235436..236068
FT                   /transl_table=11
FT                   /locus_tag="SSU0229"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44578"
FT                   /protein_id="CAR44578.1"
FT                   /translation="MFSVQSIQKKFGKRSLFSDVTLDLQAGKVYALIGASGSGKTTLLN
FT                   ILAKLESYDAGDILYKGKDLKKLKPHLFFREELGYLFQNFGLLESQTIKENLDLGLISQ
FT                   KLSKDERKSRQEAALDAVGLSYLDLSQPIYELSGGEAQRVALAKVILKNPPLILADEPT
FT                   AALDPKSSQEIMDILLSLKSPDRLIVIATHNPLIWERADLIIKMEDL"
FT   misc_feature    235514..236065
FT                   /locus_tag="SSU0229"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 1.6e-57"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    235535..235558
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    235841..235885
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   repeat_region   complement(236075..236178)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   misc_RNA        236281..236385
FT                   /note="gcvT element (RF00504) as predicted by Rfam, score
FT                   69.81"
FT   CDS_pept        236492..237826
FT                   /transl_table=11
FT                   /locus_tag="SSU0230"
FT                   /product="sodium:alanine symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44579"
FT                   /protein_id="CAR44579.1"
FT                   /translation="MLELFKAINNLVWGPPLLLLLVGTGVYFTLRLGVFQIGKLPTAFR
FT                   LIFSSDQSGQGDVSSFAALCTALAATVGTGNIVGVATAITTGGPGALFWMWVAAFFGMA
FT                   TKYAEGFLAIKYRTKDANGQAAGGPMHYITLGMGQKWKPLAVFFAISGVLVALLGIGTF
FT                   SQVNSITASLETSFGLEPPLVSVITAISIAFVVFGGIEKISDVSTKIVPFMAILYILAS
FT                   ITVLAVHWDQLLPTLALVFKSAFTPAAAVGGFAGATVQQAIQRGIARGVFSNESGLGSA
FT                   PIAAAAAKSDNPVEQGLISMTGTFIDTLIICTLTGFTILVTDQWSVEGLAGAPLTQAAF
FT                   ATVFGNTGSIALTISLVLFAFTTILGWSYYGERCIEFLFGTKSILPYRLVFVAMVALGG
FT                   FLKLDLIWTIADIVNGLMALPNLIALLALSPVIIKETRQYFAKKK"
FT   misc_feature    join(236528..236596,236669..236737,236765..236833,
FT                   236921..236989,237017..237085,237119..237172,
FT                   237200..237268,237383..237451,237536..237604,
FT                   237641..237694,237722..237790)
FT                   /locus_tag="SSU0230"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SSU0230 by TMHMM2.0 at aa 13-35, 60-82, 92-114, 144-166,
FT                   176-198, 210-227, 237-259, 298-320, 349-371, 384-401 and
FT                   411-433"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    236609..237823
FT                   /locus_tag="SSU0230"
FT                   /note="HMMPfam hit to PF01235, Sodium:alanine symporter,
FT                   score 8.6e-180"
FT                   /inference="protein motif:HMMPfam:PF01235"
FT   misc_feature    236750..236797
FT                   /note="PS00873 Sodium:alanine symporter family signature."
FT                   /inference="protein motif:Prosite:PS00873"
FT   CDS_pept        237891..238739
FT                   /transl_table=11
FT                   /locus_tag="SSU0231"
FT                   /product="mechanosensitive ion channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44581"
FT                   /protein_id="CAR44581.1"
FT                   /translation="MNDFITKYLSQFNIEAIVTAGLNKVLSLVLLFVAFYIIKKIAKAS
FT                   VKKVLVPSLKVSTQDIGRQKTISRLVESILNYLLYFILIYCILSILGLPVSSLLAGAGI
FT                   AGVAVGLGAQGFLSDLVNGFFILIERQFDVGDVVKLTNGPITISGTIVSMGIRTTQVRD
FT                   ADGTLHFIPNRNILVVSNQSRGDMRAQIDIPLKFNTDLEQVYRVIEEVNLREISNFDQI
FT                   TGVTVLGPQNAISGQFVFRVNLFVANGQQNKIYHQFFGFYQDALRQAGIDLPSSGPTVL
FT                   K"
FT   misc_feature    join(237933..238001,238107..238175,238203..238271)
FT                   /locus_tag="SSU0231"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSU0231 by TMHMM2.0 at aa 15-37, 73-95 and 105-127"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    238104..238712
FT                   /locus_tag="SSU0231"
FT                   /note="HMMPfam hit to PF00924, MscS Mechanosensitive ion
FT                   channel, score 1.9e-47"
FT                   /inference="protein motif:HMMPfam:PF00924"
FT   CDS_pept        238807..239337
FT                   /transl_table=11
FT                   /locus_tag="SSU0232"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44583"
FT                   /protein_id="CAR44583.1"
FT                   /translation="MHKQPLFWTTIAGAVLSFILGVTCFIFMIGLSSANFDNWDTGSDG
FT                   YIDETVEYTEYQVGDSVDFSNGLHVTVTSMGKDDSIELVDSYYSTAYVVEMEVENSTAK
FT                   ELYFDEYYFSLMDPVSQIPFTLDLRTYDVNLVEKLKPGEKVQVKLIYGIDNETNFGFTY
FT                   EDAMWTELVAEGI"
FT   sig_peptide     238807..238908
FT                   /locus_tag="SSU0232"
FT                   /note="Signal peptide predicted for SSU0232 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992) with cleavage site
FT                   probability 0.891 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    238825..238893
FT                   /locus_tag="SSU0232"
FT                   /note="1 probable transmembrane helix predicted for SSU0232
FT                   by TMHMM2.0 at aa 26-48"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        239392..239520
FT                   /transl_table=11
FT                   /locus_tag="SSU0233"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches. Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44586"
FT                   /protein_id="CAR44586.1"
FT                   /translation="MVQIVRLGNCTISDLSVIFTFKKGEYVYPLFSSSFNEKYPQN"
FT   CDS_pept        complement(239573..240919)
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /locus_tag="SSU0234"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44587"
FT                   /protein_id="CAR44587.1"
FT                   /translation="MSNAKAYIQASFEAVKARNPHETEFLQAVEELFSTLEPVFEAHPE
FT                   YIEENILARIVEPERIISFRVPWTDKDGNVQVNRGYRVQFNSAVGPYKGGLRFHPTVNQ
FT                   SILKFLGFEQIFKNVLTGLPIGGGKGGSDFDPKGKTDAEIMRFCQSFMTELQKHIGPSL
FT                   DVPAGDIGVGGREIGYMYGQYKRLRQFDAGVLTGKPLGFGGSLIRPEATGYGLVYFTDN
FT                   MLAANGKSFKDQTVLISGSGNVAQYAVQKATELGAKVISVSDSNGYIIDETGIDFDLLV
FT                   DIKEKRRARLTEYAAEKSTAKYFKGSVWNYDGKADIALPCATQNEINGKQAAALVKNGV
FT                   YCVAEGANMPSDLDAIKVYKENGVLYGLAKAANAGGVAVSALEMSQNSLRLSWTREEVD
FT                   GRLKDIMANIFNTAKETAEKYDLGTDYLAGANIAAFEQIADSMIAQGLV"
FT   misc_feature    complement(239582..240313)
FT                   /gene="gdh"
FT                   /locus_tag="SSU0234"
FT                   /note="HMMPfam hit to PF00208, Glu/Leu/Phe/Val
FT                   dehydrogenase, C-terminal, score 8.6e-137"
FT                   /inference="protein motif:HMMPfam:PF00208"
FT   misc_feature    complement(240356..240748)
FT                   /gene="gdh"
FT                   /locus_tag="SSU0234"
FT                   /note="HMMPfam hit to PF02812, Glu/Leu/Phe/Val
FT                   dehydrogenase, dimerisation region, score 1.3e-83"
FT                   /inference="protein motif:HMMPfam:PF02812"
FT   misc_feature    complement(240512..240553)
FT                   /note="PS00074 Glu / Leu / Phe / Val dehydrogenases active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00074"
FT   CDS_pept        241141..242079
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="SSU0235"
FT                   /product="putative dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44589"
FT                   /protein_id="CAR44589.1"
FT                   /translation="MVSTVTTLGGFTFDNCLMNAAGVWCMTKEELDAVKNSKAGTFVTK
FT                   TATLDYRAGNPEPRYQNVPLGSINSMGLPNQGLAYYLDYLLELQETEPERTFVLSVVGM
FT                   SPDETHEILRTVEASDFKGLTELNLSCPNVPGKPQIAYDFETTETILQEVFTYFTKPLG
FT                   IKLPPYFDIVHFDQAAAIFNQFPLKFVNCVNSIGNGLYIKDESVVIKPKNGFGGIGGEY
FT                   IKPTALANVHAFYQRLKPEIQIVGTGGILTGRDAFEHILCGASMVQVGTTLQKEGVAAF
FT                   GRITAELQAIMAEKGYETIEDFRGKLQHLDD"
FT   misc_feature    241147..242016
FT                   /gene="pyrD"
FT                   /locus_tag="SSU0235"
FT                   /note="HMMPfam hit to PF01180, Dihydroorotate
FT                   dehydrogenase, core, score 1.2e-110"
FT                   /inference="protein motif:HMMPfam:PF01180"
FT   misc_feature    241258..241317
FT                   /note="PS00911 Dihydroorotate dehydrogenase signature 1."
FT                   /inference="protein motif:Prosite:PS00911"
FT   misc_feature    241870..241932
FT                   /note="PS00912 Dihydroorotate dehydrogenase signature 2."
FT                   /inference="protein motif:Prosite:PS00912"
FT   CDS_pept        242412..243644
FT                   /transl_table=11
FT                   /locus_tag="SSU0236"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44590"
FT                   /protein_id="CAR44590.1"
FT                   /translation="MERRANYIRRKRYASYRTKMHLFFICGLATIILAIIIVSEHLVPR
FT                   LNQASESMHSDNSVRIMAHGDLLYHLPILRGAEQPDGSYDFSENFTYVKPWIEQADFAI
FT                   ADFEGTISPDIELAGYPLFNAPAIVANNIHDAGYDLVDLAHNHILDSHLSGLISTVNTF
FT                   RDAGVDTVGVYAEGNRATAPLYIREVNGIRIAVLAYAYGFNGMEALLSQEEYDAYLSDF
FT                   DKEKMRAEIERAEKEADITIVMPQTGVEYQLEPTEEQTSLYHQMIDWGADIVLGGHPHV
FT                   VEPTEILEKDGQRKLIIYSMGNFLSNQRIESMEDTPNAQWTERGVLMDLTIQKENGQTS
FT                   IQTAQAHPTWVNRLSKGTYSTDGYEQFSYQTYILEDWVAGGRYYGQLDLDTQARVDTAY
FT                   QEMKDFVNLVW"
FT   sig_peptide     242412..242555
FT                   /locus_tag="SSU0236"
FT                   /note="Signal peptide predicted for SSU0236 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.396 between residues 48 and 49"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    242472..242540
FT                   /locus_tag="SSU0236"
FT                   /note="1 probable transmembrane helix predicted for SSU0236
FT                   by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        243656..244483
FT                   /transl_table=11
FT                   /locus_tag="SSU0237"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44592"
FT                   /protein_id="CAR44592.1"
FT                   /translation="MIVRLIATDMDGTFLDGQGNFDRERFSRVLDQLDQKKIPFVIASG
FT                   NGIGRLLQLCQGFEDRLIFVADNGAHVYQNGKTVIRRAIQQVEVEAILHFFKGRWADVC
FT                   LMLSNDGNIYMQAGAGMPFAGTDLPIELAQMAAFQNRVTYLDNLSAYPVSESIHKVGLW
FT                   VPEARVESITEAFNQGFHGQLVAVTSGYGSVDILPQGIHKAWGLEQVLTGLDIEPEQVM
FT                   AFGDSDNDIELLSYVGYSYAMENATDKVKAVAKYMAPSHLEAGVLQVIEEYIL"
FT   misc_feature    243671..244465
FT                   /locus_tag="SSU0237"
FT                   /note="HMMPfam hit to PF08282, HAD superfamily
FT                   hydrolase-like, type 3, score 5.6e-60"
FT                   /inference="protein motif:HMMPfam:PF08282"
FT   misc_feature    244325..244393
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT                   /inference="protein motif:Prosite:PS01229"
FT   CDS_pept        complement(244532..245314)
FT                   /transl_table=11
FT                   /locus_tag="SSU0238"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44595"
FT                   /protein_id="CAR44595.1"
FT                   /translation="MKKYISLYLYNIKVYMMAQMSFRVDFFIGLFSSLIEQIVYLIFLN
FT                   ILFGNIKEIAGFNYGQMLFIYGIATVGRSIHLIFFDNLWMFGSRYIRQGEFERLLLMPV
FT                   NPLFQLICERIQPQGIGTTLIGSLALVQASNELGMEWSLGKLALLIFIAICIGLLYAAI
FT                   QLGPTALAFWIVESFPLTMGIFALNQMAQYPLNIYPKIIQILLIFVFPYAFTAYFPALY
FT                   FLDLSMWGLALPLVVVVLFSINYNLFRYGMTKFTSVGN"
FT   misc_feature    complement(244535..245224)
FT                   /locus_tag="SSU0238"
FT                   /note="HMMPfam hit to PF06182, Protein of unknown function
FT                   DUF990, score 2.2e-43"
FT                   /inference="protein motif:HMMPfam:PF06182"
FT   misc_feature    complement(join(244571..244639,244667..244735,
FT                   244754..244813,244826..244894,245075..245143,
FT                   245171..245239))
FT                   /locus_tag="SSU0238"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0238 by TMHMM2.0 at aa 26-48, 58-80, 141-163, 168-187,
FT                   194-216 and 226-248"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(245316..246095)
FT                   /transl_table=11
FT                   /locus_tag="SSU0239"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44596"
FT                   /protein_id="CAR44596.1"
FT                   /translation="MRKYLYMTRLTMMNAMQYKAFFLATFVSLAVKILVALYVWKTIFF
FT                   TQSEVNGFTLQTFTTYIIFANLLASLNSFSLGEDLSYSILKGSIAGEFLRPYSFILALF
FT                   FKDLGNKLLELIKFAIVFIGILLVHQDFYLPDGKTILLFLVSSILGMFIVQLLDMAFGF
FT                   LAFFTVNAWGVMLLRMGLFNLASGALLPLSFYPQAVENFLKLLPYNYAVNVPVSILLGQ
FT                   ESDLTALGLQVIWIPILACFIAALWSQAKRRIVIFGG"
FT   misc_feature    complement(245319..246020)
FT                   /locus_tag="SSU0239"
FT                   /note="HMMPfam hit to PF06182, Protein of unknown function
FT                   DUF990, score 2.2e-06"
FT                   /inference="protein motif:HMMPfam:PF06182"
FT   misc_feature    complement(join(245352..245420,245508..245576,
FT                   245595..245663,245706..245774,245868..245936,
FT                   245979..246038))
FT                   /locus_tag="SSU0239"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0239 by TMHMM2.0 at aa 20-39, 54-76, 108-130, 145-167,
FT                   174-196 and 226-248"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(246088..247071)
FT                   /transl_table=11
FT                   /locus_tag="SSU0240"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44598"
FT                   /protein_id="CAR44598.1"
FT                   /translation="MIQAEHLSKTYSIIDKEVGLKGSIKAFFKPKKKSIPAVQDISLQV
FT                   GKGKIIGYIGSNGSGKSTTIKMLTGVLFPDQGQVRINGLNPQENRKAVNKQIGVLFGQK
FT                   SHLDWNLPVQESFILHAKIYDVPDKVFKERLAVLIELLDLADIMKQPIRNLSLGQRVRC
FT                   EFAAIFIHQPAVVFLDEPTIGLDASVKETIRSFIRYMNQEYQTTFLITSHDMKDIESLC
FT                   ERIFIIDKGKKVYDGSLTVLKERFSTVKTILFSTEKPIEKDLQLEGWEFIRKDDFHFEI
FT                   HYQSKVWTSAQVIEQVFNHYSIEDVTMKELEIETMVRQIYEEGIHA"
FT   misc_feature    complement(246379..246930)
FT                   /locus_tag="SSU0240"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 2.9e-38"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(246886..246909)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(247156..247689)
FT                   /transl_table=11
FT                   /locus_tag="SSU0241"
FT                   /product="TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44601"
FT                   /protein_id="CAR44601.1"
FT                   /translation="MRTDSRKERTRQAILEAMVTCLESQGFNDITTTHLAQTAGISRSS
FT                   FYTHYKDKYELIDSYQQGLFHKLEAIFDHYDGNRQSSFLEIFELLYREKLLSALLTHNG
FT                   TQEIQNFLINKVRLLVANDLAERLGKENLSQLEKEYSSIYFSHAFFGIMQVWIKNGKQE
FT                   SPQYMTDFLIKMLP"
FT   misc_feature    complement(247510..247650)
FT                   /locus_tag="SSU0241"
FT                   /note="HMMPfam hit to PF00440, Transcriptional regulator,
FT                   TetR-like, DNA-binding, bacterial/archaeal, score 3.2e-09"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    complement(247537..247602)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1431.000, SD 4.06 at aa 30-51, sequence
FT                   ITTTHLAQTAGISRSSFYTHYK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        247815..250274
FT                   /transl_table=11
FT                   /locus_tag="SSU0242"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44602"
FT                   /protein_id="CAR44602.1"
FT                   /translation="MLQKVKNIFKKPMTLITILGIACVPALYNISFLTSMWDPYGRLDQ
FT                   LPVAVVNQDQSASFQDKTLTIGDDMVDNMKESKSLDFHFVSEKNAEKGLEEGDYYMVIT
FT                   LPEDLSEKATSLLTNQPEPITISYQTSKGHSFVASKMGESAMEKLKTSVSETITKTYTT
FT                   AVFDSMREIQTGMIEAADGSQKLTNGASQLESGSQTLSNGLTTLTTSGQVLVTGANQLA
FT                   TGVVSYTDGVNQAATGSQTLSSGLTIYTNGVASLVSGAEQLNANSSQLITGVGQLQSGA
FT                   SQVEQLVTGANQLQAGLEQLANSTSLSAEQSSQIQALLTGLPQLQVAINQLNDSLSSIG
FT                   GLAVDNSTLSSLLTEMGAQAQGLLTAAQADKTASIEALQTTATYQNLTADQQAELVGAL
FT                   QNSPSATATVAQTILDQLSQLSQTLSSLQSLSGMATQMNQLQSAVGQINTAANQALPGA
FT                   TTAIESLSSGLSQVNTALNQQVLPGTQTLTSGVSQLQTQLSSGASQLMFGVTAYTAGVA
FT                   QLAAGGAQLVANNSSIQSGGGQLTSGLATLASNSSQLVSGSEQLASGSQQLIAGADQLA
FT                   SGGQALTSGISSLRTGSETLTNSLSSASQQLSVVSVEDKNAQAVSQPVTLEHSDQDDVK
FT                   TNGVGMAPYMVSVALMVAALSANVIFVKHIDNRSYKNRWDWAKGKLLLNGIIASLAAVI
FT                   LYGVLRLIGIEPAHPMATLGIILLASWTFMALVTALVGWNNRFGSFASLIILLLQLGSS
FT                   AGTYPIELSPRFFQVIQPYLPMTYSVSSLRQTISMVGNSSHQVWMLSLFLVGFMGLGLL
FT                   IYNQKDE"
FT   sig_peptide     247815..247913
FT                   /locus_tag="SSU0242"
FT                   /note="Signal peptide predicted for SSU0242 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.949) with cleavage site
FT                   probability 0.474 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(247851..247919,249732..249800,249858..249926,
FT                   249936..250004,250023..250091,250200..250259)
FT                   /locus_tag="SSU0242"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0242 by TMHMM2.0 at aa 13-35, 640-662, 682-704, 708-730,
FT                   737-759 and 796-815"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    249540..250175
FT                   /locus_tag="SSU0242"
FT                   /note="HMMPfam hit to PF01061, ABC-2 type transporter,
FT                   score 0.0024"
FT                   /inference="protein motif:HMMPfam:PF01061"
FT   CDS_pept        complement(250324..251382)
FT                   /transl_table=11
FT                   /locus_tag="SSU0243"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44605"
FT                   /protein_id="CAR44605.1"
FT                   /translation="MKKKLTIAIIIGFVSLIAGLILAGIGFFTGGITRLEEVAAPTEVH
FT                   KTFTDLNTIKIDFIPHSVYIKESSDNNYHVTYANSDNNIQNPLKLSEKDGVLTLSAQEL
FT                   EFAIEGIMQYLGESLAQRRINVFSVTIEVPKGKTLDKLEGHNLHFYDFGGFTIENIHIK
FT                   EANLSGGVTLDKVTIDSGQIEAGYFQATQSTLKDMHINLQGSSVRLYETSLENVTIEGY
FT                   SQLDSRQTTLLGDNRFTPSDTYSSTTFLDVTDKSLADSNLLITNQIDKKKLVEAQGYYY
FT                   EDGNDLGEMVNQDPYLKERLGEVGIFTSDKYTKFPVKTENDLQTLTLENKGSKNKLTIE
FT                   ATNATINLGTPK"
FT   sig_peptide     complement(251266..251382)
FT                   /locus_tag="SSU0243"
FT                   /note="Signal peptide predicted for SSU0243 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.365 between residues 39 and 40"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(251296..251364)
FT                   /locus_tag="SSU0243"
FT                   /note="1 probable transmembrane helix predicted for SSU0243
FT                   by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(251379..252134)
FT                   /transl_table=11
FT                   /locus_tag="SSU0244"
FT                   /product="putative membrane protein"
FT                   /note="CDS contains additional internal amino acids,
FT                   residues 90 to 145, in comparison to orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44606"
FT                   /protein_id="CAR44606.1"
FT                   /translation="MTRTEYMEQLEKYLKKLPHKEYFEAISFFNEYFDEVGPERETEII
FT                   EELGSPKEAASELINNMLNKQIQEEKDQQEPIQLNWKLWVGLGALSMTGLFSFFLLFIM
FT                   GEFIGVIPLFATLILGAFFLGRYFRNFSQTKRTLWLAILAVISLPIAIPLLLILLASLL
FT                   GLVALILALIVGAFVLGVGLLTSGGYLIWEAFSLMSEGFNIFLMGFGSGLSLIGGAILI
FT                   YILTGFFAYWSWRLVKACFKWILKRGKRA"
FT   misc_feature    complement(join(251457..251525,251559..251627,
FT                   251655..251723,251760..251813,251826..251894))
FT                   /locus_tag="SSU0244"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0244 by TMHMM2.0 at aa 81-103, 108-125, 138-160, 170-192
FT                   and 204-226"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(251961..252134)
FT                   /locus_tag="SSU0244"
FT                   /note="HMMPfam hit to PF08006, Protein of unknown function
FT                   DUF1700, score 5.2e-05"
FT                   /inference="protein motif:HMMPfam:PF08006"
FT   CDS_pept        complement(252121..252447)
FT                   /transl_table=11
FT                   /locus_tag="SSU0245"
FT                   /product="PadR-like family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44609"
FT                   /protein_id="CAR44609.1"
FT                   /translation="MHFPVPAVLTEFLIMAILESDDSYGYEICQTIKLIANIKESALYP
FT                   ILKRLEQNDFLTTYSQEYQGRMRKYYSLTQLGHEELVRLKDDWDTYTNTINGIIEGSVR
FT                   HDKN"
FT   misc_feature    complement(252196..252423)
FT                   /locus_tag="SSU0245"
FT                   /note="HMMPfam hit to PF03551, Transcriptional regulator
FT                   PadR-like, score 1e-18"
FT                   /inference="protein motif:HMMPfam:PF03551"
FT   CDS_pept        252756..253136
FT                   /transl_table=11
FT                   /locus_tag="SSU0246"
FT                   /product="LrgA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44611"
FT                   /protein_id="CAR44611.1"
FT                   /translation="MKLYVQFMIILVFSFLGEAISTIFHLPIPGSIIGLILLFLALEFK
FT                   LIRLRHIHTVGNFLLANMTILFLPAAVGIMERFDAIKDYLLPIIVVILGAIFLNILVIG
FT                   FVVQFVKQKFEGDYIDAEGNHD"
FT   misc_feature    252762..253091
FT                   /locus_tag="SSU0246"
FT                   /note="HMMPfam hit to PF03788, LrgA, score 5.4e-41"
FT                   /inference="protein motif:HMMPfam:PF03788"
FT   misc_feature    join(252813..252881,252918..252977,253005..253073)
FT                   /locus_tag="SSU0246"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSU0246 by TMHMM2.0 at aa 20-42, 55-74 and 84-106"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        253111..253824
FT                   /transl_table=11
FT                   /locus_tag="SSU0247"
FT                   /product="LrgB-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44612"
FT                   /protein_id="CAR44612.1"
FT                   /translation="MMRREIMTELFSNPIFGIMLSIAAYLIGMLIYRRFPHPITTPLLV
FT                   ATGLIIVFLKMTGISYKEYYAGGSYLNMLIVPSTVALGIPLYRSFHLMKHHIRSILLGI
FT                   FVACIVNTVFTALIAKWFGMDFFLAISLFPKSVTTAMAVGITDKMQGIATVTLVVVVAT
FT                   GILTSVLGPVFLKLLKIEDPVAVGLALGGTGHAIGTGTAIKCGHTQGAMAGLAIGITGI
FT                   MYVVISPIVAQIILQ"
FT   misc_feature    join(253138..253206,253225..253293,253303..253371,
FT                   253408..253476,253486..253545,253564..253632,
FT                   253660..253728,253747..253815)
FT                   /locus_tag="SSU0247"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSU0247 by TMHMM2.0 at aa 10-32, 39-61, 65-87, 100-122,
FT                   126-145, 152-174, 184-206 and 213-235"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    253171..253815
FT                   /locus_tag="SSU0247"
FT                   /note="HMMPfam hit to PF04172, LrgB-like protein, score
FT                   3.4e-106"
FT                   /inference="protein motif:HMMPfam:PF04172"
FT   CDS_pept        complement(253857..254657)
FT                   /transl_table=11
FT                   /locus_tag="SSU0248"
FT                   /product="putative formate/nitrite transporter family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44614"
FT                   /protein_id="CAR44614.1"
FT                   /translation="MGANQETLMYTLEKSIKKKADLFEHSFSAYAVRSILASLYLGLGI
FT                   VISLYTADKLNHVAEGLGKFSYGLMFGWGLLMILYMNAELGTSNMMYMTVASHRKTIPT
FT                   KTALKMLATCILFNFVGAVLVCYLVSLTLPYQHVDAHSYLFEATVAKLSKTPLTQFIEG
FT                   IFANIVVNIGVFTFLRIKDDAGRLISVIFIIFIFAFLGYEHVIANFSLFSLAFFANGGP
FT                   VEGMTLLSVLSNFLFSGLGNYVGGGLFIGLLYSWLNNQSKLYVD"
FT   misc_feature    complement(253875..254648)
FT                   /locus_tag="SSU0248"
FT                   /note="HMMPfam hit to PF01226, Formate/nitrite transporter,
FT                   score 1.1e-16"
FT                   /inference="protein motif:HMMPfam:PF01226"
FT   misc_feature    complement(join(253887..253955,254037..254105,
FT                   254124..254192,254250..254318,254379..254447,
FT                   254505..254573))
FT                   /locus_tag="SSU0248"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0248 by TMHMM2.0 at aa 29-51, 71-93, 114-136, 156-178,
FT                   185-207 and 235-257"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        254798..255643
FT                   /transl_table=11
FT                   /gene="gla"
FT                   /locus_tag="SSU0249"
FT                   /product="glycerol facilitator-aquaporin"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44615"
FT                   /protein_id="CAR44615.1"
FT                   /translation="MDVTWTVKYITEFLATALLIIIGNGTVANVDLKGTKGNNSGWILI
FT                   AIGYGLAVMMPALMFGNVSGNHINPAFTLGLAVSGLFPWAHVAQYIVAQLLGAMFGQLV
FT                   VVAVYKPYFLKTENSNHILGSFSTISALDNGTKESRKAATTNGFLNEFVGSFVLFFGAL
FT                   ALTKHFFGSELVGKLIEQGYDKTVAETMTAPYTSGSIAVAHLGIGFLVMALVAALGGPT
FT                   GPGLNPARDLGPRIVHALLPKSVLGENKADSKWWYAWVGVCAPIIASIAAVALFKFLYL
FT                   "
FT   misc_feature    254798..255625
FT                   /gene="gla"
FT                   /locus_tag="SSU0249"
FT                   /note="HMMPfam hit to PF00230, Major intrinsic protein,
FT                   score 3.2e-23"
FT                   /inference="protein motif:HMMPfam:PF00230"
FT   misc_feature    join(254810..254878,254921..254989,255008..255076,
FT                   255251..255319,255380..255448,255566..255634)
FT                   /gene="gla"
FT                   /locus_tag="SSU0249"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0249 by TMHMM2.0 at aa 5-27, 42-64, 71-93, 152-174,
FT                   195-217 and 257-279"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    254996..255022
FT                   /note="PS00221 MIP family signature."
FT                   /inference="protein motif:Prosite:PS00221"
FT   CDS_pept        255772..257304
FT                   /transl_table=11
FT                   /locus_tag="SSU0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44617"
FT                   /protein_id="CAR44617.1"
FT                   /translation="MSDVIAFGYGSSRAKMQLKRLNRHGIIAGATGTGKTVTLKVLAEQ
FT                   LSDAGIPVFLSDIKGDLNSLVAANTKEIDPSRLEKTHYLDYSPVGYPVELWDVLGENGT
FT                   PIRMTISELGPVLLTRLLGLNDTQESILNIVFSVADERGLLLIDLMDLRAMLNFVAENA
FT                   AELSQYYGNIPARSVGAILRSLVVLEQQGGKIFFGEPSLDIADLMRTAEDGRGVINVLQ
FT                   ATQLFNQPTLYSTVLLSLLSELYEVLPEVGDLDKPKMVFFFDEAHVLFKDAPKVLLEKI
FT                   ELIVRLIRSKGVGVFFVTQNPTDIPDSVAAQLGNRIQHGLRAFTPKELKTVATVAETFR
FT                   QEGDEDLAKVIQELQVGEAVVSTLQADGTPSFADRVLIYPPKSMLGTVEPSALLSVINN
FT                   SPLMEKYADAVNRESAHEQILAMTEAKEAELIKKAEQAEAEKQAEKEAKAAAKMEEKAQ
FT                   KEAAKTAQKTSQPASRKTDSMMDRFTKNLMSQVGREVGRVVTRGIMGMLKGK"
FT   misc_feature    255775..257298
FT                   /locus_tag="SSU0250"
FT                   /note="HMMPfam hit to PF05872, Protein of unknown function
FT                   DUF853, NPT hydrolase putative, score 6e-248"
FT                   /inference="protein motif:HMMPfam:PF05872"
FT   misc_feature    255856..255879
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        257416..258024
FT                   /transl_table=11
FT                   /locus_tag="SSU0251"
FT                   /product="MutT/NUDIX hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44619"
FT                   /protein_id="CAR44619.1"
FT                   /translation="MTDQLQALLKDYQPQPLGEKRSYAVFLPLVWSDNQWQVLYEIRSE
FT                   SISQPGEVSFPGGGVEVGETPQQAAVREVMEELNIQPEQIDILGEIDYLVLECSTVHCF
FT                   VGRLNLDWTTILPNEEVARIFTVPLSTLLTTQPVYYQLDSQIVPDCDFPFERLRGGVDY
FT                   PFSHHKRSVPFYENLSENIWGMTAQFTHRFTEIVKSNLS"
FT   misc_feature    257563..257814
FT                   /locus_tag="SSU0251"
FT                   /note="HMMPfam hit to PF00293, NUDIX hydrolase, core, score
FT                   1.4e-15"
FT                   /inference="protein motif:HMMPfam:PF00293"
FT   misc_feature    257587..257646
FT                   /note="PS00893 mutT domain signature."
FT                   /inference="protein motif:Prosite:PS00893"
FT   CDS_pept        258026..258151
FT                   /transl_table=11
FT                   /locus_tag="SSU0252"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44628"
FT                   /protein_id="CAR44628.1"
FT                   /translation="MIGYFWEEKPAFAICINEKNGDKAQCEPMYIKTQKKQMHGR"
FT   CDS_pept        258314..260611
FT                   /transl_table=11
FT                   /locus_tag="SSU0253"
FT                   /product="putative surface-anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44630"
FT                   /protein_id="CAR44630.1"
FT                   /translation="MSKQKVVSSLLLSTVVLGGLAFYSTTTVKAESLEPDVTSVNASDA
FT                   TNKPVVPNEEGGDFLAEEELEDDDTLEEELNEKAEEVTEPSSPEALLQPRAMMSDSETS
FT                   GMEEIPMNDEPSDNTEEKVEKQQSPLIQTSNADYKSGKDQEKLRTSVSINLLKAEEGQI
FT                   QWKVTFDTSEWSFNVKHGGVYFILPNGLDLTKIVDNNQHDITASFPTDINDYRNSGQEK
FT                   YRFFSSKQGLDNENGFNSQWNWSAGQANPSETVNSWKSGNRLSKIYFINQITDTTELTY
FT                   TLTAKVTEPNQQSFPLLAVMKSFTYTNSKSTEVTSLGAREITLEKEKTLPPKENPKPEP
FT                   EAPKPDAPQAPSAPESPTEEPKKEDAPQTPQAPSTPEKQPEVPESPNPETPDAPSTPKD
FT                   EPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPSTPEKQPE
FT                   VPESPNPETPDAPSTPKDEPQVPSIPEEQPKETPAPEEPKKEDTPQTPQAPSTPKEEAP
FT                   KEEVPTPPAPSVPEEQPKETPTPEVPKQEDVQPEAPKSDKVESDKQMPETKKPDMKQPK
FT                   ADDMPKEQKPKADEPKAEQPQMDKPQMEAPKKDSEAPKSDKVETDKQLPETKQPDMKQP
FT                   KADDMPKEQKPKADEPKAEQPQMDKPQMEAPKKDSEAPKSDKVETDKPMPETKQPDMKQ
FT                   PKADKPEAEKAQMPRTEGMKPESKASMMPKAEAPKATLPNTGEASSAIGWLGGALATLA
FT                   TGLYLFKNKKEE"
FT   sig_peptide     258314..258403
FT                   /locus_tag="SSU0253"
FT                   /note="Signal peptide predicted for SSU0253 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.973 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(258332..258391,260531..260590)
FT                   /locus_tag="SSU0253"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0253 by TMHMM2.0 at aa 7-26 and 740-759"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    260483..260602
FT                   /locus_tag="SSU0253"
FT                   /note="HMMPfam hit to PF00746, Surface protein from
FT                   Gram-positive cocci, anchor region, score 1.3e-06"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   misc_feature    260507..260524
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        join(261046..261762,261766..263085)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0254"
FT                   /product="putative surface-anchored protein (pseudogene)"
FT                   /note="CDS contains a nonsense mutation (opal) after codon
FT                   239. C-terminal region is simlar to Streptococcus
FT                   pneumoniae surface protein PspC UniProt:Q8RQ77
FT                   (EMBL:AF276620) (612 aa) fasta scores: E()=6.3e-25, 35.897%
FT                   id in 429 aa"
FT                   /db_xref="PSEUDO:CAR44636.1"
FT   sig_peptide     261046..261135
FT                   /locus_tag="SSU0254"
FT                   /note="Signal peptide predicted for SSU0254 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.995 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    261064..261132
FT                   /locus_tag="SSU0254"
FT                   /note="1 probable transmembrane helix predicted for SSU0254
FT                   by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    262948..263067
FT                   /locus_tag="SSU0255"
FT                   /note="HMMPfam hit to PF00746, Surface protein from
FT                   Gram-positive cocci, anchor region, score 0.00041"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   misc_feature    262972..262989
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        join(263193..263222,263226..263285)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0254A"
FT                   /product="transposase (fragment)"
FT                   /note="Probable gene remnant. CDS contains a nonsense
FT                   mutation (opal) after codon 10. Similar to an internal
FT                   region of Streptococcus pneumoniae (strain ATCC BAA-255/R6)
FT                   IS861-truncation degenerate transposase (Orf1)
FT                   UniProt:Q8DQ22 (EMBL:AE008462) (65 aa) fasta scores:
FT                   E()=0.58, 40.000% id in 30 aa"
FT   CDS_pept        263328..263462
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0256"
FT                   /product="integrase (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus agalactiae (serotype V) phage
FT                   integrase family site-specific recombinase UniProt:Q8DWV1
FT                   (EMBL:AE014287) (494 aa) fasta scores: E()=0.00046, 55.814%
FT                   id in 43 aa"
FT                   /db_xref="PSEUDO:CAR44638.1"
FT   CDS_pept        complement(263556..263705)
FT                   /transl_table=11
FT                   /gene="rpmG1"
FT                   /gene_synonym="rpmGA"
FT                   /locus_tag="SSU0257"
FT                   /product="50S ribosomal protein L33 1"
FT                   /note="Similar to SSU1221, 44.898% identity (44.898%
FT                   ungapped) in 49 aa overlap (1-49:1-49)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44641"
FT                   /protein_id="CAR44641.1"
FT                   /translation="MRVNITLEHKESGERLYLTSKNKRNTPDRLQLKKYSPKLRKHVIF
FT                   TEVK"
FT   misc_feature    complement(263559..263702)
FT                   /gene="rpmG1"
FT                   /gene_synonym="rpmGA"
FT                   /locus_tag="SSU0257"
FT                   /note="HMMPfam hit to PF00471, Ribosomal protein L33, score
FT                   5.7e-18"
FT                   /inference="protein motif:HMMPfam:PF00471"
FT   CDS_pept        complement(263721..263903)
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="SSU0258"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44642"
FT                   /protein_id="CAR44642.1"
FT                   /translation="MAVPARRTSKAKKNKRRTHYKVAAPTVKFDETTGDYSRSHRVSLK
FT                   GYYKGRKIAKAASAE"
FT   misc_feature    complement(263736..263900)
FT                   /gene="rpmF"
FT                   /locus_tag="SSU0258"
FT                   /note="HMMPfam hit to PF01783, Ribosomal protein L32p,
FT                   score 4.8e-22"
FT                   /inference="protein motif:HMMPfam:PF01783"
FT   CDS_pept        264179..265462
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="SSU0259"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44645"
FT                   /protein_id="CAR44645.1"
FT                   /translation="MKLQKPKGTQDLLPQDSAKWQYVENFTRSIFKQYNYAEIRTPIFE
FT                   HYEVISRSVGDTTDIVTKEMYDFYDKGERHITLRPEGTAPVVRSYVENKLFAPEVQKPA
FT                   KFYYMGPMFRYERPQAGRLRQFHQIGVECFGSNNPATDVETIAMAYHFFEELGIKDIRL
FT                   HLNSLGNPESRAAYRQALIDYLTPLKEQLSKDSQRRLEENPLRVLDSKEKEDKVAVENA
FT                   PSILDYLDEESTVHFEAVRSMLDNLGITYTIDTNMVRGLDYYNHTIFEFMTEVGGNDLT
FT                   ICAGGRYDGLVTYFGGPETPAFGFGMGIERLILVLEKQGIELPLDTQLDVYIAVLGQEA
FT                   NGGALDLVQAIRKQGFRAERDYLDRKLKAQFKSADVFGAKAIITLGGSEIESGQVVVKN
FT                   NQTRSQVETSLEALKTDFASILEELEKQ"
FT   misc_feature    264233..264742
FT                   /gene="hisS"
FT                   /locus_tag="SSU0259"
FT                   /note="HMMPfam hit to PF00587, Aminoacyl-tRNA synthetase,
FT                   class II (G, H, P and S), score 9.9e-58"
FT                   /inference="protein motif:HMMPfam:PF00587"
FT   misc_feature    265094..265123
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   misc_feature    265166..265438
FT                   /gene="hisS"
FT                   /locus_tag="SSU0259"
FT                   /note="HMMPfam hit to PF03129, Anticodon-binding, score
FT                   3.4e-20"
FT                   /inference="protein motif:HMMPfam:PF03129"
FT   CDS_pept        complement(265543..266568)
FT                   /transl_table=11
FT                   /gene="adhP"
FT                   /locus_tag="SSU0260"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44648"
FT                   /protein_id="CAR44648.1"
FT                   /translation="MKAVVVNPESTGVVVVEKELRPLEAGEALVQIEYCGVCHTDLHVA
FT                   NGDFGKVPGRVLGHEGIGIVTEIAPGVTSLKVGDRVSVAWFFQGCGMCEYCTTGRETLC
FT                   RTVKNAGYSVDGGMAEQCIVTADYAVKVPEGLDPAQASSITCAGVTCYKAIKEAHLEPG
FT                   QWIAIYGAGGLGNLAVQYAKKVFNAHVIAVDINNDKLELAKEVGADVTINGLEVEDVPG
FT                   YIKEITGGGVHSTVVTAVSKVAFNQAIDSVRAGGYVVAVGLPSEYMDLSIVKTVLDGIK
FT                   VVGSLVGTRKDLEEAFHFGAMGLVVPVVQKRPVEDAEAVFNEMVAGTIQGRMVLDFCHS
FT                   H"
FT   misc_feature    complement(265663..266085)
FT                   /gene="adhP"
FT                   /locus_tag="SSU0260"
FT                   /note="HMMPfam hit to PF00107, Alcohol dehydrogenase,
FT                   zinc-binding, score 3.7e-37"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   misc_feature    complement(266173..266496)
FT                   /gene="adhP"
FT                   /locus_tag="SSU0260"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like, score 3.2e-47"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   misc_feature    complement(266353..266397)
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   misc_feature    complement(266449..266466)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS_pept        267021..269672
FT                   /transl_table=11
FT                   /gene="adhE"
FT                   /locus_tag="SSU0261"
FT                   /product="aldehyde-alcohol dehydrogenase [includes: alcohol
FT                   dehydrogenase; acetaldehyde dehydrogenase]"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44650"
FT                   /protein_id="CAR44650.1"
FT                   /translation="MADKKVVSPEEKLVEARKHVDELVQKGLVALDEFRKLGQEEVDYI
FT                   VAKASVAALDKHGELAMHAFEETKRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDD
FT                   VTGLTLIAEPVGVVCGITPTTNPTSTAIFKSLIALKTRNPIVFAFHPSAQESSAHAARV
FT                   VYEAAVAAGAPENCIQWVTKPSMEATSELMKHDGIATILATGGNAMVRAAYSCGKPALG
FT                   VGAGNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVAEFKSYK
FT                   TYFVNKKEKALLEEYCFGVKANSKNCAEGKLNADIVGRPAAWIAEQAGFSVPEGTNILA
FT                   AEVAEIGEKEPLTREKLSPVIAVLKVEGRAEGLEAARQMVEFHGLGHSAAIHTEDAELA
FT                   KEFGTIVRAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNSISDNVSAMNLLNIK
FT                   KVGRRRNNMQWFKVPSKTYFERDSIQYLQKCRDVERVMIVTDRAMVELGFLDRIIEQLD
FT                   LRRNKVVYQIFSDVEPDPDITTVYKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQ
FT                   PTVDFHDLVQKFMDIRKRAFKFPELGKKSKFIAIPTTSGTGSEVTPFAVISDKANNRKY
FT                   PIADYSLTPTVAIVDPALVLTVPAHVTADTGMDVLTHATEAYVSTVANDFTDGLALQAI
FT                   KLVFENLESSVKNADFVSREKMHNASTMAGMAFANAFLGISHSMAHKIGGRFHTVHGRT
FT                   NAILLPYVIRYNGTRPAKTATWPKYNYYKADEKYQDIARLLGLPCSTPEEAVAAYAQAV
FT                   YDLGERIGIQMNLKAQGIDEKELKEHSRELALLAYEDQCTPANPRLAMVDHMQEIIEDA
FT                   YYGYKERPGRIK"
FT   misc_feature    268197..268262
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1186.000, SD 3.23 at aa 393-414, sequence
FT                   TEDAELAKEFGTIVRAIRVIWN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    268437..269612
FT                   /gene="adhE"
FT                   /locus_tag="SSU0261"
FT                   /note="HMMPfam hit to PF00465, Iron-containing alcohol
FT                   dehydrogenase, score 1.9e-144"
FT                   /inference="protein motif:HMMPfam:PF00465"
FT   misc_feature    268959..269045
FT                   /note="PS00913 Iron-containing alcohol dehydrogenases
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00913"
FT   misc_feature    269217..269279
FT                   /note="PS00060 Iron-containing alcohol dehydrogenases
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00060"
FT   misc_feature    269373..269438
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1004.000, SD 2.61 at aa 785-806, sequence
FT                   EKYQDIARLLGLPCSTPEEAVA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        270086..271570
FT                   /transl_table=11
FT                   /locus_tag="SSU0262"
FT                   /product="putative threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44652"
FT                   /protein_id="CAR44652.1"
FT                   /translation="MTLVYQSTRDAKNTVSASQAILQGLATDGGLFTPLSIPTVDLDFS
FT                   VLKDASYQDVAKLILSAFLDDFTADELDYCINNAYDSKFDTSVIAPVVKLKGQYNLELF
FT                   RGSTIAFKDMALSILPYLMATATKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQII
FT                   VFYPRDGVSKVQELQMTTQTGANTHVVAIDGNFDDAQTNVKHMFNDEALRAKLAAKKLQ
FT                   FSSANSMNIGRLVPQIVYYVYAYAQLVKTGEIAAGDKVNFTVPTGNFGNILAAYYAKQI
FT                   GLPVGKLICASNDNNVLTDFFATGVYDKNRTFRVTTSPSMDILVSSNLERLIFHLFGND
FT                   AAKTAELMEALNTAGQYDIQGADAEILSLFAAAFATEEETAAEIKRVYDESDYIEDPHT
FT                   AVASAVYKQYVEQTGDQTPTVIASTASPYKFPVVAVEAVTGQSGLSDFEALAKLHEISG
FT                   VDLPPAVDGLETAPVRHNTVVAAADMQTEVERYLGV"
FT   misc_feature    270332..271264
FT                   /locus_tag="SSU0262"
FT                   /note="HMMPfam hit to PF00291, Pyridoxal
FT                   phosphate-dependent enzyme, beta subunit, score 9.6e-11"
FT                   /inference="protein motif:HMMPfam:PF00291"
FT   misc_feature    270389..270433
FT                   /note="PS00165 Serine/threonine dehydratases
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00165"
FT   CDS_pept        271699..273459
FT                   /transl_table=11
FT                   /locus_tag="SSU0263"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44653"
FT                   /protein_id="CAR44653.1"
FT                   /translation="MAQEQEKISREKKKALLKRLKERIKPKMKLVYLAAFLSWVQFLMR
FT                   IISFYLIAKGFVSYYEGGQVDLVRFVLILLGLNAFGYGVALIAKRLQGLGSQFARDSLK
FT                   QSFFEVLLAKDGQFASKATAADVFNIASQGIDSLDTYYSYYMASSLRTQFNCATVLLLV
FT                   FLIFPLGAVIFILALPLIPISIIAMQKRSKRIMNRYWGSYMDVGNLFLDDLKGLNTLYS
FT                   YQADATYEKTFNEQAEDFRDATMELLSFQLQAVGYMDAVMYLGIGLSGFVAVNSLAAGN
FT                   LSLFSMLFFVLIATEFFAPIREQGYGMHLVMMNTKMADRIFGFLDSMTAEQEIDSVHVP
FT                   AFDSLKLEDLAFAYGEKPVLEDISMTMPAGKVYALAGESGQGKTTLAQLLLGRLRADKG
FT                   AIYLGEQEISGISKLSLNEQVLYVSGQSTLLNQSIYHNLRMACDWSKEDILAWADQHGV
FT                   LQFVKNLPDGLDTIVGDDGAFLSPGQRQQVICARAVLAKRSLYIFDEVTSSVDQDNEGL
FT                   IYDLIDLVAKDAIVIIITHKMKQVEQADDILFLSAEGAVTGNYATLYQTSLAYGQLVDQ
FT                   QRELEEAVYG"
FT   misc_feature    join(271786..271854,271897..271956,272173..272241,
FT                   272446..272514,272533..272601)
FT                   /locus_tag="SSU0263"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0263 by TMHMM2.0 at aa 34-56, 71-90, 163-185, 254-276
FT                   and 283-305"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    272806..273360
FT                   /locus_tag="SSU0263"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 5.3e-33"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    272827..272850
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        273452..275113
FT                   /transl_table=11
FT                   /locus_tag="SSU0264"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44656"
FT                   /protein_id="CAR44656.1"
FT                   /translation="MDKKEMPTRVLIPRLLQSMKHLLPRIAVAVCFAVLGQVVTIAIPV
FT                   MLVYLAFNALTGNPAPLWTLGILILLALLRGAFRYGEHYFGHYVAFHTLAAYRRLIFAK
FT                   LRALAPGKLDRQDSGSLLKMIGEDIEALEVFFAHTIAPICTGILVALGLTVYFGLSSWG
FT                   LAFLALVTYALLAIAIPNQFAQQLQPLLKEQNASRKGYVSYFIESLKSMKDLMQFQQTD
FT                   ARFANLTQKSQEVNGQERRVAQTNFMQYAVSFLVVGLSIMGFAWLTFDLVGSQSLDLAT
FT                   GVALLVSFISSFAPFLELSRLPLGFKRAMNAGRNIYALLDEKEAERTGELVEVSVTDIA
FT                   IEQLDFDYDVRETGLYRNLSVQFEQGGIIGLVGESGAGKSTLMKLIMRWYDWQQGQIRL
FT                   SGLDSRQVDKAHLQGAFAYVPQVPQIFRQTIRENLVLGRTDISDETIMDLAEKCHMKER
FT                   ILAAPQGLDTLVEASDFSAGEGQRLELMRALLKNADCYIFDEPTSNLDSLNEARFIQLV
FT                   KEHCQGMVFLISHRSSTMACADTIFRLEDGQLVKEK"
FT   misc_feature    273527..274339
FT                   /locus_tag="SSU0264"
FT                   /note="HMMPfam hit to PF00664, ABC transporter,
FT                   transmembrane region, score 1.8e-05"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    join(273533..273601,273629..273685,273851..273919,
FT                   273932..274000,274199..274267,274295..274363)
FT                   /locus_tag="SSU0264"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0264 by TMHMM2.0 at aa 28-50, 60-78, 134-156, 161-183,
FT                   250-272 and 282-304"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    274547..275092
FT                   /locus_tag="SSU0264"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 4.3e-47"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    274568..274591
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        275114..275707
FT                   /transl_table=11
FT                   /locus_tag="SSU0265"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44657"
FT                   /protein_id="CAR44657.1"
FT                   /translation="MKKLQVKDLMVTGAFAALYFVCVGLGTLLSLVFDRSGNMMYAPAG
FT                   AALLAGPVYMLLVAKVGKFGSISLVGAVMACFFFLSGYMTAAFLPSLTFGFLAEMVAKS
FT                   GHYKQKWTNLFSYIIFSFGNLGPIILMWFMRDAYEANLLARGKSAEYIARVMLDFTPEN
FT                   VLWLSTTIILTALISGLFGQYMLQRYFKQSGYLS"
FT   sig_peptide     275114..275251
FT                   /locus_tag="SSU0265"
FT                   /note="Signal peptide predicted for SSU0265 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.878) with cleavage site
FT                   probability 0.474 between residues 46 and 47"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(275141..275209,275228..275296,275339..275407,
FT                   275444..275512,275603..275671)
FT                   /locus_tag="SSU0265"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0265 by TMHMM2.0 at aa 10-32, 39-61, 76-98, 111-133 and
FT                   164-186"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        275704..276363
FT                   /transl_table=11
FT                   /locus_tag="SSU0266"
FT                   /product="putative transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44659"
FT                   /protein_id="CAR44659.1"
FT                   /translation="MKLDARTKIILVIFTSFTYGMRLTILENAVLVLGLSLLFWFSGKR
FT                   KMAIMSPIAYSIFCLLSYITFLPAWLTHLLLVLTYTWPPLLAGHLLLMTTSGYELIHGL
FT                   RKWHLPEVFLLTLGVMFRFLPAIKQDARTICASLKVRGIFLRKRDVVCKPLQYMEFFLV
FT                   PLMMSLLRTAQELTVASLTKGLAVSTKSPAYIWSSWTVLDWSLCLCCLGFLILVRL"
FT   misc_feature    join(275761..275829,275866..275934,276286..276354)
FT                   /locus_tag="SSU0266"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSU0266 by TMHMM2.0 at aa 20-42, 55-77 and 195-217"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    275956..276285
FT                   /locus_tag="SSU0266"
FT                   /note="HMMPfam hit to PF02361, Cobalt transport protein,
FT                   score 7.5e-11"
FT                   /inference="protein motif:HMMPfam:PF02361"
FT   CDS_pept        276327..277754
FT                   /transl_table=11
FT                   /locus_tag="SSU0267"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Possible alternative translational start sites after
FT                   codons 1 and 11"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44660"
FT                   /protein_id="CAR44660.1"
FT                   /translation="MLSRFSDSRPAVTVKNVALTYSGADKPALQIEDLTIPEGQCVVLC
FT                   GQSGSGKSSFLKVLNGLTPEYYPAQLSGQIFLGDLDLQKSSLEEISRHIASVFQHPSTQ
FT                   FFHSQVLQELVFPCENQGLSREEIENRLAWVMELFGLASLSQRTISSLSGGQQQRLALA
FT                   VATMQGTDVLVLDEPTANLDQEGIVIVEDILKTLKSQGKTIIIAEHRLSYLSQLADRYL
FT                   YFQDGQVVTDYLADEFLSRTEECRQDMGLRCYDSEPYGRAIAELADQFVNDKEGLLVEN
FT                   LSVSQKENTLYEIEKLCLAPGQVVGLVGANGSGKTSLARYLVGLAEDKKSRISWQGQTL
FT                   SSRQRLEKTAFVMQDVRLQLFAESVERELTLGRKNRAVDEHLVARFGLSDLLERHPVSL
FT                   SGGEQQRVMIVASLLADKEIFIFDEPTSGLDLRRMQQVASALVDLKMKNKLVLLISHDE
FT                   ELLNLVCDKIVDIKQLK"
FT   misc_feature    276441..277007
FT                   /locus_tag="SSU0267"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 1.3e-49"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    276450..276491
FT                   /note="PS00675 Sigma-54 interaction domain ATP-binding
FT                   region A signature."
FT                   /inference="protein motif:Prosite:PS00675"
FT   misc_feature    276462..276485
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    276780..276824
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    277230..277748
FT                   /locus_tag="SSU0267"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 8e-35"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    277251..277274
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    277521..277565
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        277760..279037
FT                   /transl_table=11
FT                   /locus_tag="SSU0268"
FT                   /product="multi antimicrobial extrusion (MATE) family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44662"
FT                   /protein_id="CAR44662.1"
FT                   /translation="MNKQTYKEILTIAFPAMGENLLQMLMGVVDSYLVASIGIVALSGV
FT                   SLANNILAVYQAVFIALAVAVSSRLAQALGEGGSEGIGGTASESVKFTVFIGLLLGIFS
FT                   VLAGPIVLTSLGAESEVVQAGGLYLILVGGGAPFLGLMTSLSAILRTLGEPRFPMYISL
FT                   LSNVLNALFSAFAVFVLHAGVAGVAIGTVLSRLIGCSLLWSRLPISLKPWTWSFDKELL
FT                   RLALPATGERLMMRVGDVVVVALITSLGTATVAGNAIGETLTQFNYMPALGIATATIIL
FT                   TAKHRQDKAMVRHIFRTSFGLSLLFMFLVAGVTYFAGSFLIDLYTKDIQAAQASQTVLF
FT                   YAMLGVPFTAGTLIMTALWQGLGNARLPFYATTIGMWLVRIGIAYLLVTFFKIGLSAIW
FT                   IATILDNAFRSGVLFFQYRYSKQESI"
FT   misc_feature    277802..278284
FT                   /locus_tag="SSU0268"
FT                   /note="HMMPfam hit to PF01554, Multi antimicrobial
FT                   extrusion protein MatE, score 4.1e-31"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   misc_feature    join(277823..277891,277910..277978,278036..278104,
FT                   278138..278206,278270..278338,278477..278536,
FT                   278549..278608,278657..278725,278768..278836,
FT                   278900..278968)
FT                   /locus_tag="SSU0268"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSU0268 by TMHMM2.0 at aa 24-46, 53-75, 95-117, 129-151,
FT                   173-195, 242-261, 266-285, 302-324, 339-361 and 383-405"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    278435..278452
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    278438..278917
FT                   /locus_tag="SSU0268"
FT                   /note="HMMPfam hit to PF01554, Multi antimicrobial
FT                   extrusion protein MatE, score 1.4e-20"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   CDS_pept        279227..280162
FT                   /transl_table=11
FT                   /gene="mvaK1"
FT                   /locus_tag="SSU0269"
FT                   /product="mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44664"
FT                   /protein_id="CAR44664.1"
FT                   /translation="MSVVGKANGKIILMGEHAVVYGHPAIAMPFSAVEIIAQVTAQGEA
FT                   LTVACDFYKGLVHKMPKIWESLKHAIRFSLYRIGAPTDPAIHIEISSTIPAERGMGSSA
FT                   AVAVAVARALFAYYEKELTDSELWDIVQSSEKIAHGNPSGIDAATTSGKSPVFFIKHQP
FT                   IEPFELKLHAHLVVADTGVTGNTLEAISDVADLLEKKPEAIKLVEELGNLTRQAKEDLA
FT                   TDQAELLGSRMNQAHALLQKLGVSDPSLDKLVSLAQENGALGAKLTGGGRGGCMIALAR
FT                   TAQDAQKLAHILDQAGARQTWIQYLGETND"
FT   misc_feature    279485..279685
FT                   /gene="mvaK1"
FT                   /locus_tag="SSU0269"
FT                   /note="HMMPfam hit to PF00288, GHMP kinase, score 1.8e-20"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   misc_feature    279665..279688
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    279752..279787
FT                   /note="PS00141 Eukaryotic and viral aspartyl proteases
FT                   active site."
FT                   /inference="protein motif:Prosite:PS00141"
FT   misc_feature    279875..280123
FT                   /gene="mvaK1"
FT                   /locus_tag="SSU0269"
FT                   /note="HMMPfam hit to PF08544, GHMP kinase, C-terminal,
FT                   score 1.9e-12"
FT                   /inference="protein motif:HMMPfam:PF08544"
FT   CDS_pept        280155..281180
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="SSU0270"
FT                   /product="mevalonate diphosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44666"
FT                   /protein_id="CAR44666.1"
FT                   /translation="MTKQIGIARAHTNIALIKYWGKRDKELFLPMNSSLSLTLDAFYTD
FT                   TKVVFDPELTADEFYLNGILQKEKEILKISRFLDLFCEYIGERAFARVESLNFVPTAAG
FT                   LASSASAFAALALATATALDLDLSPATLSTLARRGSGSSTRSLFGGFVEWGMGTGSEDS
FT                   MAHPIDDADWDIGMVVLAVNTGPKKIASREGMDHTVATSPFYTAWVETAKQDLVDIKAA
FT                   IASRDFEKLGQITEHNGMKMHATTLSANPPFTYWSADSLVAQEAVRQVREATGLSAYMT
FT                   MDAGPNVKVLCRASQMDELVAGLAKVFPREKIITSKPGPAAYVLSEKDWQASQTAFEKG
FT                   I"
FT   misc_feature    280428..280604
FT                   /gene="mvaD"
FT                   /locus_tag="SSU0270"
FT                   /note="HMMPfam hit to PF00288, GHMP kinase, score 1.7e-10"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   misc_feature    280809..281084
FT                   /gene="mvaD"
FT                   /locus_tag="SSU0270"
FT                   /note="HMMPfam hit to PF08544, GHMP kinase, C-terminal,
FT                   score 0.00032"
FT                   /inference="protein motif:HMMPfam:PF08544"
FT   CDS_pept        281182..282261
FT                   /transl_table=11
FT                   /gene="mvaK2"
FT                   /locus_tag="SSU0271"
FT                   /product="phosphomevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44668"
FT                   /protein_id="CAR44668.1"
FT                   /translation="MKVQVKIPGKLFLAGEYAVVEAGYPAVIAAVGQYLTVTIETSDQG
FT                   SLHSSQKADLYLTWERKEGAVRIQGSHPYALIESAMQVTEAYLTAKGYACHGTYSLSVQ
FT                   SDLDDQASGAKYGLGSSGAVTVATVKALLTYYGHQADALLTYKLAALTQSKLGMTGSFG
FT                   DLAASSFGGLIAYHSLDRSWLLGKMAELSLLDVVESDWQSLSISPIQLPQGLDLLVGWT
FT                   GSAASTDSLVSQMESQKSQTEKEQIHSQFLADSKTCVEQLIVACQTNDSVSARQALSAN
FT                   RKLLQDFARGMGLVIETPQLSQLCDLAQTYGAVAKSSGAGGGDCGICLVDSKEQKAAIE
FT                   TAWQEAGIFPLTLNIASRE"
FT   misc_feature    281479..281697
FT                   /gene="mvaK2"
FT                   /locus_tag="SSU0271"
FT                   /note="HMMPfam hit to PF00288, GHMP kinase, score 7.6e-10"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   misc_feature    281965..282228
FT                   /gene="mvaK2"
FT                   /locus_tag="SSU0271"
FT                   /note="HMMPfam hit to PF08544, GHMP kinase, C-terminal,
FT                   score 2.4e-08"
FT                   /inference="protein motif:HMMPfam:PF08544"
FT   CDS_pept        282272..283369
FT                   /transl_table=11
FT                   /gene="fni"
FT                   /locus_tag="SSU0272"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44670"
FT                   /protein_id="CAR44670.1"
FT                   /translation="MFYLGEFGLDRKDQHVGLANQQYSATPAKDFTETLFVHHSLPQTK
FT                   VDEVDISTSVAGLDFAFPFFINAMTGGSKKTREINRLLGIMGHFGKIALASGSVSAAIK
FT                   DPSVAETFSVMRRENPYGIIFANLGAHHSVENAKRAVDLLEANAIQIHVNAPQEIVMPE
FT                   GDRDFTMWLKNIETLVREMEVPVIVKEVGFGMSRETVAQLASAGVQTIDVSGTGGTDFA
FT                   KIENARRTFNDYAYLEGWGQSTVTSLVEAMSVSEEVCPSLIASGGIKTPLDIVKSLALG
FT                   ADLVGMSNHFLQYVKDGKGHRFDDGLQAIKVYQWQIAEIMTMLGAKNIAELRQKDLVLA
FT                   PNVQNWCEARGIDWKAYARRSANVS"
FT   misc_feature    283052..283135
FT                   /gene="fni"
FT                   /locus_tag="SSU0272"
FT                   /note="HMMPfam hit to PF01645, Glutamate synthase,
FT                   central-C, score 1.8e-06"
FT                   /inference="protein motif:HMMPfam:PF01645"
FT   CDS_pept        complement(283464..285212)
FT                   /transl_table=11
FT                   /locus_tag="SSU0273"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44672"
FT                   /protein_id="CAR44672.1"
FT                   /translation="MLSKTKQASVFLRLLSYLKAYRLLTVLALSFLLLTTVVRSLIPLL
FT                   ASYFIDHYISTISETAVAILAAYFALYLLQMVLQYFGNLWFAKVSYSIVRDIRRDAFGR
FT                   MEKLGMAYFDQTPSGSIVSRITNDTESISEMFSGILSSFISALFIIVTTLSTMFALDWK
FT                   LTSLIVLFLPVIFILVDQYRKRSAPIVAKTRSLLSAINSKLAESIEGIWIIQAFSQEER
FT                   LKEEFEAINQEHLDYASRSMALDSLFLRPALSLVKILAYALLMTYFGLDWSQAGISAGL
FT                   IYAFIQYVNRLFDPLLDVTQHFSTLQTSMVSAGRVFTLMDQTIEEPLQLDRGAKIDKGH
FT                   IVFEDVYFSYDGKRQILDKVSFEVRQGQTIAFVGATGSGKSSIINVFMRFYEFQSGRIL
FT                   IDGQDIRSFSQEELRSAIGLVLQDPFLFHGTIASNIQMYQDISQEEIEEAARFVDAAPF
FT                   IEKLPEKYDHLVTERGSAFSTGQRQLLAFARTMASQPKILILDEATANIDSETEKTVQT
FT                   SLEKMRKGRTTIAIAHRLSTIQDADCIYVLDKGKIIESGNHEELLALKGHYHRMYQLQA
FT                   GQLTAT"
FT   misc_feature    complement(283563..284114)
FT                   /locus_tag="SSU0273"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 9.3e-57"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(284070..284093)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(284325..285140)
FT                   /locus_tag="SSU0273"
FT                   /note="HMMPfam hit to PF00664, ABC transporter,
FT                   transmembrane region, score 1.8e-32"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    complement(join(284406..284474,284676..284729,
FT                   284739..284807,284991..285059,285087..285155))
FT                   /locus_tag="SSU0273"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0273 by TMHMM2.0 at aa 20-42, 52-74, 136-158, 162-179
FT                   and 247-269"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(285069..285212)
FT                   /locus_tag="SSU0273"
FT                   /note="Signal peptide predicted for SSU0273 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.979) with cleavage site
FT                   probability 0.376 between residues 48 and 49"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(285202..286944)
FT                   /transl_table=11
FT                   /locus_tag="SSU0274"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44676"
FT                   /protein_id="CAR44676.1"
FT                   /translation="MKIIKQLWWFFSLEKKAYLIGILSLCLVSLLNLLPASIMGQLIDQ
FT                   IASGQLTEHRLLLGVAGLILSALAMYGLRYLWRMNILATSYRLGKIMRARLFDHFMHLS
FT                   PSFFQQHRTGDLMAHATNDINALTRLAGGGVMSFVDATVTALVTLITMSLSISWQMTLV
FT                   AILPLPFMTLTTNFLGRRTHENFKASQAAFSELNNKVQEAVSGIKVTKSFGYQEQETAA
FT                   FQEVNQAAFLQNIKTMRYDALFNPAVLFFIGLSYLLTLLVGSHFISQGQVSLGQLVTFM
FT                   TYLDLLVWPLMAIGFLVNISQRGDVSYNRIQTLLSISSEVIETDQPLPAPSNGELVYEI
FT                   SEFAYDNIPVLQDIQFQIKKGQTIGLVGLTGSGKTSLLKLLMREYDVINGQILLNQENI
FT                   KNYKLADLRRLIGYVPQDQFLFATSITENIRFGNPDLSLNQVEEAARAVHVYEDIQDMP
FT                   DRFETMVGEKGISLSGGQKQRLAMARAMILNPDILLLDDSLSAVDAKTEHAILETIKQE
FT                   RLDKTTIITAHRLSAIVHADLILVLEDGKIVERGRHQELLDEKGWYYDTYMMQQLEKEE
FT                   SDAL"
FT   misc_feature    complement(285310..285864)
FT                   /locus_tag="SSU0274"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 2.1e-53"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(285487..285531)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(285820..285843)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(join(286042..286110,286153..286221,
FT                   286411..286479,286489..286557,286714..286773,
FT                   286816..286884))
FT                   /locus_tag="SSU0274"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0274 by TMHMM2.0 at aa 21-43, 58-77, 130-152, 156-178,
FT                   242-264 and 279-301"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(286072..286893)
FT                   /locus_tag="SSU0274"
FT                   /note="HMMPfam hit to PF00664, ABC transporter,
FT                   transmembrane region, score 1.9e-39"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   sig_peptide     complement(286798..286944)
FT                   /locus_tag="SSU0274"
FT                   /note="Signal peptide predicted for SSU0274 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.743) with cleavage site
FT                   probability 0.327 between residues 49 and 50"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        287201..287467
FT                   /transl_table=11
FT                   /locus_tag="SSU0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44678"
FT                   /protein_id="CAR44678.1"
FT                   /translation="MKAIVTVVGKDKSGIVAGVATKIAELGLNIDDISQTVLDEYFTMM
FT                   AVVSSDEKKDFTKLRAELEAYGQALNVKINIQSAAIFDAMHNL"
FT   misc_feature    287207..287404
FT                   /locus_tag="SSU0275"
FT                   /note="HMMPfam hit to PF01842, Amino acid-binding ACT,
FT                   score 8e-09"
FT                   /inference="protein motif:HMMPfam:PF01842"
FT   CDS_pept        287479..288816
FT                   /transl_table=11
FT                   /locus_tag="SSU0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44679"
FT                   /protein_id="CAR44679.1"
FT                   /translation="MDIRQVRETIEMIEEQNFDIRTITMGISLLDCIDSDIDKAAEKVY
FT                   TKIVTKAKNLVAVGDEIAAELGIPIVNKRVSVTPIALIGAATDATDYLPLAHALDKAAH
FT                   EIGIDFIGGFSALAQKGYQKGDEILINSIPQALAQTSKVCSSVNIGSTKTGINMTAVRD
FT                   MGRIIKETAEASDMGAAKLVVFANAVEDNPFMAGAFHGVGEADVVINVGVSGPGVVKRA
FT                   LEKVRGESFDVVAETVKKTAFKITRIGQLVGNMASERLGVKFGIVDLSLAPTPAVGDSV
FT                   ARVLEEMGLETVGTHGTTAALALLNDAVKKGGVMACNQVGGLSGAFIPVSEDEGMIAAV
FT                   QNGSLNLEKLEAMTAICSVGLDMIAIPETTPAETIAAMIADEAAIGVINQKTTAVRIIP
FT                   LGKEGDMIEFGGLLGTAPVMKVNQASSVDFINRGGQIPAPIHSFKN"
FT   misc_feature    287479..288813
FT                   /locus_tag="SSU0276"
FT                   /note="HMMPfam hit to PF05167, Protein of unknown function
FT                   DUF711, score 7.5e-278"
FT                   /inference="protein motif:HMMPfam:PF05167"
FT   CDS_pept        288892..289587
FT                   /transl_table=11
FT                   /locus_tag="SSU0277"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44680"
FT                   /protein_id="CAR44680.1"
FT                   /translation="MADVRLYISRHGKTMFNTIGRVQGWCDTPLTKVGEEGIRELGLGL
FT                   KDAGLDFKLAVSSDLGRTVQTMTIAQRELGILGKIPYYQDKRIREWCFGSFEGMYDAEL
FT                   FQGVLPRLKGTVDATGMSFAEIAAGIQEADTAGWAESWEVLSNRILTGFESIAQDLEKQ
FT                   GGGNALVVSHGMTIATLAHLLEPERGANVFLDNGSITVLKYENGKLLIEAVGDLSYRKR
FT                   GAELIAQGK"
FT   misc_feature    288904..289431
FT                   /locus_tag="SSU0277"
FT                   /note="HMMPfam hit to PF00300, Phosphoglycerate mutase,
FT                   score 7.3e-35"
FT                   /inference="protein motif:HMMPfam:PF00300"
FT   repeat_region   complement(289774..289865)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        289906..290940
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SSU0278"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44681"
FT                   /protein_id="CAR44681.1"
FT                   /translation="MITQRQNDILNLIVELFTRHHEPVGSKALQEMIASSSATIRNDMA
FT                   KLEQLGLLEKAHTSSGRMPSRAGFQYFVNHSLNLKHINEEDVYQVVKAFDFEAFKLEDI
FT                   LERASQVLADLTGYTSVILDVEPTSQQLTSFDIVQLSSHDALAVLTLDQSKPVTVQFAI
FT                   PKNFLTRDLEVLKRLVDERFVGQTVLAIHYKLRTEIPQVVQRYFATTDNVLDLMDYIFS
FT                   NLFQESVFISGKVASLTYGNLATYQLLDSPQLLAPELRQGLAPNQQTSISVAEHREPAL
FT                   ADVTVIHHRFPIPYRGMGQMSLLGPVDMDYRRQMSLINIISRILFMKLTDYYRYLSSNH
FT                   YEVN"
FT   misc_feature    290206..290850
FT                   /gene="hrcA"
FT                   /locus_tag="SSU0278"
FT                   /note="HMMPfam hit to PF01628, Negative regulator of class
FT                   I heat shock protein, score 6.2e-53"
FT                   /inference="protein motif:HMMPfam:PF01628"
FT   CDS_pept        290953..291465
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SSU0279"
FT                   /product="GrpE protein (HSP-70 cofactor)"
FT                   /note="CDS is truncated at the N-terminus in comparison to
FT                   some orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44684"
FT                   /protein_id="CAR44684.1"
FT                   /translation="MSEEIKNEEIVEEVEATEEVVETPEKSELDLANERAEEFENKYLR
FT                   AHAEMQNIQRRANEERQTIQRYRSQDLAKKILPSLDNLERALQVEGLTEDVKKGLEMVQ
FT                   ESLIQALKEEGVEEVATDVFDPNLHMAIQTVPATDDCPAEHIAQVFQKGYKLHERLLRP
FT                   AMVVVSE"
FT   misc_feature    290986..291462
FT                   /gene="grpE"
FT                   /locus_tag="SSU0279"
FT                   /note="HMMPfam hit to PF01025, GrpE nucleotide exchange
FT                   factor, score 2.8e-60"
FT                   /inference="protein motif:HMMPfam:PF01025"
FT   misc_feature    291322..291456
FT                   /note="PS01071 grpE protein signature."
FT                   /inference="protein motif:Prosite:PS01071"
FT   CDS_pept        291562..293385
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SSU0280"
FT                   /product="chaperone protein DnaK (heat shock protein 70)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44686"
FT                   /protein_id="CAR44686.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNG
FT                   EIIVGDAAKRQAVTNPDTIISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAEEY
FT                   LGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKTDKDEK
FT                   ILVFDLGGGTFDVSILELGDGVFDVLATAGDNKLGGDDFDQKIIDHMVAEFKKENGIDL
FT                   SADKMALQRLKDAAEKAKKDLSGVTSTQISLPFITAGAAGPLHLEMTLTRAKFDELTYD
FT                   LVERTKIPVRQALSDAGLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPDEV
FT                   VAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSVKA
FT                   KDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAEADKKRKEEVDLRNDVDQAIFATE
FT                   KTLKETEGKGFDAERDQAQAALDELKAAQEANNLDDMKAKLENLNEKAQALAVKLYEQA
FT                   AAAQQAAAGQEGAQTANNADDDVVDGEFTEK"
FT   misc_feature    291571..293283
FT                   /gene="dnaK"
FT                   /locus_tag="SSU0280"
FT                   /note="HMMPfam hit to PF00012, Heat shock protein 70, score
FT                   0"
FT                   /inference="protein motif:HMMPfam:PF00012"
FT   misc_feature    291580..291603
FT                   /note="PS00297 Heat shock hsp70 proteins family signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00297"
FT   misc_feature    292057..292098
FT                   /note="PS00329 Heat shock hsp70 proteins family signature
FT                   2."
FT                   /inference="protein motif:Prosite:PS00329"
FT   misc_feature    292480..292524
FT                   /note="PS01036 Heat shock hsp70 proteins family signature
FT                   3."
FT                   /inference="protein motif:Prosite:PS01036"
FT   CDS_pept        293817..294953
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SSU0281"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44688"
FT                   /protein_id="CAR44688.1"
FT                   /translation="MNNTEFYDRLGVSKNASPDEIKKAYRKLSKKYHPDINKDPGAEDK
FT                   YKEVQEAYETLSDPQKRSAYDQYGPAGANGGFGGGAGGFGGFDGAGFGGFEDIFSSFFG
FT                   GGGATRNPNAPRQGDDLQYAVNLKFEEAIFGVEREVSYNREATCRTCTGSGAKPGTSPV
FT                   TCGRCHGSGVINVDTQTPLGTMRRQMTCDVCHGRGKQIKDPCTTCHGTGHEKQAHTVTV
FT                   KVPAGVETGQRIRLAGQGEAGFNGGPYGDLYVVIQVQPSDKFEREGTTIHYKLNLNFVQ
FT                   AALGDTVHVPTVHGDVDMVIPEGTQTGKTFRLKGKGAPSVRGGAIGDQYVTVNIVTPTG
FT                   LNDRQKAALKEFAAAGNIDVKPHKKGFFDKVKDAFEDL"
FT   misc_feature    293829..294014
FT                   /gene="dnaJ"
FT                   /locus_tag="SSU0281"
FT                   /note="HMMPfam hit to PF00226, Heat shock protein DnaJ,
FT                   N-terminal, score 1.2e-37"
FT                   /inference="protein motif:HMMPfam:PF00226"
FT   misc_feature    293952..294011
FT                   /note="PS00636 Nt-dnaJ domain signature."
FT                   /inference="protein motif:Prosite:PS00636"
FT   misc_feature    294066..294113
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   misc_feature    294219..294473
FT                   /gene="dnaJ"
FT                   /locus_tag="SSU0281"
FT                   /note="HMMPfam hit to PF00684, DnaJ central region, score
FT                   8.1e-34"
FT                   /inference="protein motif:HMMPfam:PF00684"
FT   misc_feature    294258..294332
FT                   /note="PS00637 CXXCXGXG dnaJ domain signature."
FT                   /inference="protein motif:Prosite:PS00637"
FT   misc_feature    294387..294404
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    294429..294446
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    294510..294875
FT                   /gene="dnaJ"
FT                   /locus_tag="SSU0281"
FT                   /note="HMMPfam hit to PF01556, Chaperone DnaJ, C-terminal,
FT                   score 1.2e-67"
FT                   /inference="protein motif:HMMPfam:PF01556"
FT   CDS_pept        295229..296056
FT                   /transl_table=11
FT                   /locus_tag="SSU0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44689"
FT                   /protein_id="CAR44689.1"
FT                   /translation="MKSWVENVTIKKYEDRSGLTGLKQEPLVWTEVFLREVNRQSNTGI
FT                   LHFWPMDQTVILGMMDSQVAQLDKGLASIGQAGYSPIIRSLGGLAVVADEGILNVTLIL
FT                   SNPSGHKVDLRESYQVMVDLIAQALSDFPFEVVSGEVATSYCPGTYDLSIKGRKFAGLA
FT                   QRIYQEAIAISAYISVSGNQVKRGQVVADFYVASFAPQEVSDRFPQVNPDSMANLSDLV
FT                   GQDVTVEDMKKRIEQVLVENGTRLSTFYPSSDNMADFMTFGKTIKQSMEKYGI"
FT   CDS_pept        296066..297514
FT                   /transl_table=11
FT                   /locus_tag="SSU0283"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44691"
FT                   /protein_id="CAR44691.1"
FT                   /translation="MIWKDATAMAQAVNQKQVFAKELVQETIDRIEKLNPTLNAVVSKQ
FT                   YEEALKEAEKEDYLGKPFAGVPFLLKDLGQNEKGQPSSAGSRLLAGRPAGHTDTYVQRL
FT                   KDLGFIIVGRTNTPEFGFKNISDASLHGPVNLPLDPSRNAGGSSGGAAAALASGMVSIA
FT                   AASDGGGSIRIPASFNGLIGLKTSRGRIPVGPKSYRGWQGASVNFALTKSVRDTQRLLY
FT                   HFQDYQLEAPFPLAKLSEEEVFGKLSRPLKIAYYTKSPVGSKVSLEAVEAVQKACHHLA
FT                   NLGHEVVELTEYPLDGVALMKSFYLMNSVDTAQMFDEIEAAFGRQMTLDDMEVMSWAIY
FT                   QSGQTIPAKLYSKALLDWDQFGASMARFHEEYDLLLTPTVADVAPKHGQFDLPVDLLDR
FT                   LKQTQNYSMEEQQDLIWQMFEDSLALTPFTQQANICGQPAISLPTYVRADSLPIGVQLT
FT                   ASKGREDLLLQLADQMEAAGLLNL"
FT   misc_feature    296129..297469
FT                   /locus_tag="SSU0283"
FT                   /note="HMMPfam hit to PF01425, Amidase signature enzyme,
FT                   score 9.6e-70"
FT                   /inference="protein motif:HMMPfam:PF01425"
FT   misc_feature    296498..296593
FT                   /note="PS00571 Amidases signature."
FT                   /inference="protein motif:Prosite:PS00571"
FT   CDS_pept        297639..298514
FT                   /transl_table=11
FT                   /locus_tag="SSU0284"
FT                   /product="extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44692"
FT                   /protein_id="CAR44692.1"
FT                   /translation="MLKKVLASALLVSTLTLAACSSSSSNTSSSSAEQTQWEKIQEAGV
FT                   LKVATPGTLFPTSYYNDAKELVGYEIDMINEIGKRLKLEIEYQEIGVAEAFTAVDSGKV
FT                   DISVNNFDMTEARKEKYNFSIPYKYSVGGYIVREDGSSGIEAADLSDWTGKKAGGGAGT
FT                   QYMKIAEKQGAEPVIYDNVTNDVYLRDVSTGRTDFIPNDYYTQVMAIKWANANFPDIKV
FT                   KMGEAKYNPTEQGIVMSKADTSLKEKIDEALEAMKADGTLKAISEKYYAGQDLTVPVEN
FT                   ADKLPVIEVE"
FT   sig_peptide     297639..297734
FT                   /locus_tag="SSU0284"
FT                   /note="Signal peptide predicted for SSU0284 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.616 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    297666..297698
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    297774..298454
FT                   /locus_tag="SSU0284"
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding protein, family 3, score 3.3e-58"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   misc_feature    297840..297881
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT                   /inference="protein motif:Prosite:PS01039"
FT   CDS_pept        298605..299276
FT                   /transl_table=11
FT                   /locus_tag="SSU0285"
FT                   /product="transport system membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44693"
FT                   /protein_id="CAR44693.1"
FT                   /translation="MDINWQAVFNADIAREAIPQILEGLPYTLSLSLIGFALGTFCGFF
FT                   VALMRMSKFGPLRWLAMAHISLMRGIPLMVLLFFIYFGLPFMGLQLDAISASIIAFTSM
FT                   SSAYISEIIRASLSAIDKGQWEAARSLGLRTNVIHRKIIIPQAFRIALPPLSNVLLDMV
FT                   KSTSLTAMITVPEIFNKAKIVGGAKSDYMTVYICVALIYWVICTLYAFGQLKLEKRLAT
FT                   Y"
FT   misc_feature    298665..299270
FT                   /locus_tag="SSU0285"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 1.5e-23"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    join(298683..298751,298812..298871,299175..299243)
FT                   /locus_tag="SSU0285"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSU0285 by TMHMM2.0 at aa 27-49, 70-89 and 191-213"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(299400..299609)
FT                   /transl_table=11
FT                   /locus_tag="SSU0286"
FT                   /product="putative DNA-binding protein"
FT                   /note="Possible alternative translational start site after
FT                   codon 2"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44696"
FT                   /protein_id="CAR44696.1"
FT                   /translation="MEMIRVNLDKVLKDRQMTSKDLAEQVGITEANLSILKTGKAKGIR
FT                   FNTLMSICRILDCQPGDILEYVEE"
FT   misc_feature    complement(299496..299561)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1554.000, SD 4.48 at aa 17-38, sequence
FT                   MTSKDLAEQVGITEANLSILKT"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(299611..300135)
FT                   /transl_table=11
FT                   /locus_tag="SSU0287"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44699"
FT                   /protein_id="CAR44699.1"
FT                   /translation="MKTNLLKTAGIVAACVRYFFYLLIASYIFFSLAGLGGDSFAIGSW
FT                   EYTFNKPIDQISVWLILLATGLILVVLVALSHIAHLIQKLCKLLLEEDYFASASMELYQ
FT                   KLFISLLVLTAGQFCLTSLITLTNAAGPNNFLNLRWSDFILNALFIFLTYFVWTLVQKG
FT                   QQLETENSEFI"
FT   misc_feature    complement(join(299656..299709,299752..299820,
FT                   299899..299967,300010..300078))
FT                   /locus_tag="SSU0287"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSU0287 by TMHMM2.0 at aa 20-42, 57-79, 106-128 and
FT                   143-160"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(300013..300135)
FT                   /locus_tag="SSU0287"
FT                   /note="Signal peptide predicted for SSU0287 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.796) with cleavage site
FT                   probability 0.791 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(300270..302138)
FT                   /transl_table=11
FT                   /locus_tag="SSU0288"
FT                   /product="putative cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44700"
FT                   /protein_id="CAR44700.1"
FT                   /translation="MTLVTNLKQHSHIITTALCLALILIGILLFQTGQGWAPILFISAF
FT                   VIGGYQSAKEGISELIFDKHLSVDLLMILAAIGSGLIGYWMEGALLIFIFSLSSTLEEL
FT                   AMKKSKNAIAALMNMTPPTARKIEENGDITVLDTAAIRIGDLLQVRKGDTVPLDATLIS
FT                   PQSIFDESMITGEPLPAEKMAGDAVIGGTINQGPTVTVQVTAEKGDALFDKIVQMVENA
FT                   QESKSKTATFIENMEDTYVKVVLVVVPLFILLAHFALGWDWLTAFYRGMILLTIASPCA
FT                   LVASSSPATLSAISRAARKGMIIKGGDIADNIANLEAIVFDKTGTLTIGKPEVVGATYL
FT                   GDEELIKQVVQAVEKQSSHPIAQALMTYTADSSAIALQSLEDVTGKGLVAGYEGDSWKI
FT                   GKAGFVADSLVSPLSAGLLAQIDEAESTGKTLVYVSQNDVLVAIFMVEDSLKPESKQLI
FT                   AQLKEMGVTPILLTGDQEKTARYVASQVGIDRVIANCLPTDKAAVIQELQTEFASVGMV
FT                   GDGINDAPALAQANVSYAMGSGTDIAMESADIVLMEDLTRIPYSIRLSKKMRGIIKQNI
FT                   IFALSVIALLIISNLFQSINLPLGVVGHEGSTILVILNGLRLLYFK"
FT   misc_feature    complement(join(300276..300344,300354..300413,
FT                   301260..301328,301356..301424,301854..301922,
FT                   302034..302102))
FT                   /locus_tag="SSU0288"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0288 by TMHMM2.0 at aa 13-35, 73-95, 239-261, 271-293,
FT                   576-595 and 599-621"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(300519..301193)
FT                   /locus_tag="SSU0288"
FT                   /note="HMMPfam hit to PF00702, Haloacid dehalogenase-like
FT                   hydrolase, score 2.9e-32"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    complement(300522..300590)
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT                   /inference="protein motif:Prosite:PS01229"
FT   misc_feature    complement(301155..301175)
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT                   /inference="protein motif:Prosite:PS00154"
FT   misc_feature    complement(301203..301871)
FT                   /locus_tag="SSU0288"
FT                   /note="HMMPfam hit to PF00122, E1-E2 ATPase-associated
FT                   region, score 2.9e-65"
FT                   /inference="protein motif:HMMPfam:PF00122"
FT   misc_feature    complement(301752..301817)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1444.000, SD 4.11 at aa 108-129, sequence
FT                   KSKNAIAALMNMTPPTARKIEE"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   sig_peptide     complement(302028..302138)
FT                   /locus_tag="SSU0288"
FT                   /note="Signal peptide predicted for SSU0288 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.572 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(302301..302756)
FT                   /transl_table=11
FT                   /locus_tag="SSU0289"
FT                   /product="ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44701"
FT                   /protein_id="CAR44701.1"
FT                   /translation="MELHSHFNAENQTAFEHVIQHLKEKGIRITETRKAVVAYIIESDD
FT                   HPSAEMIYQDLIPNYPNMSLATVYNNLKLLLEEGFVTKLKRTNDNTTYYDFMGHEHLNV
FT                   ICEVCGKITDFMDVEIPSLKKEAHTQTGYKITKEVLSIYGICPDCQN"
FT   misc_feature    complement(302328..302687)
FT                   /locus_tag="SSU0289"
FT                   /note="HMMPfam hit to PF01475, Ferric-uptake regulator,
FT                   score 3.3e-46"
FT                   /inference="protein motif:HMMPfam:PF01475"
FT   CDS_pept        302923..303672
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="SSU0290"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44702"
FT                   /protein_id="CAR44702.1"
FT                   /translation="MTRYKAIISYDGHDFSGFQRQPHARTVQEEIEKTLVRLNSGQPVT
FT                   VHGAGRTDAGVHAYGQVIHFDLAGSRDVEKLRFALDTQTSEDIDVVSVEQVADDFHCRY
FT                   AKHSKTYEFLVDIGRPKNPMMRHYATFYPYDLDLSLIEEAIQDLVGTHDFTGFTASGTS
FT                   VEDKVRTITVASMEYDQQRQFLIFTFSGNGFLYKQVRNMVGTLLKIGNGRMPVGQIKRI
FT                   LAEKDRGLAGPTAAGNGLYLKEIIYED"
FT   misc_feature    302938..303237
FT                   /gene="truA"
FT                   /locus_tag="SSU0290"
FT                   /note="HMMPfam hit to PF01416, tRNA pseudouridine synthase,
FT                   score 3.8e-40"
FT                   /inference="protein motif:HMMPfam:PF01416"
FT   misc_feature    303352..303666
FT                   /gene="truA"
FT                   /locus_tag="SSU0290"
FT                   /note="HMMPfam hit to PF01416, tRNA pseudouridine synthase,
FT                   score 1.1e-30"
FT                   /inference="protein motif:HMMPfam:PF01416"
FT   CDS_pept        303662..304423
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SSU0291"
FT                   /product="putative phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44703"
FT                   /protein_id="CAR44703.1"
FT                   /translation="MKTKYILALSGNDIFSGGGLHADLTTYTVHGLHGFVAVTCLTAMT
FT                   EKGFEVIPTETAVFAQQLASLKDVPFSAIKIGLLPSVEIAEQALEFIKTHQEIPVVLDP
FT                   VLVCKETHDTEVSQLRDEILKFLPYVSIITPNLAEAQLLLQKDIKTVEEMKQVAVALYD
FT                   LGAKAVVIKGGNRLGGSEAVDVFYDGQEVVVLQSPLLSENNVGAGCTFASSIASQLLLG
FT                   QEPLEAVRLSKDFVHAAIEKSDDYGVVQYEK"
FT   misc_feature    303698..304411
FT                   /gene="thiD"
FT                   /locus_tag="SSU0291"
FT                   /note="HMMPfam hit to PF08543, Phosphomethylpyrimidine
FT                   kinase type-1, score 8.8e-74"
FT                   /inference="protein motif:HMMPfam:PF08543"
FT   CDS_pept        304413..304898
FT                   /transl_table=11
FT                   /locus_tag="SSU0292"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44704"
FT                   /protein_id="CAR44704.1"
FT                   /translation="MRNKQTQELVLLAILTALSLVLAFVHVPTATGFVTLLDVGVYFTA
FT                   FYLGKKEGAIVGGLSGLLIDFLLGYPQWAFFSLVFHGAQGYFAGWTGKKRILGLVLATL
FT                   SMVGGYYLASRLYFNDLKAIESVLSNTLQNTVGLVVGYVLAQAIERIGAVNHVIKGN"
FT   sig_peptide     304413..304508
FT                   /locus_tag="SSU0292"
FT                   /note="Signal peptide predicted for SSU0292 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.417 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(304437..304490,304500..304559,304572..304640,
FT                   304698..304766)
FT                   /locus_tag="SSU0292"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSU0292 by TMHMM2.0 at aa 9-26, 30-49, 54-76 and 96-118"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        304879..305445
FT                   /transl_table=11
FT                   /locus_tag="SSU0293"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44705"
FT                   /protein_id="CAR44705.1"
FT                   /translation="MLLREIKDQTKQVVQEVLELSDLQKGQIFVLGLSSSEVIGGHIGK
FT                   NSSLEVGEVVVETILEILDQKGIYLAVQGCEHLNRALVVERELAIQKDLEIVNVLPTLH
FT                   AGGSGQLAAFKYMKDPVEVEFITAQAGVDIGDTAIGMHIKHVQVPIRPSLREIGQAHVT
FT                   ALASRPKLIGGVRAAYQEDEIRKGS"
FT   misc_feature    304900..305415
FT                   /locus_tag="SSU0293"
FT                   /note="HMMPfam hit to PF04260, Conserved hypothetical
FT                   protein CHP01440, score 5.8e-121"
FT                   /inference="protein motif:HMMPfam:PF04260"
FT   CDS_pept        305445..306059
FT                   /transl_table=11
FT                   /locus_tag="SSU0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44706"
FT                   /protein_id="CAR44706.1"
FT                   /translation="MKEFTVKDLVWTRPPRQFTISDEEITITTHPQTDLWQKTYYHFVN
FT                   DNAPVLQMETEEDYFSFTVKTDFAGSHTRFDQCGIVLYQDSENWLKCSIEYENDDFQHL
FT                   GSVVTNHGFSDWATTEVSSQIKSMWFRLSRRGADYCFENSEDGIHFKQMRVCHFHQGAG
FT                   KIAFGLYACSPENSSFTARFTNMELSDCKWQAHDGQEPDEI"
FT   misc_feature    305472..306032
FT                   /locus_tag="SSU0294"
FT                   /note="HMMPfam hit to PF07081, Protein of unknown function
FT                   DUF1349, score 4e-53"
FT                   /inference="protein motif:HMMPfam:PF07081"
FT   repeat_region   complement(306103..306206)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        306332..307096
FT                   /transl_table=11
FT                   /locus_tag="SSU0296"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44709"
FT                   /protein_id="CAR44709.1"
FT                   /translation="MTKGYQQRFSLSILLWMRQDKARQEGMDYWSGGHAQIIAASPGLL
FT                   EYRQQHLSETEHSFWPKATGLETAVPEDRRIDGIAEVTYQKLLAPIGGRRQTALAFEDE
FT                   VNVFRRTLMHMGFPYSSRWYHTSTQAQTQLRDVLYFRRKDGVKSGSFKKFVQDGLASQL
FT                   ATISGVTEVRTQVYLPWNKATWNTPNVAHDNPKEDHLHASIIPGFADQAAREAFYANQA
FT                   PQLNAEVVQYSSAVHAYHIEKTLPFVLDGKRM"
FT   misc_feature    307040..307072
FT                   /note="PS00133 Zinc carboxypeptidases, zinc-binding region
FT                   2 signature."
FT                   /inference="protein motif:Prosite:PS00133"
FT   CDS_pept        307377..307808
FT                   /transl_table=11
FT                   /locus_tag="SSU0297"
FT                   /product="putative transcription regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44712"
FT                   /protein_id="CAR44712.1"
FT                   /translation="MDTKFSVALHILTMISESKEILSSQALAESVGTNASYIRKVIALL
FT                   KNAGLITSHQGRSGYQLSKSPKDISLLEIYLATQEVEHIRLFQIHQNANLSCPVGQHIE
FT                   GAMVPIFSSVEQELENQLSRQSLDNVITNLYQSAQVTRI"
FT   misc_feature    307377..307742
FT                   /locus_tag="SSU0297"
FT                   /note="HMMPfam hit to PF02082, Transcriptional regulator,
FT                   Rrf2, score 2.1e-31"
FT                   /inference="protein motif:HMMPfam:PF02082"
FT   misc_feature    307440..307505
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1320.000, SD 3.68 at aa 22-43, sequence
FT                   LSSQALAESVGTNASYIRKVIA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        307888..308889
FT                   /transl_table=11
FT                   /locus_tag="SSU0298"
FT                   /product="zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44714"
FT                   /protein_id="CAR44714.1"
FT                   /translation="MKAAQHTSYNKNNIALNLTEIAKPQIKPNQVLVKVTAAGVNPLDN
FT                   MISRGDVKLIVPYKLPQTAGNEVVGLVEEVGSSVTTFAAGDRVFGRLPLDSIGAFAEYV
FT                   AVDAQALAKVPAYLTDEEAAAVPLTALTIMQALDLMGAQSGKTIFISGGTGGVGGMAIP
FT                   IAKAKGLTVITNGDGASAERVLSLGADRFIDYKTEDYTKTLSDVDYVLDTLGGAETEKQ
FT                   MSIMKKGGQLVSLRAMPNGEFAKRMNLPKWKQILFGLAGRSFDKMAKKYGVHYHFIFVE
FT                   SNGRQLQEVADIFNKLEIKPSIDTVYPFEEVNAALDKVANGRSRGKTVLSFN"
FT   misc_feature    307969..308229
FT                   /locus_tag="SSU0298"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like, score 1.6e-23"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   misc_feature    308317..308733
FT                   /locus_tag="SSU0298"
FT                   /note="HMMPfam hit to PF00107, Alcohol dehydrogenase,
FT                   zinc-binding, score 6.7e-13"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   CDS_pept        308915..309760
FT                   /transl_table=11
FT                   /locus_tag="SSU0299"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44715"
FT                   /protein_id="CAR44715.1"
FT                   /translation="MSYITTKNQYITVSNNKIAYRELSKGKSDIPLVMLVHLAATLDNW
FT                   DPKLLDLLAEKHHVIILDLPGVGASQGKVAPTIPGMAEQAVAIIKALGHEKINLLGLSM
FT                   GGFIAQEIVRLDSQLVNRLILAGTGPRGGFEVDKVTGKTFRYMLKAGLERVDPKRYIFY
FT                   NHDEAGRLEAEKVLGRMGQRSAAHADKDMNVPGFLTQLKAIKRWGREPQDDMTFITQPT
FT                   LIVNGDKDMQVPTENSYTMHEKIKNSQLIIYPNAGHGSIFQNAEEFSKALLAFLEESNA
FT                   "
FT   misc_feature    309083..309736
FT                   /locus_tag="SSU0299"
FT                   /note="HMMPfam hit to PF00561, Alpha/beta hydrolase fold-1,
FT                   score 7e-22"
FT                   /inference="protein motif:HMMPfam:PF00561"
FT   CDS_pept        309753..310622
FT                   /transl_table=11
FT                   /locus_tag="SSU0300"
FT                   /product="short chain dehydrogenase"
FT                   /note="Similar to the C-terminal region of Homo sapiens
FT                   (Human) RDH13 retinol dehydrogenase 13 UniProt:Q8NBN7
FT                   (EMBL:AY358473) (331 aa) fasta scores: E()=3.4e-16, 32.806%
FT                   id in 253 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44717"
FT                   /protein_id="CAR44717.1"
FT                   /translation="MPKTILITGSTDGIGKHLAMKLASEGHEVILHGRNSEKLRVALSD
FT                   IQLKTGSKKIHGYLADFSKLADVYRFSQEIKRDFEQIDVLLNNAGAYFGDARVATAENI
FT                   EMTFMLSVQVPYILTTELLPLLEKAAGRVIHTSSLMHHFAQTRGLDFGLEQSYSAAMAY
FT                   NNAKLYTIWLAIAQAEALEKQGSSVTVNAYHPGLIATNLGNDGIKRNLRSRILTSLMKP
FT                   FSKDLDQGIETGYYLSLSPEVAGVSGRYFAEKRLANVSLKGFDLAKSQALLAYLDKKIQ
FT                   VFKESYGD"
FT   misc_feature    309759..310025
FT                   /locus_tag="SSU0300"
FT                   /note="HMMPfam hit to PF00106, Short-chain
FT                   dehydrogenase/reductase SDR, score 8.7e-09"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    310200..310286
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        310615..311790
FT                   /transl_table=11
FT                   /locus_tag="SSU0301"
FT                   /product="NADH:flavin oxidoreductase / NADH oxidase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44719"
FT                   /protein_id="CAR44719.1"
FT                   /translation="MTKILLENLQLPNGQVLDNRFFKSAMSETLADSQGAPSDDLIALY
FT                   DFWAKQGVGVLVTGNVMVDGRYLGEPGNVVLDSDAHLAQFRKWAAVGKKNGVPIWLQLN
FT                   HPGKQMYRSINQTPIAPSAIPISGGSASAFRPPREMTVFDIKEARDKFIAAGLRAKAAG
FT                   FTGVQLHAAHGYLTNQFLSPADNQRTDRYGGSLDNRMQFLVEVYQGLREKVGPDFTIAL
FT                   KLNASDFKEEGFGFEDCKHVVKIMSDLGIDLIEISGGNYETPVFGSDYENGAGFVTYAL
FT                   ALADLTSVSIVSTGGFRKVTQMEEAIKDGVSMIGLARPFVLRPSLVNDYRQVGDLQADG
FT                   ERTGRYILGGEELVLNSKGESVISYADYAIGMIDEIATGDHLKARISLVSE"
FT   misc_feature    310624..311625
FT                   /locus_tag="SSU0301"
FT                   /note="HMMPfam hit to PF00724, NADH:flavin
FT                   oxidoreductase/NADH oxidase, N-terminal, score 4.9e-41"
FT                   /inference="protein motif:HMMPfam:PF00724"
FT   CDS_pept        311800..312249
FT                   /transl_table=11
FT                   /locus_tag="SSU0302"
FT                   /product="putative transcription regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44720"
FT                   /protein_id="CAR44720.1"
FT                   /translation="MQISNKFTIAIHALAFIHLFQDQQRVTSKVLANSIQANPVIIRSV
FT                   LSGLKEAGIVDAKQGSGGFRLAKTLDDISLYDIFVTVDNIDKKGLFNFHENPHPDCIVG
FT                   GNIHAAVDDKLVQVQTAMEKELKTMYMSDVLVDLEKAIEEKVKRT"
FT   misc_feature    311800..312177
FT                   /locus_tag="SSU0302"
FT                   /note="HMMPfam hit to PF02082, Transcriptional regulator,
FT                   Rrf2, score 4.5e-36"
FT                   /inference="protein motif:HMMPfam:PF02082"
FT   CDS_pept        complement(312509..313027)
FT                   /transl_table=11
FT                   /locus_tag="SSU0303"
FT                   /product="TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44721"
FT                   /protein_id="CAR44721.1"
FT                   /translation="MFRMERVKRKESLFVESVVEALWELLEDKSFEKISVSELVERAGI
FT                   GRVTFYRNFSNKEEVLERSFNLESQAWLTERQIDLSDWSDAHLLLALRQFFDFWYEQQD
FT                   KIRLLTANHLDYLLEEVLDRYFKEKLGDLTDDFHLQFIVGGFFRVLKTWVARGCKESPD
FT                   DIMRLMSEQ"
FT   misc_feature    complement(312836..312976)
FT                   /locus_tag="SSU0303"
FT                   /note="HMMPfam hit to PF00440, Transcriptional regulator,
FT                   TetR-like, DNA-binding, bacterial/archaeal, score 2.2e-11"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    complement(312863..312928)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1126.000, SD 3.02 at aa 34-55, sequence
FT                   ISVSELVERAGIGRVTFYRNFS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        313159..314082
FT                   /transl_table=11
FT                   /locus_tag="SSU0304"
FT                   /product="putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44723"
FT                   /protein_id="CAR44723.1"
FT                   /translation="MKKVLIGIGILIACFGIGFLYLASKPSVASNYTEVVETGGAVEKK
FT                   YLGQGNYDVSYLEINALQNFKKYELYYPTNIETETRKFPVVIFSNGTGVRASKYASVLK
FT                   HLASWGFIVIGTEEEYSWNGFSSEMSLRLAIKLNDNKTVEGLKSNPFFSKVDLDKIGLS
FT                   GHSQGGVGVFNAVTEQKHGHMIKTIYAASPANLELSSNLEWDYDPSLISVPTFLVSGTG
FT                   GGYEDLVVSGKQLTQIYETLPATITKVMARRKEAGHGDMLRLPNGYMVAWFMWRLQGAP
FT                   EAETAFQGNSPEIVQNKLYQDQRIMN"
FT   sig_peptide     313159..313245
FT                   /locus_tag="SSU0304"
FT                   /note="Signal peptide predicted for SSU0304 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.774 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    313168..313227
FT                   /locus_tag="SSU0304"
FT                   /note="1 probable transmembrane helix predicted for SSU0304
FT                   by TMHMM2.0 at aa 4-23"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    313168..313200
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    313405..313500
FT                   /locus_tag="SSU0304"
FT                   /note="HMMPfam hit to PF07224, Chlorophyllase, score
FT                   0.00047"
FT                   /inference="protein motif:HMMPfam:PF07224"
FT   misc_feature    313636..313665
FT                   /note="PS00120 Lipases, serine active site."
FT                   /inference="protein motif:Prosite:PS00120"
FT   CDS_pept        314189..315208
FT                   /transl_table=11
FT                   /locus_tag="SSU0305"
FT                   /product="putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44727"
FT                   /protein_id="CAR44727.1"
FT                   /translation="MKKFKKIILWTLGIVASLGIIAYVSVTNHPQLVVGVIQSFMYKES
FT                   SPNSYSPLYDPIDGLKENGQYLKSEIAYSKDYPNSFLDITYPDQNLEADRPTLFYFHGG
FT                   GFFGGSKNMGAPLSASQATYLIDDIVSKGYNVVNVDYALVPDHHFPTPVIQMNQAIAYM
FT                   KEHAEEYHLNMDNVVLMGSSAGAIMAAQYGSVLANQEYAQLLNIEPSIAKEDVKALVID
FT                   DAPLDYAKFSLGTKILVGNYVSETIYLSEEEINAYNPISHVNKDYPASFLLGSEDRTDM
FT                   VSLNKALKQAGVENELVDPLAEEGLEKPHGFVANLRTDPVSAKAFERLMIFIDDRTKE"
FT   sig_peptide     314189..314260
FT                   /locus_tag="SSU0305"
FT                   /note="Signal peptide predicted for SSU0305 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.646 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    314207..314266
FT                   /locus_tag="SSU0305"
FT                   /note="1 probable transmembrane helix predicted for SSU0305
FT                   by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    314480..314761
FT                   /locus_tag="SSU0305"
FT                   /note="HMMPfam hit to PF07859, Alpha/beta hydrolase fold-3,
FT                   score 3.7e-13"
FT                   /inference="protein motif:HMMPfam:PF07859"
FT   misc_feature    314480..314527
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   CDS_pept        315430..316713
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SSU0306"
FT                   /product="trigger factor (prolyl isomerase)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44730"
FT                   /protein_id="CAR44730.1"
FT                   /translation="MSVSFEAKETNRGVLTFTIGQDAIKPELDRVFNKVKKDINLPGFR
FT                   KGHLPRAVFNQKFGEEALYQDVVNALLPAAYEAAVAEAGLEVVAQPKIDVVSMEKGQDW
FT                   TITAEVVTKPEVKLGDYKNLAVSVEATKEVTDEEVDAKIEAARNNLAELVIKEGPAAEG
FT                   DTVVIDFVGSIDGVEFDGGKGENFSLGLGSGQFIPGFEAQLVGHAAGEEVNVEVTFPED
FT                   YQAADLAGKQALFVTKIHEVKAKEVPALDDELAKDIDEEVETLDELKAKYRKELEASKE
FT                   VAFDDAVESAALELAVENAEIVELPEEMIHEEVHRAINEFLGGMQQQGISPDMYFQITG
FT                   TTREDLHKQYEADAEKRTKTNLVVEAVAKAEGFEATEEEINKEIEDLAATYNMEVAQVR
FT                   SLLSPEMLKHDIAVKKAVEVITSTATVK"
FT   misc_feature    315430..315870
FT                   /gene="tig"
FT                   /locus_tag="SSU0306"
FT                   /note="HMMPfam hit to PF05697, Bacterial trigger factor,
FT                   N-terminal, score 1.6e-64"
FT                   /inference="protein motif:HMMPfam:PF05697"
FT   misc_feature    315889..316149
FT                   /gene="tig"
FT                   /locus_tag="SSU0306"
FT                   /note="HMMPfam hit to PF00254, Peptidyl-prolyl cis-trans
FT                   isomerase, FKBP-type, score 3.6e-26"
FT                   /inference="protein motif:HMMPfam:PF00254"
FT   misc_feature    316150..316680
FT                   /gene="tig"
FT                   /locus_tag="SSU0306"
FT                   /note="HMMPfam hit to PF05698, Bacterial trigger factor,
FT                   C-terminal, score 1.3e-66"
FT                   /inference="protein motif:HMMPfam:PF05698"
FT   misc_feature    316573..316638
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1100.000, SD 2.93 at aa 382-403, sequence
FT                   KEIEDLAATYNMEVAQVRSLLS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        316764..317648
FT                   /transl_table=11
FT                   /locus_tag="SSU0307"
FT                   /product="putative membrane protein"
FT                   /note="Similar to the C-terminal region of Staphylococcus
FT                   epidermidis biofilm PIA synthesis
FT                   N-acetylglucosaminyltransferase IcaA UniProt:Q8GLC5
FT                   (EMBL:AY138959) (412 aa) fasta scores: E()=3.7e-10, 30.328%
FT                   id in 244 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44732"
FT                   /protein_id="CAR44732.1"
FT                   /translation="MLQRNSLKNLVRPMQKWENVISVGGVVQVSQGVRITDGEVSHYQL
FT                   PWSVLPCLQAIEYDCSFLGSRILLDYLQSNLIISGAFGLFYKEYVIAVGGYDRQTLGED
FT                   MELVMKLHYFCRNNNIPYRICYETSAICWSQAPSSIGDLCKQRRRWFLGLYQCLKKYRK
FT                   MLSRVRFGAVGYFSYAYYMLFEFLAPFIETFGCFVILLSLIYHQLNISFFISLFFLHSA
FT                   FCSLITFASFLQRVYSQDLFIGPMDLCKAFLATLFRYFFLHWVLNIVRLTSFIGYKKRK
FT                   REWGEIKRVKQFV"
FT   misc_feature    join(317256..317309,317319..317378,317391..317459,
FT                   317517..317585)
FT                   /locus_tag="SSU0307"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSU0307 by TMHMM2.0 at aa 165-182, 186-205, 210-232 and
FT                   252-274"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        317757..318677
FT                   /transl_table=11
FT                   /gene="lmb"
FT                   /locus_tag="SSU0308"
FT                   /product="laminin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44735"
FT                   /protein_id="CAR44735.1"
FT                   /translation="MLKKVIRGCFVALFGFVLAACSAQKEASQVQPGMKIVTSFYPIYS
FT                   LVKEVSGNKNDVRMIGSRQGIHSYEPSAADIKAIYDADVFIYHSRILESWAGRLEPNLQ
FT                   GSSVKVLEASTNLPLTKVPGLEDMEAGQGIDEASLYDPHTWLDPVLVGQEAVAIGELLA
FT                   ESDPKNADYYRQNAATLEGKAQKLADKYSPIFLKATSKTFVTQHTAFSYTAQRFGLKQL
FT                   GIAGVSEEEPSPRQLAEIKEFVDTYNVQTIFTEKGASDKLAKALASSTGVDLKVLDPLE
FT                   ADPENNLTYLENLEQVLETLAQELK"
FT   sig_peptide     317757..317840
FT                   /gene="lmb"
FT                   /locus_tag="SSU0308"
FT                   /note="Signal peptide predicted for SSU0308 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.652 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    317781..318674
FT                   /gene="lmb"
FT                   /locus_tag="SSU0308"
FT                   /note="HMMPfam hit to PF01297, Periplasmic solute binding
FT                   protein, score 8.4e-89"
FT                   /inference="protein motif:HMMPfam:PF01297"
FT   misc_feature    317787..317819
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        318711..321866
FT                   /transl_table=11
FT                   /locus_tag="SSU0309"
FT                   /product="Streptococcal histidine triad-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44738"
FT                   /protein_id="CAR44738.1"
FT                   /translation="MKKKAVVGSVAALVLGMSLCSYQLGRFQAMEEQKNRVSYIEDSQS
FT                   VQTTVAEQLTPDQVSAKENIDAEQIVVKITDQGYVTSHGDHFHYYNGKVPFDAIFSEEL
FT                   VMKDPNYVLQDSHIINEVQDGYVIKVDGKYYLYLKDPSKHKNVRSKEEVERQKGISSAD
FT                   SKNQAAGNSKDGRYRTDDGYVFNPTDVIEDTGDGFIVPHGDHFHFIPKKDLSAAELKAA
FT                   QDYWNQKGSVSSASGSQYGDRNNRAQQTTISAGQGQDLASLLAQLDATPLSQRHVEADG
FT                   LVFDPRTITKKTAAGVIVPHGDHYHFIPYSQMSPLEEKISRMIGVNGAGVSSGAQASHS
FT                   QHTLTQPNRPVTPIGTVTTQPVSPTQPVLPTQPKQSTGKVVSYKGRQIPAYGKGLDGKA
FT                   YFTSDGYTFSKDSITSVDDQGLIASHGDHFHYVGFGELEDFEIKQVEEWVNEKAGKQVP
FT                   PKTSEQVGNDAKPTTPSQGNDSKPVKPIQEENRPAFEYKQVTAKRKLAGKVVYEMEVGG
FT                   KTYTYGRDELDLMKISFAELTLAEKDKQYIFDIAPLAEGDLKPAMLVGMDQIPMKGANA
FT                   TYDTGQSFIIPHIDHIHVLPYTWLSKEQIATIRYIMQHPEIRPSAWTTSGHGDGEATDL
FT                   VPPILNATPKANRLGLKNWQIIHTAEEVMDARAKGKFATNDGYIFSAEDVLDPASFVFS
FT                   QAFSLPRATGGSLRSISKKDLSKEELEAVQTLLDKRDAEELAKNVTPIEKRAGLKNWQI
FT                   VHSAEELAEAKAAGKYTTKDGYIFDPADLLDPKVKIGTDNYRIPRVITDGYRRINKSDL
FT                   NYLSELIPAEAMVAQREKSNSSLPSTPAPTETGASAGETTTPEQPQVAKETAEEIYNRV
FT                   EAKKVVPFEALTYNAGYATEVRNGTLVIPHQDHYHYVSFKWFDQGSARSPEGYSLEDFL
FT                   ATVKYYMTNPQERPVSDDGWGVFTPNTPSESTEETETEESDEEIISEETEEIDEFTEEL
FT                   KRRAEEFGMDFKTFEQSLVTLSDRYKVSFEAFEYDAASKVVRLVDKDGVKRTISLPSLE
FT                   EQV"
FT   sig_peptide     318711..318797
FT                   /locus_tag="SSU0309"
FT                   /note="Signal peptide predicted for SSU0309 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.776 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    318723..318791
FT                   /locus_tag="SSU0309"
FT                   /note="1 probable transmembrane helix predicted for SSU0309
FT                   by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    318945..318977
FT                   /locus_tag="SSU0309"
FT                   /note="HMMPfam hit to PF04270, Streptococcal histidine
FT                   triad, score 4.9"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    319239..319397
FT                   /locus_tag="SSU0309"
FT                   /note="HMMPfam hit to PF04270, Streptococcal histidine
FT                   triad, score 4.3e-31"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    319536..319694
FT                   /locus_tag="SSU0309"
FT                   /note="HMMPfam hit to PF04270, Streptococcal histidine
FT                   triad, score 7.8e-05"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    319908..320066
FT                   /locus_tag="SSU0309"
FT                   /note="HMMPfam hit to PF04270, Streptococcal histidine
FT                   triad, score 5.1e-05"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    320445..320552
FT                   /locus_tag="SSU0309"
FT                   /note="HMMPfam hit to PF04270, Streptococcal histidine
FT                   triad, score 0.016"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    320724..320900
FT                   /locus_tag="SSU0309"
FT                   /note="HMMPfam hit to PF04270, Streptococcal histidine
FT                   triad, score 0.00077"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    321015..321194
FT                   /locus_tag="SSU0309"
FT                   /note="HMMPfam hit to PF04270, Streptococcal histidine
FT                   triad, score 0.00014"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    321402..321434
FT                   /locus_tag="SSU0309"
FT                   /note="HMMPfam hit to PF04270, Streptococcal histidine
FT                   triad, score 3.9"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   CDS_pept        321993..322574
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="SSU0310"
FT                   /product="putative DNA-directed RNA polymerase, delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44741"
FT                   /protein_id="CAR44741.1"
FT                   /translation="MELNVFAGQEKSELSMIEVARAILEERGRDNEMYFNDLVNEIQNY
FT                   LEKSNSEIRAALPTFYSDLNVDGSFIPLGENKWGLRSWYAIDEIDEEVITLEEDDEDAP
FT                   KRKKKRVNAFMDGDDDAIDYGHDDPEDEDNYPGSVSSEYDDENPDDEKDEVESYDSEIN
FT                   EIIPDDELDEEDVDLGEDDDEYSDEEVVDE"
FT   misc_feature    321993..322562
FT                   /gene="rpoE"
FT                   /locus_tag="SSU0310"
FT                   /note="HMMPfam hit to PF05066, DNA-directed RNA polymerase
FT                   delta subunit, score 5e-83"
FT                   /inference="protein motif:HMMPfam:PF05066"
FT   CDS_pept        322767..324371
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SSU0311"
FT                   /product="putative CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44744"
FT                   /protein_id="CAR44744.1"
FT                   /translation="MTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYIN
FT                   IDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERK
FT                   GEYLGATVQVIPHITDALKDKIKRAARTTDADVIITEVGGTVGDIESLPFLEALRQMKA
FT                   DVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEQPAGQGIK
FT                   NKLAQFCDVAPEAVIESLDVEHLYQIPLNMQAQNMDQIVCDHLKLDVPPADMTEWTAMV
FT                   NKVLNLQKKVKIALVGKYVELQDAYISVVEALKHSGYANDAAIELDWVNANDLTAENVA
FT                   ERLGQAQGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCVEFARHVLGLE
FT                   GANSFELDPETKYPIIDIMRDQIGVEDLGGTLRLGLYPSKLKRGSKAAAAYDNQEVVQR
FT                   RHRHRYEFNNDFREQFEKAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELQSRPNR
FT                   PEGLYTAFVSAAMENEK"
FT   misc_feature    322770..323597
FT                   /gene="pyrG"
FT                   /locus_tag="SSU0311"
FT                   /note="HMMPfam hit to PF06418, CTP synthase, score
FT                   3.1e-215"
FT                   /inference="protein motif:HMMPfam:PF06418"
FT   misc_feature    323667..324350
FT                   /gene="pyrG"
FT                   /locus_tag="SSU0311"
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 1.6e-68"
FT                   /inference="protein motif:HMMPfam:PF00117"
FT   tRNA            324652..324737
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:324686..324688,aa:Leu)"
FT                   /note="tRNA Leu anticodon AAG, Cove score 53.84"
FT   CDS_pept        324972..325853
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="SSU0312"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44746"
FT                   /protein_id="CAR44746.1"
FT                   /translation="MPLVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKQAPV
FT                   LIQTSMGAAKYMGGYKVARNLIANLIESMNITVPVAIHLDHGHYEDALECIEVGYTSIM
FT                   FDGSHLPVEENLAKAKEVVELAHAKGISVEAEVGTIGGEEDGIVGSGELAPIEDAVAMV
FT                   ATGIDFLAAGIGNIHGPYPANWEGLDLDHLRKLTEAVPGFPIVLHGGSGIPDAQIQEAI
FT                   KLGVAKVNVNTECQIAFANATRKFAAAYEANEAEYDKKKLFDPRKFLADGVKAIQASVE
FT                   ERIDVFGSANKA"
FT   misc_feature    324975..325850
FT                   /gene="fba"
FT                   /locus_tag="SSU0312"
FT                   /note="HMMPfam hit to PF01116, Ketose-bisphosphate
FT                   aldolase, class-II, score 4.3e-115"
FT                   /inference="protein motif:HMMPfam:PF01116"
FT   misc_feature    325191..325232
FT                   /note="PS00602 Fructose-bisphosphate aldolase class-II
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00602"
FT   misc_feature    325368..325403
FT                   /note="PS00806 Fructose-bisphosphate aldolase class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00806"
FT   CDS_pept        326246..326434
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SSU0313"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44749"
FT                   /protein_id="CAR44749.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKPK
FT                   KVWASARALKSGKVERV"
FT   misc_feature    326252..326428
FT                   /gene="rpmB"
FT                   /locus_tag="SSU0313"
FT                   /note="HMMPfam hit to PF00830, Ribosomal protein L28, score
FT                   4.2e-23"
FT                   /inference="protein motif:HMMPfam:PF00830"
FT   rRNA            327055..328598
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            328650..328722
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:328683..328685,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            329002..331906
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            331984..332111
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            332112..332184
FT                   /gene="tRNA-Asn"
FT                   /product="transfer RNA-Asn"
FT                   /anticodon="(pos:332145..332147,aa:Asn)"
FT                   /note="tRNA Asn anticodon GTT, Cove score 82.38"
FT   tRNA            332207..332278
FT                   /gene="tRNA-Glu"
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:332240..332242,aa:Glu)"
FT                   /note="tRNA Glu anticodon TTC, Cove score 66.12"
FT   CDS_pept        332397..334415
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="SSU0314"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44751"
FT                   /protein_id="CAR44751.1"
FT                   /translation="MKRLCDELSVLPGIGPKSAEKFLKISIQNINDLLTYYPFRYEDFE
FT                   SKSIYDLQDGEKAVVVGEVVSPANVQYYGYKRNRLRFSMKQGEVVLAVSFFNQPYLADK
FT                   IVLGQDIAVWGKWDKAKASLTGMKILAQVSDELQPVYHVAQGISQVNLVKAIKTAIDQG
FT                   YLHLLEENLPSVLRERYRLMNRREAVFAMHFPTNLEEYRQALRRMKFEELFYFQLQLQM
FT                   LKANNRDILNGLKIAYDADRLAMQIRQLPFVLTDAQSGALAEILSDMKSYGHMNRLLQG
FT                   DVGSGKTVVAGLAMFAAVTAGMQAAIMVPTEILAEQHFESLRQLFPELSIALLTGGMKA
FT                   AERRTALEAISSGQVDIIVGTHALIQESVTYHKLGLVVTDEQHRFGVKQRRLFREKGDN
FT                   PDVLMMTATPIPRTLAITAFGDMDVSIINQLPAGRKPIITRWVKHQQLPTVLDWLEREL
FT                   EVGAQVYFISPLIEESEALDLKNAVDLQSDLQAHFGEQVTVDLLHGKMKNDEKDAIMQA
FT                   FKERKTNILVSTTVIEVGVNVPNATVMVIMDADRFGLSQLHQLRGRVGRGHKQSYAVLV
FT                   ANPKTESGKERMKIMTETTDGFILAEADLKMRGSGEIFGTRQSGLPEFQVANIIEDYPI
FT                   LEEARRVASQIVSVENWQEDPNWSILLANLKDREELD"
FT   misc_feature    333159..333647
FT                   /gene="recG"
FT                   /locus_tag="SSU0314"
FT                   /note="HMMPfam hit to PF00270, DNA/RNA helicase, DEAD/DEAH
FT                   box type, N-terminal, score 5.8e-39"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    333237..333260
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    333870..334100
FT                   /gene="recG"
FT                   /locus_tag="SSU0314"
FT                   /note="HMMPfam hit to PF00271, DNA/RNA helicase,
FT                   C-terminal, score 1.9e-24"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        complement(334479..335438)
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="SSU0315"
FT                   /product="putative L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44754"
FT                   /protein_id="CAR44754.1"
FT                   /translation="MKKILVLHTGGTISMQTNHQGEVAANKTNPMTQIDSPLEETQVTS
FT                   LDFLNVPSPHIRLEHMMTLYQKIKEEQMNFDGFVITHGTDTLEETAYFLDTMAIPEKPI
FT                   VLTGAMRSSNELGSDGIYNYRTALRVATDDKSADKGVLVVMNDEIHAAKYVTKTYTTNV
FT                   STFQTPTHGPLGLVTKREILYFKTAEPRVRFDLSTVTGTVPIIKAYADMDSILLDSLTA
FT                   SSISGLVIEALGAGNLPPTILPAIKKLLDQKIPIILVSRCFNGIAEPVYAYQGGGIQLE
FT                   KDGILFVKELNAQKARLKLLIALNAGLEEQSLADYIQG"
FT   misc_feature    complement(334497..335432)
FT                   /gene="asnB"
FT                   /locus_tag="SSU0315"
FT                   /note="HMMPfam hit to PF00710, Asparaginase/glutaminase,
FT                   score 1.5e-133"
FT                   /inference="protein motif:HMMPfam:PF00710"
FT   misc_feature    complement(335178..335210)
FT                   /note="PS00917 Asparaginase / glutaminase active site
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00917"
FT   misc_feature    complement(335397..335423)
FT                   /note="PS00144 Asparaginase / glutaminase active site
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00144"
FT   CDS_pept        join(335508..336347,336346..336873)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0316"
FT                   /product="haloacid dehalogenase-like hydrolase
FT                   (pseudogene)"
FT                   /note="CDS contains a frameshift after codon 280. Similar
FT                   to Streptococcus pneumoniae Cof family protein
FT                   UniProt:Q97NM3 (EMBL:AE007488) (462 aa) fasta scores:
FT                   E()=3.5e-89, 52.772% id in 451 aa"
FT                   /db_xref="PSEUDO:CAR44756.1"
FT   misc_feature    335520..335555
FT                   /note="PS01228 Hypothetical cof family signature 1."
FT                   /inference="protein motif:Prosite:PS01228"
FT   misc_feature    335523..336326
FT                   /locus_tag="SSU0316"
FT                   /note="HMMPfam hit to PF08282, HAD superfamily
FT                   hydrolase-like, type 3, score 8.2e-82"
FT                   /inference="protein motif:HMMPfam:PF08282"
FT   CDS_pept        complement(336889..337341)
FT                   /transl_table=11
FT                   /locus_tag="SSU0318"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44757"
FT                   /protein_id="CAR44757.1"
FT                   /translation="MTQSYKTILVAVDGSKGAELALHKAIHVALRNQARLIIAHVIDTR
FT                   ALHNVVAFDASVYESLEREAELLLEEYKQEALNAGLTDVQIRIEFGNPKTLLAIDIPKE
FT                   TGADLMLLGATGLNAFERLLIGSSSEYIMRHATIDLLIVRDGEKSL"
FT   misc_feature    complement(336910..337332)
FT                   /locus_tag="SSU0318"
FT                   /note="HMMPfam hit to PF00582, UspA, score 1.3e-23"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   CDS_pept        337496..338710
FT                   /transl_table=11
FT                   /locus_tag="SSU0319"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44759"
FT                   /protein_id="CAR44759.1"
FT                   /translation="MKQFNKSTKLDDVAYDIRGPVLEEAMRMRANGEQILRLNTGNPAE
FT                   FGFTAPDEVIRDLIHNARKSEGYSNSKGIFSARKAIMQYCQLKKFPNVDIEDIYLGNGV
FT                   SELIVMSMQGLLDNGDEVLVPMPDYPLWTAAVSLAGGKAVHYVCDEVAEWYPDLADMES
FT                   KVTSRTKAIVLINPNNPTGALYPKEILKGIIDIARRHELIIFSDEIYDRMVFDGAVHIP
FT                   IATLAPDLFVVTMNGLSKSHRICGFRVGWMVLSGPKKHVKGYIEGLNMLSNMRLCSNVL
FT                   AQQVVQTSLGGYQSVDELLMPGGRLYEQREFITKAINDIPGLSAVKPKAGLYVFPKIDR
FT                   EMYRVEDDEQFVLDFLKQEKVLLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMSRFL
FT                   RQYRR"
FT   misc_feature    337592..338689
FT                   /locus_tag="SSU0319"
FT                   /note="HMMPfam hit to PF00155, Aminotransferase, class I
FT                   and II, score 4e-36"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   CDS_pept        339119..339907
FT                   /transl_table=11
FT                   /gene="codY"
FT                   /locus_tag="SSU0320"
FT                   /product="GTP-sensing transcriptional pleiotropic
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44761"
FT                   /protein_id="CAR44761.1"
FT                   /translation="MTTLLEKTRNITSILKRSEEQLAEELPYNAIAEHLSAIIDCNSCI
FT                   INSEGEVLGYHMSYETNNDRVEEFFQNKQFPEGYVKAVAQVYDTQVNLPVESELTAIPV
FT                   ESRSTYPNGLTTIAPIHVTGIRFGSLIIWRNDEQFHDDDLILVEIAATVVGIQLLNFQR
FT                   EEDEKNIRRRAAVNMAVNTLSYSEMKAVAAILGELDGNEGQLTASVIADRIGITRSVIV
FT                   NALRKLESAGIIESRSLGMKGTYLKVLIPAIFDEIKKRDY"
FT   misc_feature    339125..339682
FT                   /gene="codY"
FT                   /locus_tag="SSU0320"
FT                   /note="HMMPfam hit to PF06018, GTP-sensing transcriptional
FT                   pleiotropic repressor CodY, N-terminal, score 2.5e-105"
FT                   /inference="protein motif:HMMPfam:PF06018"
FT   misc_feature    339719..339901
FT                   /gene="codY"
FT                   /locus_tag="SSU0320"
FT                   /note="HMMPfam hit to PF08222, GTP-sensing
FT                   helix-turn-helix, CodY, C-terminal, score 1.7e-37"
FT                   /inference="protein motif:HMMPfam:PF08222"
FT   misc_feature    339731..339796
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1428.000, SD 4.05 at aa 205-226, sequence
FT                   LTASVIADRIGITRSVIVNALR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        join(339897..339917,339917..340450)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0321"
FT                   /product="isochorismatase family protein (pseudogene)"
FT                   /note="CDS contains a frameshift after codon 7. Possible
FT                   alternative translational start site after codon 4. Similar
FT                   to Streptococcus mutans putative
FT                   pyrazinamidase/nicotinamidase PncA UniProt:Q8DSG2
FT                   (EMBL:AE015009) (183 aa) fasta scores: E()=3.2e-54, 78.022%
FT                   id in 182 aa"
FT                   /db_xref="PSEUDO:CAR44762.1"
FT   misc_feature    339950..340447
FT                   /locus_tag="SSU0321"
FT                   /note="HMMPfam hit to PF00857, Isochorismatase hydrolase,
FT                   score 1.2e-07"
FT                   /inference="protein motif:HMMPfam:PF00857"
FT   misc_feature    339953..339976
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        340704..341051
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="SSU0322"
FT                   /product="50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44765"
FT                   /protein_id="CAR44765.1"
FT                   /translation="MNPLIQSLTEGQLRTDIPSFRPGDTVRVHAKVVEGNRERIQIFEG
FT                   VVISRKGQGISEMYTVRKISGGVGVERTFPIHTPRVDKIEVVRYGKVRRAKLYYLRALQ
FT                   GKAARIKEIRR"
FT   misc_feature    340707..341045
FT                   /gene="rplS"
FT                   /locus_tag="SSU0322"
FT                   /note="HMMPfam hit to PF01245, Ribosomal protein L19, score
FT                   1.5e-71"
FT                   /inference="protein motif:HMMPfam:PF01245"
FT   misc_feature    340959..341006
FT                   /note="PS01015 Ribosomal protein L19 signature."
FT                   /inference="protein motif:Prosite:PS01015"
FT   CDS_pept        341212..341886
FT                   /transl_table=11
FT                   /locus_tag="SSU0323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44767"
FT                   /protein_id="CAR44767.1"
FT                   /translation="MSEQFIPSVLSDLRQDIVQMPEVIKECSGIRIYGRRIRSVLFTTD
FT                   VSIIANHNADAILAVYPFTPSPAIIKSIMLVASVPVLAGVGGGLTTGMRSANMSLLSES
FT                   EGAYAVVVNGPTDVKTIEAINKVVDIPIIYTVVSEKSDLTSRIKAGVDILNVSCGMETP
FT                   RVVKKIREAFPDFPIIATGGPTEDSIRRVIEAGANAVSYTAPSNGELFKGKMEKYRKHA
FT                   KD"
FT   CDS_pept        342103..342405
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="SSU0324"
FT                   /product="glutamyl-tRNA amidotransferase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44768"
FT                   /protein_id="CAR44768.1"
FT                   /translation="MKISEAEVRHVAKLSKLEFSDQETAEFATSLSKIVDMVELLNEVD
FT                   TTGVAVTTTMADRKNVLRADIAQKGESREELFKNVPESQDNFIKVPAILDGGGDA"
FT   misc_feature    342157..342372
FT                   /gene="gatC"
FT                   /locus_tag="SSU0324"
FT                   /note="HMMPfam hit to PF02686, Glu-tRNAGln
FT                   amidotransferase, C subunit, score 1.2e-15"
FT                   /inference="protein motif:HMMPfam:PF02686"
FT   CDS_pept        342405..343871
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="SSU0325"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44769"
FT                   /protein_id="CAR44769.1"
FT                   /translation="MTFNNKTIDELHDLLVKKEISAVELTKATLEDIKSREGAVDAFLT
FT                   ITEDAALAQAAALDEKGIDADNVMAGIPLAVKDNISTKGILTTAASKMLYNYEPIFDAT
FT                   SVAQAYAKDMIIVGKTNMDEFAMGGSNENSAFKPTKNAWDQTKVPGGSSGGSAAAVASG
FT                   QVRLSLGSDTGGSIRQPAAFNGIVGMKPTYGTVSRFGLIAFGSSLDQIGPFSQTVKENA
FT                   QLLNVISGHDVKDATSTINEIADFTSKIGQDIKGMKIALPKEYMGEGIDPQVKETILKA
FT                   AKHLESLGAIIEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGFRAEDATNLDEI
FT                   YVKTRSQGFGEEVKRRIMLGTFSLSSGYYDAYFKKAGQVRTLIIQDFEKVFADYDLILG
FT                   PTAPTVAFGLDTLNHDPVAMYLADLLTIPVNLAGLPGLSIPAGFVEGLPVGLQLIGPKY
FT                   SEETIYQVAAAFEATTDYHKQQPVIFGGAN"
FT   misc_feature    342474..343796
FT                   /gene="gatA"
FT                   /locus_tag="SSU0325"
FT                   /note="HMMPfam hit to PF01425, Amidase signature enzyme,
FT                   score 7.4e-186"
FT                   /inference="protein motif:HMMPfam:PF01425"
FT   misc_feature    342852..342947
FT                   /note="PS00571 Amidases signature."
FT                   /inference="protein motif:Prosite:PS00571"
FT   CDS_pept        343871..345310
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="SSU0326"
FT                   /product="glutamyl-tRNA amidotransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44771"
FT                   /protein_id="CAR44771.1"
FT                   /translation="MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFP
FT                   GVLPVLNKGVVDAGIKAALALNMDIHKDMHFDRKNYFYPDNPKAYQISQFDEPIGYNGW
FT                   IEIELEDGSTKKIRIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPE
FT                   EAYAYLTALKEIIQYTGISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFNYV
FT                   RKGLQHEVERQAKILRSGGQIQQETRRYDESTGETILMRVKEGSADYRYFPEPDLPLYE
FT                   IDDSWIEEVRAELPVFPKARRAHYVENLGLTAYDAGQLTSTKALSDFFEAAVAAGGDAK
FT                   QVSNWLQGEVAQFLNAEGKTIEQIALTPENLVEMIALIADGTISSKIAKKVFVHLAKEG
FT                   GSAKAYVEKAGLVQISDPAVLIPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATK
FT                   GQANPQVAQQLLAQELAKLLD"
FT   misc_feature    343871..344590
FT                   /gene="gatB"
FT                   /locus_tag="SSU0326"
FT                   /note="HMMPfam hit to PF02934, GatB N-terminal region,
FT                   score 1e-146"
FT                   /inference="protein motif:HMMPfam:PF02934"
FT   misc_feature    344639..344845
FT                   /gene="gatB"
FT                   /locus_tag="SSU0326"
FT                   /note="HMMPfam hit to PF01162, GatB, central region, score
FT                   4.5e-30"
FT                   /inference="protein motif:HMMPfam:PF01162"
FT   misc_feature    344849..345292
FT                   /gene="gatB"
FT                   /locus_tag="SSU0326"
FT                   /note="HMMPfam hit to PF02637, GatB/Yqey, score 3.7e-61"
FT                   /inference="protein motif:HMMPfam:PF02637"
FT   CDS_pept        345431..346780
FT                   /transl_table=11
FT                   /locus_tag="SSU0327"
FT                   /product="putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44774"
FT                   /protein_id="CAR44774.1"
FT                   /translation="MSKDFDDFLREHEENVNKLKKRDKETESDKERARDEFSRDYSRVI
FT                   YSNSFRRQQGKMQLFAVNGRAFHRNRLTHSFEVAQIARGIVDYLKKNTSNNIDIDFNSM
FT                   SVVVETGALVHDIGNPPFGHHGERILNDLAKDIGFEGNAQGLRVLKNIEKKSPDHKGLN
FT                   LTYRTLASILKYYVPYRKSRKTEKFIYKEDYEEFKKRFKEMDVFVRTIDVQIVDLADEI
FT                   AYCAHDLEDALASNYFTIDQFVFLLEQKLGEDQTLEDFKEWIEEAKNKAKRSKSNDDYD
FT                   FYFRRELLSIIVNKFIEDIDIVELNEKDKKKLGTDQDQELGLGHYKKLAGALKKTIFEG
FT                   VTNSDDIILYENVGTKVLTRLFALFMNEEYNRESFLMPIEYRFEKDDTQSDKKRKVLDY
FT                   ISGMMDTYAIEMYIKHFGTDPFLEKYDAAIFKKGTGKKLIECLAQNFLHK"
FT   misc_feature    345641..346105
FT                   /locus_tag="SSU0327"
FT                   /note="HMMPfam hit to PF01966, Metal-dependent
FT                   phosphohydrolase, HD region, subdomain, score 1.3e-07"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS_pept        complement(346839..347837)
FT                   /transl_table=11
FT                   /gene="galR"
FT                   /locus_tag="SSU0328"
FT                   /product="galactose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44775"
FT                   /protein_id="CAR44775.1"
FT                   /translation="MVTIKDIAKQAHLSSATVSRVLKGDLTLSVSQETRDRIFNLAQEL
FT                   GYTKHIKKQAPQQKGTIGIVQWYTESEELADLYYYSIRASIEHTASLLGYQIVRSFNDL
FT                   TNPLLQEVDGIIAVGKFSSGQIAELSSLSSKIIFVDSDTLTEGFSCVTTDFEHSVQTVI
FT                   DHFHSQGLTDIGLLVGQEETTDGHQLPTDPRLTAFRDYLDTLGMLQEDYIYQGKFSTQS
FT                   GYELMSQAIEDLGDKLPPAFFMANDTLAVGALRALQERQIAVPDRIQLITFNDTAITRQ
FT                   VYPALSSISVFTEEMGQEAMQLLDRIITSPTPHHPRKIKLGTQLVIRESSY"
FT   misc_feature    complement(346851..347663)
FT                   /gene="galR"
FT                   /locus_tag="SSU0328"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding
FT                   protein/LacI transcriptional regulator, score 0.0018"
FT                   /inference="protein motif:HMMPfam:PF00532"
FT   misc_feature    complement(347757..347834)
FT                   /gene="galR"
FT                   /locus_tag="SSU0328"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   protein, LacI, score 3.9e-08"
FT                   /inference="protein motif:HMMPfam:PF00356"
FT   misc_feature    complement(347769..347834)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2067.000, SD 6.23 at aa 2-23, sequence
FT                   VTIKDIAKQAHLSSATVSRVLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        347971..349143
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="SSU0329"
FT                   /product="galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44777"
FT                   /protein_id="CAR44777.1"
FT                   /translation="MNTEQLKQAFLDVFGQEADATFFSPGRINLIGEHTDYNGGHVFPA
FT                   AITLGTYGAARKRDDQVLRFYSANFEELGIIEVDLNNLVFDKADNWTNYAKGVLKFLKE
FT                   AGHVIDTGMEVFVYGNIPNGSGLSSSASLELLIGIIAEELYGLELTRLDLVKIGKQTEN
FT                   HFIGVNSGIMDQFAIGMGADNRAIYLDTNSLEYELVPLDLGDHVIVIMNTNKRRELADS
FT                   KYNERRAECEKAVEELNAVLNIQTLGELDEWTFDQYSYLIKDENRIKRARHAVLENQRT
FT                   LQARKALEEGDLATFGRLVNASHVSLEHDYEVTGLELDTLAHTAWEQEGVLGARMTGAG
FT                   FGGCGIAIVHKDKVEAFKENVGKTYTEVVGYAPSFYVAEIAGGSRVLSRK"
FT   misc_feature    348046..348081
FT                   /note="PS00106 Galactokinase signature."
FT                   /inference="protein motif:Prosite:PS00106"
FT   misc_feature    348310..348516
FT                   /gene="galK"
FT                   /locus_tag="SSU0329"
FT                   /note="HMMPfam hit to PF00288, GHMP kinase, score 8.4e-19"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   misc_feature    348331..348366
FT                   /note="PS00627 GHMP kinases putative ATP-binding domain."
FT                   /inference="protein motif:Prosite:PS00627"
FT   misc_feature    348340..348387
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    348820..349071
FT                   /gene="galK"
FT                   /locus_tag="SSU0329"
FT                   /note="HMMPfam hit to PF08544, GHMP kinase, C-terminal,
FT                   score 8.4e-15"
FT                   /inference="protein motif:HMMPfam:PF08544"
FT   CDS_pept        349153..350634
FT                   /transl_table=11
FT                   /gene="galT"
FT                   /locus_tag="SSU0330"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44778"
FT                   /protein_id="CAR44778.1"
FT                   /translation="MMTGLVDRFVEQVIANSDFEEMDAIYLRNRVLALVGDQVLTVQTD
FT                   LEDLIELKDELLAHGVRTGFVGELLEEQDMVGSCLMDLMTPSPSQVNRDFWQTYQDSPE
FT                   QAISDFYELSKRNDYIKMAAIAKNIYYPVSTEYGDLEITINLSKPEKDPKSIAAATKAE
FT                   ASNYPKCLLCMENEGYQGRINHPARANHRIIRLELGQEKWGFQYSPYAYYNEHAIFLNQ
FT                   EHVPMVISPRTFEQLLDLLDLLPGYFVGSNSDLPISGGSILTHNHYQGGRHSFAMDQAP
FT                   IEHQLVFEGFESVSAGIVKWPMSVIRLSSADKPSLLGLAAKILEKWRSYSDDSVQIKAE
FT                   TDGTPHHTITPIARKRGDLYELDLVLRDNQTSEEFPDGIYHPHPDVQHIKKENIGLIEV
FT                   MGLAILPPRLKAELAEVEKFLLGQDSQVADYHQPWAESLKTAHPDVTEETVEQVVRESV
FT                   GQIFARVLEDAGVYKRTPEGQAAFLRFVEFVGLAT"
FT   misc_feature    349201..349830
FT                   /gene="galT"
FT                   /locus_tag="SSU0330"
FT                   /note="HMMPfam hit to PF01087, Galactose-1-phosphate uridyl
FT                   transferase, N-terminal, score 1.2e-79"
FT                   /inference="protein motif:HMMPfam:PF01087"
FT   misc_feature    349834..350460
FT                   /gene="galT"
FT                   /locus_tag="SSU0330"
FT                   /note="HMMPfam hit to PF02744, Galactose-1-phosphate uridyl
FT                   transferase, C-terminal, score 1.5e-85"
FT                   /inference="protein motif:HMMPfam:PF02744"
FT   CDS_pept        350710..351618
FT                   /transl_table=11
FT                   /locus_tag="SSU0331"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44781"
FT                   /protein_id="CAR44781.1"
FT                   /translation="MAEKRLGTLITVIAGIAWGLSGVSGQYLMSRGVSVDMITSLRLLV
FT                   SGLFLVGLAYATAKEQLLAVLKDKNALLGIFIFAMLGLVLNQTAYLQAIYHTNAGTATV
FT                   LQYLCPILVLAYTCLKNREKPSGIELISIILAIAGTFLIATHGKLDELAVTPIGLFWGI
FT                   FSAFTYALYIILPGKLIRQYGSITVIGLGMLMGGFVVTLGLQTWQHRLPIDGGSFLGLL
FT                   GIVGVGTIFAYTAFLKGVSMVGPVNGSLLASIEPIASVFFAVWLVNEQFYAIDFVGMLL
FT                   ILLAVLLISLKDILVAQKSIG"
FT   sig_peptide     350710..350784
FT                   /locus_tag="SSU0331"
FT                   /note="Signal peptide predicted for SSU0331 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.621) with cleavage site
FT                   probability 0.389 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(350728..350796,350824..350883,350920..350988,
FT                   350998..351066,351085..351141,351169..351237,
FT                   351256..351324,351352..351420,351439..351507,
FT                   351520..351582)
FT                   /locus_tag="SSU0331"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSU0331 by TMHMM2.0 at aa 7-29, 39-58, 71-93, 97-119,
FT                   126-144, 154-176, 183-205, 215-237, 244-266 and 271-291"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    350755..351144
FT                   /locus_tag="SSU0331"
FT                   /note="HMMPfam hit to PF00892, Protein of unknown function
FT                   DUF6, transmembrane, score 3.8e-16"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   misc_feature    351208..351582
FT                   /locus_tag="SSU0331"
FT                   /note="HMMPfam hit to PF00892, Protein of unknown function
FT                   DUF6, transmembrane, score 7.4e-21"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   CDS_pept        351666..352295
FT                   /transl_table=11
FT                   /locus_tag="SSU0332"
FT                   /product="CutC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44783"
FT                   /protein_id="CAR44783.1"
FT                   /translation="MIKEFCSENHVGVMKALSLGAKRIELCDNLAVGGTTPSYGVVKHV
FT                   CQLAHENEATVMTMIRPRGGDFCYDKAEVEMMVEDCKAAIELGADGLVYGLLTEENWLD
FT                   EPALERLFAVSQDCQIVFHMAFDQIPRERQFEALDWLVEHGVTRILMRGSLTGSALNNV
FT                   EWLQEIVAYAQGKIEILIGGGLTVDNVPTLLEALPINQVHGTRLFW"
FT   misc_feature    351666..352289
FT                   /locus_tag="SSU0332"
FT                   /note="HMMPfam hit to PF03932, CutC, score 2.1e-72"
FT                   /inference="protein motif:HMMPfam:PF03932"
FT   CDS_pept        352502..352876
FT                   /transl_table=11
FT                   /locus_tag="SSU0333"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /note="Possible alternative translational start site after
FT                   codon 7"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44785"
FT                   /protein_id="CAR44785.1"
FT                   /translation="MNPLRKELRTVAVEVSDLALDYAVRLAQSLNSTLRYHNYDSLIAI
FT                   AKTKGVEPKGKDCQSFSEYRQRYSLYDAKKLIYRALAWRLFDDSHADYGHALTILGLDE
FT                   DESGVEQIGFAFSKFTLDID"
FT   CDS_pept        353060..353587
FT                   /transl_table=11
FT                   /locus_tag="SSU0334"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44787"
FT                   /protein_id="CAR44787.1"
FT                   /translation="MSLENYMPDFALEKAYDVTVESLKKHGIKVVFVDLDNTLIAWNNP
FT                   DGTPEMRQWLHDLQDAGIPVVVVSNNKYERVKRAVEKFGIEFEAFALKPFTFGINRALK
FT                   RFDVQPYEVIMIGDQLMTDIRAAKRAGLKSVLVKPLIKTDSINTQINRWRERRTMKKII
FT                   AKYGAIDYKREM"
FT   misc_feature    353204..353479
FT                   /locus_tag="SSU0334"
FT                   /note="HMMPfam hit to PF00702, Haloacid dehalogenase-like
FT                   hydrolase, score 4.3e-12"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   CDS_pept        353588..354694
FT                   /transl_table=11
FT                   /locus_tag="SSU0335"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44789"
FT                   /protein_id="CAR44789.1"
FT                   /translation="MEELFCIGCGAQIQTLDKAVAGFTPQSALEKGLETGQLYCQRCFR
FT                   LRHYNEISDVNISDDDFLKLLHSVGESDALVVNVIDIFDFNGSVIPGLPRFISGNDVLL
FT                   VGNKQDILPKSVKTGKVTQWLTERAHEIGMRPVDVVLTSAQNKQAIKDLIEKIEQHRKG
FT                   RDVYVVGVTNVGKSTLINAIIQEITGDKDVITTSRFPGTTLDKIEIPLDDGSYIYDTPG
FT                   IIHRHQMAHYLTAKNLKYISPRKEIKPKTYQLNPEQTLFLAGLGRFDFVAGERQGFTAF
FT                   FDNELQLHRTKLQGASEFYQKHAGSLLVPPTSKELKEFPELVRHEFTINEKTDVVFSGL
FT                   GWIRVNEKAKIAAWAPKGVDVVIRKAII"
FT   misc_feature    354077..354394
FT                   /locus_tag="SSU0335"
FT                   /note="HMMPfam hit to PF01926, GTP-binding protein,
FT                   HSR1-related, score 6.5e-12"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    354095..354118
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        354967..355275
FT                   /transl_table=11
FT                   /locus_tag="SSU0336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44791"
FT                   /protein_id="CAR44791.1"
FT                   /translation="MLTSKQRAFLNSQAHSLKPIIQIGKNGLNDQIKTSVRQALDAREL
FT                   IKVTLLQNTDENIHEVAEILEEEIGVDTVQKIGRILILFKQSSKKENRKISKQVKEI"
FT   misc_feature    354970..355221
FT                   /locus_tag="SSU0336"
FT                   /note="HMMPfam hit to PF01985, CRS1/YhbY, score 2.6e-33"
FT                   /inference="protein motif:HMMPfam:PF01985"
FT   CDS_pept        355288..355920
FT                   /transl_table=11
FT                   /locus_tag="SSU0337"
FT                   /product="putative nicotinate-nucleotide
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44792"
FT                   /protein_id="CAR44792.1"
FT                   /translation="MAIELLTPFTKVELEVEKKETNRKQVGILGGNFNPVHNAHLIVAD
FT                   QVRQQLKLDQVLLMPEFIPPHVDKKETIDEYHRYSMLKMAIAGIEGLGIETIELERRGV
FT                   SYTYDTMKLLKEKNPDTDYYFIIGADMVDYLPKWHRIDELVQLVQFVGVQRPRYKAGTS
FT                   YPVIWVDVPLMDISSSMVRSFIKQGRVPNFMVPHEVLDYIEEKGLYQ"
FT   misc_feature    355369..355839
FT                   /locus_tag="SSU0337"
FT                   /note="HMMPfam hit to PF01467, Cytidylyltransferase, score
FT                   5.5e-62"
FT                   /inference="protein motif:HMMPfam:PF01467"
FT   CDS_pept        355917..356504
FT                   /transl_table=11
FT                   /locus_tag="SSU0338"
FT                   /product="putative metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44795"
FT                   /protein_id="CAR44795.1"
FT                   /translation="MIAADLTFDRQALLEKIRVAMKPARFQHVLGVEQAALVLADQYGC
FT                   DPKKASLAALLHDYAKEVEDQVFLDLIAKYDLDKDLLNWDNNIWHGVVGAYKIAEDFGL
FT                   EDEEIFQAIQRHTVGAGQMTLLDKVLYVADYIEPNRDFPGVDEARRIAKESLDKAVAYE
FT                   TAQTISYLAKKGIPIYPQILETYNGYVVWLKE"
FT   misc_feature    355989..356333
FT                   /locus_tag="SSU0338"
FT                   /note="HMMPfam hit to PF01966, Metal-dependent
FT                   phosphohydrolase, HD region, subdomain, score 1.5e-21"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS_pept        join(356614..356739,357017..357337)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0339"
FT                   /product="acetyltransferase (GNAT) family (pseudogene)"
FT                   /note="CDS lacks a translational start codon, and is
FT                   disrupted by a 277bp DNA region. Similar to Bacillus
FT                   thuringiensis serovar konkukian str. 97-27
FT                   acetyltransferase UniProt:Q5LK91 (EMBL:CP000047) (148 aa)
FT                   fasta scores: E()=6.8e-14, 36.429% id in 140 aa"
FT   misc_feature    357053..357274
FT                   /locus_tag="SSU0340"
FT                   /note="HMMPfam hit to PF00583, GCN5-related
FT                   N-acetyltransferase, score 0.0015"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        join(357334..357420,357424..357507,357509..357844)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0341"
FT                   /product="isochorismatase family protein (pseudogene)"
FT                   /note="CDS contains a nonsense mutation (ochre) after codon
FT                   29, and a frameshift after codon 57. Similar to
FT                   Streptococcus agalactiae (serotype III) hypothetical
FT                   protein GBS1704 UniProt:Q8E3Q2 (EMBL:SAG766852) (173 aa)
FT                   fasta scores: E()=1.7e-21, 42.262% id in 168 aa"
FT                   /db_xref="PSEUDO:CAR44799.1"
FT   misc_feature    357575..357718
FT                   /locus_tag="SSU0341"
FT                   /note="HMMPfam hit to PF00857, Isochorismatase hydrolase,
FT                   score 2.2e-09"
FT                   /inference="protein motif:HMMPfam:PF00857"
FT   CDS_pept        357846..358205
FT                   /transl_table=11
FT                   /locus_tag="SSU0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44801"
FT                   /protein_id="CAR44801.1"
FT                   /translation="MKELDLVKVVVQAADDKRAEDLVVIDVQGVTSLTDYFVIASSMNS
FT                   RQLEAIAENIREKVADVGIKSSRVEGDSNGGWVLLDLGGVVVHIFSEEMRDLYNLEKLW
FT                   HEGSFLEVADFLEEE"
FT   misc_feature    357855..358160
FT                   /locus_tag="SSU0342"
FT                   /note="HMMPfam hit to PF02410, Iojap-related protein, score
FT                   4.5e-45"
FT                   /inference="protein motif:HMMPfam:PF02410"
FT   CDS_pept        358507..359250
FT                   /transl_table=11
FT                   /locus_tag="SSU0343"
FT                   /product="SAM dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44803"
FT                   /protein_id="CAR44803.1"
FT                   /translation="MATYETFAAVYDEIMDDSLYDKWTDFSLRNLPQDTKTILELACGT
FT                   GIQAVRFAQKGYEVTGLDLSYEMLELAQKKAEAAGVMMELAQADMMALEGVGDFDAVTC
FT                   YSDSLCYMSDREAVLRVFEGVHSVLNQGGTFLFDVHSIYQMEEVFAGYSYHENYEDFAF
FT                   VWDTYEGEHAHSIVHELTFFVKDEASQEERFIRRDEVHEERTYPIETYVELLKEAGFAS
FT                   VEVFADFEDEAPTETSQRWFFKCKK"
FT   misc_feature    358621..358917
FT                   /locus_tag="SSU0343"
FT                   /note="HMMPfam hit to PF08241, Methyltransferase type 11,
FT                   score 4.8e-16"
FT                   /inference="protein motif:HMMPfam:PF08241"
FT   CDS_pept        359345..363397
FT                   /transl_table=11
FT                   /locus_tag="SSU0344"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44805"
FT                   /protein_id="CAR44805.1"
FT                   /translation="MESLHRKISNWGQKIFLQFKNRTPNVEGISFNRLTSNKNIDLERE
FT                   NPSFKQALDFAIQDDELKNVAITGNYGSGKSSLLDSYEAKYSNKKFLHISLADYKENDL
FT                   SGYKENDSSESGKKLNVRQINVIEGKIINQLLHQIHPKHVKKSIFKTLSRTPRRIPLLL
FT                   TVYIVLFFITLSYFLKPNFLKALVTADKVFGWDANTVFSWLFLILLFIGSLTTIWYIVE
FT                   NKTIKSLTIGGKNVSSEIDIFSDQSMRVSYFDKYLDDVLYLLNESRADVIVFEDIDRFE
FT                   NNTIFAKIKELNVLVNNKRKIAKKSSKLVFLYLIRDDLFISKERTKFFDFIIPVLPVIT
FT                   SSNSSDKLTTTLKEMGIKSGLADDFLFRISLYIDDMRLLNNICNEFYSYQLELTHDKTG
FT                   EKNALDLDLKKIFAMIVYKNIFPKDFSELQNNQGFLYSLFNEKEVRRSEKLTKIDSEKL
FT                   HLENKLRKIQSEHIQDEIELYGTIFKIPNGRKVVSVNDKFQDEFTSYHDFISEMLVEGS
FT                   RIISYVDFDDAYRNVGIKTENMDSIFPEKDSPEFKERLDTVRSRNNSKELQQKIASLNQ
FT                   KRSFVEKQLIADIYTNQEIHEFAKSREEFIDIEKNQQFDIIYFLLKNSYIDETYPDYLT
FT                   YFYGNVLTKNDKEFLRNISSGRGAGFDFRLVNISNIYHHLQLKDFRNEEVLNFDLIEYM
FT                   LKNLELQSREENLSAILLQEDNLDFLVELAKKLYDSKSEKYNLEQFGQLMEFWLSTNPQ
FT                   RFIDYMKSTKVEYQAPLKNKFIRALMNQVNLDSVDNEIKALVARYINENNDLISPNEDF
FT                   TSFFKTNLKAINLKFTHFREPDDDAPRTTTFLELIDFIFGNSLYEINKENLRFFMRWFK
FT                   GSTDWSEEDFKHKNFELLHTNDNYSPLLEYSRLKITDYVYAYLEICEGTILDNSEYIVE
FT                   LLQRNEVYESGFNLGTLEEERQIDRILQFLPDNSINFNSDDFRQLVEEDILEEGNYLTL
FT                   LSLLVQTSKAVVDTDIILSYFTENQNYDNSLINFINNARDLKFEEDIFNLLEKEEQRNF
FT                   FTKTVECMELDDTKYELILSTLGWHYTDTFNKSGIESSKLRILIDLEIIQFNSKNIEFF
FT                   RDNYPEDTLYLIKKHLSEYLDTKSKIYKEDELLALLDDDIISDDEKTNIADHILKISIK
FT                   NKQYSEKLTAHILENQFDEEDLSYIISSQFFDNQSLSLKELVKQIAIENLDTIAEEFYA
FT                   QISNNLMRKLIAESQLNTLKKLIYNYYVYTPNLDENEKREQFSKYLNLFALSDNITALK
FT                   ELNVFDEWDSVLKTLNKPGTRWGQVQKTTINLAFARYLDSNNFVSSINERSNDIRLNSY
FT                   KDKTIPL"
FT   misc_feature    359549..359572
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    join(359819..359878,359939..360007)
FT                   /locus_tag="SSU0344"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0344 by TMHMM2.0 at aa 159-178 and 199-221"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        363456..364547
FT                   /transl_table=11
FT                   /locus_tag="SSU0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44808"
FT                   /protein_id="CAR44808.1"
FT                   /translation="MSISGIIAEYNPFHTGHKYLLEQAEGLKIVVMSGNFMQRGEPAIV
FT                   DKWTRAQMALEHGADLVVEMPFLVSVQSADHFAKGAISILHRLGVEKLVFGTEEMLDYQ
FT                   KIADIYVDKSEEMENFVKNLPDNFSYPQKTQAMWQEFAGLTFTGDTPNHILALAYAKGV
FT                   AGTGIQLSPVQRQGAGFHSEEVETSYASAIAIRKGADQLDLVRDFLPSASLFEEATKVS
FT                   WRNYFPLLRYQITTHPDLSQVFQVNEELASRIRSAIGSVATVEELVEAVTTKRYTKARV
FT                   RRVLTYILINAVETPLPDAVHVLGFSARGQAYLKQVKERVGLVTRIGKEPWDSLTQQAD
FT                   LVYQLGADAMAEQTYGRVPVRVE"
FT   misc_feature    363456..364535
FT                   /locus_tag="SSU0345"
FT                   /note="HMMPfam hit to PF05636, Protein of unknown function
FT                   DUF795, score 1.8e-181"
FT                   /inference="protein motif:HMMPfam:PF05636"
FT   misc_feature    363624..363656
FT                   /note="PS00133 Zinc carboxypeptidases, zinc-binding region
FT                   2 signature."
FT                   /inference="protein motif:Prosite:PS00133"
FT   CDS_pept        364643..365362
FT                   /transl_table=11
FT                   /locus_tag="SSU0346"
FT                   /product="MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44811"
FT                   /protein_id="CAR44811.1"
FT                   /translation="MKTVKEMSQLSGISVRTLHYYDEINLLTPSFIAENGYRYYDNEAF
FT                   EKLQEILLFRELEFPLKEIKKIVGNAAYDRESALKDQIRLLELKKKHLEKVIKHAKSLQ
FT                   QKGENYMNFEVFDKSDLLAFQEEAKERWGNTAAFQEFSAKTNQEGFAHISAEMSGIMME
FT                   FGKMKSLSADDSKVHKQVEVLKAYISENFYNCTNEILASLGQMYIADNRFTQFIDQVGG
FT                   EGTASFVSQAIAVYCKE"
FT   misc_feature    364649..364762
FT                   /locus_tag="SSU0346"
FT                   /note="HMMPfam hit to PF00376, Bacterial regulatory
FT                   protein, MerR, score 2.4e-11"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   misc_feature    364973..365353
FT                   /locus_tag="SSU0346"
FT                   /note="HMMPfam hit to PF07739, TipAS
FT                   antibiotic-recognition, score 1.4e-50"
FT                   /inference="protein motif:HMMPfam:PF07739"
FT   CDS_pept        365458..367992
FT                   /transl_table=11
FT                   /locus_tag="SSU0347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44812"
FT                   /protein_id="CAR44812.1"
FT                   /translation="MTKIKIISNPFHKSIVFQKQQPITEVWEEITFESNPNSRLVRENI
FT                   QKGVLSFHIQEIVDILVAEYDDGTGIDLLFEGNSDEFQELKTFVQSLNNSSISLKKSAY
FT                   SLTNARDILPEVLSIFDKTQVILPEELEHDAAIQKFQDATKPQIPLLVLGNYSAGKSTF
FT                   INSLVGYELLPASDQPTTAKIIQIEKFAEKWIEIEGTLLRNKVCIRIDEDGFEVEGDRI
FT                   DETIIKDLESIRQSLPQTTPQILARAVLAYLNAREDSDLNIITVKTAFTDSPLSKSSHR
FT                   YIIFDTPGSNSSTNMEHLQLLREAMAGMSNGLPIFISEYTSLDTVDNDKLYQELEQIDG
FT                   IDLRYTILVVNKADTAALSTFQDHQVLNQALPRKLSTKRVYFLSSLMGLGSKTSGLFQE
FT                   PDYERVYQKSLAEFTDASNPYYQQLYTYNILPTQQKLAQELQSKEERNLLYANSGLYSL
FT                   ESEIEVFSTKYAAYNKCVQADQYLQHIISQTQSIIEDSKKTIEQEKDRLEKKLEKDKLA
FT                   LVNDLKRQQADFFNSSSTVYQQNLNEKVRDEKHYAPLQLFIKERDSLWSKAVDDFQLKS
FT                   YQKEMAESPKKALNNIKNSLGKAWDKKNIEILGSAFVNGFNDTGKVFSKVDDYNKMKTK
FT                   AKGQVRDQLITFARFEYIKQVEEVGKDFTTLSIHYWKEQTGLIKDRFSQLIGDASVLSD
FT                   QKRAAIKEIIFQFQQPVLYHDSKQLFDQKSLVEGFRLGDIQIFGDANKIDLQKLEKRYN
FT                   SLLKTAYKHINEQLISHHQATFYKWVEALLHLVTENIVEFSPDLHSTNLLIQDNRVKIE
FT                   ELSTNLQNLHEYSKDLHDLMAWKDDEEVANGY"
FT   misc_feature    365917..365940
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        367982..371320
FT                   /transl_table=11
FT                   /locus_tag="SSU0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44813"
FT                   /protein_id="CAR44813.1"
FT                   /translation="MVIKKMIKKVATKAADGVSKLSELSPEQLEKVQAQMATYRDQIPD
FT                   LSGEAAEEYFRKQLAIAGVEVYNAYLPQLKDLYLPIDNKTEFRLEDEGVLIDEGEFKSG
FT                   YNIRYINITKWVTDKQENSLEKLVSVYEVLSTTPCNISLVFHRKQEETSVYLAVTNTEN
FT                   ADSNADVDSYRKRLVSAIKGNFPGAAWKEEVGRGSLPCFEDYIPYSVATASNIPTEKSE
FT                   KFISQTIEKLLDGIVPENKEQEYILVLLATPVLDVTDRKLHLSQIYSNLSPYATWQTQF
FT                   QLTESDSRGSSATVGVNIGASVGSQTGHNLTQTHSQGQTESRGTSETETNTKGSGWQAG
FT                   VNIKILNGGHNWNKSKSIAKGITNTIGKTASVANAVGKTVSSSLGANFGANFARTSSVT
FT                   ATIGKNEGISQSFVNHHVQHALKNLDKQMERLELSTALGLWDFSAYVLSEDPTIANNVA
FT                   HSYLALTQGEESHLSQTVVNLWRGDVQMERDKAKALIAYLRDLRHPLFGFNPEILEIDE
FT                   EFAVYPEIVTAATPLSGKELAYALNFPQKSIAGLPVLECAQFGRNISTFEEKDDQEQLP
FT                   LGNIFHMNHEENTAVQLSLPSLASHTFITGSTGTGKSNTVYQLLAQAREKGIKFLVVEP
FT                   AKGEYKQVFGSDEDVAVFGTNPTITPLLKINPFSFPEGIHILEHLDRLVELFNVCWPMY
FT                   AAMPAVLKKAIEQAYQDCGWDLISSVNTYSKTIFPTFADVLRTIREIIDSSEYDNDNKG
FT                   AYKGALLTRLESLTTGIYQLMFTEDEISSEKLFDENVIVDLSRLGSSETKSLIMGLLIL
FT                   KMQEYRMVSSQGMNQQLRHVTVLEEAHNLLKRTSTEQATESSNLLGKSVEMLTNAIAEM
FT                   RTYGEGFIIADQSPGLLDLAVIRNTNTKIILRLPEYSDRELVGKSANLNEEQINELAKL
FT                   PKGVAAVYQNEWLEPVLCKVAKYDSTEMVFQQPTQLVRTESPYHRLAILELLTTSPNLD
FT                   STLSFEELQELTLAVGLDSLTQVRIFNFLRTTSPDNFSMHELAHILGKVYPELVEKIRL
FT                   KAEKGLEPPALTQVLQQEIDSSIPETISEQARRDLVQGLMTCYYLFELKDHKAMQDWLR
FT                   NGDLI"
FT   misc_feature    369797..369820
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        371317..371916
FT                   /transl_table=11
FT                   /locus_tag="SSU0349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44817"
FT                   /protein_id="CAR44817.1"
FT                   /translation="MIEGLKTVAEAVKPVVNEVGKRAIDAFEKPIDSDKRLEAASDNKT
FT                   TFRYDGLSKPQEFLAQAQGFPKEIAKDIYNSQELKHYMDIGMRAVQFGQKENGEPRFCL
FT                   IPKDLSFDRVVDSQGRTNAERLQSGLLPIKDGQPLEVHHIGQKNGGHYALLTKEEHIKN
FT                   GNKEMLHKPGKSDVDHGLDFARDKRSIAKVLMEEQV"
FT   CDS_pept        371913..372323
FT                   /transl_table=11
FT                   /locus_tag="SSU0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44819"
FT                   /protein_id="CAR44819.1"
FT                   /translation="MSQLVDKIKVVQGLYSGSPASEQEVAVAESKLQLIFPAEYKDYLK
FT                   EYGVISFYGTEWNGLKGDTWTDVVATTLEARSLYENFPKEKFILEDLHFDDMLVLADST
FT                   GKVFLWHNGLEKEIHSSIASYLEECVARKDTP"
FT   CDS_pept        372320..372730
FT                   /transl_table=11
FT                   /gene="fms"
FT                   /locus_tag="SSU0351"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44821"
FT                   /protein_id="CAR44821.1"
FT                   /translation="MIQPIMKDIFFLQQKSEPATQLDVQVGQDLQDTLAANAHACVGMA
FT                   ANMIGVKKRIIIVNMGFTNLVMYNPVLISKAKPYQTEEGCLSLEGTRPTTRYQEIEVEF
FT                   FDASWKKISLKLTDFQAQIVQHELDHLEGIII"
FT   misc_feature    372335..372727
FT                   /gene="fms"
FT                   /locus_tag="SSU0351"
FT                   /note="HMMPfam hit to PF01327, Formylmethionine
FT                   deformylase, score 2.8e-12"
FT                   /inference="protein motif:HMMPfam:PF01327"
FT   CDS_pept        373035..375134
FT                   /transl_table=11
FT                   /gene="clpL"
FT                   /locus_tag="SSU0352"
FT                   /product="putative ATP-dependent protease ATP-binding
FT                   subunit ClpL"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44823"
FT                   /protein_id="CAR44823.1"
FT                   /translation="MNNNFNNFNNMDDIFNQLMGNMGGYSTERRRYSINGREVTPEEFA
FT                   MYRQTGRLPQTEEVAQTQAKGQIKSDGILAKLGRNLTQDAREGKLDPVIGRNKEIQETS
FT                   EILARRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIISIDISGLEAGTQ
FT                   YRGAFEENVQNLVDEVKKAGNIILFFDEIHQILGAGSTGGDSGSKGLADILKPALSRGE
FT                   LTVIGATTQDEYRNTIHKNAALARRFNEVKVNAPSAEDTYQILKGIKPLYEAHHNIELP
FT                   DEVLRAAVDYSVQYIPQRSLPDKAIDLVDVTAAHLAAQHPVTDIQTLEAEMAEAKQLQL
FT                   EAAEKEDYEKALNEKVRIDKLQKQIDNHTEQQKVVATVNDVAQAVERMTGIPVSQMGAS
FT                   DIERLKELKNRLAANVIGQDDAVEAVSRAIRRNRAGFDDGNRPIGSFLFVGPTGVGKTE
FT                   LAKQLALDLFGNKDAIIRLDMSEYSDRTAVSKLIGTTAGYIGYDDNSHTLTERVRRNPY
FT                   SIVLMDEIEKADPQVITLLLQVLDDGHLTDGQGNQVNFKNTIIIATSNAGFGYGMAEGE
FT                   ENQDIMDRIAPFFRPEFLNRFNAVIEFKHLDKDDLKAIVELLLAQVNNTLAKKGIQLTV
FT                   TEAAKEFLMEEGYDKAMGARPLRRVIENQIRDKVTDFYLDHVDVKYLEADVVDGSIQIK
FT                   EQSFA"
FT   misc_feature    373374..373838
FT                   /gene="clpL"
FT                   /locus_tag="SSU0352"
FT                   /note="HMMPfam hit to PF00004, AAA ATPase, core, score
FT                   4.7e-18"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    373389..373412
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    374355..374834
FT                   /gene="clpL"
FT                   /locus_tag="SSU0352"
FT                   /note="HMMPfam hit to PF07724, ATPase AAA-2, score 6.1e-76"
FT                   /inference="protein motif:HMMPfam:PF07724"
FT   misc_feature    374382..374405
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        375317..376825
FT                   /transl_table=11
FT                   /gene="malM"
FT                   /gene_synonym="malQ"
FT                   /locus_tag="SSU0353"
FT                   /product="putative 4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44827"
FT                   /protein_id="CAR44827.1"
FT                   /translation="MTNRTSGILMHITSLPGKFGIGTFGQSAYDFVDFLVETKQTYWQI
FT                   LPLTTTSYGDSPYQSFSAIAGNTHLIDFDLLVEDGLLATEDFQDVNFGDNPEKVDYALI
FT                   YQVRRPILEKAVQAFLQDDKKKAAFLEFEKANSSWLTDYAEFMAIKEYFGNKALQEWED
FT                   KKVVARNEEALDKYRLELANQIDYYKVTQYFFFSQWKQLKEYANKHHIKIIGDMPIYVS
FT                   ADSVEVWTKPQLFKLDSERKPLYVAGVPADNFSADGQLWGNPIYDWPEHEKTGYNWWIY
FT                   RIHESFKLYDVLRIDHFKGFSDFWQVDGKAEVAKVGTWEPGPGYNLFKAVKETLGDLPI
FT                   IAEDLGNIDAKARKLLADCGYPGMKILEFGFFDVTGKSIDAPHRCIPNSVAYTGTHDNE
FT                   VVNGWYNNLDPEQQEYVDAYSNRKPIEKVSQAMLRMLFATVSDTAIATMQDVLDLGEES
FT                   RMNMPSTIGGNWEWRMKAEDLTQERKDFLTKMTLLYQRGNENHD"
FT   misc_feature    375344..376798
FT                   /gene="malM"
FT                   /gene_synonym="malQ"
FT                   /locus_tag="SSU0353"
FT                   /note="HMMPfam hit to PF02446, Glycoside hydrolase, family
FT                   77, score 5.6e-200"
FT                   /inference="protein motif:HMMPfam:PF02446"
FT   CDS_pept        376818..379082
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="SSU0354"
FT                   /product="putative glycogen phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44829"
FT                   /protein_id="CAR44829.1"
FT                   /translation="MTKFTTFAETNTSKKLADLTNEEIYLQLLNYVKDAAASKPKNTGK
FT                   RKVYYISAEFLIGKLLSNNLINLGVYKDVQAELAAAGKSLAQVEDVEPEPSLGNGGLGR
FT                   LASCFVDSMSTLAINGEGVGLNYHCGLFRQVFKKNEQEAEPNFWIENDSWLIPTTISYD
FT                   VPFKNFTLKSKLDRLDILGYKKETKNYLNLFDIESVNYDLITDGISFDKTDIKENLTLF
FT                   LYPDDSDKNGELLRIYQQYFMVSNAAQLLIDEAIERGSNLHDLADYAYVQINDTHPSMV
FT                   IPELIRLLTEKHGIEFAEAVAIVKNMTGYTNHTILAEALEKWPLEFLEEVVPHLVDIIK
FT                   ELDALIRAEIKDPAVQIIDESGRVHMAHMDIHFSNSVNGVAALHTEILKNSELKAFYEL
FT                   YPEKFNNKTNGITFRRWLEFANQDLADYIKELIGDEYLTDATKLEKLLAFADDKEVHAK
FT                   LAEIKFNNKLALKRYLKDNKGIELDENSIIDTQIKRFHEYKRQQMNALYVIHKYLEIKN
FT                   GNLPKRKITVIFGGKAAPAYIIAQDIIHLILCLSELINNDPEVNKYLNVHLVENYNVTV
FT                   AEKLIPATDISEQISLASKEASGTGNMKFMLNGALTLGTMDGANVEIAELAGMDNIYTF
FT                   GKDSDTIIDLYDKAGYVSADYYNGDANIKRAVDFIVSDEVKALGNEERLGRLHHELISK
FT                   DWFMTLIDLAEYIEVKEQVFADYEDQDSWNKKVVHNIAKAGFFSSDRTIEQYNEDIWHS
FT                   N"
FT   misc_feature    377049..379073
FT                   /gene="glgP"
FT                   /locus_tag="SSU0354"
FT                   /note="HMMPfam hit to PF00343, Glycosyl transferase, family
FT                   35, score 2.3e-190"
FT                   /inference="protein motif:HMMPfam:PF00343"
FT   misc_feature    378603..378641
FT                   /note="PS00102 Phosphorylase pyridoxal-phosphate attachment
FT                   site."
FT                   /inference="protein motif:Prosite:PS00102"
FT   CDS_pept        complement(379310..380017)
FT                   /transl_table=11
FT                   /locus_tag="SSU0355"
FT                   /product="GntR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44832"
FT                   /protein_id="CAR44832.1"
FT                   /translation="MSKYKKVYQDIKKKIEEQVWSTGQALPTENELMEVYSYSKDTIRK
FT                   ALSLLEMDGYIQKKQGKSSIVIEHGLMKDQYLSEIKTAGELNKRSQHQIQTQLTSLYII
FT                   QGQEDLMSTFEVDDKVDFYRVSRVRTIDGERLEYDISYFDRRVVPYLSKEIAESSIYRY
FT                   LEEELHLTISHSRREISFRFANEEEKQLMDLGDYDMVVVVTSITYLSNGQAFQYGTISY
FT                   RPDKVSFVSMAKR"
FT   misc_feature    complement(379334..379750)
FT                   /locus_tag="SSU0355"
FT                   /note="HMMPfam hit to PF07702, UbiC transcription
FT                   regulator-associated, score 2.8e-30"
FT                   /inference="protein motif:HMMPfam:PF07702"
FT   misc_feature    complement(379820..380011)
FT                   /locus_tag="SSU0355"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory protein
FT                   GntR, HTH, score 5.4e-17"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   CDS_pept        380216..381007
FT                   /transl_table=11
FT                   /locus_tag="SSU0356"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44833"
FT                   /protein_id="CAR44833.1"
FT                   /translation="MKLLTINVHAWLEERQDEKLDVLAQTIAEKAYDVIALQEVNQLIT
FT                   ADLVTKDLKADNYGLILLEKLRTLGQFDYSYYWSNSHIGYDKYEEGIAFLTKLPVYEVD
FT                   QFYCSQNKSIDSILSRKIMGLTVFYQDQLIDLYSCHINLPGSEEEDQLDNIRTIVERTG
FT                   NRRFKILMGDFNTDAFSDREAYEAITELGLYDSYNLAMEKDQGITVEKAIDGWAGHSQE
FT                   KRLDYIFLNQKKEVLSSLVIFNGENRPIISDHFGVEVEINV"
FT   misc_feature    380216..380998
FT                   /locus_tag="SSU0356"
FT                   /note="HMMPfam hit to PF03372,
FT                   Endonuclease/exonuclease/phosphatase, score 1.9e-11"
FT                   /inference="protein motif:HMMPfam:PF03372"
FT   CDS_pept        381041..383209
FT                   /transl_table=11
FT                   /locus_tag="SSU0357"
FT                   /product="putative glucose-specific phosphotransferase
FT                   system (PTS), IIABC component"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44835"
FT                   /protein_id="CAR44835.1"
FT                   /translation="MKKFLSFEFWQKFGKCLMVVIAVMPAAGLMVSIGNSIPLISPESE
FT                   LLIRIGNIIAQIGWGIIGNLHLLFALAIGGSWAKEKAGGAFSAGLAFILINLITGHFFG
FT                   VTTDMLADAAATVTTVFGTEIPVSGYFVNILGQPALNMGVFVGIIAGFVGATTYNKYYN
FT                   YRKLPDVLTFFNGKRFVPFVVIYRSVLVALGLAIFWPVVQTGINSFGKWIASSQDTAPI
FT                   LAPFVYGTLERLLLPFGLHHMLTIPMNYTSLGGTYDILTGAQAGTQVFGQDPLWLAWIT
FT                   DLINLKDAGDMAQYNDLLANITPARFKVGQMIGSSGILMGLTYAMYRNVDEDKKHKYKG
FT                   MFISSALAVFLTGVTEPIEFMFMFAAMPLYVVYAFVQGAAFAMADIVNLRMHSFGNIEF
FT                   LTRTPMAIKAGIGMDVINFIWVTALFAVGMYFIANFMIKKFNLATAGRNGNYDTETTDV
FT                   VSNSNVDTADANSQVVQIINLLGGRDNIADVDACMTRLRVSVKDVAQVGDENAWKQAGA
FT                   MGLIIKDSGVQAVYGPKADVLKSDIQDLLESGVAIPRTEIVATEEVAPETQFKGVTETV
FT                   YSVAEGQAIAITEVKDPVFSQKMMGDGYAVEPSSGNVYAPVSGIVTSVFPTKHAVGILS
FT                   DKGVEVLVHVGLDTVALNGAPFSTKVTDGQRVEAGDLLLVADLEAIRSAGRETTIVVAF
FT                   TNTAEIKSVSLENLGQVSQDSQVATVEL"
FT   sig_peptide     381041..381148
FT                   /locus_tag="SSU0357"
FT                   /note="Signal peptide predicted for SSU0357 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.901) with cleavage site
FT                   probability 0.428 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    381080..382174
FT                   /locus_tag="SSU0357"
FT                   /note="HMMPfam hit to PF02378, Phosphotransferase system,
FT                   EIIC, score 1.7e-37"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    join(381086..381154,381197..381265,381284..381352,
FT                   381380..381448,381467..381535,381578..381646,
FT                   382052..382105,382118..382186,382283..382351)
FT                   /locus_tag="SSU0357"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SSU0357 by TMHMM2.0 at aa 16-38, 53-75, 82-104, 114-136,
FT                   143-165, 180-202, 338-355, 360-382 and 415-437"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    382457..382561
FT                   /locus_tag="SSU0357"
FT                   /note="HMMPfam hit to PF00367, Phosphotransferase system,
FT                   EIIB, score 5.2e-16"
FT                   /inference="protein motif:HMMPfam:PF00367"
FT   misc_feature    382493..382546
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT                   /inference="protein motif:Prosite:PS01035"
FT   misc_feature    382751..383149
FT                   /locus_tag="SSU0357"
FT                   /note="HMMPfam hit to PF00358, Phosphotransferase system,
FT                   sugar-specific permease EIIA 1 domain, score 5.3e-57"
FT                   /inference="protein motif:HMMPfam:PF00358"
FT   misc_feature    382952..382990
FT                   /note="PS00371 PTS EIIA domains phosphorylation site
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00371"
FT   CDS_pept        complement(383280..383906)
FT                   /transl_table=11
FT                   /locus_tag="SSU0358"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44837"
FT                   /protein_id="CAR44837.1"
FT                   /translation="MIRHKLFTSLQEEEHWINSIQSEGYQLVKVTPWTATYHFEKCSRT
FT                   PHPVRLDFHEHIAKGEYSNYLSLFEDCGWQPIQGSRRCGIHYFQQTIETSSTEIFSDTE
FT                   SKKAFYSRYQNYAYSYFGLFLTLFFIHYQVGLQNGYTLWNPKSWYLTPGLWERTGTSFW
FT                   FGFLFETPFALFRSGIIPLFFLAWSIYFLHIAEKGKKEAKKLEKY"
FT   misc_feature    complement(join(383325..383393,383502..383561))
FT                   /locus_tag="SSU0358"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0358 by TMHMM2.0 at aa 116-135 and 172-194"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(383917..384228)
FT                   /transl_table=11
FT                   /locus_tag="SSU0359"
FT                   /product="PadR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44839"
FT                   /protein_id="CAR44839.1"
FT                   /translation="MKRNKHLPLTETTYYILLALLEPAHGYHIMQKVEDMSDGDVKIAA
FT                   GTMYGAIENLLKLKWICSVPSSDKRRKVYQVTATGQEIIKLETQRIQKLHHIAKELGF"
FT   misc_feature    complement(383983..384213)
FT                   /locus_tag="SSU0359"
FT                   /note="HMMPfam hit to PF03551, Transcriptional regulator
FT                   PadR-like, score 3e-08"
FT                   /inference="protein motif:HMMPfam:PF03551"
FT   CDS_pept        384389..385105
FT                   /transl_table=11
FT                   /locus_tag="SSU0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44845"
FT                   /protein_id="CAR44845.1"
FT                   /translation="MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKGDPDPETNS
FT                   ALKFVIDRAKQAQVPKHIIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVN
FT                   RTAANVRSAFGKNGGNMGASGSVSFMFDKKGVVVFAGDDADAIFELLLEADVEVDDVEA
FT                   EDGTITVYTAPTDLHKAIVALKESGIQEFNVTELEMIPQSEVSLEGDDLATFEKLYDAL
FT                   EDDEDVQKIYTNVDGF"
FT   misc_feature    384395..385096
FT                   /locus_tag="SSU0360"
FT                   /note="HMMPfam hit to PF01709, Protein of unknown function
FT                   DUF28, score 7.7e-130"
FT                   /inference="protein motif:HMMPfam:PF01709"
FT   CDS_pept        385469..386317
FT                   /transl_table=11
FT                   /locus_tag="SSU0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44847"
FT                   /protein_id="CAR44847.1"
FT                   /translation="MSNNLLVLQSDFGLVDGAVSAMIGVALQESRDLVVHHLTHDITPY
FT                   NIFEGSYRLFQTVEYWPEGTTFVSVVDPGVGSKRKSVVALTEQNHYIVTPDNGTLSFIK
FT                   KYVGIKAVREISEVANRRANTEHSYTFHGRDVYAYTGAKLASGHISFEEVGPELSVDKI
FT                   VEIPTVPTEVGSDYVKGAIDILDVRFGSLWTSITREEFYTLQPQFEDRFEVTIYNNDML
FT                   VYQNQVTYGKSFADVRIGQPLIYINSLYRVGVAINQGSFAKAYNVGVGQNWHIEIKRIS
FT                   N"
FT   misc_feature    385481..386302
FT                   /locus_tag="SSU0361"
FT                   /note="HMMPfam hit to PF01887, Protein of unknown function
FT                   DUF62, score 5.8e-76"
FT                   /inference="protein motif:HMMPfam:PF01887"
FT   CDS_pept        386338..386883
FT                   /transl_table=11
FT                   /locus_tag="SSU0362"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44849"
FT                   /protein_id="CAR44849.1"
FT                   /translation="MKNNSIKTVVATGIGAALFVVIGHLINIPTFVPNTSIQLQYAVQS
FT                   LLAVVFGPVVGFLVGFIGHTLKDSLTYGPWWSWILASGVFGLVVGLTKKRLRIQEGIFE
FT                   GKDILFFNLVQIAANVLAWGVIAPVLDILIYSEAANKVFAQGLVAGIANSITIAIAGTL
FT                   LLVVYAKSQTKTGSLSKD"
FT   sig_peptide     386338..386460
FT                   /locus_tag="SSU0362"
FT                   /note="Signal peptide predicted for SSU0362 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.981) with cleavage site
FT                   probability 0.285 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    386344..386880
FT                   /locus_tag="SSU0362"
FT                   /note="HMMPfam hit to PF07155, Protein of unknown function
FT                   DUF1393, score 4.2e-120"
FT                   /inference="protein motif:HMMPfam:PF07155"
FT   misc_feature    join(386365..386433,386470..386529,386557..386610,
FT                   386659..386727,386770..386838)
FT                   /locus_tag="SSU0362"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0362 by TMHMM2.0 at aa 10-32, 45-64, 74-91, 108-130 and
FT                   145-167"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        386991..387911
FT                   /transl_table=11
FT                   /locus_tag="SSU0363"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44851"
FT                   /protein_id="CAR44851.1"
FT                   /translation="MVWTEEKLGPIIHSILNPDEEVLSLYQSKTTKSIYGCILWNNYYY
FT                   KVFRVSNHPSQSTYKQPTFYDFHGEFYMKGAIRTYLYHTNSWYELSKQGYYLLLFFQKL
FT                   WDEKQEVEASWQNGRMQIRLVVEEEGWQVHYRFPDNQAREVERLLGSGMLVAIRSSRNF
FT                   IKIRTSRFVAPYIALIKQRQLYRKKPSKAMLQWEKYQSQLIEIQRTYRLVEESAPQTFF
FT                   GHWLNKVQLYLCSAIASYWEEVIKGVEWQEAREIKEQRKAEKPHNPIEDKWKENIARRH
FT                   KRKMDQLIGHDTLEKLRQLKTELDD"
FT   CDS_pept        388124..389107
FT                   /transl_table=11
FT                   /locus_tag="SSU0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44854"
FT                   /protein_id="CAR44854.1"
FT                   /translation="MSKDIRVLLYYKYVPIENAKEYAAEHLAFCKSIGLKGRILIADEG
FT                   INGTVSGDYETTQKYMDYVHANPLFSDLWFKIDEENEQAFKKMFVRYKKEIVHLGLEDN
FT                   DFDNDIDPLVTTGAYLSPKEFKEALLDEDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRE
FT                   LPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVR
FT                   GELWDGKMYVFDERIAVDVNHVNPVVVGKDWFDGTPCERYVNCGNPFCNRRILTSEENE
FT                   HKYVRGCSAECRAHERNRYISENGLTRQEWAERLEAIGETLTPANA"
FT   misc_feature    388484..388777
FT                   /locus_tag="SSU0364"
FT                   /note="HMMPfam hit to PF00581, Rhodanese-like, score
FT                   6.4e-15"
FT                   /inference="protein motif:HMMPfam:PF00581"
FT   repeat_region   complement(389247..389345)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        join(389332..389361,389365..389676)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0365"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="CDS contains a nonsense mutation (opal) after codon
FT                   10, and lack a translational start codon. Similar to
FT                   Staphylococcus aureus (strain Mu50/ATCC 700699)
FT                   hypothetical protein UniProt:Q99R63 (EMBL:BA000017) (125
FT                   aa) fasta scores: E()=3.4e-06, 34.513% id in 113 aa"
FT   CDS_pept        389794..391467
FT                   /transl_table=11
FT                   /locus_tag="SSU0366"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44858"
FT                   /protein_id="CAR44858.1"
FT                   /translation="MKKIIEFKDFTFKYQAQQEPTLKDIQLTIYQGEKVLIIGPSGSGK
FT                   STIGQCLNGIIPNIYKGEHSGSLLLDGQEAFNLSVYDKSLLVSTVLQDTDGQFIGLSVA
FT                   EDLAFALENDMESQVVMKQKVGDWAERLSLTDLLAHRPQDLSGGQKQRVSLGGVLIDES
FT                   PILLFDEPLANLDPKSGQDTIDLIDRLHKQEGTTTIIIEHRLEDVLYRQVDRVVLINDG
FT                   RILFNGGPDDLLRTSLLQENGIREPLYLSTLRALGYPIAQAERLSSVWEIDIEALNIAS
FT                   LPTLHFENGEKEALLEVKHLYFSYPNKQVLTDIQLTIHKGERLAIVGKNGAGKSTLAKV
FT                   LCGFIQGEGEILWKGQSIKEDSVKERAERIGYVLQNPNQMISQTMIFDEVALGLRMRGV
FT                   TEEEIEHRVHHILKVCGLYPFRNWPISALSYGQKKRVTIASILVLNPEIILLDEPTAGQ
FT                   DQRHYREMMEFLDQLNAQGHTIVMITHDMQLMLDYSDRAVVVVDGQIIEDASPAEILSD
FT                   DTVIERANLKETSIFHLAERVGVNPLELTTFYMQEERRGR"
FT   misc_feature    389887..390459
FT                   /locus_tag="SSU0366"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 2.4e-33"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    389908..389931
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    390226..390270
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    390754..391302
FT                   /locus_tag="SSU0366"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 3.5e-54"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    390775..390798
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    391075..391119
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    391324..391398
FT                   /note="PS00963 Ribosomal protein S2 signature 2."
FT                   /inference="protein motif:Prosite:PS00963"
FT   CDS_pept        391464..392297
FT                   /transl_table=11
FT                   /locus_tag="SSU0367"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44860"
FT                   /protein_id="CAR44860.1"
FT                   /translation="MSQQKLIGYHPGTGLIHSLSAVSKLLFFLIVSILAMITYDTRLIL
FT                   FIAVFSLALFKMSGIRYKEISLVLILTIIFAAMNALMVHLFAPRYGVELYGADTPLLSG
FT                   LGVYSLTSQQAFYLVNLLLKYFCTVPLAIIFLMTTHPSQFASSLNQIGVSYKVAYAVSL
FT                   TMRYIPDIQEEFYTIRMSQEARGLELSKKGKLMDRIKGNLSLVIPLIFSSLERIDTIST
FT                   AMELRRFGKNKKRTWYTQQPLQRIDYAVLLFILALVVVTIYLFFVNQGRFYNPWR"
FT   misc_feature    391497..392177
FT                   /locus_tag="SSU0367"
FT                   /note="HMMPfam hit to PF02361, Cobalt transport protein,
FT                   score 2.9e-21"
FT                   /inference="protein motif:HMMPfam:PF02361"
FT   misc_feature    join(391506..391574,391656..391724,391806..391874,
FT                   392205..392264)
FT                   /locus_tag="SSU0367"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSU0367 by TMHMM2.0 at aa 15-37, 65-87, 115-137 and
FT                   248-267"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    392094..392123
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        392457..392660
FT                   /transl_table=11
FT                   /locus_tag="SSU0368"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44864"
FT                   /protein_id="CAR44864.1"
FT                   /translation="MVQGTVKWFNAEKGFGFIAQENGPDVFAHFSEIQSNGFKSLEDGQ
FT                   KVTFEVEQGQRGLQATNITKIG"
FT   misc_feature    392457..392654
FT                   /locus_tag="SSU0368"
FT                   /note="HMMPfam hit to PF00313, Cold-shock protein,
FT                   DNA-binding, score 1.5e-40"
FT                   /inference="protein motif:HMMPfam:PF00313"
FT   misc_feature    392499..392555
FT                   /note="PS00352 'Cold-shock' DNA-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00352"
FT   CDS_pept        complement(392702..393415)
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="SSU0369"
FT                   /product="methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44867"
FT                   /protein_id="CAR44867.1"
FT                   /translation="MKPEVFYKTLADQGIQLTDQQKHQFHRYFQLLVEWNEKINLTAIT
FT                   EESEVYLKHFYDSIAPLLQGHIQNEPLRLLDIGAGAGFPSLPMKIIFPQLDVTIIDSLN
FT                   KRINFLHLLAEELELEGVHFYHGRAEDFAQDKNFRAQFDLVTARAVARMQILSELTIPY
FT                   LKLHGKLIALKASSAEDELTQAKNALNLLFAKVIENHDYTLPNGDPRTLTIVEKKKETP
FT                   NKFPRKAGMPNKRPL"
FT   misc_feature    complement(392780..393355)
FT                   /gene="gidB"
FT                   /locus_tag="SSU0369"
FT                   /note="HMMPfam hit to PF02527, Glucose inhibited division
FT                   protein, score 5.5e-56"
FT                   /inference="protein motif:HMMPfam:PF02527"
FT   CDS_pept        complement(393474..395660)
FT                   /transl_table=11
FT                   /gene="pbp1A"
FT                   /locus_tag="SSU0370"
FT                   /product="putative penicillin-binding protein 1A"
FT                   /note="Possible alternative translational start site after
FT                   codons 1 and 4"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44869"
FT                   /protein_id="CAR44869.1"
FT                   /translation="MVNLLKTTTIKKALLITANILLAGAIIACLAGAALVVYYIQSAPE
FT                   LTEESLTATVSSKIYDKNGNLIADLGAEKRSSAKTEEIPTDLVNAIVAIEDQRFFNHRG
FT                   VDVIRIAGSLINNLSGGRLQGGSTLDQQFIKLTYFSTSVEDQNLKRKIQEAWLATQLER
FT                   RNTKQEILTYYINKVYMSNGNYGMKTAALAFYGKELKDLTLPQLALLAGMPQAPNQYDP
FT                   YTNPEDAKARRDLVLAEMLEEKYIDNTQYEQAVLTPVTDGLQPLSNAAAYPAYMDNYLK
FT                   QVVEEVEAKTGYNLLTTGMDVYTNVDPAAQQQLWNIYNTDMYVSYPDDLLQVASTVVDV
FT                   SNGKVVAQLGGRKQETNVSFGTNQAVETNRDFGSTMKPITDYAPAFENGIYTSTADLIL
FT                   DGPYNYPGTPTPVNNWDKQYYGNISVKTAIQYSRNVTAVKALEATGLENALKFLNSVGI
FT                   NYPDIHYSNAISSNTSDTSSKYGASSEKMAAAYAAFANGGTYYAPQYVNKIVFSDGTVT
FT                   EYAPKGTKVMSAETAYMMTDMMKAVMSYGYGLNASVSGVPMAGKTGTSNYTDSETDTIL
FT                   ASIPEANYSYMVVPDENFVGYSSQYAMAVWTGYTNRMTPILDNSMRIATDVYHNMMLFM
FT                   HSDYTATDWEMPSGLVRYGSNYYLRGSRSLSNAYNTYTSSSTSSSSSTETSETTEATTT
FT                   SSETSSGTATETATSSTETATTGNNPATGQTDGQ"
FT   misc_feature    complement(393969..394664)
FT                   /gene="pbp1A"
FT                   /locus_tag="SSU0370"
FT                   /note="HMMPfam hit to PF00905, Penicillin-binding protein,
FT                   transpeptidase, score 8.5e-28"
FT                   /inference="protein motif:HMMPfam:PF00905"
FT   misc_feature    complement(393975..393998)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(394983..395492)
FT                   /gene="pbp1A"
FT                   /locus_tag="SSU0370"
FT                   /note="HMMPfam hit to PF00912, Glycosyl transferase, family
FT                   51, score 1.2e-80"
FT                   /inference="protein motif:HMMPfam:PF00912"
FT   misc_feature    complement(395556..395624)
FT                   /gene="pbp1A"
FT                   /locus_tag="SSU0370"
FT                   /note="1 probable transmembrane helix predicted for SSU0370
FT                   by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(395562..395660)
FT                   /gene="pbp1A"
FT                   /locus_tag="SSU0370"
FT                   /note="Signal peptide predicted for SSU0370 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.541 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(395574..395606)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(395629..396246)
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="SSU0371"
FT                   /product="putative recombination protein U homologue"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44871"
FT                   /protein_id="CAR44871.1"
FT                   /translation="MVNYPHKVSKKINRTSPISSQRVNFANRGMSFEAAINDSNQYYLA
FT                   HDIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYSGVFKRHYIDFEAKETRQ
FT                   KASMPMKNFHAHQIEHMKQVVKQGGICFVLLHFSTLKETYLLPATHLIEFYQVDMGSKS
FT                   MPLTFIRQYGFEIQMGRFPSIPYLEIVEKNLLGGESFENYNN"
FT   misc_feature    complement(395668..396168)
FT                   /gene="recU"
FT                   /locus_tag="SSU0371"
FT                   /note="HMMPfam hit to PF03838, Recombination protein U,
FT                   score 7.4e-112"
FT                   /inference="protein motif:HMMPfam:PF03838"
FT   CDS_pept        396312..396851
FT                   /transl_table=11
FT                   /locus_tag="SSU0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44873"
FT                   /protein_id="CAR44873.1"
FT                   /translation="MDTKSLLVTGYRHTDLGIFSEKDPRLHIIKSAIRRNFIRFLEEGV
FT                   SWFILTGQLGFEYWSLEVLEDLRAEGYQLSIATIFPFENHGEQWNEANQAKLARFKQVD
FT                   FVKYAYPRYENPGQFRDYNQFLLDNTTGCYLFYDSENETNLKYLYHMVLKKEGYNRKTL
FT                   TFEELNEEAENFSNSE"
FT   misc_feature    396312..396833
FT                   /locus_tag="SSU0372"
FT                   /note="HMMPfam hit to PF06908, Protein of unknown function
FT                   DUF1273, score 6.3e-99"
FT                   /inference="protein motif:HMMPfam:PF06908"
FT   CDS_pept        396922..397257
FT                   /transl_table=11
FT                   /locus_tag="SSU0373"
FT                   /product="DivIVA protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44875"
FT                   /protein_id="CAR44875.1"
FT                   /translation="MASIKFTTKDIFEQDFKIGFRGYDQDEVNDFLDDIMKDYDAYEAI
FT                   IKELKGEIARLKAQAANSPKTTLPTEESNDVLRTERPSSATNFDILRRLNRLEKEVFGK
FT                   QIVQDQE"
FT   misc_feature    396922..397254
FT                   /locus_tag="SSU0373"
FT                   /note="HMMPfam hit to PF05103, DivIVA, score 2.2e-16"
FT                   /inference="protein motif:HMMPfam:PF05103"
FT   misc_RNA        397396..397763
FT                   /note="RNase P class B (RF00011) as predicted by Rfam,
FT                   score 350.89"
FT   CDS_pept        397814..398980
FT                   /transl_table=11
FT                   /locus_tag="SSU0374"
FT                   /product="putative RNA methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44876"
FT                   /protein_id="CAR44876.1"
FT                   /translation="MKKQFELIATAAAGLEAVVGREIRNLGYECQVENGRVRFQGDVKS
FT                   IIETNIWLRSADRIKIIVGQFPAKTFEELFQGVFNLDWENYLPLGCKFPISKAKCVKSK
FT                   LHNEPSVQAISKKAVVKKLQKHFSRPEGVPLQEMGAEFKIEVSILKDVATVMIDTTGSS
FT                   LFKRGYRVEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIEAAMLAKNIAPG
FT                   LKRSFAFEEWPWVEDQLVVALRKEAQASIKTDLVLDITGSDIDARMIEIAKKNAFAAGV
FT                   EQDIVFKQMRVQDLRTDKINGVIISNPPYGERLLDDEAIVTLYREMGETFEPLKTWSKF
FT                   ILTSDELFETRFGQQADKKRKLYNGTLKVDLYQFFGQRVKRQVQEVQG"
FT   misc_feature    398312..398932
FT                   /locus_tag="SSU0374"
FT                   /note="HMMPfam hit to PF01170, Putative RNA methylase,
FT                   score 3.1e-65"
FT                   /inference="protein motif:HMMPfam:PF01170"
FT   misc_feature    398723..398743
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS_pept        398990..400444
FT                   /transl_table=11
FT                   /locus_tag="SSU0375"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44877"
FT                   /protein_id="CAR44877.1"
FT                   /translation="MGEKNSHHLPLDEEKVLDFEVAKDLTIEEAVKKHKEIEAGVTEDD
FT                   GLLDRYIKQHRAEIESQKFETKINHLPLVEVADEEKNQGHESAEEVEANESSLTEVSEE
FT                   IAPIVEELSVTPMETLEETVIASTVAMEGLSSVADDSSLELEEDETEDLDHSEGADRDQ
FT                   KKKFYFWSAVGLSMIGVMATALVWMNSVNKSNTATSSSSTSTSQTSSTASSSTDANVTA
FT                   FEQLYNSFFTDSSLTKLKNSEFGKLAELKVLLEKLDKNSDSYTKAKEQYDHLEKAIAAI
FT                   QAINGQFDKEVVVNGEIDTTATVKSGESLSATTTGISAVDSLLASVVNFGRSQQEVASA
FT                   TVASEAAVTRNQGADETVSTGVPATTEVASTTVSGSTTDFGIAVPAGVVLQRDRSRVPY
FT                   NQAMIDDVNNEAWNFNPGILENIVTISQQRGYITGNQYILEKVNIINGNGYYNMFKPDG
FT                   TYLFSINCKTGYFVGNGAGHSDALDY"
FT   misc_feature    399488..399556
FT                   /locus_tag="SSU0375"
FT                   /note="1 probable transmembrane helix predicted for SSU0375
FT                   by TMHMM2.0 at aa 167-189"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(400827..401309)
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="SSU0376"
FT                   /product="S-ribosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44879"
FT                   /protein_id="CAR44879.1"
FT                   /translation="MKKEVTVESFELDHTIVKAPYIRLISEEVGPKGDIITNFDIRLIQ
FT                   PNENAMDTAGLHTIEHLLAKLIRQRIDGLIDCSPFGCRTGFHMIMWGKQDSEKIAQVIK
FT                   SSLEEIAEGITWEDVPGTTIESCGNYKDHSLHSAKEWAKLILSQGISTDAFERKPI"
FT   misc_feature    complement(400860..401297)
FT                   /gene="luxS"
FT                   /locus_tag="SSU0376"
FT                   /note="HMMPfam hit to PF02664, S-ribosylhomocysteinase
FT                   (LuxS), score 1.6e-50"
FT                   /inference="protein motif:HMMPfam:PF02664"
FT   CDS_pept        401439..403052
FT                   /transl_table=11
FT                   /locus_tag="SSU0377"
FT                   /product="putative phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44882"
FT                   /protein_id="CAR44882.1"
FT                   /translation="MNIITVVVTLVSALIGLVLGYFAISLKMKSAKETAELTLLNAEQE
FT                   ASNVRGRAEEQAEVILKTAERDRQTLKKELLLEAKEEARKYREEIAEEFKSERQELKQI
FT                   ESRLTERATSLDRKDDNLTNKEKTLEQKEQSLTDKAKHIDEREQEVVKLEEQKALELER
FT                   VAALSQEEAKEIILTDTRDKLTHEIATRIKEAEREVKERSDKMAKDLLAQAMQRISGEY
FT                   VAEQTITSVHLPDDAMKGRIIGREGRNIRTFESLTGIDVIIDDTPEVVVLSGFDPIRRE
FT                   IARMTMETLLQDGRIHPARIEELVEKHRVEMDNRIREYGEAAAYEVGAPNLHPDLIKIM
FT                   GRLHFRTSYGQNVLRHSIEVAKLAGVLAAELGENVNLARRAGFLHDVGKAIDREVDGSH
FT                   VEIGTELAKKYKENPIVINAIASHHGDVEATSTIAVIVAAADALSAARPGSRRESMEAY
FT                   IKRLQDLEEIANSFEGIKQSYAIQAGREIRIIVHPNKVTDDQITILAHDVREKIENNLD
FT                   YPGNIKITVIRETRATDVAK"
FT   sig_peptide     401439..401534
FT                   /locus_tag="SSU0377"
FT                   /note="Signal peptide predicted for SSU0377 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.801) with cleavage site
FT                   probability 0.572 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    401442..401510
FT                   /locus_tag="SSU0377"
FT                   /note="1 probable transmembrane helix predicted for SSU0377
FT                   by TMHMM2.0 at aa 2-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    402120..402299
FT                   /locus_tag="SSU0377"
FT                   /note="HMMPfam hit to PF00013, K Homology, type 1, score
FT                   1.1e-08"
FT                   /inference="protein motif:HMMPfam:PF00013"
FT   misc_feature    402495..402776
FT                   /locus_tag="SSU0377"
FT                   /note="HMMPfam hit to PF01966, Metal-dependent
FT                   phosphohydrolase, HD region, subdomain, score 1.4e-25"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS_pept        403207..403833
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="SSU0378"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44886"
FT                   /protein_id="CAR44886.1"
FT                   /translation="MKERGLLIVFSGPSGVGKGTVRKEIFESSDNKFEYSVSMTTRPQR
FT                   PGEVDGVDYFFRSREEFEDLIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIE
FT                   VQGALQVKKKVPDGVFIFLTPPDLEELQDRLIGRGTDSEEVIAQRIERAKEEIALMREY
FT                   DYAVVNDEVPLAAERVKRIIEAEHFRVDRVIGRYDEMIREQIVER"
FT   misc_feature    403327..403641
FT                   /gene="gmk"
FT                   /locus_tag="SSU0378"
FT                   /note="HMMPfam hit to PF00625, Guanylate kinase, score
FT                   1.2e-47"
FT                   /inference="protein motif:HMMPfam:PF00625"
FT   CDS_pept        403860..404171
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="SSU0379"
FT                   /product="DNA-directed RNA polymerase omega chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44887"
FT                   /protein_id="CAR44887.1"
FT                   /translation="MLKPSIDTLLDKVPSKYSLVILEAKRAHELEAGAKPTQEFTSVKS
FT                   TLRALEEIESGNVVIHPDPEAKREAVRRRAEEAKRLAEEEERKIKAQIAKEKEEGEKI"
FT   misc_feature    403893..404051
FT                   /gene="rpoZ"
FT                   /locus_tag="SSU0379"
FT                   /note="HMMPfam hit to PF01192, RNA polymerase Rpb6, score
FT                   2.7e-16"
FT                   /inference="protein motif:HMMPfam:PF01192"
FT   CDS_pept        404364..406754
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="SSU0380"
FT                   /product="putative primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44889"
FT                   /protein_id="CAR44889.1"
FT                   /translation="MLAQIIVDVPLMQTDQAYSYRVPAELEEGLKVGVRVHVPFGKGNR
FT                   LIQGIVVDLIDEDDENSLQDLKELAEVLDYSPVLNQEQFWLADQMRKSVFSYKITLLKS
FT                   MLPSLLNSTYDKLIRPGIGLEMAEQISLFGDKEQIRFSDLDVTEQGKIMRLAQSGKILV
FT                   DYVAKDKKQIKTEKWYRVCLEKLREADISNRAKKRQQLREFLLEQSEDQLLSNLKSDYS
FT                   ADTLRYFQEKGYIEVWEEEVSRTQGVFDKVEKTQALDLNPEQAIAVREIVASIGQESQT
FT                   FLLQGVTGSGKTEVYLQVIDRVLKMGKTAIMLVPEISLTPQMTNRFISRFGQQVAILHS
FT                   GLSDGEKYDEWRKIEAGNAQVVVGARSAIFAPLTNLGVIIIDEEHEATYKQDSNPRYHA
FT                   RDVAKLRADYNRATLVLGSATPSLETRARASRGVYGRLTLNQRANPLARIPEVEVVDFR
FT                   DYIGQQEASNFTPVLIEKIREKLARKEQVVLMLNRRGYSSFVMCRDCGSVDQCPNCDIS
FT                   LTLHMDTKTMNCHYCGFQKGIPQTCPNCQSRSIRYYGTGTQKAYDELQELLPEARILRM
FT                   DVDTTKKKGAHEDLLERFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFR
FT                   SSERTFQLLTQVAGRAGRADKEGEVLIQTYNPNHYAIAFAKEQDYEGFYRYEMDIRKNL
FT                   GYPPYYFTVGLTFSHKSEEFVVKKAYETVAFLRQHLTDAIQILGPTPKPIARTHNLYHY
FT                   QIILKYRHEDRLEEVLNQILDWTQERENQDLRLIIDNEPQNMM"
FT   misc_feature    405132..405632
FT                   /gene="priA"
FT                   /locus_tag="SSU0380"
FT                   /note="HMMPfam hit to PF04851, Restriction endonuclease,
FT                   type I, R subunit/Type III, Res subunit, score 1.3e-30"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    405138..405176
FT                   /note="PS00018 EF-hand calcium-binding domain."
FT                   /inference="protein motif:Prosite:PS00018"
FT   misc_feature    405219..405242
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    406125..406328
FT                   /gene="priA"
FT                   /locus_tag="SSU0380"
FT                   /note="HMMPfam hit to PF00271, DNA/RNA helicase,
FT                   C-terminal, score 7.2e-10"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        406886..407824
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="SSU0381"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44890"
FT                   /protein_id="CAR44890.1"
FT                   /translation="MTKLIFMGTPAFSATVLRGLLADGNYNILAVVTQPDRAVGRKKVI
FT                   QMTPVKEVALEYNLPVYQPEKLSGSQEMDELMNLGADGIVTAAFGQFLPTKLLNSVDFA
FT                   VNVHASLLPKYRGGAPIHYALINGDERAGVTIMEMVKEMDAGDMISSDSIAIEESDNVG
FT                   TLFEKLAVVGRDLLLQTLPAYIAGDLKPVAQNPEQVTFSPNIQPEEEVLDWNKTARQLF
FT                   NQIRGMYPWPVAHTYWQGERFKIQEAVEAEGEGSVGRVIARSKKELIIATGQGALSLKT
FT                   VQPAGKPKMTIADFLNGAGRDIAVGDQFGDQ"
FT   misc_feature    406889..407428
FT                   /gene="fmt"
FT                   /locus_tag="SSU0381"
FT                   /note="HMMPfam hit to PF00551, Formyl transferase,
FT                   N-terminal, score 7.1e-38"
FT                   /inference="protein motif:HMMPfam:PF00551"
FT   misc_feature    407501..407785
FT                   /gene="fmt"
FT                   /locus_tag="SSU0381"
FT                   /note="HMMPfam hit to PF02911, Formyl transferase,
FT                   C-terminal, score 2.7e-34"
FT                   /inference="protein motif:HMMPfam:PF02911"
FT   CDS_pept        407811..409124
FT                   /transl_table=11
FT                   /locus_tag="SSU0382"
FT                   /product="putative ribosomal RNA small subunit
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44892"
FT                   /protein_id="CAR44892.1"
FT                   /translation="MVINKHETARSLALSVLEQVFDQGAYSNIALNKALESSRLSAQDK
FT                   GLATELVYGTVSRKITLEWYLAHFIEDREKLDTWVYYLLMLSLYQLVYLDKLPTHAVVN
FT                   EAVNIAKRKPGTDKFVNAILRKLSQDSLPKPADIKRKNKRLSVQYSVPVWLVQTLIAEY
FT                   GDERAEKIFQSLHDRNKASVRVTDGQQVERLAEELGAQHSQLSPVGLVKPHGHFAGTDY
FT                   FKEGLITIQDETSQLVAPTLDIQGDEIILDACAAPGGKTCHMASYLTDGKVYALDLYDH
FT                   KLNLIEENARRLGLADKIETKGLDASRVHEEFGPDTFDKILVDAPCSGIGLIRRKPDIR
FT                   YNKASMDFDSLKTIQLQILDSVCQSLKIGGIITYSTCTIIAKENQEVIQEFLQNHPNFE
FT                   QVTLEHPQTDIMVDGCLLITPEQYKTDGFFIGQLRRKS"
FT   misc_feature    407829..408203
FT                   /locus_tag="SSU0382"
FT                   /note="HMMPfam hit to PF01029, NusB/RsmB/TIM44, score
FT                   4.1e-35"
FT                   /inference="protein motif:HMMPfam:PF01029"
FT   misc_feature    408477..409112
FT                   /locus_tag="SSU0382"
FT                   /note="HMMPfam hit to PF01189, Bacterial Fmu
FT                   (Sun)/eukaryotic nucleolar NOL1/Nop2p, score 2.3e-49"
FT                   /inference="protein motif:HMMPfam:PF01189"
FT   misc_feature    408762..408797
FT                   /note="PS01153 NOL1/NOP2/sun family signature."
FT                   /inference="protein motif:Prosite:PS01153"
FT   CDS_pept        409162..409899
FT                   /transl_table=11
FT                   /locus_tag="SSU0383"
FT                   /product="putative protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44893"
FT                   /protein_id="CAR44893.1"
FT                   /translation="MEIALLTDVGQKRSNNQDYINRYKNRAGIDLVVLADGMGGHRAGH
FT                   IASEMAATDLGAAWVDTQLVTLNDVREWMVAIIDAENQKIHELGQTEEYKGMGTTLEAV
FT                   VVIDNQMIYAHVGDSRVGLIRDGEYTRLTNDHSLVGALVRAGQLTEEEAQRHPQKNIVT
FT                   QSIGQAEPIEPDIALKTLEVGDYVLINSDGLTNMIPTEDIRDIVLSDVSIESKVETLVR
FT                   FANNAGGLDNITVGLLHITEEAR"
FT   misc_feature    409165..409860
FT                   /locus_tag="SSU0383"
FT                   /note="HMMPfam hit to PF00481, Protein phosphatase 2C,
FT                   N-terminal, score 3.9e-06"
FT                   /inference="protein motif:HMMPfam:PF00481"
FT   CDS_pept        409899..411893
FT                   /transl_table=11
FT                   /locus_tag="SSU0384"
FT                   /product="serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44894"
FT                   /protein_id="CAR44894.1"
FT                   /translation="MIQIGKIFAGRYRIVRQIGRGGMADVYLARDLILDGEEVAVKVLR
FT                   TNYQTDQIAIQRFQREARAMAELDHPNIVRISDIGEEDGQQYLAMEYVNGLDLKRYIKE
FT                   NAPLSNDVAVRIMGQILLAMRMAHTRGIVHRDLKPQNVLLTSNGVAKVTDFGIAVAFAE
FT                   TSLTQTNSMLGSVHYLSPEQARGSKATIQSDIYAMGIILFEMLTGRIPYDGDSAVTIAL
FT                   QHFQKPLPSVREENANVPQALENVVLKATAKKLNERYKSVAEMYADLASALSMDRQNEP
FT                   RVELEGNKVDTKTLPKLSQANVETKVPHTNSSAQVSATDKGSGKKEVAKSGNKPVSKPR
FT                   PGIRTRYKVLIGAILLTVIAAGLMFFNTPRTVTVPDVSGQTVEKATEMIEVAGLEVGNI
FT                   TEEATATVDEGLVIRTSPAAKTTRRQGSKIDIVVATAALASIPDVVDKESDTARQELEA
FT                   LGFQVTIKEEYSEKVAQGLVIKTDPGANSSAEKGAKITLYVSKGVAPQVVPNVVGKSQE
FT                   NATQILQTAGFSIGTITQEYSSSVTAGQVISTDPVANTELAKGSIINLVISKGKELIMP
FT                   DLTSGNYTYSQARSQLQALGVNAESIEKQEDRSYYSTTSDIVIGQYPAAGATIDGTVTL
FT                   YVSVASTRTSSDSSAGSSTSTSTSTGSGQ"
FT   misc_feature    409932..410555
FT                   /locus_tag="SSU0384"
FT                   /note="HMMPfam hit to PF00069, Protein kinase, core, score
FT                   2e-62"
FT                   /inference="protein motif:HMMPfam:PF00069"
FT   misc_feature    409950..410024
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00107"
FT   misc_feature    410292..410330
FT                   /note="PS00108 Serine/Threonine protein kinases active-site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00108"
FT   misc_feature    411012..411203
FT                   /locus_tag="SSU0384"
FT                   /note="HMMPfam hit to PF03793, PASTA, score 1.7e-12"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   misc_feature    411213..411401
FT                   /locus_tag="SSU0384"
FT                   /note="HMMPfam hit to PF03793, PASTA, score 1.7e-15"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   misc_feature    411414..411605
FT                   /locus_tag="SSU0384"
FT                   /note="HMMPfam hit to PF03793, PASTA, score 6.8e-14"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   misc_feature    411615..411815
FT                   /locus_tag="SSU0384"
FT                   /note="HMMPfam hit to PF03793, PASTA, score 8.2e-09"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   repeat_region   411917..412030
FT                   /note="Region similar to ISSs2"
FT   repeat_region   complement(412029..412132)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        412314..413009
FT                   /transl_table=11
FT                   /locus_tag="SSU0386"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44895"
FT                   /protein_id="CAR44895.1"
FT                   /translation="MRKVQFFLLIESMIFTMAAFDVVANEASRTLLLFSALLLVIWYFL
FT                   GRKVNSVLLVSSLSLLFLVFVLNPFFIIGIMLLVVYMLINFFSRYEKRNQYTHIVFSDY
FT                   SLQVQKEKNRWFGNHDHSQDRFGFEDINIVRLFGNDVVDLDKTVLVGRDNIVVIRKTFG
FT                   RTKIIVPIDVEVALSATSIYGRVSFLGESYWDLRNESIAVNSPDYQESHKRVKVVTNNI
FT                   LGDVEVVRV"
FT   sig_peptide     412314..412391
FT                   /locus_tag="SSU0386"
FT                   /note="Signal peptide predicted for SSU0386 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.853) with cleavage site
FT                   probability 0.756 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(412332..412385,412398..412451,412485..412553)
FT                   /locus_tag="SSU0386"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSU0386 by TMHMM2.0 at aa 7-24, 29-46 and 58-80"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        413006..414022
FT                   /transl_table=11
FT                   /locus_tag="SSU0387"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44897"
FT                   /protein_id="CAR44897.1"
FT                   /translation="MRKRTYLLLAWFACLIVFVVIASTLPLLNYSLLDVTLWISTEQLV
FT                   FTLILLVIVLTLFLAVMVQTVSLASTQVMRTKLQAILKNKSIRTDTESDQLLLQLSDKV
FT                   RNLTRQVQLVDNQDLVKKEEIVEGERKRIARDLHDTVSQELFATSMILSGLSSNLSTLP
FT                   QETLQEQLMLVKDMIESAQRDLRILLLHLRPSELESKTLVEGFELILREVSDKSNIIVH
FT                   FQHEVEELPKLIEEHLFRIAQEIISNTLRHAKAKHLDVYLLQKETELQLKMTDDGIGFQ
FT                   QGADDELSYGLQNIRERVEDMAGTIKIRTAPNKGVAIDIRIPLLKGKEDEYDSSDAG"
FT   sig_peptide     413006..413071
FT                   /locus_tag="SSU0387"
FT                   /note="Signal peptide predicted for SSU0387 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.890 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(413024..413092,413135..413203)
FT                   /locus_tag="SSU0387"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0387 by TMHMM2.0 at aa 7-29 and 44-66"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    413390..413596
FT                   /locus_tag="SSU0387"
FT                   /note="HMMPfam hit to PF07730, Histidine kinase,
FT                   dimerisation and phosphoacceptor region, score 1.2e-20"
FT                   /inference="protein motif:HMMPfam:PF07730"
FT   misc_feature    413702..413980
FT                   /locus_tag="SSU0387"
FT                   /note="HMMPfam hit to PF02518, ATP-binding region,
FT                   ATPase-like, score 1.3e-15"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS_pept        413994..414635
FT                   /transl_table=11
FT                   /locus_tag="SSU0388"
FT                   /product="response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44899"
FT                   /protein_id="CAR44899.1"
FT                   /translation="MNTIRVMLVDDHEMVRLGLKSYLNLQPDVEVVAEASDGEEGLAKA
FT                   LEVKPDVVVMDLVMPKMTGVEATLALLKEWPQAQIVILTSYLDNEKIYPVLEAGARGYM
FT                   LKTSSADEILAAIRKVALGEYAIETEVEKKVEHHKRHPDLHDDLTAREREILTLLAKGY
FT                   DNQRIADESFISLKTVKTHVSNILSKLAVSDRTQAVVYAFQHGLVAQEDQ"
FT   misc_feature    414012..414347
FT                   /locus_tag="SSU0388"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver,
FT                   score 2.6e-30"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    414426..414599
FT                   /locus_tag="SSU0388"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   protein, LuxR, score 5.3e-23"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   CDS_pept        414685..416085
FT                   /transl_table=11
FT                   /locus_tag="SSU0389"
FT                   /product="cyclophilin type peptidyl-prolyl cis-trans
FT                   isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44900"
FT                   /protein_id="CAR44900.1"
FT                   /translation="MDAKLRYKAKKIKIVFFDIDDTLRVKNTGYIPESIQQVFKSLKEK
FT                   GILTGIASGRTPYGLVPEIKALKPDFFAMINGSYVEDAKGQVVYHQPMPQNLVESVLNW
FT                   AKEIGIEYGMLSSQKGTLSARTDRISQVIDLIYEGLETKPTFYKENDIYQLLTFEKDGH
FT                   EVELPEELQAELRSVRWDAISSDIVLKGSSKATGVAKVVEKLGLKPENVLVFGDGLNDI
FT                   ELFDYAGISIAMGHSHPELQKHADYITKKVEEDGIFDALEKLGMVEKEKYFPQLDLENV
FT                   TGPVAHIKTNHGKLTVKLFPEIAPKTVANFVALSKDGYYDGIIFHRIIKDFMIQGGDPT
FT                   GTGMGGESIYGTAFEDEFSMEAFNLRGALSMANAGPNTNGSQFFIVQNQNFPYNAKELE
FT                   RGGWPKEVAEAYVKNGGTPYLDQRHTVFGHLVDEESFVVLDAIAAVATDSADCPHEDVV
FT                   IETIEIED"
FT   misc_feature    414727..415467
FT                   /locus_tag="SSU0389"
FT                   /note="HMMPfam hit to PF08282, HAD superfamily
FT                   hydrolase-like, type 3, score 5.5e-71"
FT                   /inference="protein motif:HMMPfam:PF08282"
FT   misc_feature    415327..415395
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT                   /inference="protein motif:Prosite:PS01229"
FT   misc_feature    415537..416076
FT                   /locus_tag="SSU0389"
FT                   /note="HMMPfam hit to PF00160, Peptidyl-prolyl cis-trans
FT                   isomerase, cyclophilin-type, score 1.8e-52"
FT                   /inference="protein motif:HMMPfam:PF00160"
FT   CDS_pept        416087..416458
FT                   /transl_table=11
FT                   /locus_tag="SSU0390"
FT                   /product="putative S1 RNA binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44902"
FT                   /protein_id="CAR44902.1"
FT                   /translation="MKIGDKLKGTVTGIQPYGAFVQLENGTTGLIHISEIKTGFVDNIY
FT                   DHLKLGQEVLVQVVDFDEYTEKASLSIRTLEEEQQKIPCHHRFTNERNKIGFSPLAKQL
FT                   PKWIEEAKGYLKEHKEKKV"
FT   misc_feature    416090..416305
FT                   /locus_tag="SSU0390"
FT                   /note="HMMPfam hit to PF00575, S1, RNA binding, score
FT                   1.5e-19"
FT                   /inference="protein motif:HMMPfam:PF00575"
FT   CDS_pept        complement(416484..417410)
FT                   /transl_table=11
FT                   /gene="cysM"
FT                   /locus_tag="SSU0391"
FT                   /product="putative cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44903"
FT                   /protein_id="CAR44903.1"
FT                   /translation="MAIYQNITQLVGKTPVIKLNNIVPEGAAEVYVKLEAFNPGSSVKD
FT                   RIALAMIEDAEKAGTIKPGDTIVEPTSGNTGIGLAWVGAAKGYNVIIVMPETMSVERRK
FT                   IIQAYGAELVLTPGSEGMKGAIAKAKEIAEEKNGWVPFQFANPSNPKVHEDTTGQEILE
FT                   DFGTTGLDAFVSGVGTGGTVSGVSHVLKTANPDIAIYAVEADESAVLSGEAPGPHKIQG
FT                   ISAGFIPDTLDTSAYDGIIRVKSDDALATGRAIGGKEGFLVGISSGAAIHAAIEVAKEL
FT                   GTGKKVLAILPDNGERYLSTALYEFND"
FT   misc_feature    complement(416529..417392)
FT                   /gene="cysM"
FT                   /locus_tag="SSU0391"
FT                   /note="HMMPfam hit to PF00291, Pyridoxal
FT                   phosphate-dependent enzyme, beta subunit, score 6.5e-115"
FT                   /inference="protein motif:HMMPfam:PF00291"
FT   misc_feature    complement(417258..417314)
FT                   /note="PS00901 Cysteine synthase/cystathionine
FT                   beta-synthase P-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00901"
FT   CDS_pept        complement(417500..418138)
FT                   /transl_table=11
FT                   /locus_tag="SSU0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44906"
FT                   /protein_id="CAR44906.1"
FT                   /translation="MVMKEFKTIREDGIVEEEIKKSRFICFMKRVTSEEEARDFINKIK
FT                   KEHYKATHNCSAFVLGENMEIKRSSDDGEPSGTAGVPMLTVLENHELTNVATVVTRYFG
FT                   GIKLGAGGLIRAYAGAVANAVKEIGVVEVKEQEGISLSMSYAQYQEFANWRAEQGLEEF
FT                   DTQFTTEVSTMIFVDKEFLEQTLASLTDFYHGKVSTEKANSRIVEVPVY"
FT   misc_feature    complement(417761..418084)
FT                   /locus_tag="SSU0392"
FT                   /note="HMMPfam hit to PF01205, Protein of unknown function
FT                   UPF0029, N-terminal, score 2.8e-60"
FT                   /inference="protein motif:HMMPfam:PF01205"
FT   misc_feature    complement(417812..417901)
FT                   /note="PS00910 Uncharacterized protein family UPF0029
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00910"
FT   CDS_pept        418189..419481
FT                   /transl_table=11
FT                   /gene="comFA"
FT                   /locus_tag="SSU0393"
FT                   /product="putative late competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44907"
FT                   /protein_id="CAR44907.1"
FT                   /translation="MKELENYYGRLFTKYQLTAKEREIAEKVPSITKKNNCFRCGTTFE
FT                   EENKLPNDAYYCRACLLLGRVRSDEKLYHFPQKDFPITKCLKWKGQLTDWQQRISDGLV
FT                   ANVENNRATLVHAVTGAGKTEMIYHTVASVIDKGGAVCLASPRIDVCIELYKRLQNDFS
FT                   VPISLLHGESEPYFRTPLVVATTHQLLKFYQAFDLVLIDEVDAFPYADNPMLYRAADNA
FT                   VKEAGVQVFLTATSTDELDKKVRTGKLSRLSLPRRFHGNPLVVPQKVWFSKFDDTLKKN
FT                   RLVPKLKKAIEEQRKSCFPLLIFVPEISKGQEFTKIMKKTFPEETIGFVSSQTENRLEI
FT                   VEGFRKREITVLISTTILERGVTFPCVDVFVVQANHYLYTVSSLVQIAGRVGRSMERPT
FT                   GLLQFYHEGSTGAIEKAVAEIKQMNKEAGYV"
FT   misc_feature    418453..418902
FT                   /gene="comFA"
FT                   /locus_tag="SSU0393"
FT                   /note="HMMPfam hit to PF04851, Restriction endonuclease,
FT                   type I, R subunit/Type III, Res subunit, score 1.9e-05"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    418537..418560
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    419143..419373
FT                   /gene="comFA"
FT                   /locus_tag="SSU0393"
FT                   /note="HMMPfam hit to PF00271, DNA/RNA helicase,
FT                   C-terminal, score 8.6e-11"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        419474..420139
FT                   /transl_table=11
FT                   /gene="comFC"
FT                   /locus_tag="SSU0394"
FT                   /product="putative late competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44908"
FT                   /protein_id="CAR44908.1"
FT                   /translation="MSNCLLCGQAMKNKTRFSDLIFFSKEKSGICEECFSTFEEIAEQH
FT                   CPHCYKNGESESCKDCQYWQNQGKPVVHTALYQYNQAMAHYFSRYKFQGDYVLRNIFAK
FT                   KLRIALSQFPDYTIVPIPISQKRLSERGFNQVEGLLDATNIPYQSLLGKYESQKQSSKN
FT                   RAERLEAKQMFYLLDEKEVPEKILLFDDIYTTGATIQLAVELFMKIGRKEIKTFSLTR"
FT   CDS_pept        420216..420758
FT                   /transl_table=11
FT                   /locus_tag="SSU0395"
FT                   /product="sigma 54 modulation protein / S30EA ribosomal
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44909"
FT                   /protein_id="CAR44909.1"
FT                   /translation="MIKFSIRGENLEVTEALRTYVEEKVAKIEKYFNEEQELNAKVNLK
FT                   VYRDKRAKVEVTIPVGAVTLRAEDISQEMYGSIDLVVDKIERQIRRNKTKIERKHRQKV
FT                   ATGQVFTDELVEQTGEEVKVVRTKQVDLKPMDMEEAVLQLELLGHDFFIYTDANDGTTN
FT                   VLYRREDGDLGLLEVRQ"
FT   misc_feature    420222..420512
FT                   /locus_tag="SSU0395"
FT                   /note="HMMPfam hit to PF02482, Ribosomal protein
FT                   S30Ae/sigma 54 modulation protein, score 1.8e-30"
FT                   /inference="protein motif:HMMPfam:PF02482"
FT   rRNA            421096..422639
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            422691..422763
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:422724..422726,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            423043..425947
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            426025..426153
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            426154..426226
FT                   /gene="tRNA-Val"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:426187..426189,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 68.42"
FT   tRNA            426229..426301
FT                   /gene="tRNA-Asp"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:426262..426264,aa:Asp)"
FT                   /note="tRNA Asp anticodon GTC, Cove score 82.91"
FT   tRNA            426347..426419
FT                   /gene="tRNA-Lys"
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:426380..426382,aa:Lys)"
FT                   /note="tRNA Lys anticodon TTT, Cove score 81.85"
FT   tRNA            426423..426504
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:426457..426459,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAG, Cove score 45.48"
FT   tRNA            426519..426591
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:426552..426554,aa:Thr)"
FT                   /note="tRNA Thr anticodon TGT, Cove score 71.26"
FT   tRNA            426604..426675
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:426636..426638,aa:Gly)"
FT                   /note="tRNA Gly anticodon GCC, Cove score 77.41"
FT   tRNA            426683..426766
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:426717..426719,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAA, Cove score 51.48"
FT   tRNA            426785..426858
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:426819..426821,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 72.48"
FT   tRNA            426906..426979
FT                   /gene="tRNA-Pro"
FT                   /product="transfer RNA-Pro"
FT                   /anticodon="(pos:426940..426942,aa:Pro)"
FT                   /note="tRNA Pro anticodon TGG, Cove score 61.18"
FT   CDS_pept        complement(427536..428888)
FT                   /transl_table=11
FT                   /locus_tag="SSU0396"
FT                   /product="putative RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44912"
FT                   /protein_id="CAR44912.1"
FT                   /translation="MNLQVNQRIPLKIKRMGINGEGIGFYQKTLVFVPGVLKGEEIFCQ
FT                   ITSVKRNFVEAKLLKINKESKFRVKPACDIYRACGGCQIMHLRYDKQLDFKQDLLQQAL
FT                   KKFKPAGYENYTIYPTIGMDKPSHYRAKLQFQTRSFKDQVKAGLYAENSHRLIGITNCY
FT                   VQDAETQEIINGIAKLLTKHRIPIYNERKQHGIRTVMVRKARKTGQVQVIFITSCQVNL
FT                   IKLIDELTSQFPSIITIALNWNRQKTSDIYGEKTEILWGEQAIDEAVLDYEFSLSPRAF
FT                   YQLNPQQTEILYGEAVKALDISGDEDLIDAYCGVGTIGFAFAKKVKSVRGMDIIPEAIE
FT                   DAKANAKRMGLSNTHYEAGKAEEIIPKWYQEGYRADALVVDPPRTGLDEKLLKTILNYK
FT                   PAKMVYVSCNVSTLARDLVELSKAYKVEYIQSVDMFPHTARTEAVVKLSKK"
FT   misc_feature    complement(427539..428627)
FT                   /locus_tag="SSU0396"
FT                   /note="HMMPfam hit to PF05958,
FT                   (Uracil-5)-methyltransferase, score 1.3e-06"
FT                   /inference="protein motif:HMMPfam:PF05958"
FT   misc_feature    complement(427653..427748)
FT                   /note="PS01230 RNA methyltransferase trmA family signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS01230"
FT   misc_feature    complement(428709..428885)
FT                   /locus_tag="SSU0396"
FT                   /note="HMMPfam hit to PF01938, Deoxyribonuclease/rho
FT                   motif-related TRAM, score 2.1e-07"
FT                   /inference="protein motif:HMMPfam:PF01938"
FT   CDS_pept        428926..429702
FT                   /transl_table=11
FT                   /locus_tag="SSU0397"
FT                   /product="RecX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44913"
FT                   /protein_id="CAR44913.1"
FT                   /translation="MRITKIEKKKRLYLLEVDGQDSLYITEDTIVRFMLSKGKEITEQE
FT                   FRELRDFAQFSYGKNLALYYLSFKQRTKKEVSNYLKKYEIEENNIVKIVTVLEEEKWLD
FT                   DGNYVDSYVRQNALNGDKGPAMIRQKLMQKGIPKTLIDKRLAEEDFSELAGKIGEKLVG
FT                   RYQRKLPLRALQDKVVQGLMGKGFSYEAAKQSLGQLELVADEENEDDLIAKELDKQYRK
FT                   YSRKYEGYELKQRLIQALARKGYDFDRIQAVLRDYL"
FT   misc_feature    429163..429543
FT                   /locus_tag="SSU0397"
FT                   /note="HMMPfam hit to PF02631, Regulatory protein RecX,
FT                   score 9.5e-09"
FT                   /inference="protein motif:HMMPfam:PF02631"
FT   CDS_pept        429778..430311
FT                   /transl_table=11
FT                   /locus_tag="SSU0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44916"
FT                   /protein_id="CAR44916.1"
FT                   /translation="MKLPKEGDFITIQSYKHDGEIHRTWRDTMVLKTTENAIIGVNNHT
FT                   LVTENDGRRWVTREPAIVYFHKKYWFNIIAMIRENGVSYYCNLASPYVLDNEALKYIDY
FT                   DLDVKVFADGEKRLLDVDEYERHRKAMKYSDDIDFILKENVKILVDWINNQRGPFSPAY
FT                   VNIWYKRYLELRSR"
FT   misc_feature    429886..430179
FT                   /locus_tag="SSU0398"
FT                   /note="HMMPfam hit to PF04167, Protein of unknown function
FT                   DUF402, score 6.8e-41"
FT                   /inference="protein motif:HMMPfam:PF04167"
FT   CDS_pept        430369..430686
FT                   /transl_table=11
FT                   /locus_tag="SSU0399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44917"
FT                   /protein_id="CAR44917.1"
FT                   /translation="MAFEQTNGRYASFGVVTSLPGEVIDSFWYVIDHYLKGVIPLKSVI
FT                   RFSIKNRRGKITLVFSQEGYKNVLAVDLSSRFDPFYPSTILVMDKQGKETITLPDEVTL
FT                   L"
FT   CDS_pept        430786..431517
FT                   /transl_table=11
FT                   /locus_tag="SSU0400"
FT                   /product="GntR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44920"
FT                   /protein_id="CAR44920.1"
FT                   /translation="MVSQTVEKPLYLQLVDELEVAIRERMAPNDKLFSERELTQVYGVS
FT                   RITVRLALQELEKRGLVYKKHGKGTYVSEISDTAVDLSQAYSFTEQMKKIGKVPRTSIL
FT                   SFELVKASDYIAQHLQLSQGEEVFEVERLRLADEIPMMLERTYVPASVFPGLAAQRMKS
FT                   TPLYEIFSEDYHQVIRLAEEEFYASIALDNEAKILGIPSNSPVLHLVRKTYNDKNRIIE
FT                   FTFSIARADQFRYKITHQRGY"
FT   misc_feature    430813..431001
FT                   /locus_tag="SSU0400"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory protein
FT                   GntR, HTH, score 7.5e-18"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    430882..430947
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1087.000, SD 2.89 at aa 33-54, sequence
FT                   FSERELTQVYGVSRITVRLALQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    431065..431487
FT                   /locus_tag="SSU0400"
FT                   /note="HMMPfam hit to PF07702, UbiC transcription
FT                   regulator-associated, score 3.6e-51"
FT                   /inference="protein motif:HMMPfam:PF07702"
FT   repeat_region   complement(431522..431613)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        complement(431657..432367)
FT                   /transl_table=11
FT                   /locus_tag="SSU0401"
FT                   /product="GntR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44923"
FT                   /protein_id="CAR44923.1"
FT                   /translation="MKVPKYQLIQNDLRQQIVSGKFENGDKFYTESELTKLFNVSSITV
FT                   IRAVNELVKDGYLVRQQGKGTFVSRSRKGRLVEFSDIEIFPMDKDKVTVLSCEKGNKPD
FT                   ILEKLNLDKNEFYYKIVRVRAAEDTPYIFHNSYIPQRYIQNPDAPLEHYQSIYQRFKLD
FT                   YNIHMSEEPFVETNEIVSPCPKEVATHLKLKATEPAVLQNKTTTNSTSGEVMEYTETYK
FT                   HWKYYKFEITANHR"
FT   misc_feature    complement(431684..432088)
FT                   /locus_tag="SSU0401"
FT                   /note="HMMPfam hit to PF07702, UbiC transcription
FT                   regulator-associated, score 6.7e-16"
FT                   /inference="protein motif:HMMPfam:PF07702"
FT   misc_feature    complement(432164..432355)
FT                   /locus_tag="SSU0401"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory protein
FT                   GntR, HTH, score 2.2e-14"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    complement(432212..432259)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    complement(432218..432283)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1054.000, SD 2.78 at aa 29-50, sequence
FT                   YTESELTKLFNVSSITVIRAVN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        432574..434346
FT                   /transl_table=11
FT                   /locus_tag="SSU0402"
FT                   /product="putative beta-galactosidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44926"
FT                   /protein_id="CAR44926.1"
FT                   /translation="MKEFYIGDQFYLDGEPFKILSGAIHYFRVHPDDWYHSLYNLKALG
FT                   FNTVETYVPWNMHEPRKGEFCYEGILDIERFLKLAQELGLYAIVRPSPYICAEWEWGGL
FT                   PAWLMKEELRVRSSDSVYLQHLDEYYVSLIPKLAKLQLAQGGNVLMFQVENEYGSYGEE
FT                   KAYLRAVAGLMRKHGLTAPLFTSDGSWRATLRAGTLIEDDVFVTGNFGSKARENFANMT
FT                   AFFNEHQKNWPLMCMEFWDGWFNRWGDEIIRREPEEMVDSVMECIELGSLNLYMFHGGT
FT                   NFGFMNGCSARGQIDLPQVTSYDYDAILDEAGNPTKKFYILQQRLKEVYPELEYAEPLV
FT                   KEAKAFSDVSLHDKVSLFATLENVSDCVKGFYPKNMEELDQSTGYILYRTELERDKTEA
FT                   ERFRVVDARDRIQIYADGKFVATQYQTEIGDDVELDFKDDKLTLDILVENMGRVNYGHK
FT                   LTAPTQSKGIGRGAMADLHFIGHWETYPLHLESVEDLDFSKGWEEGQAAFYRYQFELDE
FT                   LADTYLDMTGFGKGVVFVNNVNIGRFWEKGPILYLYIPKGYLKKGANEIVVFETEGKYR
FT                   EKIHFSQRPVIKDL"
FT   misc_feature    432598..433560
FT                   /locus_tag="SSU0402"
FT                   /note="HMMPfam hit to PF01301, Glycoside hydrolase, family
FT                   35, score 1.5e-177"
FT                   /inference="protein motif:HMMPfam:PF01301"
FT   CDS_pept        434400..434885
FT                   /transl_table=11
FT                   /locus_tag="SSU0403"
FT                   /product="sugar phosphotransferase system (PTS), sorbose
FT                   subfamily, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44927"
FT                   /protein_id="CAR44927.1"
FT                   /translation="MAIIATRIDGRLIHGQVANLWTTKLNIGRIMVIDDAVAQNDIEKQ
FT                   GLKLACPPGVKLSILPIEKAANNIKEGKYDSQRLLIVARRPENFLRLVEYGVELAELNV
FT                   GNMSQTPETRSVTRSINVVDKDIADFDALAAKGVKLFAQMVPGDSPKDFMPLLDKVR"
FT   misc_feature    434403..434855
FT                   /locus_tag="SSU0403"
FT                   /note="HMMPfam hit to PF03830, Phosphotransferase system,
FT                   sorbose subfamily IIB component, score 2.9e-74"
FT                   /inference="protein motif:HMMPfam:PF03830"
FT   CDS_pept        434927..435826
FT                   /transl_table=11
FT                   /locus_tag="SSU0404"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   sorbose-specific family, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44929"
FT                   /protein_id="CAR44929.1"
FT                   /translation="MQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLIMGNME
FT                   VGLLIGASLQLVVLGVGTFGGASRIDATSGAVLATAFSISQGLDPEIAISTIGVPVAGL
FT                   LVYTDILGRFTTTFFAHRVDAAIERFDYAGIERNYLLGAIPWALSRALPVFLALAFGGG
FT                   LVETLVTTIELPEYKWIAAGLTLAARMLPGLGFAILLHYLPLKRNLHYLAVGFALTAML
FT                   TVLYGNVSALGGAVAGIVGTLPEDAGVSFVNNFKGLSMIGIAIVGAFLSVIHFKNSQKV
FT                   TVVAPSNSESGEIEDDEI"
FT   misc_feature    434927..435646
FT                   /locus_tag="SSU0404"
FT                   /note="HMMPfam hit to PF03609, Phosphotransferase system,
FT                   sorbose-specific IIC subunit, score 1.1e-09"
FT                   /inference="protein motif:HMMPfam:PF03609"
FT   misc_feature    join(434984..435043,435062..435130,435200..435268,
FT                   435365..435433,435461..435529,435566..435634,
FT                   435677..435745)
FT                   /locus_tag="SSU0404"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SSU0404 by TMHMM2.0 at aa 20-39, 46-68, 92-114, 147-169,
FT                   179-201, 214-236 and 251-273"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        435813..436631
FT                   /transl_table=11
FT                   /locus_tag="SSU0405"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   mannose/fructose/sorbose family, IID component"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44931"
FT                   /protein_id="CAR44931.1"
FT                   /translation="MTKSNYKLTKEDFNQINKRSLFTFQLGWNYERMQASGYLYMILPQ
FT                   LRKMYGDGTPELKEMMKLHTQFFNTSPFFHTIITGIDLALEESDGVASKDAVNGVKTGL
FT                   MGPFAPIGDSIFGSLVPAIMGTVAATMGKEGSPVGIFLWVAVAIAYDIFRWKQLEVAYK
FT                   EGTKLITTMRDRLTALVDAASVMGVFMMGALIATMINFEVTWAPAIGEKVIDIQDILNT
FT                   IFPRLVPAIFTGFVFWLLGRRGMTSTKAILIIIVLALGFSAIGHFLFGMV"
FT   misc_feature    435828..436613
FT                   /locus_tag="SSU0405"
FT                   /note="HMMPfam hit to PF03613, Phosphotransferase system,
FT                   mannose/fructose/sorbose family IID component, score
FT                   5.1e-119"
FT                   /inference="protein motif:HMMPfam:PF03613"
FT   misc_feature    join(436341..436409,436467..436535,436554..436622)
FT                   /locus_tag="SSU0405"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSU0405 by TMHMM2.0 at aa 177-199, 219-241 and 248-270"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        436631..437032
FT                   /transl_table=11
FT                   /locus_tag="SSU0406"
FT                   /product="sugar phosphotransferase system (PTS), fructose
FT                   family, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44933"
FT                   /protein_id="CAR44933.1"
FT                   /translation="MVRSLVLVSHGIFCEELKKSTEMIMGPQEDIYTVALLPEEGPEDF
FT                   QKKFEETIAGLEDFVVFADLLGGTPANVVSRKLIEGGQFDLYAGMNMPMVIGFLNGVLL
FT                   GEAVDYVEFGTSNLVHVNSLLTSDEDDDE"
FT   misc_feature    436637..436966
FT                   /locus_tag="SSU0406"
FT                   /note="HMMPfam hit to PF03610, Phosphotransferase system,
FT                   fructose subfamily IIA component, score 1.2e-25"
FT                   /inference="protein motif:HMMPfam:PF03610"
FT   CDS_pept        437248..438249
FT                   /transl_table=11
FT                   /locus_tag="SSU0407"
FT                   /product="putative aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44936"
FT                   /protein_id="CAR44936.1"
FT                   /translation="MIEVKTFDEKAKLYCLENKNGMQVTLTDFGARVVEVLLPVEENGG
FT                   LRNVSLAAKSDDDYRKTDLYPGSTIVPVAGRISGAQAEIEGTSYHFTENEPGRTLHGGV
FT                   DTANEQYWDVELDHERNQVTFGMVLKDGFNGFPGDVRVKAIYCLTDKNELTVDYQAVSD
FT                   KDTIFNPTNHIYFNLTGDFQRSVAEHRIKIAANHYAPLGEDNLPTGVLEDVTGTPFDFR
FT                   DFAPFAQGFDSQYPQNVLVKGYDHPWLLEEVDIPVEVLSPDGKIGLSVKTNQPAVVIYT
FT                   YNFPVEALACYHGVFSLECQALPNACNVDGFGSILLEQGEEFLSKTTYRFTW"
FT   misc_feature    437281..438237
FT                   /locus_tag="SSU0407"
FT                   /note="HMMPfam hit to PF01263, Aldose 1-epimerase, score
FT                   2.2e-82"
FT                   /inference="protein motif:HMMPfam:PF01263"
FT   misc_feature    437752..437781
FT                   /note="PS00545 Aldose 1-epimerase putative active site."
FT                   /inference="protein motif:Prosite:PS00545"
FT   CDS_pept        438359..438613
FT                   /transl_table=11
FT                   /locus_tag="SSU0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44938"
FT                   /protein_id="CAR44938.1"
FT                   /translation="MTKEQEFLKEFEAWVNTQVMVNEMAVEESRRVLEEDKDERAADAY
FT                   IRYESKLDAYRFIQGKFANYHAGKGFHDLPDELFGQRHY"
FT   misc_feature    438359..438610
FT                   /locus_tag="SSU0408"
FT                   /note="HMMPfam hit to PF08930, Protein of unknown function
FT                   DUF1912, score 8.6e-61"
FT                   /inference="protein motif:HMMPfam:PF08930"
FT   CDS_pept        438628..439014
FT                   /transl_table=11
FT                   /locus_tag="SSU0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44940"
FT                   /protein_id="CAR44940.1"
FT                   /translation="MAKKKVNRKKQLKKQLADLKRAGRVGLERAAEVVETVAHKAEAVV
FT                   ERTVEQVKEVVAEVTSSATSLEDFLALPELEGIAAARLETFYEAGIQSVADFANHTEKE
FT                   LLALKGIGPATIKQLKEKGIELKA"
FT   CDS_pept        439256..439645
FT                   /transl_table=11
FT                   /locus_tag="SSU0410"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44942"
FT                   /protein_id="CAR44942.1"
FT                   /translation="MLHHVEIYVSDLETSRAFYDFLLTKLGYSLYQEWDKGLSYKKAEQ
FT                   YLVFVQTPEDFLEVGYHRCRTGLNHLAFHAGTPDEIDQWRKEFLTRRVKLLYDDRYPHA
FT                   GGPDHYALYLEDPDGIKIELVGEGV"
FT   misc_feature    439256..439627
FT                   /locus_tag="SSU0410"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/bleomycin
FT                   resistance protein/dioxygenase, score 0.00029"
FT                   /inference="protein motif:HMMPfam:PF00903"
FT   CDS_pept        439642..440217
FT                   /transl_table=11
FT                   /locus_tag="SSU0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44945"
FT                   /protein_id="CAR44945.1"
FT                   /translation="MNLIIIGAQASGKMTVGQEVAKLTGMTLFHNHDSIDFSLRFIPEF
FT                   SEDMFDLNTRITFAVYDVFARSGRPLIGTALINFKNLIEVQFLTTVQTIFHHHGQEILF
FT                   VELETALEERLRRNRTENRLTHKPLKRHIEVSEAEILSTADTCRYTSLGIPEGIQHYLK
FT                   INNTHLSANDVAQLIIQKMEELEQEQTK"
FT   CDS_pept        440332..442983
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="SSU0412"
FT                   /product="valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44947"
FT                   /protein_id="CAR44947.1"
FT                   /translation="MSKELSPKYNPAEVEAGRYQTWLDQDVFKPSGDAEAKPYSIVIPP
FT                   PNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGVT
FT                   RYDLGREKFLDKVWEWKDEYAATIREQWGKLGLSLDYQRDRFTLDEGLSKAVRKVFVEL
FT                   YKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPE
FT                   TMFGDVAVAVNPEDPRYKDLIGKNVILPIVNKPIPIVADEHADPEFGTGVVKITPAHDP
FT                   NDFLVGQRHNLPQVNVMNDDGTMNELAGEFAGMDRFEARKATVAKLQELGALVEIENRV
FT                   HSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTADKVEFYPPRFNDTFLQWMEN
FT                   VHDWVISRQLWWGHQIPAWYNESGEMYVGEEAPAGDGWVQDEDVLDTWFSSALWPFSTM
FT                   GWPDENAADFQRYFPTSTLVTGYDIIPFWVSRMIFQGIEFTGKSPFKNALIHGLIRDEE
FT                   GRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWN
FT                   ISRYILMNNEGLTLDAARENVAKVAAGEAGNVTDRWILHNLNETIAKVTENFDKFEFGV
FT                   AGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVMTRSVLLYTLDQILRLLHPIMPFVT
FT                   EEIFAQYAEGSIVVAAYPVVNPAFENAEAHKGVESLKDLIRSVRNSRAEVNVAPSKPIT
FT                   ILIKTADSELETFFKANENYIRRFTNPEQLEISSSIAAPELAMSAVITGAEIFLPLADL
FT                   LNVEEELARLDKELVKWQKELDMVGKKLSNERFIANAKPEVVEKEKEKQADYQAKYDAT
FT                   VARIEEMKKLVK"
FT   misc_feature    440380..442011
FT                   /gene="valS"
FT                   /locus_tag="SSU0412"
FT                   /note="HMMPfam hit to PF00133, Aminoacyl-tRNA synthetase,
FT                   class Ia, score 0"
FT                   /inference="protein motif:HMMPfam:PF00133"
FT   misc_feature    440467..440502
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00178"
FT   misc_feature    441814..441837
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    442159..442602
FT                   /gene="valS"
FT                   /locus_tag="SSU0412"
FT                   /note="HMMPfam hit to PF08264, Valyl/Leucyl/Isoleucyl-tRNA
FT                   synthetase, class I, anticodon-binding, score 3e-63"
FT                   /inference="protein motif:HMMPfam:PF08264"
FT   CDS_pept        443061..445844
FT                   /transl_table=11
FT                   /locus_tag="SSU0413"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44948"
FT                   /protein_id="CAR44948.1"
FT                   /translation="MMIILICLSLFIISRTMNGFRLFLDSTIIIGFICLFFYYCCFDLI
FT                   FISLTNLVLILILLVYSFSDILFGIRIIGLSIPFIRSIVLKYIDCKGFLQNKIRNHLVE
FT                   IREIILVTFLFLIFGVQVQLQLPYINFTNYSLIEILGFDIAIFSLYGIYVAFLQFLTEN
FT                   DKVYYLGVSKIRFMLDNSVWSQLTRAKLFHIILLVSVLIPLFSKSNIEFNYQLQNIEYL
FT                   WQTCYIISIVVYIFLLKLSISIVYGVFRLNLENVSKTVKKEDVKEKDSRHKEKIFNRFG
FT                   ITDKINISVQRSFKDEFWKIYKNQNQYRDDYIKVRLQERITLVEKADRDELIFTIFGRE
FT                   NWENYNLSESIFVFIENIDSDEGKQFFRFYKNFCIHKWNFLRDYQTDISPRTWVKLVEQ
FT                   DILIFDKLVKSDSTFNIFKIEFSDNAISRNLNLEKNKKIKEFLFELLLDKEGVNLDDVL
FT                   ISIKKEIQRFSQNKSDQFYRYTYDFLKFRLVTILDKYENDDVNINLPEYKSLSDAFQNG
FT                   QRNDYENSMLYSKICFNYLDRGRIEDFSHTKVEADDSKEREKQKLKAQKIQGLILSMNE
FT                   EYRMAFMLYQLFYTDRTQWDENLAFYDNNIQSIMKHGKQYHGYLFDQVKNIILSETDID
FT                   HRITESFLDKIWETKNETIMDFSWFDQFGDQHQMSNFKILYVQWILSGATTSYLKSRIN
FT                   FERGFPIKVRNSLVGKIKGKENRKMSVKDLKWRIRRKEERIGHLCRDYLLLTDQLTTIF
FT                   TKVPSDKHNLQISVEYLLHSGKVNLSDVIDNISVTSLLRLEWLLRWNYYHYHRESNYTS
FT                   RTFFDEMTSNDRYYWSAGRGILEFFIAKIVDNFYRDLYQDKEFMAGFKYHLESQLNSLN
FT                   KTVEEYVELIAERVSGIDNLSILQKGQIISKLNYILFGQDNNIKIRQKENIAINKF"
FT   misc_feature    join(443118..443186,443190..443249,443259..443315,
FT                   443364..443432,443475..443543,443739..443807)
FT                   /locus_tag="SSU0413"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0413 by TMHMM2.0 at aa 20-42, 44-63, 67-85, 102-124,
FT                   139-161 and 227-249"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        445916..445990
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0414"
FT                   /product="putative valine-tRNA ligase (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus pyogenes (serotype M3) putative
FT                   valine-tRNA ligase ValS UniProt:Q8K6M9 (EMBL:AE014161) (882
FT                   aa) fasta scores: E()=3.6e-05, 91.667% id in 24 aa"
FT   CDS_pept        446071..446877
FT                   /transl_table=11
FT                   /locus_tag="SSU0415"
FT                   /product="Fic protein family"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44952"
FT                   /protein_id="CAR44952.1"
FT                   /translation="MQPTYNIDNPNLSYEAKQELWETGFGLQKVDGLTPSVYMEELAER
FT                   QARGEYTYEQVYEEITKYHQSTDASTQEADIVSLRIVEMLSQNGFSLRPTTLLHIHKEL
FT                   FHDIFDSSIPVVEYRTVNITKNELVLKGDTVIYSDFPLIAATLDYDFQQERDFSYARLD
FT                   KKAIVAHIQSFISGVWQIHPFREGNTRTITVFLIKYLRSLGFEIDNEPFQKHAKYFRDA
FT                   LVLDNAKLVNKRSDFLTAFFENLLLNGQNDLSSERMYEELGLDEYQ"
FT   misc_feature    446359..446745
FT                   /locus_tag="SSU0415"
FT                   /note="HMMPfam hit to PF02661, Filamentation induced by
FT                   cAMP protein Fic, score 3.3e-11"
FT                   /inference="protein motif:HMMPfam:PF02661"
FT   misc_feature    446677..446706
FT                   /note="PS00659 Glycosyl hydrolases family 5 signature."
FT                   /inference="protein motif:Prosite:PS00659"
FT   CDS_pept        446972..449680
FT                   /transl_table=11
FT                   /locus_tag="SSU0416"
FT                   /product="DEAD/DEAH box family helicase"
FT                   /product="helicase, putative"
FT                   /note="C-terminal region is similar to Streptococcus
FT                   pneumoniae putative helicase UniProt:Q97S40 (EMBL:AE007367)
FT                   (548 aa) fasta scores: E()=1.3e-110, 55.657% id in 548 aa.
FT                   Full length CDS is similar to Bacteroides fragilis probable
FT                   helicase UniProt:Q64S40 (EMBL:AP006841) (970 aa) fasta
FT                   scores: E()=4.9e-64, 36.773% id in 911 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44953"
FT                   /protein_id="CAR44953.1"
FT                   /translation="MSYYYEKLTGKVAKHLARFPYYATDKILNLMQFQDNNQQFLISDK
FT                   HLYDYFEEQKHQLSTDEKLSILFNLFKGRIDVYAKSYIDENGKINYFPSYNYGWKKRPV
FT                   EKRTCQPLTKQVLLAHLRGEISIGIFPMSLSDTCSFLAIDFDKNNWREEVSILRDTAEQ
FT                   HGFEGHIEISRSGNGAHLWFFFEEEIACQQARNVGKRLLELAMQESKDIRFSSFDRMFP
FT                   NQDILPKGGFGNLIALPLQGEAFKKGRTVFVDKHFQPFSEQWTYLQQVQKIGQKKILDF
FT                   LGQEFSDTVDDTVLDCSLSNVIRVEKRAISSKTNYLLRKLASFPNPEFYLKQATRQPTY
FT                   QTPERIYLFEETNEALHLPRGILAKLQEIFETVTIRDNRNSLSPIQISFKGRLRFEQEL
FT                   ALADLLASENGLLCAETGFGKTVLGAALIAQRKCRTIILVHNRQLLEQWLERLGEFLEI
FT                   EEEEAVRYTPSGRVKVIGHIGQYGASKKWRSKLVDVVMIQSLFQLDVISDFLSDYDMMI
FT                   VDECHHVTALQFEKVVAQFASQYLYGLTATPECKNGHQPIVFQRIGPILHTAQSGQYDF
FT                   KKRLLLHLTSFGKLDLEQSNSTNFASLNDWLAKDLHRNTLIVQDIFKLYQEKRNILVLV
FT                   NRREHIELLEKLLIEKEMPNIFCLSGASKRRDTKELLKRISELDENSPFVLISTGKFIG
FT                   EGFDMPKLDTLILAAPLSWKNNLIQYAGRLHRPYQGKTEVRIVDYLDIHVPYLERMYQK
FT                   RQIAYRKMAYQVGEKEQTQVLFSGRDYEEKFREDLRNTRSTVYLQLHSFTSSRIQELLG
FT                   LLRGKQVVIHVSKNHKLSEWLMGLNSDNVKVKLVPERIGTTAVILDSNLVWYGNLSPFT
FT                   YQSDDQASLLRLESQSIATELLEKFENSNIK"
FT   misc_feature    447392..447736
FT                   /locus_tag="SSU0416"
FT                   /note="HMMPfam hit to PF01896, DNA primase, small subunit,
FT                   score 8.5e-06"
FT                   /inference="protein motif:HMMPfam:PF01896"
FT   misc_feature    448139..448621
FT                   /locus_tag="SSU0416"
FT                   /note="HMMPfam hit to PF04851, Restriction endonuclease,
FT                   type I, R subunit/Type III, Res subunit, score 7e-30"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    448211..448234
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        449796..450518
FT                   /transl_table=11
FT                   /locus_tag="SSU0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44955"
FT                   /protein_id="CAR44955.1"
FT                   /translation="MEKEVFTPDQSQSIVDAILKGYKSYLDERIEKRRTMHVSAGYVWT
FT                   KANHIDGALATANLNFIDKFELKHASQSWEFLEFNSENQLLGRVCFVLKGLTRLRQVFP
FT                   TAVKSGKGYLFDYAQINTSYLENLSRHTDESTLFPVQMELFDDNLFELLNRSEQSINNF
FT                   FFITYQADELHHLTNIQVIMPDSRTGKLIEIQNLSTFISTSNVDFNDEKYQELQGLSEI
FT                   DDVADFEIIPRLASEKEA"
FT   CDS_pept        450531..451685
FT                   /transl_table=11
FT                   /locus_tag="SSU0418"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44956"
FT                   /protein_id="CAR44956.1"
FT                   /translation="MFNGSRLEELRLLNGLTRADLARELEVTEQAIWQFETGVTLPKMK
FT                   NKIAMARFFQVEVDYFDAVDKNGSFSLSRIAFRNADLEAKKNIHIQMVYLEKMNQMIDY
FT                   LENFVSIPNQIIYQLVDSIEQKLQQHESLEFIADHVREVLAVSVDNANLLYSLEKSGIY
FT                   ISERLINGNADAYSAWSRNGRPFIVLGLGKSAVRHNFDLAHELGHLLLHNQVDFEELSK
FT                   EELEEKEKEANQFASYFLLPRKQFLMDFVNIVGKRVSNPDQYILLKKRFGVSIQALEYR
FT                   AYKLGLLTPQQNSYFYRQISKKGYKAVEPLDLEIPLKKPSKIRSILDVILSNNLLTLSD
FT                   IERNQRVSKNFISQLFSFDVKFFDKYLLQLDTFDNVIPLFSRKQ"
FT   misc_feature    450549..450713
FT                   /locus_tag="SSU0418"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix type 3,
FT                   score 3e-10"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    450576..450641
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1677.000, SD 4.90 at aa 16-37, sequence
FT                   LTRADLARELEVTEQAIWQFET"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    450999..451379
FT                   /locus_tag="SSU0418"
FT                   /note="HMMPfam hit to PF06114, Protein of unknown function
FT                   DUF955, score 1.1e-23"
FT                   /inference="protein motif:HMMPfam:PF06114"
FT   misc_feature    451536..451601
FT                   /note="Predicted helix-turn-helix motif with score 995.000,
FT                   SD 2.58 at aa 336-357, sequence LTLSDIERNQRVSKNFISQLFS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        451700..452758
FT                   /transl_table=11
FT                   /locus_tag="SSU0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44957"
FT                   /protein_id="CAR44957.1"
FT                   /translation="MNKINSYKIHLPSLLPFGFLFANNCYTYREVFMEGQFEAVVEVDE
FT                   AGQLSSYVWDCEMEEVYTAHLVTAPSGAFVGQVRESYQSILDRVEEACCIALPFTKDQS
FT                   NRIAQLIKEQWGDLPDYPFAKLPTYGAFRHPNNNKWYALVSQIPRDKLDGSGSQEEVEI
FT                   VNLKVAGREIAELLSRSGIFPAYHMSKKTWVSVLLDDTVEDQTVFALLEKSRYLVGPKS
FT                   YKATQGPDYWVIPANPKVYDIDTEFAENKVVYWPQKSTIQVGDIVAIYVTAPVQAIRYV
FT                   CRVLGENLENHGESDIPTEKKLMQVELLAQFSDDVLPRARMMDLGVKAVRGPRRLTKEL
FT                   IDVLTSEVINIY"
FT   misc_feature    452030..452356
FT                   /locus_tag="SSU0419"
FT                   /note="HMMPfam hit to PF04237, Protein of unknown function
FT                   DUF419, score 1.5e-32"
FT                   /inference="protein motif:HMMPfam:PF04237"
FT   CDS_pept        452842..453834
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="SSU0420"
FT                   /product="aspartate--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44959"
FT                   /protein_id="CAR44959.1"
FT                   /translation="MKKSFIHQQEEISFVKNTFTQYLKDKLEIVEVQGPILSRVGDGMQ
FT                   DNLSGVENAVTVNVKLIPDATYEVVHSLAKWKRHTLARFGFHEGEGLFVHMKALRPDED
FT                   SLDPIHSVYVDQWDWEKVIPDGRRNLAYLKETVEQIYKAIRLTELAVEARYDIESVLPK
FT                   KITFIHTEDLVKNFPDLTPKERENVVAKEYGAVFLIGIGGELADGKPHDGRAPDYDDWT
FT                   SPSEAGYKGLNGDILVWNEALGSAFELSSMGIRVDEEALKRQVAITGDEDRLEFDWHRA
FT                   LLNGLFPLSIGGGIGQSRLAMFLLRKKHIGEVQSSVWPQEVRDNFENIL"
FT   misc_feature    452848..453579
FT                   /gene="asnA"
FT                   /locus_tag="SSU0420"
FT                   /note="HMMPfam hit to PF03590, Aspartate--ammonia ligase,
FT                   score 3.4e-181"
FT                   /inference="protein motif:HMMPfam:PF03590"
FT   CDS_pept        453967..455814
FT                   /transl_table=11
FT                   /locus_tag="SSU0421"
FT                   /product="BipA family GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44961"
FT                   /protein_id="CAR44961.1"
FT                   /translation="MTKLREDIRNVAIIAHVDHGKTTLVDELLKQSQTLDERTQLDERA
FT                   MDSNDIEKERGITILAKNTAVAYNGTRINIMDTPGHADFGGEVERIMKMVDGVVLVVDA
FT                   YEGTMPQTRFVLKKALEQNLTPIVVVNKIDKPSARPEEVVDEVLELFIELGADDDQLEF
FT                   PVVYASAINGTSSLSDNPADQEETMAPIFDTIIEHIPAPVDNSDEPLQFQVSLLDYNDF
FT                   VGRIGIGRVFRGTVKVGDQVTLSKLDGTTKNFRVTKLFGFFGLERKEIQEAKAGDLIAV
FT                   SGMEDIFVGETVTPTDAVEALPVLRIDEPTLQMTFLVNNSPFAGREGKWVTSRKIEERL
FT                   LAELQTDVSLRVDPTDSPDKWTVSGRGELHLSILIETMRREGYELQVSRPEVIIKEIDG
FT                   VKMEPFERVQIDTPEEYQGSVIQSLSERKGDMLDMVATGNGQTRLVFLVPARGLIGYST
FT                   EFLSMTRGYGIMNHTFDQYLPVVQGEIGGRHRGALVSIDQGKATTYSIMRIEERGTIFV
FT                   NPGTEVYEGMIIGENSRENDLTVNITTAKQMTNVRSATKDQTSVIKTPRILTLEESLEF
FT                   LNDDEYMEVTPESIRLRKQILNKAERDKAAKKKKLATEE"
FT   misc_feature    453982..454575
FT                   /locus_tag="SSU0421"
FT                   /note="HMMPfam hit to PF00009, Protein synthesis factor,
FT                   GTP-binding, score 2.9e-67"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    454009..454032
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    454105..454152
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    454636..454848
FT                   /locus_tag="SSU0421"
FT                   /note="HMMPfam hit to PF03144, Translation elongation
FT                   factor EFTu/EF1A, domain 2, score 6.8e-17"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    455164..455421
FT                   /locus_tag="SSU0421"
FT                   /note="HMMPfam hit to PF00679, Translation elongation
FT                   factor EFG/EF2, C-terminal, score 1.2e-27"
FT                   /inference="protein motif:HMMPfam:PF00679"
FT   CDS_pept        455832..456080
FT                   /transl_table=11
FT                   /locus_tag="SSU0422"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44963"
FT                   /protein_id="CAR44963.1"
FT                   /translation="MFYLILAIMLVLFYIFIAPSNIKGTMNLIAAVFLLVALAIALVLG
FT                   FLRIMQFPKEIWVGLLMILIGFWAMRDIYQLNDDTKF"
FT   misc_feature    join(455835..455885,455913..455981,456000..456053)
FT                   /locus_tag="SSU0422"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSU0422 by TMHMM2.0 at aa 2-18, 28-50 and 57-74"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        456787..457047
FT                   /transl_table=11
FT                   /locus_tag="SSU0423"
FT                   /product="hypothetical protein"
FT                   /note="Possible gene remnant. Weakly similar to the
FT                   N-terminal region of Clostridium tetani DNA replication
FT                   protein DnaC UniProt:Q899P7 (EMBL:AE015936) (329 aa) fasta
FT                   scores: E()=7.2, 36.111% id in 72 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44965"
FT                   /protein_id="CAR44965.1"
FT                   /translation="MDVKNLRKLKRIELYEIMLAQSEEIDCLRNQLEKIKTELADRRIM
FT                   ISQSGSIAEASMKLTNIFEEAQKAADLYLYNVKNKIGDVHE"
FT   CDS_pept        457040..457630
FT                   /transl_table=11
FT                   /locus_tag="SSU0424"
FT                   /product="putative signal peptidase I 2"
FT                   /note="Similar to SSU0450, 52.308% identity (52.308%
FT                   ungapped) in 195 aa overlap (4-198:8-202)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44967"
FT                   /protein_id="CAR44967.1"
FT                   /translation="MNSSNLKGKELPKTSELKELYQHERYRHTFWRTVKSTVFMLVVVA
FT                   AFAILIAVLFLPILRIYGDSMKGTLNSGDIVVSVKSNDFESSDVVAFYYNNNILVKRVI
FT                   AEAGDWVDMDKQGNVYVNNQRLDEPYLANRDYGHTDIEFPYQVPENRIFVMGDNRKESI
FT                   DSRNNAIGTVSNEQIVGKLVFKIWPLSELGWIE"
FT   misc_feature    457148..457216
FT                   /locus_tag="SSU0424"
FT                   /note="1 probable transmembrane helix predicted for SSU0424
FT                   by TMHMM2.0 at aa 39-61"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    457217..457411
FT                   /locus_tag="SSU0424"
FT                   /note="HMMPfam hit to PF00717, Peptidase S24, S26A and
FT                   S26B, C-terminal, score 2.5e-13"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   misc_feature    457493..457534
FT                   /note="PS00761 Signal peptidases I signature 3."
FT                   /inference="protein motif:Prosite:PS00761"
FT   CDS_pept        join(457662..457808,457812..462638)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0425"
FT                   /product="putative surface-anchored protein (pseudogene)"
FT                   /note="CDS contains a nonsense mutation (ochre) after codon
FT                   49. Internal region is similar to the N-terminal region of
FT                   Listeria monocytogenes internalin A precursorinla InlA
FT                   UniProt:P25146 (EMBL:LMO012346) (800 aa) blastp scores:
FT                   E()=4e-09"
FT                   /db_xref="PSEUDO:CAR44968.1"
FT   misc_feature    457719..457787
FT                   /locus_tag="SSU0425"
FT                   /note="1 probable transmembrane helix predicted for SSU0425
FT                   by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    462534..462551
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    462564..462623
FT                   /locus_tag="SSU0426"
FT                   /note="1 probable transmembrane helix predicted for SSU0426
FT                   by TMHMM2.0 at aa 1580-1599"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        462745..464187
FT                   /transl_table=11
FT                   /locus_tag="SSU0427"
FT                   /product="putative surface-anchored protein"
FT                   /note="Similar to protein mediating epithelial cell
FT                   invasion by virulent serotype III group B Streptococcus
FT                   agalactiae, Spb1 UniProt:Q84A41 (EMBL:AF485279) (502 aa)
FT                   fasta scores: E()=1.9e-05, 32.961% id in 537 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44971"
FT                   /protein_id="CAR44971.1"
FT                   /translation="MKKLQQFFTSLVAVLTVFAFGSTALAQTVDSGKSGAGTITVSNAS
FT                   QGQTYTAYKLFDATVTTDGSGISYKLPAGKIATNFGGDTWFEVDSKGNITAKEGATVSS
FT                   EAFAAWAKNFGTEVTSATANDNSLVFTHLTFGYYFVTSSLGAVLTVDSTTPNATVIDKN
FT                   TTNPTIPDSNNGGGKKILSNGATTSETTAKIGDTINFQIKFNATNYVTKDRQTKQIVSY
FT                   TIEDSPTALAIDQNSVNVKVDGVDITAKISKTFDATGKMNLVITWADAAASNKTIYNSP
FT                   AEVIITYSAVVTKDAKEGEATNSATIGYNTIDNPTTPPTPVDPDKPTETTKVTTHRFTL
FT                   KKTNNVGETLTGAEFKLYDAANNGTEIKVVKESDGVYRVAQADEQGVVIEAGEVVIKGL
FT                   KHSTTYYLEEMKAPNGYNILTERQSIEVKENNTAQANIVNKKGGVLPSTGAIGTTLFYL
FT                   VGSILLLVALVYTISKRRMNNI"
FT   sig_peptide     462745..462822
FT                   /locus_tag="SSU0427"
FT                   /note="Signal peptide predicted for SSU0427 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.890 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(462763..462831,464092..464160)
FT                   /locus_tag="SSU0427"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0427 by TMHMM2.0 at aa 7-29 and 450-472"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    463792..464058
FT                   /locus_tag="SSU0427"
FT                   /note="HMMPfam hit to PF05738, Collagen-binding surface
FT                   protein Cna-like, B region, score 7.4e-11"
FT                   /inference="protein motif:HMMPfam:PF05738"
FT   misc_feature    464053..464169
FT                   /locus_tag="SSU0427"
FT                   /note="HMMPfam hit to PF00746, Surface protein from
FT                   Gram-positive cocci, anchor region, score 1.4e-05"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   misc_feature    464077..464094
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        464301..465170
FT                   /transl_table=11
FT                   /locus_tag="SSU0428"
FT                   /product="sortase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44973"
FT                   /protein_id="CAR44973.1"
FT                   /translation="MIKWLKKKGPSFIMPLIFILGIGLLAYPSVSDYWNSFHQSEAIMS
FT                   YSDTVSDMTADQYKEIIDSARQYNQEKPLNWNVTASDIEAYNQELNFNKDGIMGYIEIP
FT                   KIDVKLSIFHGTDETVLETSIGHLEGTSLPVGGLGTHSVLSGHRGLPSARLFSDLDKLR
FT                   EGDIFTIHVLNETLTYKVDQIRVVEPSDLSALTMEPQKDLLTLVTCTPYGINTHRLLVR
FT                   GYRIENVNGSALVTSDAIQIKAIFIAPFIATPILFVILIYIFITTSKTFRSRNRNQVLD
FT                   DFLVPKKF"
FT   sig_peptide     464301..464399
FT                   /locus_tag="SSU0428"
FT                   /note="Signal peptide predicted for SSU0428 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.949) with cleavage site
FT                   probability 0.518 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(464334..464402,465030..465098)
FT                   /locus_tag="SSU0428"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0428 by TMHMM2.0 at aa 12-34 and 244-266"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    464601..464978
FT                   /locus_tag="SSU0428"
FT                   /note="HMMPfam hit to PF04203, Peptidase C60, sortase A and
FT                   B, score 8.2e-62"
FT                   /inference="protein motif:HMMPfam:PF04203"
FT   CDS_pept        complement(465281..465616)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0429"
FT                   /product="transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus mutans transposase UniProt:Q93UN9
FT                   (EMBL:AF068251) (297 aa) fasta scores: E()=2e-19, 55.000%
FT                   id in 100 aa"
FT                   /db_xref="PSEUDO:CAR44975.1"
FT   CDS_pept        465742..467091
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SSU0430"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44977"
FT                   /protein_id="CAR44977.1"
FT                   /translation="MKMIDIVKNKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFEE
FT                   NPTAQSLLEDGIRVICGSHPLELLDEDFALMVKNPGIRYDNPMVEKAIGKGIPVWTEVE
FT                   LAYLVSDVPIVGITGSNGKTTTTTMIAEVLNAGKKPAKLCGNIGYPASSVAQTATAEDT
FT                   LVMELSSFQLMGTESFHPHIAVVTNLIASHIDYHGTFEDYVAAKWMIQRQMTAEDFVVI
FT                   NFNQKEAKELAGQTKATVVPFSTQEVVDGAYLADGKLYFKGEYIMDADQIGVPGSHNVE
FT                   NALATIVVAKLLGVDQQAIQESLSAFGGVKHRLQFVGEINGVSFYNDSKSTNILATQKA
FT                   LSGFDNSKVILIAGGLDRGNEFDELVPDLVGLKKMVILGQSAPRVQRAADKAEVETIEA
FT                   LDIADATRKAFAIAEKGDIVLLSPANASWDMYANFEVRGDVFLQTFEELK"
FT   sig_peptide     465742..465813
FT                   /gene="murD"
FT                   /locus_tag="SSU0430"
FT                   /note="Signal peptide predicted for SSU0430 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.600) with cleavage site
FT                   probability 0.399 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    466084..466611
FT                   /gene="murD"
FT                   /locus_tag="SSU0430"
FT                   /note="HMMPfam hit to PF08245, Mur ligase, central, score
FT                   8.5e-62"
FT                   /inference="protein motif:HMMPfam:PF08245"
FT   misc_feature    466669..466896
FT                   /gene="murD"
FT                   /locus_tag="SSU0430"
FT                   /note="HMMPfam hit to PF02875, Mur ligase, C-terminal,
FT                   score 1.3e-19"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   CDS_pept        467094..468158
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="SSU0431"
FT                   /product="putative
FT                   UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide)pyr
FT                   ophosphoryl-undecaprenol N-acetylglucosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44979"
FT                   /protein_id="CAR44979.1"
FT                   /translation="MKKIVFTGGGTVGHVTLNLLLIPRFLEEGWEVHYIGDGNGIEHEQ
FT                   VVKSGLDVHFHSIATGKLRRYFSFQNMLDVFKVGFGVLQSLTIIAKIRPQALFSKGGFV
FT                   SVPPVIAANLLRVPVFIHESDLTMGLANKIAYKFATTMYSTFEQPASLTKVKHVGAVTK
FT                   VGQTNDKVTPIQLPEILSHFDKSLPTLLFVGGSGGAKVFNDLISQNSAALTERFNIINL
FT                   TGDSSLNKLDKNLYRVDYVTELYQPLMDLADVVITRGGSNTLFELIAMQQLHLIVPLGR
FT                   QASRGDQIENALYAEKKGYSKQIDESQLTFASLLVEVDELLKHKEFYVQNMANSNEIQS
FT                   VDSFYNLLREDMGR"
FT   misc_feature    467103..467525
FT                   /gene="murG"
FT                   /locus_tag="SSU0431"
FT                   /note="HMMPfam hit to PF03033, Glycosyl transferase, family
FT                   28, score 1.2e-39"
FT                   /inference="protein motif:HMMPfam:PF03033"
FT   misc_feature    467658..468128
FT                   /gene="murG"
FT                   /locus_tag="SSU0431"
FT                   /note="HMMPfam hit to PF04101, Glycosyltransferase 28,
FT                   C-terminal, score 3.5e-27"
FT                   /inference="protein motif:HMMPfam:PF04101"
FT   CDS_pept        468164..469246
FT                   /transl_table=11
FT                   /locus_tag="SSU0432"
FT                   /product="putative cell division protein"
FT                   /note="CDS is truncated at the C-terminus in comparison to
FT                   some orthologues, for example, similar to Streptococcus
FT                   pneumoniae cell division protein DivIB UniProt:Q9ZHA8
FT                   (EMBL:AF068902) (399 aa) fasta scores: E()=1.7e-28, 35.457%
FT                   id in 361 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44981"
FT                   /protein_id="CAR44981.1"
FT                   /translation="MTEKDSNVEESVLEVEQASQVELDSEQISPAEKESVLAEEKEFST
FT                   DVDIPEMTAPDDEKSAFFEQWKARHQAYLAHKDEADIQAVDEGQTEQEIPEAKKSKRVL
FT                   FQGIERKTESLKSKKETGEKVQTLKVDIPSKVVWKAIPVLVTSLLLAALALYFISPTSK
FT                   KKQIEVVGNERLTAEQVENYSLISPDDYNVTIALHADAYAKNIKKNSSSVETATIKFQF
FT                   PATFTIHIKEYAIIGYIQQQSQWYPVLSSGEIGGEPISQDSLPEDYTTINLSDKELIKE
FT                   LAIELGKIDAGIRSAIQTINLTPSKVTADLLTFNMRDGNTVLVPLSEISQKVSYYTKIA
FT                   AEVTVPTTIDMEVGIYRYAS"
FT   misc_feature    468569..468637
FT                   /locus_tag="SSU0432"
FT                   /note="1 probable transmembrane helix predicted for SSU0432
FT                   by TMHMM2.0 at aa 136-158"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    468647..468862
FT                   /locus_tag="SSU0432"
FT                   /note="HMMPfam hit to PF08478,
FT                   Polypeptide-transport-associated, FtsQ-type, score 7.4e-15"
FT                   /inference="protein motif:HMMPfam:PF08478"
FT   misc_feature    468869..469240
FT                   /locus_tag="SSU0432"
FT                   /note="HMMPfam hit to PF03799, Cell division protein FtsQ,
FT                   score 7.8e-12"
FT                   /inference="protein motif:HMMPfam:PF03799"
FT   CDS_pept        469399..470778
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="SSU0433"
FT                   /product="putative cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44983"
FT                   /protein_id="CAR44983.1"
FT                   /translation="MARNGFFTGLDIGTSSVKVLVAEYIDNEMNVIGVSNVKSAGVKDG
FT                   IIVNIEVAAGAIKKAIEQAEEKSGIRIEKVNVGLPANLLQIEPTQGMIPVTTDSQEITD
FT                   LDVENVVKSALTKSMTPEREVISFIPEEFTVDGFQGIKDPRGMMGIRLEMRGMLYTGPR
FT                   TILHNLRKTVERAGVQVENIVISPLALTRSVLNEGEREFGATVIDLGGGQTTVAVMRGQ
FT                   ELQYTNIYQEGGDYITNDISKVLTTSKSIAENLKYNYGIAYPQDASDKEKFTVEVIGEN
FT                   APVEVTERYLSEVIAARLRQIFDRVKQDLERTRALDLPGGIVLVGGGAILPGIIELAQE
FT                   VFGVNTKLFVPNQIGIRNPAFASVISFVEYVGELEDVENIAQHAVNGETTLRHKPVEIP
FT                   VARPRISQPIQREIVNELNTVDQVEEQVAPTYHDEEEEVRPAAKGNITDRIRGLFGSMF
FT                   E"
FT   misc_feature    469417..469980
FT                   /gene="ftsA"
FT                   /locus_tag="SSU0433"
FT                   /note="HMMPfam hit to PF02491, Cell division protein FtsA,
FT                   score 5.9e-64"
FT                   /inference="protein motif:HMMPfam:PF02491"
FT   misc_feature    470008..470499
FT                   /gene="ftsA"
FT                   /locus_tag="SSU0433"
FT                   /note="HMMPfam hit to PF02491, Cell division protein FtsA,
FT                   score 2e-50"
FT                   /inference="protein motif:HMMPfam:PF02491"
FT   CDS_pept        470804..472033
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="SSU0434"
FT                   /product="cell division protein FtsZ"
FT                   /note="CDS lacks internal amino acids around residue 360 in
FT                   comparison to some orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44985"
FT                   /protein_id="CAR44985.1"
FT                   /translation="MAFSFEAAASHGAVIKVIGVGGGGGNAINRMIEEGVAGVEFIAAN
FT                   TDVQALSSSKAETVIQLGPKLTRGLGAGGQPEVGRKAAEESEEALTNVLTGADMVFITA
FT                   GMGGGSGTGAAPVIARIAKNLGALTVAVVTRPFGFEGNKRGNFAIEGIEGLREQVDTLL
FT                   IISNNNLLEIVDKKTPLLEALSEADNVLRQGVQGITDLITNPGLINLDFADVKTVMENK
FT                   GNALMGIGIGTGEDRVIEAARKAIYSPLLETTIDGAEDVIVNVTGGYDMTLTEAEDASE
FT                   IVNQAAGQGVNIWLGTSIDETMKDEIRVTVVATGVRQDTADKPARHRTEAVSPRPSHRF
FT                   DHSVASAPTRGAAQQTEAPKASAFGEWDLRRENLIRPTDTEPTSTVSVEKFTMDQDEDE
FT                   LDTPPFFRNR"
FT   misc_feature    470840..471421
FT                   /gene="ftsZ"
FT                   /locus_tag="SSU0434"
FT                   /note="HMMPfam hit to PF00091, Tubulin/FtsZ, GTPase, score
FT                   1.2e-95"
FT                   /inference="protein motif:HMMPfam:PF00091"
FT   misc_feature    470936..471040
FT                   /note="PS01134 FtsZ protein signature 1."
FT                   /inference="protein motif:Prosite:PS01134"
FT   misc_feature    471425..471790
FT                   /gene="ftsZ"
FT                   /locus_tag="SSU0434"
FT                   /note="HMMPfam hit to PF03953, Tubulin/FtsZ, C-terminal,
FT                   score 3.3e-25"
FT                   /inference="protein motif:HMMPfam:PF03953"
FT   CDS_pept        472040..472711
FT                   /transl_table=11
FT                   /locus_tag="SSU0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44987"
FT                   /protein_id="CAR44987.1"
FT                   /translation="MNFQKNKDAIFSAVAKAAEKAGRPSESVKVIAVTKYVDSSIANQL
FT                   VNTGITHIGENRVDQFLEKYNALADKQLTWHLIGTLQRRKVKDIIPFVDYFHALDSVKL
FT                   AQEIDKRATKIVKCFLQVNVSGEESKHGFAVSEIDAALAEISLLENIELVGLMTMAPID
FT                   ATDDELDEIFSKMQEIQEELATRNLPRMPFTELSMGMSGDFERAIAHGATYVRIGSAFF
FT                   E"
FT   sig_peptide     472040..472090
FT                   /locus_tag="SSU0435"
FT                   /note="Signal peptide predicted for SSU0435 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.710) with cleavage site
FT                   probability 0.649 between residues 17 and 18"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    472055..472708
FT                   /locus_tag="SSU0435"
FT                   /note="HMMPfam hit to PF01168, Alanine racemase,
FT                   N-terminal, score 1.1e-07"
FT                   /inference="protein motif:HMMPfam:PF01168"
FT   CDS_pept        472728..473291
FT                   /transl_table=11
FT                   /locus_tag="SSU0436"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44988"
FT                   /protein_id="CAR44988.1"
FT                   /translation="MALKDTFKNLFNYFEVDEVNEVEEQADAYSMPNDRPKMRVANTTV
FT                   APVREQQPKVETRREARSESQLQRLHERQQELMTNNNEKEIVKTTIDIKFPKRYEDAPE
FT                   MVNLLLDNASILIDFQYMSEQQARRCLDYLDGARSVLSGNLKKVSNTMWLLTPVNVTVN
FT                   IEELRNAGTTTGVADSNFEFDIKR"
FT   misc_feature    472983..473222
FT                   /locus_tag="SSU0436"
FT                   /note="HMMPfam hit to PF04472, Protein of unknown function
FT                   DUF552, score 8.6e-28"
FT                   /inference="protein motif:HMMPfam:PF04472"
FT   CDS_pept        473296..473559
FT                   /transl_table=11
FT                   /locus_tag="SSU0437"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44990"
FT                   /protein_id="CAR44990.1"
FT                   /translation="MQILIFLLLKIVEIYSYLLLAYALLSWFPSLYTSSIGRLIQWLVA
FT                   PILKPFRRLNLQFMGLDWTVMAAMIALNMGTRFLVQLLLLLA"
FT   misc_feature    473296..473541
FT                   /locus_tag="SSU0437"
FT                   /note="HMMPfam hit to PF02325, Protein of unknown function
FT                   YGGT, score 7.9e-20"
FT                   /inference="protein motif:HMMPfam:PF02325"
FT   misc_feature    join(473308..473376,473485..473553)
FT                   /locus_tag="SSU0437"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0437 by TMHMM2.0 at aa 5-27 and 64-86"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        473562..474353
FT                   /transl_table=11
FT                   /locus_tag="SSU0438"
FT                   /product="putative RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44992"
FT                   /protein_id="CAR44992.1"
FT                   /translation="MKNDKNLLQHFSREEREFVEKIMDMCQQVEDTYSYRLTHFLHPRQ
FT                   DEIVCKIANYYQLQTFSSRDLVSTEHSRVIIAPTYYELDIKDFELTALHLSYARKFHTL
FT                   SHSQVLGTFLNQLGIKREYLGDILIDDERLIVFIDQKFGQIALQSITKVARVPVKGKEE
FT                   EWTTVRLPIGQEWRSKDVLVSSMRLDKLISVAFNLSRATANKLIEAGHVKLDYVLTEQT
FT                   SKLVEIGQLISVRRYGRVRLNEFLGFSKQGKIKLKLDIVKT"
FT   misc_feature    474117..474257
FT                   /locus_tag="SSU0438"
FT                   /note="HMMPfam hit to PF01479, RNA-binding S4, score
FT                   9.8e-08"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   CDS_pept        474362..475051
FT                   /transl_table=11
FT                   /locus_tag="SSU0439"
FT                   /product="putative cell-division protein DivIVA"
FT                   /note="In comparison to orthologues, CDS lacks similarity
FT                   in the C-terminal region, for example, similar to
FT                   Streptococcus pneumoniae cell division protein DivIVA
FT                   UniProt:Q9ZHB4 (EMBL:AF068901) (262 aa) fasta scores:
FT                   E()=6.8e-42, 66.038% id in 212 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44994"
FT                   /protein_id="CAR44994.1"
FT                   /translation="MALTALELKDKTFATKFRGYDADEVDDFLDIVTRDYEDLIRKNHD
FT                   QELELKNLRERLAYFDEMKESLSKSVLLAQDTAEKVKVAAEDQAANIIKQADYDAATLL
FT                   HEAKDKANEILRNATDNAKKVVIETEELKNQTRIFHQRLKSTVESQLSLVNSSEWEEIL
FT                   RPTASYIQTSDEAFRDVLHKALDEELPVEEESLDYTRQLTPEEIAELTRQAAAFESGES
FT                   VVLSIEE"
FT   misc_feature    474362..475048
FT                   /locus_tag="SSU0439"
FT                   /note="HMMPfam hit to PF05103, DivIVA, score 7.1e-66"
FT                   /inference="protein motif:HMMPfam:PF05103"
FT   misc_RNA        475066..475286
FT                   /note="T-box leader (RF00230) as predicted by Rfam, score
FT                   60.74"
FT   CDS_pept        475281..475724
FT                   /transl_table=11
FT                   /locus_tag="SSU0440"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44996"
FT                   /protein_id="CAR44996.1"
FT                   /translation="MIRLELVNKDNFEVVLQVQLASEDQRRVASVEYSLAQAWLYKDSG
FT                   MILPYAVVSGRKVVGFAMLSIEPKDNSYYLWRLLIDKDFQNRGCGKEAIQQIIGKAKAD
FT                   PLCHKISINYVIGNHKMRYILEKIGFQSVGLEGQEMKMELIIK"
FT   misc_feature    475428..475673
FT                   /locus_tag="SSU0440"
FT                   /note="HMMPfam hit to PF00583, GCN5-related
FT                   N-acetyltransferase, score 4.7e-11"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        475735..478524
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="SSU0441"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAR44998"
FT                   /protein_id="CAR44998.1"
FT                   /translation="MKLKETLNLGKTAFPMRAGLPTREPEWQKAWDEANLYARRQELNE
FT                   GKPAFHLHDGPPYANGNIHVGHALNKISKDIIVRSKSMSGFRAPFVPGWDTHGLPIEQV
FT                   LAKQGVKRKEMDLVEYLEMCRDYAFSQVDKQRDDFKRLGVSADWENPYITLTKDYEAAQ
FT                   IRVFGAMADKGYIYRGAKPVYWSWSSESALAEAEIEYHDIDSTSLYYANKVKDGKGLLD
FT                   TDSYIVVWTTTPFTVTASRGLTMGADIDYVLVQPAGSDRKYVLAEALVDSLAAKFGWES
FT                   FEVISKHKGAEFEYIVTEHPWDREVDELVILGDHVTTDSGTGIVHTAPGFGEDDYNVGV
FT                   KYDLEVAVTVNERGLMNEAAGPDFEGQFYDKVVPTVKEKLGDLLLASEVINHSYPFDWR
FT                   TKKPIIWRAVPQWFASVSKFRQEILDQIEATTFNPSWGKTRLYNMIRDRGDWVISRQRA
FT                   WGVPLPIFYAEDGTAIMTKEVTDHVAALFEEHGSIIWWKSDAKDLLPAGFTHPGSPNGE
FT                   FTKETDIMDVWFDSGSSWNGVMNARENLAYPADLYLEGSDQYRGWFNSSLITSVAVNGH
FT                   APYKAILSQGFVLDGNGMKMSKSLGNTILPSDVEKQFGAEILRLWVTSVDTSNDVRVSM
FT                   DILGQVSETYRKIRNTLRFLIANTSDFNPASDAVAYEELRSVDQYLLVKFNKLVVQIRE
FT                   AYDNYDFMGIYKSVVNFVTLDLSAFYLDFAKDVVYIDGAKSLSRRQMQTVFYDILVKIT
FT                   KLLTPILPHTAEEIWSYLEHEAEEFVQLAEMPEVETFANEAQLLADWENFMVFRTQAQK
FT                   ALEEARNAKVIGKSLEAHLTAYVSAETKSFLESLNADLAQLLIVSNLTVTTETAPSTAL
FT                   VVDEVAFAVERAAGEVCDRCRRIDTSVAERSYGATICDHCASVVEENFAEAVAQGFEA"
FT   misc_feature    475810..477636
FT                   /gene="ileS"
FT                   /locus_tag="SSU0441"
FT                   /note="HMMPfam hit to PF00133, Aminoacyl-tRNA synthetase,
FT                   class Ia, score 5.5e-273"
FT                   /inference="protein motif:HMMPfam:PF00133"
FT   misc_feature    475903..475938
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00178"
FT   misc_feature    477766..478236
FT                   /gene="ileS"
FT                   /locus_tag="SSU0441"
FT                   /note="HMMPfam hit to PF08264, Valyl/Leucyl/Isoleucyl-tRNA
FT                   synthetase, class I, anticodon-binding, score 1.8e-52"
FT                   /inference="protein motif:HMMPfam:PF08264"
FT   misc_feature    478387..478476
FT                   /gene="ileS"
FT                   /locus_tag="SSU0441"
FT                   /note="HMMPfam hit to PF06827, Formamidopyrimidine-DNA
FT                   glycolase, C-terminal, score 8.4e-09"
FT                   /inference="protein motif:HMMPfam:PF06827"
FT   repeat_region   complement(478575..478681)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        complement(478903..479211)
FT                   /transl_table=11
FT                   /locus_tag="SSU0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45001"
FT                   /protein_id="CAR45001.1"
FT                   /translation="MKIINTTNSHPNLVQSQLANTDAFLVETYSAGNTDVIFTQAPRHY
FT                   ELLISNKYRAVQQNEIEQIRDFFLHRKIDERTINKAAIQTIHTDRLIEMSIPIIAEV"
FT   misc_feature    complement(478918..479211)
FT                   /locus_tag="SSU0442"
FT                   /note="HMMPfam hit to PF08860, Protein of unknown function
FT                   DUF1827, score 6.3e-58"
FT                   /inference="protein motif:HMMPfam:PF08860"
FT   CDS_pept        complement(479266..479733)
FT                   /transl_table=11
FT                   /locus_tag="SSU0443"
FT                   /product="MutT/NUDIX hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45002"
FT                   /protein_id="CAR45002.1"
FT                   /translation="MPMEKIAVFGEKKAGVSYQSRFGVYAVIPDEKKEQIILVQAPNGA
FT                   WFLPGGEIEKGENHLIALERELMEELGFTAEIGKYFGQADEYFYSSHRDTHFYNPAYIY
FT                   EVTSYHQIGQPLEDFNHIAWFPVNEAIDKLKRGSHKWGIEQWKLQENSFNN"
FT   misc_feature    complement(479287..479676)
FT                   /locus_tag="SSU0443"
FT                   /note="HMMPfam hit to PF00293, NUDIX hydrolase, core, score
FT                   1.7e-19"
FT                   /inference="protein motif:HMMPfam:PF00293"
FT   misc_feature    complement(479524..479583)
FT                   /note="PS00893 mutT domain signature."
FT                   /inference="protein motif:Prosite:PS00893"
FT   CDS_pept        complement(479913..482141)
FT                   /transl_table=11
FT                   /gene="clpE"
FT                   /locus_tag="SSU0444"
FT                   /product="putative ATP-dependent Clp protease ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45003"
FT                   /protein_id="CAR45003.1"
FT                   /translation="MLCKNCNINDATIHLYTNLNGKQQQVDLCHNCYQIMKTDPHNAIL
FT                   RGLGDLTNPNNMDPFSEFFNHLGGYPGNTPAGKNREQTPPTQAGGHNGRGGQTPPPQQP
FT                   QQPNGLLEEFGINVTEIARRGDIDPVIGRDQEITRVIEILNRRTKNNPVLIGEPGVGKT
FT                   AVVEGLAQKIVDGDVPQKLRDKEVIRLDVVSLVQGTGIRGQFEERMQKLMEEIRNRREI
FT                   ILFIDEIHEIVGAGSAGDGNMDAGNILKPALARGEMQLVGATTLNEYRIIEKDAALERR
FT                   MQPVKVEEPSVEETITILKGIQNKYQDYHHVKYSDAAIEAAAVLSNRYIQDRFLPDKAI
FT                   DLLDEAGSKMNLTLNFIDPKEIDQRLIDSENRKAQATRDEDYEKAAYFRDQIAKYKEMQ
FT                   KATISEEDIPLITEKEIEAIVEQKTNIPVGDLKEKEQSQLVSLASDLKAHVIGQDEAVD
FT                   KIAKAIRRNRVGLGAPNRPIGSFLFVGPTGVGKTELSKQLAIELFGSADSMIRFDMSEY
FT                   MEKHAVAKLVGAPPGYVGYEEAGQLTEKVRRNPYSLILLDEVEKAHPDVMHMFLQVLDD
FT                   GRLTDGQGRTVSFKDTIIIMTSNAGTGKVEASVGFGAAMEGRTQSVLGQLSNFFTPEFM
FT                   NRFDGIIEFQPLSKENLLEIVSLMLDDVNKRLSHNGISLHVTDKVKEKLVDLGYNPKMG
FT                   ARPLRRTIQDQIEDAITDFYLEHPAEKDLRAVMSSKGTIQIKAQTKTK"
FT   misc_feature    complement(480219..480716)
FT                   /gene="clpE"
FT                   /locus_tag="SSU0444"
FT                   /note="HMMPfam hit to PF07724, ATPase AAA-2, score 6.3e-98"
FT                   /inference="protein motif:HMMPfam:PF07724"
FT   misc_feature    complement(480555..480611)
FT                   /note="PS00871 Chaperonins clpA/B signature 2."
FT                   /inference="protein motif:Prosite:PS00871"
FT   misc_feature    complement(480666..480689)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(480948..481055)
FT                   /gene="clpE"
FT                   /locus_tag="SSU0444"
FT                   /note="HMMPfam hit to PF02151, UvrB/UvrC protein, score
FT                   0.0014"
FT                   /inference="protein motif:HMMPfam:PF02151"
FT   misc_feature    complement(481374..481412)
FT                   /note="PS00870 Chaperonins clpA/B signature 1."
FT                   /inference="protein motif:Prosite:PS00870"
FT   misc_feature    complement(481407..481691)
FT                   /gene="clpE"
FT                   /locus_tag="SSU0444"
FT                   /note="HMMPfam hit to PF00004, AAA ATPase, core, score
FT                   2.8e-12"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    complement(481653..481676)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        482365..482595
FT                   /transl_table=11
FT                   /locus_tag="SSU0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45007"
FT                   /protein_id="CAR45007.1"
FT                   /translation="MESHLVRIINRLEAMANDGGTLKRNFERDGIVVAEVAYSYDEENG
FT                   SVFTLRDVAARETYAFDSIDLIAMEIYELLY"
FT   misc_feature    482386..482589
FT                   /locus_tag="SSU0445"
FT                   /note="HMMPfam hit to PF08796, Protein of unknown function
FT                   DUF1797, score 1.7e-33"
FT                   /inference="protein motif:HMMPfam:PF08796"
FT   CDS_pept        482721..483410
FT                   /transl_table=11
FT                   /locus_tag="SSU0446"
FT                   /product="putative amino acid ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45008"
FT                   /protein_id="CAR45008.1"
FT                   /translation="MNFSFLPEYWAYFNYGAIVTLIIAFFSVFFGSILGVLLAFAQRSK
FT                   YKVLAWTANIYVWIFRGTPMIVQIMIAFAMTHFVAPTFQLGILTVDLTRLIPGIIVISM
FT                   NSGAYVSETVRAGINAVPKGQLEAAYSLGIRPKQAMRYVIMPQAIKNILPALGNEFVTI
FT                   VKDSSLLSTIGVMELWNGAQTVQSTSYIPLTPLVFAASYYLIMTTVLTVIIQSFEKKLN
FT                   KGGQFHV"
FT   misc_feature    482757..483389
FT                   /locus_tag="SSU0446"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 8.2e-32"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    join(482763..482831,482889..482957,483291..483359)
FT                   /locus_tag="SSU0446"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSU0446 by TMHMM2.0 at aa 15-37, 57-79 and 191-213"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    483072..483158
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        483403..484137
FT                   /transl_table=11
FT                   /gene="glnQ3"
FT                   /locus_tag="SSU0447"
FT                   /product="putative glutamine transporter, ATP-binding
FT                   protein 3"
FT                   /note="Similar to SSU0884, 65.984% identity (65.984%
FT                   ungapped) in 244 aa overlap (1-244:1-244); SSU1676, 58.436%
FT                   identity (58.678% ungapped) in 243 aa overlap
FT                   (3-244:4-246); SSU1192, 55.556% identity (56.017% ungapped)
FT                   in 243 aa overlap (4-244:2-244); and SSU1851, 54.545%
FT                   identity (55.230% ungapped) in 242 aa overlap
FT                   (5-243:1-242)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45011"
FT                   /protein_id="CAR45011.1"
FT                   /translation="MSNAIISIKDLHKYFGKNEVLKGIDLDIQQGQVVVIIGPSGSGKS
FT                   TFLRTMNLLEVPTKGTVTFEGVDITDKSNDIFKMREKMGMVFQQFNLFPNMTVLDNITL
FT                   SPIKTKGIAKDEAEKKAKELLEKVGLPDKANAYPQSLSGGQQQRIAIARGLAMDPDVLL
FT                   FDEPTSALDPEMVGEVLAVMQDLAKSGMTMVIVTHEMGFAREVADRVIFMDGGVIVEDG
FT                   TPEEVFEHTKEERTKDFLSKVL"
FT   misc_feature    483493..484050
FT                   /gene="glnQ3"
FT                   /locus_tag="SSU0447"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 1.5e-68"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    483514..483537
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    483823..483867
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        484267..485115
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="SSU0448"
FT                   /product="FolD bifunctional protein [includes:
FT                   methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase]"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45013"
FT                   /protein_id="CAR45013.1"
FT                   /translation="MTVIDGKALGVKLQAALAEKTARLKEEKGLVPGLVVILVGENPAS
FT                   QVYVRNKERSALAAGFKSEVVRVPDTISESDLLDLIERYNQDDEWHGILVQLPLPAHIS
FT                   EEKVLLAIDPDKDVDGFHPTNMGKFWSGHPVMIPSTPAGIMEMFKEYQIELEGKSALVI
FT                   GRSNIVGKPMAQLLLDADATVTIAHSRTKNLPDLARQADILVVAIGRGHFVTKEFVKLG
FT                   AVVIDVGMNRDENGKLIGDVKYDEVSEVASYITPVPGGVGPMTITMLMEQTYEACVRSA
FT                   K"
FT   misc_feature    484270..484623
FT                   /gene="folD"
FT                   /locus_tag="SSU0448"
FT                   /note="HMMPfam hit to PF00763, Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, score 2.3e-57"
FT                   /inference="protein motif:HMMPfam:PF00763"
FT   misc_feature    484630..485109
FT                   /gene="folD"
FT                   /locus_tag="SSU0448"
FT                   /note="HMMPfam hit to PF02882, Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, score 2.2e-106"
FT                   /inference="protein motif:HMMPfam:PF02882"
FT   misc_feature    485038..485064
FT                   /note="PS00767 Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase signature 2."
FT                   /inference="protein motif:Prosite:PS00767"
FT   CDS_pept        486564..486857
FT                   /transl_table=11
FT                   /locus_tag="SSU0449"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45014"
FT                   /protein_id="CAR45014.1"
FT                   /translation="MQKTLEKLKRSELFELLVEQAKEIESYQAKLVDLEKRIEYREAVL
FT                   GEIGSIAEASLAVTRIFEEAQLAANIYLEQVQKVTHKQSDNCEIGRTDEDGD"
FT   CDS_pept        486907..487449
FT                   /transl_table=11
FT                   /locus_tag="SSU0450"
FT                   /product="putative signal peptidase I 3"
FT                   /note="Similar to SSU0424, 52.308% identity (52.308%
FT                   ungapped) in 195 aa overlap (8-202:4-198)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45018"
FT                   /protein_id="CAR45018.1"
FT                   /translation="MSEELDKIRYKERYLETLKNTIFTLVTVVALAVLIAMLWLPVLHI
FT                   YVSSMSPTLKAGDMVATVKTNTLSTGDMVAFYYNNKVLVKRVVATSGQWVNIDEQGNVY
FT                   ANGKTLDEPYVKDKAYGQTDIKLPYQVPEGQYFVMGDHRSVSIDSRNTAIGSIGEEQLV
FT                   GKLTFRIWPFHKMGVIK"
FT   misc_feature    486967..487035
FT                   /locus_tag="SSU0450"
FT                   /note="1 probable transmembrane helix predicted for SSU0450
FT                   by TMHMM2.0 at aa 43-65"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    487036..487230
FT                   /locus_tag="SSU0450"
FT                   /note="HMMPfam hit to PF00717, Peptidase S24, S26A and
FT                   S26B, C-terminal, score 2.9e-10"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   misc_feature    487312..487353
FT                   /note="PS00761 Signal peptidases I signature 3."
FT                   /inference="protein motif:Prosite:PS00761"
FT   CDS_pept        487468..487854
FT                   /transl_table=11
FT                   /locus_tag="SSU0451"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45020"
FT                   /protein_id="CAR45020.1"
FT                   /translation="MKILWERLFKFVQQYFREKKTAKITMVLSIIMAFGISYLLILPAI
FT                   TLETDSQESVLQSVYNQPTTVEQPVQEEQAESQLAQVQSAGSLFAEHENITVQVNYEEH
FT                   TFEQPVRLQVLPSEDSTKYIGLVR"
FT   sig_peptide     487468..487614
FT                   /locus_tag="SSU0451"
FT                   /note="Signal peptide predicted for SSU0451 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.765) with cleavage site
FT                   probability 0.476 between residues 49 and 50"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    487537..487605
FT                   /locus_tag="SSU0451"
FT                   /note="1 probable transmembrane helix predicted for SSU0451
FT                   by TMHMM2.0 at aa 24-46"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(487855..488226)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0452"
FT                   /product="putative transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Lactobacillus helveticus ISl2 mobile genetic
FT                   element protein UniProt:Q48559 (EMBL:LHISL2) (268 aa) fasta
FT                   scores: E()=1.2e-13, 44.167% id in 120 aa"
FT   misc_feature    complement(487861..488226)
FT                   /locus_tag="SSU0452"
FT                   /note="HMMPfam hit to PF01609, Transposase, IS4-like, score
FT                   0.0035"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   CDS_pept        488212..489039
FT                   /transl_table=11
FT                   /gene="srtE"
FT                   /locus_tag="SSU0453"
FT                   /product="sortase SrtE"
FT                   /note="Previously sequenced as Streptococcus suis
FT                   sortase-like protein SrtE UniProt:Q8VUN6 (EMBL:AB066355)
FT                   (275 aa) fasta scores: E()=8.4e-98, 100.000% id in 275 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45025"
FT                   /protein_id="CAR45025.1"
FT                   /translation="MASQIRHDLSLLVFFLITGLLLLLYPTVSDYWNSHYQSEAVATYS
FT                   EKLLDISKEEKQKILENVSAYNNTLEKGTIPNLNIDSVALKKYDSILNITDTGIMGYVE
FT                   IPKLQTTLPIYHGTDDAVLQVAVGHLAGTSLPIGGQGSHAAISGHRGLPSAKLFSDLDQ
FT                   LVIGDTFMIQVLDNTLTYEIDKIITVTPDDVSPLMIDPNEDFVTLVTCTPYGVNSHRLL
FT                   VRGHRIENQLLARQVVSEGSIVKPILVSPFIALCLLGLLWSLFFIKKEVNLFM"
FT   sig_peptide     488212..488304
FT                   /gene="srtE"
FT                   /locus_tag="SSU0453"
FT                   /note="Signal peptide predicted for SSU0453 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.809) with cleavage site
FT                   probability 0.583 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(488236..488295,488950..489009)
FT                   /gene="srtE"
FT                   /locus_tag="SSU0453"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0453 by TMHMM2.0 at aa 9-28 and 247-266"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    488518..488895
FT                   /gene="srtE"
FT                   /locus_tag="SSU0453"
FT                   /note="HMMPfam hit to PF04203, Peptidase C60, sortase A and
FT                   B, score 3.6e-58"
FT                   /inference="protein motif:HMMPfam:PF04203"
FT   CDS_pept        489169..489333
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0454"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Enterococcus faecalis (Streptococcus faecalis)
FT                   hypothetical protein UniProt:Q835N7 (EMBL:AE016951) (153
FT                   aa) fasta scores: E()=4.6e-11, 66.667% id in 57 aa"
FT   CDS_pept        489422..489832
FT                   /transl_table=11
FT                   /locus_tag="SSU0455"
FT                   /product="MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45029"
FT                   /protein_id="CAR45029.1"
FT                   /translation="MNIKEVSDVTGLSADTIRYYERVGLIPKIARKSSGVRDFVENDVA
FT                   VLEFVRCFRSAGMSIERLIEYMGLVQAGDSTVEARIDLLKEEREVLQSRLSKIQQALER
FT                   LDYKIENYQTILRGAENQLFTDGSGSCKKDRE"
FT   misc_feature    489422..489487
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1649.000, SD 4.80 at aa 3-24, sequence
FT                   MNIKEVSDVTGLSADTIRYYER"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    489425..489538
FT                   /locus_tag="SSU0455"
FT                   /note="HMMPfam hit to PF00376, Bacterial regulatory
FT                   protein, MerR, score 3.7e-11"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   CDS_pept        complement(489858..490169)
FT                   /transl_table=11
FT                   /locus_tag="SSU0456"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45031"
FT                   /protein_id="CAR45031.1"
FT                   /translation="MPLRHYQSHEYQYEEYIPKEKKANFQTYQAKNANKERLKELLFFV
FT                   NIAFFSLITVIASYVYLSVGIPVFIAIILASATGFLGLRLVQIGLKKKFKPKQVIRKN"
FT   misc_feature    complement(join(489912..489980,489990..490049))
FT                   /locus_tag="SSU0456"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0456 by TMHMM2.0 at aa 41-60 and 64-86"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        490330..491259
FT                   /transl_table=11
FT                   /locus_tag="SSU0457"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45033"
FT                   /protein_id="CAR45033.1"
FT                   /translation="MEKIIITATAESIEQVKELLVAGVDRIYVGEADHALRIPTNFTYD
FT                   ELREIAELVHSAGKELTVAANALMHQDMMDNIKPFMELMREIKVDYLVVGDTGIFYINK
FT                   RDGYNFKLIYDTSVFVTSSRQINFWKDHGAVEAVLAREIPSEELFDIAKNLEMPAEILV
FT                   YGASVIHHSKRTLLQNYYNFTKADETDLSRGRGLFLAEPSDPDSHYSIFEDKHGTHIFI
FT                   NNDIDMMTKLSELDEHGYHNWKLDGIYCPGQNFVEIVKLFVQARDLIEKGDFTYDQAFL
FT                   LDEQVRKLHPAERGLDTGFYEFDRNKVK"
FT   misc_feature    490549..491250
FT                   /locus_tag="SSU0457"
FT                   /note="HMMPfam hit to PF01136, Peptidase U32, score
FT                   9.7e-74"
FT                   /inference="protein motif:HMMPfam:PF01136"
FT   CDS_pept        491554..492843
FT                   /transl_table=11
FT                   /locus_tag="SSU0458"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45037"
FT                   /protein_id="CAR45037.1"
FT                   /translation="MMSKTLKRPEVLSPAGTLEKLKVAIDYGADAVFVGGQAYGLRSRA
FT                   GNFTMDEMREGIEYAHARGAKVYVAANMVTHEGNEEGAGAWFRELRDMGLDAVIVSDPA
FT                   LIVICATEAPGLEIHLSTQASSTNYETFEFWKELGLTRVVLAREVTMEEVAEIRKRTDV
FT                   EIEAFVHGAMCISYSGRCVLSNHMSKRDANRGGCSQSCRWKYNLYDLPFGEERRSIKGE
FT                   IPEEFSMSAVDMCMIDHIPDMIENGVDSLKIEGRMKSVHYVSTVTNCYKAAVDAYLESP
FT                   ERFEAIKQDLIDEMWKVAQRELATGFYYSPPSENEQLFGARRKIPEYKFIAEVVAFDKE
FT                   TMTATIRQRNVINEGDQVEFYGPGFRHFETTIQDLHDSNGEKIDRANKPMELLTIKLDR
FT                   EIYPGDMIRACKSGLINLYQEDGQSLTIRA"
FT   misc_feature    491791..492495
FT                   /locus_tag="SSU0458"
FT                   /note="HMMPfam hit to PF01136, Peptidase U32, score
FT                   6.8e-128"
FT                   /inference="protein motif:HMMPfam:PF01136"
FT   misc_feature    492049..492105
FT                   /note="PS01276 Peptidase family U32 signature."
FT                   /inference="protein motif:Prosite:PS01276"
FT   CDS_pept        492969..493085
FT                   /transl_table=11
FT                   /locus_tag="SSU0459"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45038"
FT                   /protein_id="CAR45038.1"
FT                   /translation="MLRKCYLQPPKVPQTFGASTKSKLKDYKKAEISASERR"
FT   CDS_pept        complement(493259..493582)
FT                   /transl_table=11
FT                   /locus_tag="SSU0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45039"
FT                   /protein_id="CAR45039.1"
FT                   /translation="MKRFLEVIFEQFTIFLEHGKAPKSIEPDSKEEIKNNLELALYKKA
FT                   AVHVIYGDRSFTGDIVKYDTDRQRIIMKNFKRQVTSIIKIEDIKKVTLVPDSIKTSQQQ
FT                   TKG"
FT   CDS_pept        493674..493889
FT                   /transl_table=11
FT                   /locus_tag="SSU0461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45040"
FT                   /protein_id="CAR45040.1"
FT                   /translation="MAEFTFEIEEKLLVLSENDKGWTKELNRVSFNGAPAKYDIRTWSP
FT                   DHTKMGKGITLSNEEFQVLLDAFANK"
FT   CDS_pept        complement(493901..494440)
FT                   /transl_table=11
FT                   /locus_tag="SSU0462"
FT                   /product="BioY family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45042"
FT                   /protein_id="CAR45042.1"
FT                   /translation="MKTTSIKSLVYIAIGTALISTLSQISLSIGPVPFTLQTLAIGLVA
FT                   CLYKPKEAITSVSLYLVLGAIGLPVFAGFSGGFAALTGPTSGFLWGFLLYTIITSALTK
FT                   SDSSPVTIFLACLLGTSICFLLGCCVFKLVSGASWTDTIGWTVLPFILPDLAKITLVMI
FT                   CHRLLQPVIKKEAYFA"
FT   misc_feature    complement(493925..494368)
FT                   /locus_tag="SSU0462"
FT                   /note="HMMPfam hit to PF02632, BioY protein, score 4.1e-27"
FT                   /inference="protein motif:HMMPfam:PF02632"
FT   misc_feature    complement(join(494048..494116,494144..494212,
FT                   494216..494284,494354..494422))
FT                   /locus_tag="SSU0462"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSU0462 by TMHMM2.0 at aa 7-29, 53-75, 77-99 and 109-131"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(494357..494440)
FT                   /locus_tag="SSU0462"
FT                   /note="Signal peptide predicted for SSU0462 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.961) with cleavage site
FT                   probability 0.323 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        494645..495382
FT                   /transl_table=11
FT                   /locus_tag="SSU0463"
FT                   /product="putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45044"
FT                   /protein_id="CAR45044.1"
FT                   /translation="MTELLDIYRTLKSKTWVDLTHQINEKSPHFPALPALEKKALFTHK
FT                   DGFFVEQFTVVGQYGTHIDPPIHFVEGARYLDEIDLKDLLLPLYVIDKSAAVIENNDYE
FT                   ITKQDILDFEAEYGPIAPKSFVAFRSDLSKRWPSQDAIRNLDEDGVQRTPGWSHEALEY
FT                   LIEERQVKAVGHETLDTDSGVSAAKHGGSLSEEYYLLSKDIYQLEVLANLDQVPPTGAL
FT                   ISIAFPHWEKASGSPVRAIAILP"
FT   misc_feature    494690..495334
FT                   /locus_tag="SSU0463"
FT                   /note="HMMPfam hit to PF04199, Putative cyclase, score
FT                   1.3e-52"
FT                   /inference="protein motif:HMMPfam:PF04199"
FT   CDS_pept        complement(495432..496781)
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="SSU0464"
FT                   /product="glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45045"
FT                   /protein_id="CAR45045.1"
FT                   /translation="MKVFDIIAIGGGSGGIATMNRAAMYGAKAAVIEGSYLGGTCVNLG
FT                   CVPKKIMWYGSQVAEAIQHYGPEYGFTSQEVTFDFATLRKNREAYIERSRASYGNTFNN
FT                   NEVEVIQGFARFVDNQTVEVNGELIRAKHIVITTGAKPVVPAIPGSELGIVSDDVFAWE
FT                   ELPSSVAVIGAGYIAVEMAGLLHGLGVQTDLFVRGNRPLRSFDTYIVDALMEEMQRTNL
FT                   PLHTGKTPVSLEKTDDGQIQINFADGSNHIAQKVLWAIGRKPNIDKLNLKATSVQLTSS
FT                   GHISVNEYQETAVPGIYALGDVTGEKELTPVAIKAGRLLAERLFNNKPTAKMDYTTIPT
FT                   VVFSHPAIGTVGLTEDEAITQYGQDNVKVYTSAFTSMYTALENNRQMAKFKLVTVGENE
FT                   KVVGLHGIGYGVDEMIQGFSVAIKMGATKEEFDAVVAIHPTGSEEFVTMR"
FT   misc_feature    complement(495435..495770)
FT                   /gene="gor"
FT                   /locus_tag="SSU0464"
FT                   /note="HMMPfam hit to PF02852, Pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region,
FT                   score 1.5e-47"
FT                   /inference="protein motif:HMMPfam:PF02852"
FT   misc_feature    complement(495861..496769)
FT                   /gene="gor"
FT                   /locus_tag="SSU0464"
FT                   /note="HMMPfam hit to PF07992, FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase, score 1.6e-59"
FT                   /inference="protein motif:HMMPfam:PF07992"
FT   misc_feature    complement(495999..496280)
FT                   /gene="gor"
FT                   /locus_tag="SSU0464"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreductase, NAD-binding region,
FT                   score 1.8e-27"
FT                   /inference="protein motif:HMMPfam:PF00070"
FT   misc_feature    complement(496638..496670)
FT                   /note="PS00076 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-I active site."
FT                   /inference="protein motif:Prosite:PS00076"
FT   CDS_pept        496995..498152
FT                   /transl_table=11
FT                   /locus_tag="SSU0465"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45047"
FT                   /protein_id="CAR45047.1"
FT                   /translation="MLKTKKAKIALFGGLGVVAVALVGGALIFSNMLTSPSSSEDVAMS
FT                   MTYTVAKEGSIASSTLLTGTITAADEQYVYYDPSKGDLSEVLVAPGAKVEVGTPLIRYD
FT                   ATELQSALDTAVRGRDKIGRQIADLRTNGQTVQTTGDAETDAAATATAQRSVDMQLADL
FT                   NDSYADAQAAVDKAYTALTEATVTSTVAGTVVEVNKAVSKNSTSSQTVVHIVNQGSLQV
FT                   TGSLTEYDLANIAVDQEVKLTSKVYPDKTWTGKITYISNYPSSNQAGAATTGTSGSGAK
FT                   YPFKAALTSELGELKQGFSVNIEVVNTSKNILIPVSAVVPEEDKNYVWTLVDGKAKKVE
FT                   VTLGNADALNQEVTAGIAAGDKVITIPTPNLEDGKEVEANEEPAY"
FT   sig_peptide     496995..497111
FT                   /locus_tag="SSU0465"
FT                   /note="Signal peptide predicted for SSU0465 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.809 between residues 39 and 40"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    497013..497081
FT                   /locus_tag="SSU0465"
FT                   /note="1 probable transmembrane helix predicted for SSU0465
FT                   by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        498133..498828
FT                   /transl_table=11
FT                   /locus_tag="SSU0466"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45049"
FT                   /protein_id="CAR45049.1"
FT                   /translation="MKNQLIRLTSINKSYKNGDQELRVLKNIDLEVEEGEFLAIMGPSG
FT                   SGKSTLMNIIGLLDRFSSGNYWLEGEEVSQLSEKKLAQVRNDQIGFVFQQFFLLSKLNA
FT                   LQNVELPLIYAGVPSSKRKELAKQYLEKVELAERMTHLPSELSGGQKQRVAIARALVNT
FT                   PAIILADEPTGALDTKTGEQIMQLLTELNNEGKTIIMVTHEPEIAAYAKRKIVLRDGVI
FT                   TEDSRREGV"
FT   misc_feature    498235..498792
FT                   /locus_tag="SSU0466"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 4.3e-57"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    498256..498279
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    498568..498612
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        498829..500076
FT                   /transl_table=11
FT                   /locus_tag="SSU0467"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45053"
FT                   /protein_id="CAR45053.1"
FT                   /translation="MENWKFALKSIMAHKMRSLLTMLGIIIGVAAVVIIVAMGTGVAKS
FT                   IEKSLAGDQNNVQVYFTAFSSSGTAFGPFGTASTEEPILEEEPDLTDSTLKGLLEIDGV
FT                   SNYYSSISNIAEVRSGNKKAENVTITGVSQNFFAVKEYEILAGRQFTANDYSRFSRMIM
FT                   LDTALAEKLFGSIENSLNQTISVNSNAYLVIGVYKDPKAGTAIYGMNSGGNAVMTNTQL
FT                   AAETGMKENSQIFVHVEDVTRATEVGKAAADYLTKATGLKEARYEIYDMSAMLEEFKSQ
FT                   MSGVTLFIGAVAGISLLVGGIGVMNIMLVSVTERTREIGLRKALGATRGNILIQFLIEA
FT                   MVLTTLGGAIGLAIAQTIVFLLNVSKALGERIAAEISIPVVLGSLAFSAVVGIVFGVLP
FT                   ANKASKLDPIEALRYE"
FT   sig_peptide     498829..498963
FT                   /locus_tag="SSU0467"
FT                   /note="Signal peptide predicted for SSU0467 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.550 between residues 45 and 46"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(498886..498954,499690..499758,499816..499911,
FT                   499954..500022)
FT                   /locus_tag="SSU0467"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSU0467 by TMHMM2.0 at aa 20-42, 288-310, 330-361 and
FT                   376-398"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    499519..500052
FT                   /locus_tag="SSU0467"
FT                   /note="HMMPfam hit to PF02687, Protein of unknown function
FT                   DUF214, permase predicted, score 3.8e-49"
FT                   /inference="protein motif:HMMPfam:PF02687"
FT   CDS_pept        500202..501266
FT                   /transl_table=11
FT                   /locus_tag="SSU0468"
FT                   /product="luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45054"
FT                   /protein_id="CAR45054.1"
FT                   /translation="MVELGISTFGETTPLEKTGETYSHDERIRQLVKEIELADAVGLDV
FT                   YGIGEHHREDFAVSAPEIVLAAGAVNTKHIKLTSAVSILSSMDPVRLYQQYTTIDALSN
FT                   GRAEIMAGRGSFTESFPLFGYDLHDYEELFDEKLDMLLEIGKETNLKWDGHFTQSVDNK
FT                   PVYPRPVQEDFPIWVATGGNVESTIKIAKKGLPIVYAVIGAGAHRFKPLVDAYRKVARN
FT                   SGHDPKKTKVAAHSWGWIADDHDKAVEEYYHPTKVITDNIAKDRPHWSEMTKAQYLYSL
FT                   TDEGATIVGDPKRVAEKIIKTIETLDLDRFFLHLPIGSMPHEDVLRAIELYGKEVVPIV
FT                   RDYFAKKEENQSQD"
FT   misc_feature    500205..501221
FT                   /locus_tag="SSU0468"
FT                   /note="HMMPfam hit to PF00296, Bacterial luciferase-like,
FT                   score 2.4e-22"
FT                   /inference="protein motif:HMMPfam:PF00296"
FT   CDS_pept        complement(501466..501702)
FT                   /transl_table=11
FT                   /locus_tag="SSU0469"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45055"
FT                   /protein_id="CAR45055.1"
FT                   /translation="MEIPRVFLHSKIPTTWSGFSGDYEKYLGLGVGKNSNNHREFVNKF
FT                   IFPVVELKQSIPRLFHSHPRTAPKVWGTFGGRR"
FT   CDS_pept        complement(501854..503344)
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SSU0470"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45058"
FT                   /protein_id="CAR45058.1"
FT                   /translation="MSTEHFEELNDQQIVRREKMTALAEQGIDPFGKRFERSANSAELK
FT                   AQYEDKSKEDLEELGQTAIIAGRIMTKRGKGKAGFAHIQDREGQIQIYVRKDDVSEENY
FT                   EIFKKADLGDFIGVEGDVFKTNVGELSIHARKLTHLSKALRPLPEKFHGLTDIETRYRK
FT                   RYLDLITNRESFDRFVTRSKIISEIRRYLDGLGFLEVETPVLHNEAGGAAARPFITHHN
FT                   AQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADY
FT                   QDIMDLTEGIIQHTAKAVVGDGPVTYQGTEIAIHEPFKRIHMVDAIKEQTGVDFWQEMS
FT                   FEEAKALAAEHKVPVEKHHTEVGQIINSFFEEYVEATLIQPTFVYGHPVAVSPLAKKND
FT                   EDPRFTDRFELFIMTKEYGNAFTELNDPIDQLERFEAQAKAKELGDDEATGVDYDYIEA
FT                   LEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK"
FT   misc_feature    complement(501857..502879)
FT                   /gene="lysS"
FT                   /locus_tag="SSU0470"
FT                   /note="HMMPfam hit to PF00152, Aminoacyl-tRNA synthetase,
FT                   class II (D, K and N), score 7.1e-119"
FT                   /inference="protein motif:HMMPfam:PF00152"
FT   misc_feature    complement(501908..501937)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   misc_feature    complement(502526..502579)
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00179"
FT   misc_feature    complement(502925..503158)
FT                   /gene="lysS"
FT                   /locus_tag="SSU0470"
FT                   /note="HMMPfam hit to PF01336, Nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type, score 8.1e-20"
FT                   /inference="protein motif:HMMPfam:PF01336"
FT   CDS_pept        complement(503447..504073)
FT                   /transl_table=11
FT                   /locus_tag="SSU0471"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45062"
FT                   /protein_id="CAR45062.1"
FT                   /translation="MKIYFVRHGKTEWNLEGRFQGYSGDSALLPESYQDLEKLGKYLAE
FT                   IPFDAIYSSDLQRAHSTAVEIAKANHHCQTVLTTQQLREWNFGTLEGSKMAIFRAIYPK
FT                   QAWALKHNLALFNNDLFEAESVRQVTQRMVDFVQSLKGQDMETVLIVSHGAFLTASIHR
FT                   LLGFPPAQLRHRGGLDNASVTILETSDFENFTELAWNDTSYKAKQ"
FT   misc_feature    complement(503594..504070)
FT                   /locus_tag="SSU0471"
FT                   /note="HMMPfam hit to PF00300, Phosphoglycerate mutase,
FT                   score 3.5e-43"
FT                   /inference="protein motif:HMMPfam:PF00300"
FT   CDS_pept        complement(504076..504558)
FT                   /transl_table=11
FT                   /locus_tag="SSU0472"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45064"
FT                   /protein_id="CAR45064.1"
FT                   /translation="MAKKVKIKKTLVDQILDKAKINHDSLVLNAFEGQLPPGIEEHEIY
FT                   KTLALTGDKTGPIIGIIPITEHLSEKKLAKISGNKKVSMIPQKDLEKTTGYIHGANNPV
FT                   GIRQKHNFPIYIDQSALELGHLIVSAGEIGRSIRIDSQVLADFVKADFADLIEGRD"
FT   misc_feature    complement(504094..504507)
FT                   /locus_tag="SSU0472"
FT                   /note="HMMPfam hit to PF04073, YbaK/prolyl-tRNA synthetase
FT                   associated region, score 7e-54"
FT                   /inference="protein motif:HMMPfam:PF04073"
FT   CDS_pept        complement(504558..505400)
FT                   /transl_table=11
FT                   /locus_tag="SSU0473"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45065"
FT                   /protein_id="CAR45065.1"
FT                   /translation="MASWISRIIKGMIIALGFILPGVSGGVLAAILGIYERLIGFLANI
FT                   RKDFKENFLYFVPVGIGGILGIALFSFPVEFLLQHFQVPVLWAFAGAIVGTIPSLLKES
FT                   TQKSKRDSIDLAWLIGTFIISGLLLYNLSDLVGTLPATFASFVLAGALIALGVLVPGLS
FT                   PSNLLLILGIYTPMLNGFKSLDLFGTFLPIAIGGVLAMVAFSKAMDHALKVYHSRVYHF
FT                   IIGIVSSSTLLILIPQASNKESISYAGANFVTWIAAIVLFILGAWLGLWMSKLEEKYK"
FT   misc_feature    complement(join(504588..504647,504690..504749,
FT                   504786..504845,504918..504986,505005..505058,
FT                   505101..505154,505173..505241,505299..505367))
FT                   /locus_tag="SSU0473"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSU0473 by TMHMM2.0 at aa 12-34, 54-76, 83-100, 115-132,
FT                   139-161, 186-205, 218-237 and 252-271"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(504591..505391)
FT                   /locus_tag="SSU0473"
FT                   /note="HMMPfam hit to PF04018, Protein of unknown function
FT                   DUF368, score 3.9e-107"
FT                   /inference="protein motif:HMMPfam:PF04018"
FT   sig_peptide     complement(505314..505400)
FT                   /locus_tag="SSU0473"
FT                   /note="Signal peptide predicted for SSU0473 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.908) with cleavage site
FT                   probability 0.852 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(505503..506051)
FT                   /transl_table=11
FT                   /locus_tag="SSU0474"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45067"
FT                   /protein_id="CAR45067.1"
FT                   /translation="MPTSKLPILAEVAIFSAIALVFDKIPLFTMPQGGSVSLVMLPILL
FT                   LALRHGLGVGVLTGGIVGTIQLFYGGYFLNVFQVFLDYAFSYAGIGLAGLVAPTLSKQN
FT                   NLKNATLIITLASFLGGSIRLLATFLSGIIFYADYAPDGMPVWFYSFTYNISYILPSTA
FT                   IASILLILLYRARPGFYNL"
FT   misc_feature    complement(join(505533..505601,505644..505712,
FT                   505749..505817,505830..505898,505911..505979))
FT                   /locus_tag="SSU0474"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0474 by TMHMM2.0 at aa 25-47, 52-74, 79-101, 114-136 and
FT                   151-173"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_RNA        complement(506110..506205)
FT                   /note="TPP riboswitch (THI element) (RF00059) as predicted
FT                   by Rfam, score 76.06"
FT   CDS_pept        complement(506229..507083)
FT                   /transl_table=11
FT                   /locus_tag="SSU0475"
FT                   /product="glycosyl hydrolases family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45069"
FT                   /protein_id="CAR45069.1"
FT                   /translation="MRKKLNPMIVVGFFLSFFALIFITGVTGNTVNKTEVANEPAVTQS
FT                   NTSTSSKTTNSSSSYYIANALEMKPIIDVSAWQRPSEIDYDTLSKNISGAIVRIQSGSH
FT                   TKNENTATDKNGLDKSFDTHIKEFQARNIPVAVYAYVTGNSIENMREEARSFYKAANKY
FT                   KPTFYWLDVEEYTMDDMNAGVEAFRKELETLGAKNIGIYVGTYFMEDHSINVDKFDAIW
FT                   IPTYGDDSGYYNAAPNTDLNYDLHQYTSRGYVNGFEHHLDLNIITTLKDPNEVYQKLFT
FT                   TPE"
FT   misc_feature    complement(506313..506870)
FT                   /locus_tag="SSU0475"
FT                   /note="HMMPfam hit to PF01183, Glycoside hydrolase, family
FT                   25, score 7.6e-07"
FT                   /inference="protein motif:HMMPfam:PF01183"
FT   sig_peptide     complement(506985..507083)
FT                   /locus_tag="SSU0475"
FT                   /note="Signal peptide predicted for SSU0475 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.973) with cleavage site
FT                   probability 0.404 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(506991..507059)
FT                   /locus_tag="SSU0475"
FT                   /note="1 probable transmembrane helix predicted for SSU0475
FT                   by TMHMM2.0 at aa 2-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        507196..507615
FT                   /transl_table=11
FT                   /locus_tag="SSU0476"
FT                   /product="putative membrane protein"
FT                   /note="Possible gene remnant. Similar to the C-terminal
FT                   regions of many protein, for example, Streptococcus mutans
FT                   hypothetical protein SMU.709. UniProt:Q8DV12
FT                   (EMBL:AE014914) (174 aa) fasta scores: E()=5.2e-09, 38.281%
FT                   id in 128 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45070"
FT                   /protein_id="CAR45070.1"
FT                   /translation="MHDKSEKVRRVSQLVVLSYFSLLESWILMILVMVGSGLLFGFGTV
FT                   VLWQVLSFAFIQFIWWLAIGPFIKKENIPLWLQSLLAGILVFLYGLTISFLSATQFGTS
FT                   PIVFWLNGLVFDSLHATSTVLFYPIIDYIFRRFYK"
FT   misc_feature    join(507232..507300,507328..507396,507415..507483,
FT                   507511..507579)
FT                   /locus_tag="SSU0476"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSU0476 by TMHMM2.0 at aa 13-35, 45-67, 74-96 and 106-128"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        507612..507977
FT                   /transl_table=11
FT                   /locus_tag="SSU0477"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45072"
FT                   /protein_id="CAR45072.1"
FT                   /translation="MKKISIMLMVVFSLFLAACTNTTEKQNNSAIEVTLQITTKDKENR
FT                   QEVTAEEGDSVMDVLKEHHDIVEDNGLITEIDGVSQDTSTNTYWMYKVNGQMADKGAKD
FT                   LTVANGDEIEFYLETFE"
FT   sig_peptide     507612..507686
FT                   /locus_tag="SSU0477"
FT                   /note="Signal peptide predicted for SSU0477 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.439 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    507636..507668
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        508114..509328
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="SSU0478"
FT                   /product="putative cell division protein"
FT                   /note="CDS is truncated at the C-terminus in comparison to
FT                   orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45075"
FT                   /protein_id="CAR45075.1"
FT                   /translation="MKIDKRQLLNYSILIPYLILSVIGLVMVYSTTSATQIINGGNPFR
FT                   TVINQAGFWIVSLVAIYTIYRMKLSFLRKKAVIYSVILVEVFLLAISRLFPPINGAHGW
FT                   IPLPIAGTLQPAEYLKLIIIWYLAHEFAKQQADIRTYDYVSLIKGSWIPKEFTDWRVVS
FT                   LLLLGLVATLPDLGNATIIVLIMVVMISVSGIAYRWFSTAVLGIVAASTVILGTIRILG
FT                   VETVEKIPLFGYIARRFAAYFDPFGNATNSGLQLTHSYYAMSNGGWLGRGLGNSIEKKG
FT                   YLPEAHTDFAFSIVIEELGFVGASLILALLFFLIIRIIIVGVRARSPFNAMMALGMAGM
FT                   LLIQTFVNIGGISGIIPATGVTFPFLSQGGSSLLIISIGIGFVLNIDASEKRRLIEEEI
FT                   ERTLI"
FT   sig_peptide     508114..508215
FT                   /gene="ftsW"
FT                   /locus_tag="SSU0478"
FT                   /note="Signal peptide predicted for SSU0478 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.885) with cleavage site
FT                   probability 0.506 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(508138..508206,508249..508308,508342..508401,
FT                   508621..508689,508708..508776,509008..509076,
FT                   509113..509181,509194..509262)
FT                   /gene="ftsW"
FT                   /locus_tag="SSU0478"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSU0478 by TMHMM2.0 at aa 9-31, 46-65, 77-96, 170-192,
FT                   199-221, 299-321, 334-356 and 361-383"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    508141..509289
FT                   /gene="ftsW"
FT                   /locus_tag="SSU0478"
FT                   /note="HMMPfam hit to PF01098, Cell cycle protein, score
FT                   7.3e-83"
FT                   /inference="protein motif:HMMPfam:PF01098"
FT   CDS_pept        509349..512045
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="SSU0479"
FT                   /product="putative phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45076"
FT                   /protein_id="CAR45076.1"
FT                   /translation="MAIQKLENYNNKEAIREEVTILTSILEEVAAQMMPAETFAKIVEL
FT                   SQLSRQDDYQALIAIISQLNNDELAVISRYFAVLPLLINISEDVDLAYEINHQNNIDQD
FT                   YLGKISTTIDMVSKQENAAEILEKLNVVPVLTAHPTQVQRQSMLDLTKHIHELLRRYRD
FT                   VKLGLLNKNKWEDELRCYIEIIMQTDMIREKKLKVTNEITNVMEYYNSSFIKAVTKLQR
FT                   EYKRLAAEKGIVLNNPRPITMGMWIGGDRDGNPFVTAETLKLSALTQCEVIMNYYDEQL
FT                   YKLYRNFSLSTSIVNVSTAVKMLADLSEDSSVYRENEPYRRAFHYIQMKLANTRDYLVH
FT                   NKPSDVRYSNVAEFKADLLAIKQSLVENKSMALLKGDFTELLEAVEAFGFYLASIDMRQ
FT                   DSSIHEASVAELLASARIVEDYSSLSEEAKCHVLLKQLETDPRILSATHMPKSEQLEKE
FT                   LAIFAAARELKDKLGEEIIKQHIISHSESVSDLLELAVLLKEVGLVDVDKARVQIVPLF
FT                   ETIEDLDNAPDTMRQYLQLDLAKRWIAGNKYYQEIMLGYSDSNKDGGYLSSGWTLYKAQ
FT                   NELTQIGQDYGVNITFFHGRGGTVGRGGGPSYDAITSQPFGSIKDRLRLTEQGEVIGNK
FT                   YGNKDAAYYNLEMLVSATLDRMVTQMITDPNEIDGYRETMDEIVSDSYRIYRDLVFNNP
FT                   HFYDYFFAASPIREVSSLNIGSRPAARKTITEIGGLRAIPWVFSWSQNRVMLPGWYGVG
FT                   SSFKRFIDKHPDNLSKLQKMYESWPFFRSLLSNVDMVLSKSNMNIAFEYAKMCESEEVR
FT                   NIFHVILDEWQLTKEIILSIEQNDELLAELPFLKASLDYRMPYFNVLNYIQIELIHRLR
FT                   RGELSKEQENLIHITINGVATGLRNSG"
FT   misc_feature    509349..512042
FT                   /gene="ppc"
FT                   /locus_tag="SSU0479"
FT                   /note="HMMPfam hit to PF00311, Phosphoenolpyruvate
FT                   carboxylase, score 1.6e-92"
FT                   /inference="protein motif:HMMPfam:PF00311"
FT   misc_feature    511002..511040
FT                   /note="PS00393 Phosphoenolpyruvate carboxylase active site
FT                   2."
FT                   /inference="protein motif:Prosite:PS00393"
FT   CDS_pept        512160..512663
FT                   /transl_table=11
FT                   /locus_tag="SSU0480"
FT                   /product="RNA polymerase sigma factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45078"
FT                   /protein_id="CAR45078.1"
FT                   /translation="MSIKLDQYEKEVIGIAEEISYYLQKSGANYADSQDIAQDILVKIL
FT                   EAELVLPFEKLRAWLYRSAVRAYIDKYRRDKRYHEILQKEFFTPENFLVYDQEDYEELY
FT                   QAVADLPEKYQQVIDLYYFQDMSIKEIAHILGAGQSWVKISLHRGRKQLRKILEERGYD
FT                   YEDF"
FT   misc_feature    512223..512393
FT                   /locus_tag="SSU0480"
FT                   /note="HMMPfam hit to PF04542, RNA polymerase sigma-70
FT                   region 2, score 0.00024"
FT                   /inference="protein motif:HMMPfam:PF04542"
FT   misc_feature    512457..512618
FT                   /locus_tag="SSU0480"
FT                   /note="HMMPfam hit to PF08281, RNA polymerase sigma factor
FT                   70, region 4 type 2, score 7.3e-15"
FT                   /inference="protein motif:HMMPfam:PF08281"
FT   misc_feature    512535..512600
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1396.000, SD 3.94 at aa 126-147, sequence
FT                   MSIKEIAHILGAGQSWVKISLH"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        512650..513615
FT                   /transl_table=11
FT                   /locus_tag="SSU0481"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45080"
FT                   /protein_id="CAR45080.1"
FT                   /translation="MKTFEEVTKKSKRKNLWKTVGLSSFIGFILLLIGIQTVKIIVGAR
FT                   EGSENWKQIILMEISYPNIKHDGIKIQSTSYVSGKLYCNLYKDLAGVPMAFGQHEIYYD
FT                   LFDRHYDFAQHIPGNTFKYLYDFTTNTKIPVFYNRKKSVWSVQDIANELHYLKDMSGQL
FT                   VEVAISFDKKYSLAEIKQMIPSNLKQNWYWIGTEGKQNTHYYRPEQLLGLDPEDIQLVF
FT                   SDMPGDYMTGMDFMKEFLESGDQKRAQYLDIPVDDLQAFVDKFGDTDFTKQEEIDKLEF
FT                   AGIILTGKAEDFAQLEGKDWIYSSSIGASIPIQPYYQLHH"
FT   sig_peptide     512650..512781
FT                   /locus_tag="SSU0481"
FT                   /note="Signal peptide predicted for SSU0481 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.984) with cleavage site
FT                   probability 0.937 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    512707..512775
FT                   /locus_tag="SSU0481"
FT                   /note="1 probable transmembrane helix predicted for SSU0481
FT                   by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        513971..515167
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /gene_synonym="tuf"
FT                   /locus_tag="SSU0482"
FT                   /product="elongation factor Tu (EF-Tu)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45081"
FT                   /protein_id="CAR45081.1"
FT                   /translation="MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVN
FT                   QPKDYASIDAAPEERERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDG
FT                   AILVVASTDGPMPQTREHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSE
FT                   YDFPGDDLPVIQGSALKALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPVEDVF
FT                   SITGRGTVASGRIDRGTVRVNDEIEIVGLQEEKSKAVVTGVEMFRKQLDEGLAGDNVGV
FT                   LLRGVQRDEIERGQVISKPGSINPHTKFKGEVYILTKEEGGRHTPFFDNYRPQFYFRTT
FT                   DVTGSIKLPEGTEMVMPGDNVTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA"
FT   misc_feature    513998..514591
FT                   /gene="tufA"
FT                   /gene_synonym="tuf"
FT                   /locus_tag="SSU0482"
FT                   /note="HMMPfam hit to PF00009, Protein synthesis factor,
FT                   GTP-binding, score 4.9e-101"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    514025..514048
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    514130..514177
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    514652..514864
FT                   /gene="tufA"
FT                   /gene_synonym="tuf"
FT                   /locus_tag="SSU0482"
FT                   /note="HMMPfam hit to PF03144, Translation elongation
FT                   factor EFTu/EF1A, domain 2, score 1.5e-23"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    514877..515161
FT                   /gene="tufA"
FT                   /gene_synonym="tuf"
FT                   /locus_tag="SSU0482"
FT                   /note="HMMPfam hit to PF03143, Translation elongation
FT                   factor EFTu/EF1A, C-terminal, score 2e-60"
FT                   /inference="protein motif:HMMPfam:PF03143"
FT   CDS_pept        515342..516094
FT                   /transl_table=11
FT                   /gene="tpi"
FT                   /gene_synonym="tpiA"
FT                   /locus_tag="SSU0483"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45083"
FT                   /protein_id="CAR45083.1"
FT                   /translation="MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPA
FT                   VDLNALLWFAKDSELKVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFH
FT                   ETDEDINKKAHAIFRNGLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTADQVASL
FT                   VIAYEPIWAIGTGKSATKDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAE
FT                   YMACPDVDGALVGGASLEAESFLALLNF"
FT   misc_feature    515354..516085
FT                   /gene="tpi"
FT                   /gene_synonym="tpiA"
FT                   /locus_tag="SSU0483"
FT                   /note="HMMPfam hit to PF00121, Triosephosphate isomerase,
FT                   score 3.3e-132"
FT                   /inference="protein motif:HMMPfam:PF00121"
FT   misc_feature    515837..515869
FT                   /note="PS00171 Triosephosphate isomerase active site."
FT                   /inference="protein motif:Prosite:PS00171"
FT   CDS_pept        complement(516147..516956)
FT                   /transl_table=11
FT                   /locus_tag="SSU0484"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45087"
FT                   /protein_id="CAR45087.1"
FT                   /translation="MSIKLVAIDIDGTLLNSQHQITAEVHSTIQEAKKAGVKIVIATGR
FT                   PISGVQAILEELNLTEAGDYVITFNGGLVQDAATGEDIVKDTLTYEDYLDIESAARKLK
FT                   LPMHASTKEGIYTANRNIGKYTIYESTLVSAPIFYRTPEEMADKEIIKTMMVDEPEILD
FT                   AAIPLLPTILTEKYNVAKSAPFYLEITPKTVNKGQAIIHLAEKLGLTMDQTMAIGDQEN
FT                   DRPMLEVVGNPVVMENGNPELKKIAKYITKSNDESGVAHAFREWVLK"
FT   misc_feature    complement(516168..516941)
FT                   /locus_tag="SSU0484"
FT                   /note="HMMPfam hit to PF08282, HAD superfamily
FT                   hydrolase-like, type 3, score 5.8e-103"
FT                   /inference="protein motif:HMMPfam:PF08282"
FT   misc_feature    complement(516240..516308)
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT                   /inference="protein motif:Prosite:PS01229"
FT   misc_feature    complement(516909..516944)
FT                   /note="PS01228 Hypothetical cof family signature 1."
FT                   /inference="protein motif:Prosite:PS01228"
FT   CDS_pept        complement(516946..518259)
FT                   /transl_table=11
FT                   /locus_tag="SSU0485"
FT                   /product="putative phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45089"
FT                   /protein_id="CAR45089.1"
FT                   /translation="MIEKVFRDPVHNYVHVDHELIYKLINTKEFQRLRRIKQLGTTSYT
FT                   FHGGEHSRFSHCLGAYEIARRITQKFEDKYPQIWDTNESLLTMVAALLHDVGHGAYSHT
FT                   FERLFDTDHEEMTCAIITSPETEINALLKQVSPEFPDKVASVIKHTYPNKQVVQLISSQ
FT                   IDVDRMDYLLRDSYFTGANYGEFDLTRILRVIRPTENGIAFKESGMHAVEDYVLSRYQM
FT                   YMQVYFHPASRSMEVLLQNLLNRAKLLYTGEQEFFARTSPRLLPFFEHRIRLTDYLSLD
FT                   DGVMNTYFQSWIDGPDRILSDLAQRYINRKVLKSITFKAEEEEALDRLRSLVADVGFDP
FT                   EYYTAIHHNFDLPYDIYRPNAEKKRTQIEIYRKDETLVELSSLSPIVHSLSGTIHGDSR
FT                   FYFPKEMLEETGIFAPQIADFNSHIHNDHFIIGESNEH"
FT   misc_feature    complement(517735..518103)
FT                   /locus_tag="SSU0485"
FT                   /note="HMMPfam hit to PF01966, Metal-dependent
FT                   phosphohydrolase, HD region, subdomain, score 2.1e-08"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS_pept        518358..519245
FT                   /transl_table=11
FT                   /locus_tag="SSU0486"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45092"
FT                   /protein_id="CAR45092.1"
FT                   /translation="MNNQIILLTIQVFIVALILWMLYTILSYAKKHDISLKEKFWTGFG
FT                   IGYVTDLLDTLGIGTFATTTTMFKLTKLVEDDRKIPATMTTAHIIPVLVEALLFITIVE
FT                   VDMVTLIAMAAAAFTGAFVGAKVTQKWDTKKVQRILGILLIIAACFMVYRMITNPGADL
FT                   TNEVKGLTGWKLAVGIAFDFMVGMLMSMGLGNYAPELIFFSLMGISPAVALPVMMLNAA
FT                   MIMTAGAKQFIQSGRVNWPGVPGIVVGGVLGVLTAAFFLSNLDINNLKILVVFIAAYTG
FT                   FTLLRSSFVTRIKK"
FT   misc_feature    join(518370..518438,518475..518543,518643..518711,
FT                   518772..518825,518868..518936,518955..519023,
FT                   519081..519149,519168..519227)
FT                   /locus_tag="SSU0486"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSU0486 by TMHMM2.0 at aa 5-27, 40-62, 96-118, 139-156,
FT                   171-193, 200-222, 242-264 and 271-290"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    518643..518813
FT                   /locus_tag="SSU0486"
FT                   /note="HMMPfam hit to PF01925, Protein of unknown function
FT                   DUF81, score 2.2e-08"
FT                   /inference="protein motif:HMMPfam:PF01925"
FT   CDS_pept        519257..519643
FT                   /transl_table=11
FT                   /locus_tag="SSU0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45093"
FT                   /protein_id="CAR45093.1"
FT                   /translation="MDIHLRNEIDLDGQIEVVDQQFQVEVKEKDGNLYLIYSNDEAEKV
FT                   VIKCDEEELVMTRFSTPKSIMRFISGKEAIVTIPTPLGIQHFVTDTKRYQLNRSDQSVQ
FT                   LQYELKGLENQQLFASYDLEISWK"
FT   misc_feature    519257..519631
FT                   /locus_tag="SSU0487"
FT                   /note="HMMPfam hit to PF09148, Protein of unknown function
FT                   DUF1934, score 5.6e-08"
FT                   /inference="protein motif:HMMPfam:PF09148"
FT   repeat_region   complement(519645..521181)
FT                   /note="Putative IS element, novel IS"
FT   repeat_region   519655..519670
FT                   /note="Inverted repeat, 16mer"
FT   CDS_pept        complement(519915..521078)
FT                   /transl_table=11
FT                   /locus_tag="SSU0488"
FT                   /product="putative transposase"
FT                   /note="Identical to SSU1631, 100.000% identity (100.000%
FT                   ungapped) in 387 aa overlap (1-387:1-387), SSU1247,
FT                   100.000% identity (100.000% ungapped) in 387 aa overlap
FT                   (1-387:1-387), and SSU1036, 100.000% identity (100.000%
FT                   ungapped) in 387 aa overlap (1-387:1-387)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45096"
FT                   /protein_id="CAR45096.1"
FT                   /translation="MKNKHLTLSDRNDIQIGIEQLKPFSAIAAKLGKDPSTISKEVRRN
FT                   RVIKENSSTSNCEACPLLKKTPYVCNACPKKRSNCGYQKQFYYAKRAQLDYEVKLSDSR
FT                   TGVALNKEEFYRMDEIVSAAIQKGQHLNHIIASNEMSASRASIYRYLEKGYLSTKPIDF
FT                   PRVVKFRKRRIRNLQPIPKIAKEGRSYEDFQRFLTEKGISYWLEMDTVTGRIGGKVLLT
FT                   FNLSFCNFIFAQLLDNKTANEVAKHLYAIKNDLHQKEMDFCEIFPVILTDNGGEFARVD
FT                   DIEMDVRGESKLFFCDPNRSDQKGRIEKNHTLIRDILPKRSSFDNLTQEDINLVCSHIN
FT                   SVKRASFNGKSAYELFTFTYGEELATLLGISKIDPENVIQSPRLLDK"
FT   misc_feature    complement(520008..520487)
FT                   /locus_tag="SSU0488"
FT                   /note="HMMPfam hit to PF00665, Integrase, catalytic core,
FT                   score 9.1e-14"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   misc_feature    complement(520950..521015)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1377.000, SD 3.88 at aa 22-43, sequence
FT                   KPFSAIAAKLGKDPSTISKEVR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   repeat_region   complement(521156..521171)
FT                   /note="Inverted repeat, 16mer"
FT   CDS_pept        521271..522281
FT                   /transl_table=11
FT                   /locus_tag="SSU0489"
FT                   /product="putative adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45097"
FT                   /protein_id="CAR45097.1"
FT                   /translation="MLIVLNVNELVKTELHCHLDGSLSLGVIRQLAQMAKITIPAEDEA
FT                   LRKLVSVHGKVDSLMAYLKLFDFVRPLLQTATALELAAYDLVRQVASDKVIYIEVRFAP
FT                   ELSTDQDLTILEAVSAVLVGLNRGQEDFGVVAKLLVCGLKQTNTNQTKELFLAIADLAP
FT                   KGLVGFDFAGNEADYPTEELRDIIQFTQSLGYPMTFHAGECGCVTNVIQALELGIRRIG
FT                   HGTALTRNPEAIQAFVNSGATLEMCLTSNLQTGAADSIEYFPYRELVEAGANITINTDN
FT                   RTVSNTTLNREYQLFVEYFGTSKADFYRFNQNAIQASFASEEEKKVLLELLDQQY"
FT   misc_feature    521295..522263
FT                   /locus_tag="SSU0489"
FT                   /note="HMMPfam hit to PF00962, Adenosine/AMP deaminase,
FT                   score 1.6e-48"
FT                   /inference="protein motif:HMMPfam:PF00962"
FT   CDS_pept        complement(522325..523107)
FT                   /transl_table=11
FT                   /locus_tag="SSU0490"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45098"
FT                   /protein_id="CAR45098.1"
FT                   /translation="MFKKLLKYEFQSVGKWYLGIYIAAVVLSAVLGFWLQALALRTQAG
FT                   NTEPGGGEMVLLGTSFMTFGILIAALFLSTFVLVINRFRKNVYGRQGYLTMTLPVSSHQ
FT                   IILSKLLASIVWYILAGITCLLSIGIILAVILAASEEAIMPEIQTFVQAIDWTILFSQI
FT                   VYYLIEITTGILLIYFSISVGQLFKDHRFLFAILTYIGILIVTGVFSTFFVLSNLGTAY
FT                   STPFSLYPSPVLALVNIILAFAYYFGTHFIMTKKLNLQ"
FT   misc_feature    complement(join(522355..522423,522466..522534,
FT                   522571..522639,522697..522765,522868..522936,
FT                   522994..523062))
FT                   /locus_tag="SSU0490"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0490 by TMHMM2.0 at aa 16-38, 58-80, 115-137, 157-179,
FT                   192-214 and 229-251"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(522976..523107)
FT                   /locus_tag="SSU0490"
FT                   /note="Signal peptide predicted for SSU0490 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.736) with cleavage site
FT                   probability 0.528 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(523124..523831)
FT                   /transl_table=11
FT                   /locus_tag="SSU0491"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45101"
FT                   /protein_id="CAR45101.1"
FT                   /translation="MSNAYTLVELQQVSKSYGGAVALNNVNLKLAAGKIIGLLGPNGSG
FT                   KTTMIKLINGLLQPEYGQVLINGRTPSPETKAIVSYLPDTTYLDEHMKVLEAVTFFEDF
FT                   YADFDKERALHLLQDLGIDLNSRMKHLSKGNKEKVQLILVMSRQAQLYVLDEPIGGVDP
FT                   AARDYILKTIVNNYSPTASVIISTHLISDVEQILDEVIFLHYGSVIRHGNVDDLRIESG
FT                   ESIDELFRQDFKA"
FT   misc_feature    complement(523214..523735)
FT                   /locus_tag="SSU0491"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 1.9e-33"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(523691..523714)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(523824..524198)
FT                   /transl_table=11
FT                   /locus_tag="SSU0492"
FT                   /product="GntR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45102"
FT                   /protein_id="CAR45102.1"
FT                   /translation="MAWKFDNNIPIYIQISNTIKLQIVTNQLKSGDKLPTVRDLAEIAG
FT                   VNPNTVQRALSDLETEGFVYSVRTTGRFVTDNQELITQTRLHLAQKELENFVNNMLELG
FT                   FRHDELTSQLDDYLKGVTYE"
FT   misc_feature    complement(523977..524168)
FT                   /locus_tag="SSU0492"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory protein
FT                   GntR, HTH, score 5.3e-13"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    complement(524031..524096)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1665.000, SD 4.86 at aa 37-58, sequence
FT                   PTVRDLAEIAGVNPNTVQRALS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        524352..527462
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="SSU0493"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45104"
FT                   /protein_id="CAR45104.1"
FT                   /translation="MLAQLDTKTVYTFMDSMVTIESYVGRAKELGYHALGIMDKNSLYA
FT                   AYSFMESCNKMGLQPIIGCELDWKLQGEEQDITTQLIALTTRGYRNLLKISTAKMTGQD
FT                   DFETIRQYLVDIAVVVPYFSGIEHLELGVNYYIGVTVDTPVQDFKQAPLPIHTVRFFEE
FT                   EQLESLQVLHAIRDNIPLNQVSDVDSRQKLLSADSLTNLFSNRFPQAVDNLRDLVAGIS
FT                   YQLNTDLKLPRFNRDRPAVEELYERSYQGLEEKGLTNSLYKERLEKELSIIHQMEFDDY
FT                   FLIVWDLLRFGRSQGYYMGMGRGSAVGSLVAYALNITGIDPVKHNLLFERFLNAERYSM
FT                   PDIDIDIPDIHRADFIRYVRDRYGSTHAAQIVTYSTFGAKQAIRDVFKRFGTPEYELSN
FT                   ITKKISFRDSLTSAYQRNAAFRQIINSKIEYQKAFAIAQQIEGQPRQTSIHAAGIVMSD
FT                   EELTDTIPLKIGDDMLVTQYDAHAVEANGLLKMDFLGLRNLTFVQKMAEGVRERYQQEI
FT                   DIAKIDLEDKKTLELFAAGRTKGIFQFEQPGAISLLRRVKPGRFEDIVATTSLNRPGAS
FT                   DYSDNFVKRKHGQETVDLLDPTIAPILQPTYGIMLYQEQVMQIAQVYAGFTLGKADLLR
FT                   RAMSKKNAQEMQAMEAEFLQGALKNGHAEENAREIFGMMAKFAGYGFNRSHAYAYSALA
FT                   FQMAYFKSHYTDVFFDVMLNHSSSAYIEDAMQFDFEVARLTINNIPYHDKFDKSKVYLG
FT                   LKTLKGLPKDLALWILDHRPYKSVEDFILRLPDNFKKKDLLIPLIQIGLFDDFDANRKK
FT                   IIENLDNLFVFAEAIGTFFAEESYSWTDVEDYSDSEKFMLEQELLGVGISPHPLVNICR
FT                   ESKRSFTDLADLAVGNRATVLVQIQAIRLIRTKKTGEQMAFLRVTDTKRTLDVTLFPES
FT                   YRQYASILEEGGMGYITGRVQERDGQLQLVLEKLEPVSLEKFWILLENREHDYAVARIL
FT                   DKYRGSIPVVLHYQDSNQTIQAEHHMVMKTPQLEEELSEFVMKTIFR"
FT   misc_feature    524376..524699
FT                   /gene="dnaE"
FT                   /locus_tag="SSU0493"
FT                   /note="HMMPfam hit to PF02811, PHP, C-terminal, score
FT                   2e-14"
FT                   /inference="protein motif:HMMPfam:PF02811"
FT   misc_feature    524922..526334
FT                   /gene="dnaE"
FT                   /locus_tag="SSU0493"
FT                   /note="HMMPfam hit to PF07733, Bacterial DNA polymerase
FT                   III, alpha subunit, score 2.8e-244"
FT                   /inference="protein motif:HMMPfam:PF07733"
FT   misc_feature    526974..527039
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1040.000, SD 2.73 at aa 875-896, sequence
FT                   RSFTDLADLAVGNRATVLVQIQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    527016..527252
FT                   /gene="dnaE"
FT                   /locus_tag="SSU0493"
FT                   /note="HMMPfam hit to PF01336, Nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type, score 7.5e-10"
FT                   /inference="protein motif:HMMPfam:PF01336"
FT   CDS_pept        527547..528557
FT                   /transl_table=11
FT                   /gene="pfk"
FT                   /gene_synonym="pfkA"
FT                   /locus_tag="SSU0494"
FT                   /product="6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45106"
FT                   /protein_id="CAR45106.1"
FT                   /translation="MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVYGINEGYAGMV
FT                   AGDIHELSARSVGDIISRGGTFLCSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDG
FT                   SYHGAMRLTEHGFPAIGVPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRT
FT                   FVVEVMGRHAGDIALWAGIASGADVIVVPEEDFNINDVVDRIKAGYDKGKKHSIIVLAE
FT                   GVMPAAQFAEELKAAGDTSDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGRG
FT                   GLAVGIRNEQMVENPILGTAEEGALFSLTTDGKIVVNNPHKADLELADLNRNLSI"
FT   misc_feature    527550..528380
FT                   /gene="pfk"
FT                   /gene_synonym="pfkA"
FT                   /locus_tag="SSU0494"
FT                   /note="HMMPfam hit to PF00365, Phosphofructokinase, score
FT                   1.4e-182"
FT                   /inference="protein motif:HMMPfam:PF00365"
FT   misc_feature    528276..528332
FT                   /note="PS00433 Phosphofructokinase signature."
FT                   /inference="protein motif:Prosite:PS00433"
FT   CDS_pept        528624..530129
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="SSU0495"
FT                   /product="putative pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45110"
FT                   /protein_id="CAR45110.1"
FT                   /translation="MNKRVKIVATLGPAVEIRGGKKFGDDGYWGEKLDVESSAQKIAAL
FT                   ITEGANVFRFNFSHGDHQEQGDRMATVRRAEEIAGKKVGFLLDTKGPEIRTELFEDDAK
FT                   EYAYTTGDKLRVATKQGIKSTKEVIALNVAGGLDVFDDVEVGKQILVDDGKLGLTVVEK
FT                   DAVNREFVVLVENDGVIAKQKGVNIPYTKIPFPALAERDNADIRFGLEQGLNFIAISFV
FT                   RTAKDVEVVRNICKETGNDHVQLFAKIENQQGIDNIDEIIEAADGIMIARGDMGIEVPF
FT                   EMVPVYQKMIITKVNAAGKAVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLS
FT                   GESANGKYPVESVRTMATIAKNAQTLLNEYGRLNSDQFNRASKTEVIASAVKDACHSMD
FT                   IKLVVTVTETGYSARSISKYRPDADILAVTFTEKVQKSLMLNWGVIPIVTNRPDSTDDM
FT                   FDLAERIAKEQGLVEAGDDIIIVAGVPVGVAGSTNTMRVRTVK"
FT   misc_feature    528627..529742
FT                   /gene="pyk"
FT                   /locus_tag="SSU0495"
FT                   /note="HMMPfam hit to PF00224, Pyruvate kinase, barrel,
FT                   score 1.5e-208"
FT                   /inference="protein motif:HMMPfam:PF00224"
FT   misc_feature    529773..530120
FT                   /gene="pyk"
FT                   /locus_tag="SSU0495"
FT                   /note="HMMPfam hit to PF02887, Pyruvate kinase, alpha/beta,
FT                   score 7.8e-49"
FT                   /inference="protein motif:HMMPfam:PF02887"
FT   CDS_pept        530290..533715
FT                   /transl_table=11
FT                   /locus_tag="SSU0496"
FT                   /product="putative Mac family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45112"
FT                   /db_xref="GOA:C5W022"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR015117"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5W022"
FT                   /protein_id="CAR45112.1"
FT                   /translation="MNIQERFSLRKSAVGLVSVSLLCAIYTSTVAADTVVTGVNEIIEE
FT                   SQVKDEVSIESEKNESLDGSNIEIVEEIADNIPSPVIAEGEVAVEMKVDRGTENVVSRN
FT                   DTEVTTSEQNQIEVTETKEILNQTSYQTESGEQRQIIWAHGITPPAMEQSGGFVKEKYG
FT                   DYLNYTAPFEAGKGYYDTNKSLNASFIDLNLCFAAVSSNMVHWWLEQNSSYVERYLKEK
FT                   KGTVNVEENYAITDLRRYINSFQNQQNSRVFDMFKTYYGYRTNGFVSDALVDLFINGYK
FT                   PKAQGGVNLEDSQLVPDSRGGFFYDVFKEKKLTNRIFSGSYERFGEDVRTVLESKGLLG
FT                   LTYRTLGYATHIVTVWGAEYDNQGKIKAVYITDSDDQQEQIGLKRMGITRDASGNPRLN
FT                   NHMKNNSAGALLDYVHTIRLGQDLWEEYFNPLAKAKETASQTLADTKKALDLSIQGQSE
FT                   LPESMRLIYLEKLNNLYNQGILSIQKAESSEMLSGALENGLNSLKSLDFPISEVGNALA
FT                   PDLPVGDRSTVSDVDSLSSQETSSTNLEADTENAGIIADGTNQLHFPVEAQTTSSVEAE
FT                   GDNVFEQEADTLPIIIENKDEFGSELSRNMQTSETDSLVVAVEEDVKNDEVAQVEELLE
FT                   SEKVENQSSELLSDTLIVESANDKEEDRVEAVVSEQPDSIPHQNVEISLVEPTNVETET
FT                   VVTPINDAATPHGSPTYIDNSVTESVATPLEKDSIQAGETEIAEPTSSESTNVETETVV
FT                   TPVNDVATPHGSPTYIDNSVTESVATPLEKDSIQAGETEIAEPTSSESTNVETETVVTP
FT                   VNDVATPHGSPTYIDNSVTESVATPLEKDSIQAGETEIAEPTSSESTSVEAELVDNSEI
FT                   HAATSSVTPCGSSAYADGSTTESVATPLEKDSIQTGNTEIAEPTSSKSTNVEAASVDNS
FT                   EIHADASLTAVSSVNLDNPVIEPVAISLIGSKRDTNAEVEVSSLSKREVRKTNTDGLIS
FT                   VQSKVIKKELLESSLAEAGSPLLEATIAQSSNSNSTEIGMSYQNTVLLESNNTERQVSK
FT                   AEIVMEHKETELVETVSSASEPVVLVENISQTSNNTIESGKNMGVQSQAGAKQILGVEQ
FT                   SSKVSTPTSRQIMGVGLLTLVLGSALGLLKKRRK"
FT   sig_peptide     530290..530385
FT                   /locus_tag="SSU0496"
FT                   /note="Signal peptide predicted for SSU0496 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.991 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    530503..531561
FT                   /locus_tag="SSU0496"
FT                   /note="HMMPfam hit to PF09028, Mac 1, score 1.3e-257"
FT                   /inference="protein motif:HMMPfam:PF09028"
FT   misc_feature    533644..533697
FT                   /locus_tag="SSU0496"
FT                   /note="1 probable transmembrane helix predicted for SSU0496
FT                   by TMHMM2.0 at aa 1119-1136"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(534040..535149)
FT                   /transl_table=11
FT                   /locus_tag="SSU0497"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45115"
FT                   /protein_id="CAR45115.1"
FT                   /translation="MKKQVIIIGGGIVGSTAAFYLSQEEQVNLTLIDSGVGTATRAAAG
FT                   IIGPWMAQKKNKDWYKLTSDGAVFYRQLVADLEKSGATEIPFKQTGTIGLKSKPELLDK
FT                   IQKIAEERRVDTPTIGEITPLIGSEINQYLPLLKPDYFGIHLEGGGRIDGGRLIDILQE
FT                   QFLKNGGTRIYGQAKLLDNHTVEVDNQVLTADHIILATGAWLPHILEPLGYQVDVRPQK
FT                   GQLFELDTEFDTDNWPVCMPYGEIDILPFENGKIIIGATHEDDMGYDLELDPEKIQAMH
FT                   DKIAEFMPDLANYPVTRTRIGTRAYTSTYSPFYGNIEDMPNVWVASGLGSTGLTNGPII
FT                   GWQIAKEILNQETNFDRTPYSPNRYILKK"
FT   misc_feature    complement(534109..535140)
FT                   /locus_tag="SSU0497"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 9.9e-65"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   sig_peptide     complement(535027..535149)
FT                   /locus_tag="SSU0497"
FT                   /note="Signal peptide predicted for SSU0497 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.617) with cleavage site
FT                   probability 0.206 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        535234..535851
FT                   /transl_table=11
FT                   /locus_tag="SSU0498"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45117"
FT                   /protein_id="CAR45117.1"
FT                   /translation="MSDIMYPEVLTVGSGAVKVATVGDSLTYGYGLENREKDAYPCILA
FT                   EKLGHHYQVSNYGLSGRSLQSTADFPYFKEKNAQLSLESEADIVIIMIGSNDSRGPYWN
FT                   RERFIQEYREMAEQYMDLPSQPDVYLVIPPYVPTSRFGLNNQIIEDELQKIIPAIGNEL
FT                   GLPVINLYTVTEGHLEYYSDGLHLTPLGNQVIAEEIYQHLRH"
FT   misc_feature    535288..535830
FT                   /locus_tag="SSU0498"
FT                   /note="HMMPfam hit to PF00657, Lipolytic enzyme, G-D-S-L,
FT                   score 3.3e-14"
FT                   /inference="protein motif:HMMPfam:PF00657"
FT   CDS_pept        535894..536436
FT                   /transl_table=11
FT                   /gene="sipC"
FT                   /locus_tag="SSU0499"
FT                   /product="putative signal peptidase I 1"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45118"
FT                   /protein_id="CAR45118.1"
FT                   /translation="MVKRDLIKQISLLVLLIFGIIGLRFWLLEPVTITPEMANSYLKEN
FT                   DFIMTVRNVRPIHGDFILYNHEGKEYVSRVIALENETVTYMDDVLYRNDIIVTENYLKT
FT                   PHSQESYTDDFTLETLTNGKYNIIPEGHYLVLNDVRTNQQDSRSFGLISSEAIVGRLTF
FT                   RISPLSEFGFIKTGLVQ"
FT   sig_peptide     535894..536007
FT                   /gene="sipC"
FT                   /locus_tag="SSU0499"
FT                   /note="Signal peptide predicted for SSU0499 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.866) with cleavage site
FT                   probability 0.566 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    535927..535995
FT                   /gene="sipC"
FT                   /locus_tag="SSU0499"
FT                   /note="1 probable transmembrane helix predicted for SSU0499
FT                   by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    536002..536178
FT                   /gene="sipC"
FT                   /locus_tag="SSU0499"
FT                   /note="HMMPfam hit to PF00717, Peptidase S24, S26A and
FT                   S26B, C-terminal, score 0.017"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   CDS_pept        536626..538437
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /gene_synonym="gcaA"
FT                   /locus_tag="SSU0500"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase [isomerizing]"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45119"
FT                   /protein_id="CAR45119.1"
FT                   /translation="MCGIVGVVGNTNATDILIQGLEKLEYRGYDSAGIFVTGGEQAHLV
FT                   KAVGRIAELSAKVGDKTEGTTGIGHTRWATHGKPTENNAHPHTSQTAGHILVHNGVIEN
FT                   YAEIKEEYLAGHDLKGQTDTEIAVHLIGQFAEEGLSTLEAFKKALKIIQGSYAFALIDA
FT                   ADADTIYVAKNKSPLLIGLGDGYNMVCSDAMAMIRETSEYMEIHDKELVIVKKDSVEVM
FT                   DYDGNAIERGSYTAELDLSDIGKGTYPYYMLKEIDEQPTVMRKLISAYTNEAGQVTVDA
FT                   DIIKAVQEADRIYILAAGTSYHAGFAAKDFLEKLTDTPVELGISSEWGYSMPLLSKKPL
FT                   FVMISQSGETADSRQVLVKANEMGIPSLTVTNVPGSTLSREATYTMLLHAGPEIAVAST
FT                   KAYTAQIATLAILAKAVGDANGNAYAKEFDLVHELSIVAQSIEASLSEKDVIAEKVEKL
FT                   LSTTRNAFYIGRGSDYYVSMEASLKLKEISYIQCEGFAAGELKHGTISLIEDGVPVLAL
FT                   ISNHPHLASHTRGNIQEVVARGANVLTIVDEAVAKEEDDITVTTVHPFLSAIAMVVPTQ
FT                   LIAYYATLQRGLDVDKPRNLAKSVTVE"
FT   misc_feature    536626..536643
FT                   /note="PS00443 Glutamine amidotransferases class-II active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00443"
FT   misc_feature    536629..537204
FT                   /gene="glmS"
FT                   /gene_synonym="gcaA"
FT                   /locus_tag="SSU0500"
FT                   /note="HMMPfam hit to PF00310, Glutamine amidotransferase,
FT                   class-II, score 1.4e-32"
FT                   /inference="protein motif:HMMPfam:PF00310"
FT   misc_feature    537481..537879
FT                   /gene="glmS"
FT                   /gene_synonym="gcaA"
FT                   /locus_tag="SSU0500"
FT                   /note="HMMPfam hit to PF01380, Sugar isomerase (SIS), score
FT                   1.2e-29"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   misc_feature    537997..538392
FT                   /gene="glmS"
FT                   /gene_synonym="gcaA"
FT                   /locus_tag="SSU0500"
FT                   /note="HMMPfam hit to PF01380, Sugar isomerase (SIS), score
FT                   1.1e-15"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   CDS_pept        538589..539230
FT                   /transl_table=11
FT                   /locus_tag="SSU0501"
FT                   /product="putative amino acid ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45120"
FT                   /protein_id="CAR45120.1"
FT                   /translation="MDYVLEVLPSLLNGAAVSLQVFFLVLILSLPLGAVFAFLMQIKFK
FT                   PLQWLLHFYVLIMRGTPLLLQLIFVYYVLPSVGITFDRMPAVILAFTLNYAAYFSEIFR
FT                   GGIEAIPKGQYEAAKVLKFTPVQTIRYIVLPQVVKIVLPSVFNEVMTLVKDTSLVYALG
FT                   VSDLLLASRTAANRDASLAPMFIAGAIYLLMIGAVTLISKQVEKKFDYYR"
FT   misc_feature    538619..539221
FT                   /locus_tag="SSU0501"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 1.1e-28"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    join(538631..538699,538733..538801,538844..538897,
FT                   539123..539191)
FT                   /locus_tag="SSU0501"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSU0501 by TMHMM2.0 at aa 15-37, 49-71, 86-103 and 179-201"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    538820..538849
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        539240..539872
FT                   /transl_table=11
FT                   /locus_tag="SSU0502"
FT                   /product="putative amino acid ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45121"
FT                   /protein_id="CAR45121.1"
FT                   /translation="MLELRNLSKRFEDKQIFSNYDLVIPEGKIVAIVGQSGGGKTTLLR
FT                   MLAGLETIDSGTLMYNGQELPLEELGKRHLLGFVFQDFQLFPHLSVLENLVLSPMKTQN
FT                   MLRSEAEDKALKLLDTLGLANHANAYPFSLSGGQKQRVALARAMMIDPEIIGYDEPTSA
FT                   LDPELRKEVEKLILENRATGITQIVVTHDMQFAENIADEIIKIEPKH"
FT   misc_feature    539318..539866
FT                   /locus_tag="SSU0502"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 5.5e-59"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    539339..539362
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    539639..539683
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        539893..540729
FT                   /transl_table=11
FT                   /locus_tag="SSU0503"
FT                   /product="putative amino acid ABC transporter,
FT                   extracellular amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45122"
FT                   /protein_id="CAR45122.1"
FT                   /translation="MNIKKMMLGALALVTSLTLAACGSNDSATKSDNWTAYESEKSVTI
FT                   GFDKTFVPMGFEQTDGSYTGFDIDLANAVFEKYGITVKWQPIDWDLKETELNNGNIDLI
FT                   WNGYSITDERKEKVLFTNPYMDNQQVLVTKKSSNISQVSDMKDKILGAQAGSSGYSVFE
FT                   SQPAILKDIVQNNDASQYATFNEALIDLKNDRIDGLLIDRVYANYYLQQEGIIADYNII
FT                   DAGFENEAFAVGARKSDTTLVENINKAFAELYKEGKFQEISQKWFGEDVATDTVKK"
FT   sig_peptide     539893..539979
FT                   /locus_tag="SSU0503"
FT                   /note="Signal peptide predicted for SSU0503 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.326 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    539926..539958
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    540019..540699
FT                   /locus_tag="SSU0503"
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding protein, family 3, score 4.1e-75"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   CDS_pept        complement(541187..541474)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0503A"
FT                   /product="putative transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Geobacillus kaustophilus transposase
FT                   UniProt:Q5KVU7 (EMBL:BA000043) (378 aa) fasta scores:
FT                   E()=4.5e-05, 28.889% id in 90 aa"
FT                   /db_xref="PSEUDO:CAR45123.1"
FT   CDS_pept        join(541701..541814,541818..541967,541971..542042)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0505A"
FT                   /product="putative transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus gordonii transposase UniProt:Q84AQ8
FT                   (EMBL:AY116209) (170 aa) fasta scores: E()=5.1e-05, 35.766%
FT                   id in 137 aa"
FT   CDS_pept        join(542084..542176,542181..542264,542268..542339,
FT                   542343..542348,542352..542384,542388..542516)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0505B"
FT                   /product="putative transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus agalactiae putative transposase
FT                   UniProt:Q9L9Q9 (EMBL:AF165983) (287 aa) fasta scores:
FT                   E()=0.00035, 44.785% id in 163 aa"
FT   CDS_pept        complement(542569..543207)
FT                   /transl_table=11
FT                   /locus_tag="SSU0506"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45126"
FT                   /protein_id="CAR45126.1"
FT                   /translation="MIIHKSVNPVAFQNTYYLENDTHLIIIDPGSDWTKIQVTIEKIGK
FT                   PISAILLTHTHYDHIMSLDILRETYNFPPVYVAENEASWLYTPEMNLSGLPRHDDMENV
FT                   VCRPAEKIFQYQEDYQFDGFHFKVVPTPGHSIGGVSFIFPEDECVITGDALFRETVGRT
FT                   DLPTSNFDDLITGIREHIFTLPNHYTVHPGHGQNTSVGHEKNFNPFFRM"
FT   misc_feature    complement(542626..543174)
FT                   /locus_tag="SSU0506"
FT                   /note="HMMPfam hit to PF00753, Beta-lactamase-like, score
FT                   1.8e-35"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS_pept        543315..545783
FT                   /transl_table=11
FT                   /locus_tag="SSU0507"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45129"
FT                   /protein_id="CAR45129.1"
FT                   /translation="MNSMKDTRTSNRYAVVDLEATGTGTDAKIIQIGIVLVENGEIIDS
FT                   YATDINPYELLDDHIKNLTGITDQQLSQAPDFGQVASTIYDMIGDAIFVAHNVKFDANL
FT                   LAEALFFEGYELLTPRVDTVELSQLFFPTFEKYSLGNLAEHLELGLDQAHTAISDAMAT
FT                   ARLLIKIQEKIKSLPRSIVEKILDLADNLLFESRLVIDEMVPVLSENLSYDLESIHDLV
FT                   LKKPEEIKSAYRLSEDFSTNIALLGLHERKKQTAFAQVVEKRLVDEEKVHFIQAQAGLG
FT                   KTYGYLLPLLAKSDQPLLVTVPTKLLQEQIMEKEGSKLKEIFRIPIVSLKSPKHFIKLD
FT                   NYWKTLQRQDDNRLVNQFKMQVLVWLCETTTGDLDELKQKQRYQAYFDEIAHDGKLEPE
FT                   SLFWGLDFWQRLNQQALSSRLLITNHAYFLSHLKDQDPHMDKRMVVIDEAQKFLLAAEN
FT                   LATASQDLTSMLQVLQSKKDRATAILDQRLYESCQFELNHFLSRFRQHGQREVQKAELH
FT                   QLGQNLEELGDVDLNDLHQLIDYYDTFWLEEKNLEEKRLAYLRSSKDSLLNATNYLPDT
FT                   KIFCISATLTISKKVSLADLLGFEQVTLDLIPTQTVTNQRLLFPTHLPDILAWTKEEHA
FT                   AYLATTLGEIAELGRPILVLFTSISMLLQVSDLLEDNNIPHLAQHKHGQEMTLKRKFER
FT                   GECQILLGTGVFWEGVDFASQNQLIQVITRLPFDNPKDRFVQKINHHLREEGKNPFYDY
FT                   SLPMMMIKLKQAIGRTNRHDKQDSLVLVLDPRVHTKRYGQQILSFFEKDYLMLSVDAKE
FT                   IEGAIQDFFE"
FT   misc_feature    543351..543815
FT                   /locus_tag="SSU0507"
FT                   /note="HMMPfam hit to PF00929, Exonuclease, RNase T and DNA
FT                   polymerase III, score 6.7e-35"
FT                   /inference="protein motif:HMMPfam:PF00929"
FT   misc_feature    544140..544163
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    545316..545633
FT                   /locus_tag="SSU0507"
FT                   /note="HMMPfam hit to PF00271, DNA/RNA helicase,
FT                   C-terminal, score 0.0044"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        545943..547019
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="SSU0508"
FT                   /product="glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45130"
FT                   /protein_id="CAR45130.1"
FT                   /translation="MTEKTIVFKVGTSSLTQENGSLDRIKIARITNQLAQLHQKGYQIV
FT                   LVTSGSIAAGFRRLGFDKRPTKIAEKQASAAVGQGLLIEEYTQNLMKDGIVSAQILLTQ
FT                   DDFADARRYQNASQALQVLLKQRAIPIINENDTIAIEEIKVGDNDTLSAQVASLLKADL
FT                   LVLLTDVDGLYTANPNSDPTAQHLPQIKEITEDLFAMAAGAGSSNGTGGMTTKLQAAQI
FT                   ATKSGVPVFICSSKEDTALLQAVTQANRGTLFLADDHAMNQRKQWMAFYARTDAAVEVD
FT                   AGAVDAMLHQGRSLLATGVKALEGDFEVGQVVEVYSQADHRLIGKGRVKLSSKDLQDQL
FT                   ANGRAEGVLIHRNDWVSL"
FT   misc_feature    545952..546644
FT                   /gene="proB"
FT                   /locus_tag="SSU0508"
FT                   /note="HMMPfam hit to PF00696,
FT                   Aspartate/glutamate/uridylate kinase, score 1.3e-64"
FT                   /inference="protein motif:HMMPfam:PF00696"
FT   misc_feature    546558..546623
FT                   /note="PS00902 Glutamate 5-kinase signature."
FT                   /inference="protein motif:Prosite:PS00902"
FT   misc_feature    546768..546956
FT                   /gene="proB"
FT                   /locus_tag="SSU0508"
FT                   /note="HMMPfam hit to PF01472, PUA, score 1.7e-17"
FT                   /inference="protein motif:HMMPfam:PF01472"
FT   CDS_pept        547084..548322
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="SSU0509"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45137"
FT                   /protein_id="CAR45137.1"
FT                   /translation="MTTTQVLLDSLLANKASINLATTEQKNQALSAMADQLVAQTEAIL
FT                   AGNAIDMEHAQGKISQVMQDRLLLTEERIEAMADGIRALIGLPDPVGLVLEESTRADGL
FT                   NICKKSIPFGLVGMIYESRPNVTSDAAALAIKSGNAVILRGGKEAFHSAKAIVTALKSG
FT                   LEEAGVSPKVIELVQDTSRVSATELMTAKGKIDLLVPRGGAGLIQAVVENATVPVIETG
FT                   TGICHVYVDKDADLDKALRIVVNAKTSRPSVCNAAEVLLVHEEIASQFLPRLEEALSGQ
FT                   VELRADSQAQALLNQARPAGDQDFDTEFLDYIMAVKVVSSVEEAISHIAQHSTGHSEAI
FT                   VTENSQTAEHFTLHVDSAAVYVNASTRFTDGGEFGLGCELGISTQKMHARGPMGLREMT
FT                   TYKYIITGDGHIR"
FT   misc_feature    547090..548295
FT                   /gene="proA"
FT                   /locus_tag="SSU0509"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase,
FT                   score 1.4e-07"
FT                   /inference="protein motif:HMMPfam:PF00171"
FT   misc_feature    548038..548103
FT                   /note="PS01223 Gamma-glutamyl phosphate reductase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01223"
FT   CDS_pept        548332..549117
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SSU0510"
FT                   /product="putative pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45138"
FT                   /protein_id="CAR45138.1"
FT                   /translation="MKIGFIGLGNMGAALAQAVSQQPDTQLLLSNHNPAKAQALQEKVG
FT                   GQLFSNGQIAEQAEIIFLGVKPHLIQTVLSGLQDQISQNPSAIWISMAAGVPLDSLAAF
FT                   VSADKVIRIMPNTPVAIGQGMTTYSLVNQNLAPLLEQILEKSGKVQQVPESLIDAATAI
FT                   AGCGPAFVYQMIEALTDAGVQNGLTAQDAKVLAAQTLAGTAQMVLTSDKHPAQLRQEVT
FT                   SPGGSTIAGVVALEKEGFRYAIIKAVAAALKKTRKLGKK"
FT   sig_peptide     548332..548442
FT                   /gene="proC"
FT                   /locus_tag="SSU0510"
FT                   /note="Signal peptide predicted for SSU0510 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.884) with cleavage site
FT                   probability 0.647 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    548335..549060
FT                   /gene="proC"
FT                   /locus_tag="SSU0510"
FT                   /note="HMMPfam hit to PF03807, NADP oxidoreductase,
FT                   coenzyme F420-dependent, score 5.6e-61"
FT                   /inference="protein motif:HMMPfam:PF03807"
FT   misc_feature    548971..549039
FT                   /note="PS00521 Delta 1-pyrroline-5-carboxylate reductase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00521"
FT   CDS_pept        complement(549140..549544)
FT                   /transl_table=11
FT                   /locus_tag="SSU0511"
FT                   /product="TetR family regulatory proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45139"
FT                   /protein_id="CAR45139.1"
FT                   /translation="MAGRKISPQSLKNLYQSNKEANQLTKESIETALLFLLEKKELKQI
FT                   SVSELVRKAGVSRNAFYRNYKSKEEILEDYYERTSSNLKKKWHDLQDKVQKDGVKQSFA
FT                   DFVQEQKRKAEQSKALSNVSQWIKEKTKRD"
FT   misc_feature    complement(549320..549409)
FT                   /locus_tag="SSU0511"
FT                   /note="HMMPfam hit to PF00440, Transcriptional regulator,
FT                   TetR-like, DNA-binding, bacterial/archaeal, score 2.2e-07"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    complement(549347..549412)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1173.000, SD 3.18 at aa 45-66, sequence
FT                   ISVSELVRKAGVSRNAFYRNYK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        549671..550522
FT                   /transl_table=11
FT                   /locus_tag="SSU0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45140"
FT                   /protein_id="CAR45140.1"
FT                   /translation="MTKWKIVADSGCDYRQLANLAPDTEFISVPLTIQVGEQAFVDDAS
FT                   LDIDHMMEVMEASKSAAGSACPSPQAYQAAFEGAENIIVVTITGGLSGSFNAARVARDM
FT                   YIEEHPNVNIHLIDSLSASGEMDLLVDEINRLISAGLDFPQVVEAITHYREHSKLLFVL
FT                   AKVDNLVKNGRLSKLVGTVVGLLNIRMVGEASAEGKLELLQKARGHKKSVTAAFEEMKK
FT                   AGYDGGRIVMAHRNNAKFFQQFSELVKASFPTAVIDEVATSGLCSFYAEEGGLLMGYEV
FT                   KA"
FT   misc_feature    549878..550510
FT                   /locus_tag="SSU0512"
FT                   /note="HMMPfam hit to PF02645, DegV, score 9.6e-67"
FT                   /inference="protein motif:HMMPfam:PF02645"
FT   CDS_pept        complement(550621..551880)
FT                   /transl_table=11
FT                   /locus_tag="SSU0513"
FT                   /product="GntR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45142"
FT                   /protein_id="CAR45142.1"
FT                   /translation="MKKYQVIIQDILTGIEEHRFKRGEKLPSIRQLREQYHCSKDTVQK
FT                   AMLELKYQNKIYAVEKSGYYILEDRDFQDHTVELNPTDFQELPYEDFRICLKESLIGRE
FT                   NYLFNYYHQQEGLAELISSVQSLLMDYHVYTKKDQLVITAGSQQALYILTQMETLAGKT
FT                   EILIENPTYSRMIELIRHQGIPYQTIERNLDGIDLEELESIFQTGKIKFFYTIPRLHNP
FT                   LGSTYDIATKTAIVKLAKQYDVYIIEDDYLADFDSSHSLPLHYLDTDNRVIYIKSFTPT
FT                   LFPALRIGAISLPNQLRDIFIKHKSLIDYDTNLIMQKALSLYIDNGMFARNTQHLHHIY
FT                   HAQWNKIKDCLEKYALNIPYRISKGSVTFQLSKGILSPSIQHMFGKCYYFSGQKADFLQ
FT                   IFFEQDFADKLEQFVRYLNE"
FT   misc_feature    complement(550705..550740)
FT                   /note="PS00139 Eukaryotic thiol (cysteine) proteases
FT                   cysteine active site."
FT                   /inference="protein motif:Prosite:PS00139"
FT   misc_feature    complement(551131..551541)
FT                   /locus_tag="SSU0513"
FT                   /note="HMMPfam hit to PF00155, Aminotransferase, class I
FT                   and II, score 1.3e-05"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   misc_feature    complement(551683..551874)
FT                   /locus_tag="SSU0513"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory protein
FT                   GntR, HTH, score 1.6e-10"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   CDS_pept        552003..552737
FT                   /transl_table=11
FT                   /locus_tag="SSU0514"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45144"
FT                   /protein_id="CAR45144.1"
FT                   /translation="MKIIIPNAKEVNTNLENASFYLLSDRSKPVLDAISQFDVKKMAAF
FT                   YKLNEAKAELEADRWYRIRTGQAKTYPAWQLYDGLMYRYMDRRGIDSKEENYLRDHVRV
FT                   ATALYGLIHPFEFISPHRLDFQGSLKIGNQSLKQYWRPYYDQEVGDDELILSLASSEFE
FT                   QVFSPQIQKRLVKILFMEEKAGQLKVHSTISKKGRGRLLSWLAKNNIQELSDIQDFKVD
FT                   GFEYCTSESTANQLTFIRSIKM"
FT   misc_feature    552003..552728
FT                   /locus_tag="SSU0514"
FT                   /note="HMMPfam hit to PF03883, Protein of unknown function
FT                   DUF328, score 1.8e-46"
FT                   /inference="protein motif:HMMPfam:PF03883"
FT   CDS_pept        552842..554287
FT                   /transl_table=11
FT                   /gene="wzg"
FT                   /gene_synonym="cps2A"
FT                   /locus_tag="SSU0515"
FT                   /product="integral membrane regulatory protein Wzg"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45145"
FT                   /protein_id="CAR45145.1"
FT                   /translation="MKKRSGRSKSSKFKLVNFALLGLYSITLCLFLVTMYRYNILDFRY
FT                   LNYIVTLLLVGVAVLAGLLMWRKKARIFTALLLVFSLVITSVGIYGMQEVVKFSTRLNS
FT                   NSTFSEYEMSILVPANSDITDVRQLTSILAPAEYDQDNITALLDDISKMESTQLATSPA
FT                   TSYLTAYQSMLNGESQAMVFNGVFTNILENEDPGFSSKVKKIYSFKVTQTVETATKQVS
FT                   GDSFNIYISGIDAYGPISTVSRSDVNIIMTVNRATHKILLTTTPRDSYVAIADGGQNQY
FT                   DKLTHAGIYGVNASVHTLENLYGIDISNYVRLNFISFLQLIDLVGGIDVYNDQEFTSLH
FT                   GNYHFPVGQVHLNSDQALGFVRERYSLTGGDNDRGKNQEKVIAALIKKMSTPENLKNYQ
FT                   AILSGLEGSIQTDLSLETIMSLVNTQLESGTQFTVESQALTGTGRSDLSSYAMPGSQLY
FT                   MMEINQDSLEQSKAAIQSVLVEK"
FT   sig_peptide     552842..552949
FT                   /gene="wzg"
FT                   /gene_synonym="cps2A"
FT                   /locus_tag="SSU0515"
FT                   /note="Signal peptide predicted for SSU0515 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.892) with cleavage site
FT                   probability 0.312 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(552878..552946,552974..553039,553058..553117)
FT                   /gene="wzg"
FT                   /gene_synonym="cps2A"
FT                   /locus_tag="SSU0515"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSU0515 by TMHMM2.0 at aa 13-35, 45-66 and 73-92"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    553043..553390
FT                   /gene="wzg"
FT                   /gene_synonym="cps2A"
FT                   /locus_tag="SSU0515"
FT                   /note="HMMPfam hit to PF02916, DNA polymerase processivity
FT                   factor, score 8.6e-65"
FT                   /inference="protein motif:HMMPfam:PF02916"
FT   misc_feature    553571..554014
FT                   /gene="wzg"
FT                   /gene_synonym="cps2A"
FT                   /locus_tag="SSU0515"
FT                   /note="HMMPfam hit to PF03816, Cell envelope-related
FT                   transcriptional attenuator, score 2.1e-69"
FT                   /inference="protein motif:HMMPfam:PF03816"
FT   CDS_pept        554305..554994
FT                   /transl_table=11
FT                   /gene="cps2B"
FT                   /locus_tag="SSU0516"
FT                   /product="putative chain length determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45146"
FT                   /protein_id="CAR45146.1"
FT                   /translation="MNNQEVNAIEIDVLFLLKTIWRKKFLILLTAVLTAGLAFVYSSFL
FT                   VTPQYDSTTRIYVVSQNVEAGAGLTNQELQAGTYLAKDYREIILSQDVLTQVATELNLK
FT                   ESLKEKISVSIPVDTRIVSISVRDADPNEAARIANSLRTFAVQKVVEVTKVSDVTTLEE
FT                   AVPAEEPTTPNTKRNILLGLLAGGILATGLVLVMEVLDDRVKRPQDIEEVMGLTLLGIV
FT                   PDSKKLK"
FT   misc_feature    554329..554736
FT                   /gene="cps2B"
FT                   /locus_tag="SSU0516"
FT                   /note="HMMPfam hit to PF02706, Lipopolysaccharide
FT                   biosynthesis, score 1.7e-50"
FT                   /inference="protein motif:HMMPfam:PF02706"
FT   misc_feature    join(554377..554445,554836..554904)
FT                   /gene="cps2B"
FT                   /locus_tag="SSU0516"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSU0516 by TMHMM2.0 at aa 25-47 and 178-200"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    554842..554919
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT                   /inference="protein motif:Prosite:PS00217"
FT   CDS_pept        555004..555681
FT                   /transl_table=11
FT                   /gene="wze"
FT                   /gene_synonym="cps2c"
FT                   /locus_tag="SSU0517"
FT                   /product="tyrosine-protein kinase Wze"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45148"
FT                   /protein_id="CAR45148.1"
FT                   /translation="MAMLEIARTKREGVNKTEEYFNAIRTNIQLSGADIKVVGITSVKS
FT                   NEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMPGFFKPITKITGLTDYLAGTTDLSQ
FT                   GLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVIDAA
FT                   IIAQKCDAMVAVVEAGNVKCSSLKKVKEQLEQTGTPFLGVILNKYDIATEKYSEYGNYG
FT                   KKA"
FT   misc_feature    555115..555633
FT                   /gene="wze"
FT                   /gene_synonym="cps2c"
FT                   /locus_tag="SSU0517"
FT                   /note="HMMPfam hit to PF01656, Cobyrinic acid a,c-diamide
FT                   synthase, score 5.1e-18"
FT                   /inference="protein motif:HMMPfam:PF01656"
FT   CDS_pept        555720..556451
FT                   /transl_table=11
FT                   /gene="wzh"
FT                   /gene_synonym="cps2d"
FT                   /locus_tag="SSU0518"
FT                   /product="protein-tyrosine phosphatase Wzh"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45149"
FT                   /protein_id="CAR45149.1"
FT                   /translation="MIDIHSHIIFGVDDGPKTIEESLSLISEAYRQGVRYIVATSHRRK
FT                   GMFETPEKIIMINFLQLKEAVAEVYPEIRLCYGAELYYSKDILSKLEKKKVPTLNGSCY
FT                   ILLEFSTDTPWKEIQEAVNEMTLLGLTPVLAHIERYDALAFQSERVEKLIDKGCYTQVN
FT                   SNHVLKPALIGERAKEFKKRTRYFLEQDLVHCVASDMHNLYSRPPFMREAYQLVKKEYG
FT                   EDRAKALFKKNPLLILKNQVQ"
FT   misc_feature    555723..556331
FT                   /gene="wzh"
FT                   /gene_synonym="cps2d"
FT                   /locus_tag="SSU0518"
FT                   /note="HMMPfam hit to PF02811, PHP, C-terminal, score
FT                   1e-29"
FT                   /inference="protein motif:HMMPfam:PF02811"
FT   CDS_pept        556476..557855
FT                   /transl_table=11
FT                   /gene="cps2E"
FT                   /locus_tag="SSU0519"
FT                   /product="putative galactosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45151"
FT                   /protein_id="CAR45151.1"
FT                   /translation="MNIEIGYRQTKLALFDMIAVTISAILTSHIPNADLNRSGIFIIMM
FT                   VHYFAFFISRMPVEFEYRGNLIEFEKTFNYSIIFVIFLMAVSFMLENNFALSRRGAVYF
FT                   TLINFVLVYLFNVIIKQFKDSFLFSTTYQKKTILITTAELWENMQVLFESDILFQKNLV
FT                   ALVILGTEIDKINLPLPLYYSVEEAIEFSTREVVDYVFINLPSEYFDLKQLVSDFELLG
FT                   IDVGVDINSFGFTVLKNKKIQMLGDHSIVTFSTNFYKPSHILMKRLLDILGAVVGLIIC
FT                   GIVSILLIPIIRRDGGPAIFAQKRVGQNGRIFTFYKFRSMFVDAEVRKKELMAQNQMQG
FT                   GMFKMDNDPRITPIGHFIRKTSLDELPQFYNVLIGDMSLVGTRPPTVDEFEKYTPSQKR
FT                   RLSFKPGITGLWQVSGRSDITDFNEVVRLDLTYIDNWTIWSDIKILLKTVKVVLLREGS
FT                   K"
FT   misc_feature    join(556509..556568,556578..556631,556692..556745,
FT                   556773..556832,557286..557354)
FT                   /gene="cps2E"
FT                   /locus_tag="SSU0519"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0519 by TMHMM2.0 at aa 12-31, 35-52, 73-90, 100-119 and
FT                   271-293"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    557271..557852
FT                   /gene="cps2E"
FT                   /locus_tag="SSU0519"
FT                   /note="HMMPfam hit to PF02397, Bacterial sugar transferase,
FT                   score 1e-143"
FT                   /inference="protein motif:HMMPfam:PF02397"
FT   CDS_pept        557890..559059
FT                   /transl_table=11
FT                   /gene="cps2F"
FT                   /gene_synonym="wchF"
FT                   /locus_tag="SSU0520"
FT                   /product="putative rhamnosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45153"
FT                   /protein_id="CAR45153.1"
FT                   /translation="MRTVYIIGSKGIPAKYGGFETFVEKLTEYQKDKSINYFVACTREN
FT                   SAKSDITGEVFEHNGATCFNIDVPNIGSAKAILYDIMALKKSIEIAKDRNDTSPIFYIL
FT                   ACRIGPFIYLFKKQIESIGGQLFVNPDGHEWLREKWSYPVRQYWKFSESLMLKYADLLI
FT                   CDSKNIEKYIHEDYRKYAPETSYIAYGTDLDKSRLSPTDSVVREWYKEKEISENDYYLV
FT                   VGRFVPENNYEVMIREFMKSYSRKDFVLITNVEHNSFYEKLKKETGFDKDKRIKFVGTV
FT                   YNQELLKYIRENAFAYFHGHEVGGTNPSLLEALSSTKLNLLLDVGFNREVGEEGAKYWN
FT                   KDNLHRVIDSCEQLSQEQINDMDSLSTKQVKERFSWDFIVDEYEKLFKG"
FT   misc_feature    557890..558465
FT                   /gene="cps2F"
FT                   /gene_synonym="wchF"
FT                   /locus_tag="SSU0520"
FT                   /note="HMMPfam hit to PF09314, Protein of unknown function
FT                   DUF1972, score 3.4e-139"
FT                   /inference="protein motif:HMMPfam:PF09314"
FT   misc_feature    558505..558996
FT                   /gene="cps2F"
FT                   /gene_synonym="wchF"
FT                   /locus_tag="SSU0520"
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferase, group
FT                   1, score 0.0048"
FT                   /inference="protein motif:HMMPfam:PF00534"
FT   CDS_pept        559063..560220
FT                   /transl_table=11
FT                   /gene="csp2G"
FT                   /locus_tag="SSU0521"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45154"
FT                   /protein_id="CAR45154.1"
FT                   /translation="MKKILYLHAGAELYGADKVLLELIKGLDKNEFEAHVILPNDGVLV
FT                   PALREVGAQVEVINYPILRRKYFNPKGIFDYFISYHHYSKQIAQYAIENKVDIIHNNTT
FT                   AVLEGIYLKRKLKLPLLWHVHEIIVKPKFISDSINFLMGRFADKIVTVSQAVANHIKQS
FT                   PHIKDDQISVIYNGVDNKVYYQSDARSVRERFDIDEEALVIGMVGRVNAWKGQGDFLEA
FT                   VAPILEQNPKAIAFIAGSAFEGEEWRVVELEKKISQLKVSSQVRRIDYYANTTELYNMF
FT                   DIFVLPSTNPDPLPTVVLEAMACGKPVVGYRHGGVCEMVKEGVNGFLVTPNSPLNLSKV
FT                   ILQLSENINLRKKIGNNSIERQKEHFSLKSYVKNFSKVYTSLKVY"
FT   misc_feature    559624..560145
FT                   /gene="csp2G"
FT                   /locus_tag="SSU0521"
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferase, group
FT                   1, score 8.2e-34"
FT                   /inference="protein motif:HMMPfam:PF00534"
FT   repeat_region   560309..560403
FT                   /note="csp repeat region"
FT   repeat_region   560309..560371
FT                   /note="63mer direct repeat"
FT   repeat_region   560327..560374
FT                   /note="48mer direct repeat"
FT   repeat_region   560370..560403
FT                   /note="34mer direct repeat"
FT   CDS_pept        560457..560612
FT                   /transl_table=11
FT                   /locus_tag="SSU0522"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45157"
FT                   /protein_id="CAR45157.1"
FT                   /translation="MDCRKTVKSIFRFLGVQFLGGELNNLCTIFRKIYGVKSELMVVAK
FT                   KRMRNL"
FT   CDS_pept        560609..561979
FT                   /transl_table=11
FT                   /gene="csp2H"
FT                   /locus_tag="SSU0523"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45159"
FT                   /protein_id="CAR45159.1"
FT                   /translation="MKIISFTMVNNESEIIESFIRYNYNFIDEMVIIDNGCTDNTMQII
FT                   FNLIKEGYKISVYDESLEAYNQYRLDNKYLTKIIAEKNPDLIIPLDADEFLTADSNPRK
FT                   LLEQLDLEKIHYVNWQWFVMTKKDDINESFIPRRMQYCFEKPVWHHSDGKPVTKCIISA
FT                   KYYKKMNLKLSMGHHTVFGNPNVRIEHHNDLKFAHYRAISQEQLIYKTICYTIRDIATM
FT                   ENNIETAQRTNQMALIESGVDMWETAREASYSGYDCNVIHAPIDLSFCKENIVIKYNEL
FT                   SRETVAERVMKTGREMAVRAYNVERKQKEKKFLKPIIFVLDGLKGDEYIHPNPSNHLTI
FT                   LTEMYNVRGLLTDNHQIKFLKVNYRLIITPDFAKFLPHEFIVVPDTLDIEQVKSQYVGT
FT                   GVDLSKIISLKEYRKEIGFIGNLYALLGFVPNMLNRIYLYIQRNGIANTIIKIKSRL"
FT   misc_feature    561374..561394
FT                   /note="PS00290 Immunoglobulins and major histocompatibility
FT                   complex proteins signature."
FT                   /inference="protein motif:Prosite:PS00290"
FT   misc_feature    561854..561922
FT                   /gene="csp2H"
FT                   /locus_tag="SSU0523"
FT                   /note="1 probable transmembrane helix predicted for SSU0523
FT                   by TMHMM2.0 at aa 416-438"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        562047..563246
FT                   /transl_table=11
FT                   /gene="wzy"
FT                   /gene_synonym="csp2I"
FT                   /locus_tag="SSU0524"
FT                   /product="oligosaccharide repeat unit polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45163"
FT                   /protein_id="CAR45163.1"
FT                   /translation="MRIRINNLFFVAIAFMGIIISNSQVVLAIGKASVIQYLSYLVLIL
FT                   CIVNDLLKNNKHIVVYKLGYLFLIIFLFTIGICQQILPITTKIYLSISMMIISVLATLP
FT                   ISLIKDIDDFRRISNHLLFALFITSILGIMMGATMFTGAVEGIGFSQGFNGGLTHKNFF
FT                   GITILMGFVLTYLAYKYGSYKRTDRFILGLELFLILISNTRSVYLILLLFLFLVNLDKI
FT                   KIEQRQWSTLKYISMLFCAIFLYYFFGFLITHSDSYAHRVNGLINFFEYYRNDWFHLMF
FT                   GAADLAYGDLTLDYAIRVRRVLGWNGTLEMPLLSIMLKNGFIGLVGYGIVLYKLYRNVR
FT                   ILKTDNIKTIGKSVFIIVVLSATVENYIVNLSFVFMPICFCLLNSISTMESTINKQLQT
FT                   "
FT   sig_peptide     562047..562130
FT                   /gene="wzy"
FT                   /gene_synonym="csp2I"
FT                   /locus_tag="SSU0524"
FT                   /note="Signal peptide predicted for SSU0524 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.937 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(562065..562133,562143..562202,562221..562289,
FT                   562302..562370,562407..562475,562533..562592,
FT                   562629..562697,562740..562808,562866..562934,
FT                   562977..563045,563106..563174)
FT                   /gene="wzy"
FT                   /gene_synonym="csp2I"
FT                   /locus_tag="SSU0524"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SSU0524 by TMHMM2.0 at aa 7-29, 33-52, 59-81, 86-108,
FT                   121-143, 163-182, 195-217, 232-254, 274-296, 311-333 and
FT                   354-376"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        563385..564383
FT                   /transl_table=11
FT                   /gene="cps2J"
FT                   /locus_tag="SSU0525"
FT                   /product="ptative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45167"
FT                   /protein_id="CAR45167.1"
FT                   /translation="MEKVSIIVPIFNTEKYLRECLDSIISQSYTNLEILLIDDGSSDSS
FT                   TDICLEYAEQDGRIKLFRLPNGGVSNARNYGIKNSTANYIMFVDSDDIVDGNIVESLYT
FT                   CLKENDSDLSGGLLATFDGNYQESELQKCQIDLEEIKEVRDLGNENFPNHYMSGIFNSP
FT                   CCKLYKNIYINKGFDTEQWLGEDLLFNLNYLKNIKKVSYVNRNLYFARRGIQSTTNTFK
FT                   KDVFIQLENLEEKTFDLFVKIFGGQYEFSVFKETLQWHIIYYSLLMFKNGDESLPKKLH
FT                   IFKYLYNRHSLDTLSIKRTSSVFKRICKLIVANNLFKIFLNTLIREEKNND"
FT   misc_feature    563397..563915
FT                   /gene="cps2J"
FT                   /locus_tag="SSU0525"
FT                   /note="HMMPfam hit to PF00535, Glycosyl transferase, family
FT                   2, score 1.5e-43"
FT                   /inference="protein motif:HMMPfam:PF00535"
FT   CDS_pept        564376..565380
FT                   /transl_table=11
FT                   /gene="csp2K"
FT                   /locus_tag="SSU0526"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45169"
FT                   /protein_id="CAR45169.1"
FT                   /translation="MINISIIVPIYNVEQYLSKCINSIVNQTYKHIEILLVNDGSTDNS
FT                   EEICLAYAKKDSRIRYFKKENGGLSDARNYGISRAKGDYLAFIDSDDFIHSEFIQRLHE
FT                   AIERENALVAVAGYDRVDASGHFLTAEPLPTNQAVLSGRNVCKKLLEADGHRFVVAWNK
FT                   LYKKELFEDFRFEKGKIHEDEYFTYRLLYELEKVAIVKECLYYYVDRENSIITSSMTDH
FT                   RFHCLLEFQNERMDFYESRGDKELLLECYRSFLAFAVLFLGKYNHWLSKQQKKLLQTLF
FT                   RIVYKQLKQNKRLALLMNAYYLVGCLHLNFSVFLKTGKDKIQERLRRSESSTR"
FT   misc_feature    564388..564897
FT                   /gene="csp2K"
FT                   /locus_tag="SSU0526"
FT                   /note="HMMPfam hit to PF00535, Glycosyl transferase, family
FT                   2, score 4.5e-51"
FT                   /inference="protein motif:HMMPfam:PF00535"
FT   misc_feature    565252..565320
FT                   /gene="csp2K"
FT                   /locus_tag="SSU0526"
FT                   /note="1 probable transmembrane helix predicted for SSU0526
FT                   by TMHMM2.0 at aa 293-315"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        565420..565731
FT                   /transl_table=11
FT                   /locus_tag="SSU0527"
FT                   /product="putative membrane protein"
FT                   /note="Possible gene remnant, CDS could be fragement of
FT                   larger CDS including downstream CDSs"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45171"
FT                   /protein_id="CAR45171.1"
FT                   /translation="MNPTNSRIALFDTIKCIMVLCVIFTHLDWSVEQRQWFIFPYFVDM
FT                   AVPIFLLLSAYFRTNKWNTKQETLKLKFSSGIKESINMLCLYAIVMAVNVLLSYSRTI"
FT   misc_feature    join(565432..565500,565528..565596,565657..565716)
FT                   /locus_tag="SSU0527"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSU0527 by TMHMM2.0 at aa 5-27, 37-59 and 80-99"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        565774..565980
FT                   /transl_table=11
FT                   /locus_tag="SSU0528"
FT                   /product="putative membrane protein"
FT                   /note="Possible gene remnant, CDS could be fragement of
FT                   larger CDS including upstream and downstream CDSs"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45174"
FT                   /protein_id="CAR45174.1"
FT                   /translation="MSCGYFLENRVQGVGSYYVPLLIQVVFLLPILYVLFEKNKWLGLL
FT                   TCFLVNFSVDAIFANMAEHGIYI"
FT   misc_feature    565810..565878
FT                   /locus_tag="SSU0528"
FT                   /note="1 probable transmembrane helix predicted for SSU0528
FT                   by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        566041..566439
FT                   /transl_table=11
FT                   /locus_tag="SSU0529"
FT                   /product="putative membrane protein"
FT                   /note="Possible gene remnant, CDS could be fragement of
FT                   larger CDS including upstream CDSs"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45176"
FT                   /protein_id="CAR45176.1"
FT                   /translation="MRSKVDTFIATLFGIIGAILIFVNHSIEPFSWFYGWKSTSFLCVP
FT                   FAYAMLFFMIKYGQKIPAILLSKLGVASYHIYLTQMLYFSVVAPFLAVQFKVSSLNLWN
FT                   GLFTFLICLFGGYIFYKVDLFMRVRGKR"
FT   misc_feature    566622..566786
FT                   /locus_tag="SSU0530"
FT                   /note="HMMPfam hit to PF02348, Acylneuraminate
FT                   cytidylyltransferase, score 8.8e-25"
FT                   /inference="protein motif:HMMPfam:PF02348"
FT   CDS_pept        join(566625..566783,566879..567001,567001..567123)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0530"
FT                   /product="N-acylneuraminate cytidylyltransferase
FT                   (fragment)"
FT                   /note="Probable gene remnant. CDS is disrupted by a repeat,
FT                   that is also found elsewhere the csp region. Similar to the
FT                   N-terminal region of Streptococcus agalactiae (serotype V)
FT                   N-acylneuraminate cytidylyltransferase (ec 2.7.7.43) (CMP-N
FT                   acetylneuraminic acid synthetase) (CMP-NeuNAc synthetase)
FT                   (CMP-siali acid synthetase) NeuA UniProt:Q9AFG9
FT                   (EMBL:AE014244) (413 aa) fasta scores: E()=7.3e-25, 57.246%
FT                   id in 138 aa. Similar to the N-terminal region of SSU0538,
FT                   87.273% identity (87.273% ungapped) in 55 aa overlap
FT                   (9-63:4-58)"
FT   repeat_region   566805..566888
FT                   /note="csp repeat region"
FT   repeat_region   566805..566852
FT                   /note="48mer direct repeat"
FT   repeat_region   566805..566849
FT                   /note="45mer direct repeat"
FT   repeat_region   566854..566888
FT                   /note="35mer direct repeat"
FT   CDS_pept        567223..568194
FT                   /transl_table=11
FT                   /locus_tag="SSU0533"
FT                   /product="putative lipooligosaccharide sialyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45180"
FT                   /protein_id="CAR45180.1"
FT                   /translation="MRRIYICHTMYQILISLLKMDVERDSLMSVDIIGHFPDVREQLQQ
FT                   HVHLIEETERSFDLYSLIARSKTKERLSLLQSYDEVIIFQDHRQVGHFLNKHRIPYSLL
FT                   EDGYNFFKDKRVCDLESIQSSVWKRLFYQWYFKPTYLIGSSLYCQSIEVNDLSLVQFDE
FT                   AYKPFVEVPRKQLFDQASPEKVQALLQIFGARAIVADEESSQKRLLLLTQPLSWDYHVT
FT                   EEELLEIYVAGLAPYREDYTIYIKPHPRDGVDYSFLGKAVVLLPQGIPFELFEMAGSIR
FT                   FDIGMTYSSSALDFLNCFEEKVYLKDTFPLLSKNDILREGIE"
FT   misc_feature    567226..568128
FT                   /locus_tag="SSU0533"
FT                   /note="HMMPfam hit to PF05855, Lipooligosaccharide
FT                   sialyltransferase, score 1.7e-28"
FT                   /inference="protein motif:HMMPfam:PF05855"
FT   CDS_pept        568203..569609
FT                   /transl_table=11
FT                   /locus_tag="SSU0534"
FT                   /product="flippase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45184"
FT                   /protein_id="CAR45184.1"
FT                   /translation="MSKKSIVVSGLVYTIGTILVQGLAFITLPIYTRVISQEVYGQFSL
FT                   YNSWVGLVGLFIGLQLGGAFGPGWVHFREKFDDFVSTLMVSSIAFFLPIFGLSFLLSQP
FT                   LSLLFGLPDWVVPLIFLQSFMSVVQGFFTTYLVQRQQSMWTLLLSVLSAVINTALSLFL
FT                   IFSMENDFIARVMANSATTGVFACVSLLFFYKKIGLHFRKDYLRYGLSISIPLIFHGLG
FT                   HNVLNQFDRIMLGKMLTLSDVALYSFGYTLASILQIVFSSLNTVWCPWYFEKKRGADKD
FT                   LLSYVRYYLAIGLFVTFGFLTIYPELAMLLGGSEYRFSMGFIPMIIVGVFFVFLYSFPA
FT                   NIQFYSGNTKFLPIGTFIAGVLNISVNFVLIPTIGIYGAALATTASYLLLLVLHYFVAK
FT                   KKYAYDEVAISTFVKVIALVVVYTGLMTVFVGSIWIRWSLGIAVLVVYAYIFRKELTVA
FT                   LNTFREKRSK"
FT   sig_peptide     568203..568310
FT                   /locus_tag="SSU0534"
FT                   /note="Signal peptide predicted for SSU0534 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.613) with cleavage site
FT                   probability 0.438 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    568218..569027
FT                   /locus_tag="SSU0534"
FT                   /note="HMMPfam hit to PF01943, Polysaccharide biosynthesis
FT                   protein, score 4.2e-22"
FT                   /inference="protein motif:HMMPfam:PF01943"
FT   misc_feature    join(568221..568289,568347..568415,568449..568517,
FT                   568545..568613,568632..568700,568713..568781,
FT                   568818..568877,568935..569003,569064..569132,
FT                   569160..569228,569247..569315,569328..569396,
FT                   569421..569489,569499..569555)
FT                   /locus_tag="SSU0534"
FT                   /note="14 probable transmembrane helices predicted for
FT                   SSU0534 by TMHMM2.0 at aa 7-29, 49-71, 83-105, 115-137,
FT                   144-166, 171-193, 206-225, 245-267, 288-310, 320-342,
FT                   349-371, 376-398, 407-429 and 433-451"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   569608..569710
FT                   /note="csp repeat region"
FT   repeat_region   569608..569670
FT                   /note="63mer direct repeat"
FT   repeat_region   569626..569670
FT                   /note="45mer direct repeat"
FT   repeat_region   569670..569703
FT                   /note="34mer direct repeat"
FT   repeat_region   569676..569710
FT                   /note="35mer direct repeat"
FT   CDS_pept        570132..571148
FT                   /transl_table=11
FT                   /gene="neuB"
FT                   /locus_tag="SSU0535"
FT                   /product="putative N-acetylneuraminic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45188"
FT                   /protein_id="CAR45188.1"
FT                   /translation="MVYIIAEIGCNHNGDVHLARKMVEVAVDCGVDAVKFQTFKADLLI
FT                   SKYAPKAEYQKITTGESDSQLEMTRRLELSFEEYLDLRDYCLEKGVDVFSTPFDEESLD
FT                   FLISTDMPVYKIPSGEITNLPYLEKIGRQAKKVILSTGMAVMDEIHQAVKILQENGTTD
FT                   ISILHCTTEYPTPYPALNLNVLHTLKKEFPNLTIGYSDHSVGSEVPIAAAAMGAELIEK
FT                   HFTLDNEMEGPDHKASATPDILAALVKGVRIVEQSLGKFEKEPEEVEVRNKIVARKSIV
FT                   AKKAIAKGEVFTEENITVKRPGNGISPMEWYKVLGQVSEQDFEEDQNICHSAFENQM"
FT   misc_feature    570195..570920
FT                   /gene="neuB"
FT                   /locus_tag="SSU0535"
FT                   /note="HMMPfam hit to PF03102, N-acetylneuraminic acid
FT                   synthase, N-terminal, score 4.6e-144"
FT                   /inference="protein motif:HMMPfam:PF03102"
FT   misc_feature    570960..571136
FT                   /gene="neuB"
FT                   /locus_tag="SSU0535"
FT                   /note="HMMPfam hit to PF08666, SAF domain, score 4.9e-10"
FT                   /inference="protein motif:HMMPfam:PF08666"
FT   CDS_pept        571160..572293
FT                   /transl_table=11
FT                   /gene="neuC"
FT                   /locus_tag="SSU0536"
FT                   /product="putative UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45190"
FT                   /protein_id="CAR45190.1"
FT                   /translation="MKKICFVTGSRAEYGIMRRLLSYLQDDPEMELDLVVTAMHLEEKY
FT                   GMTVKDIEADKRRIVKRIPLHLTDTSKQTIVKSLATLTEQLTVLFEEVQYDLVLILGDR
FT                   YEMLPVANAALLYNIPICHIHGGEKTMGNFDESIRHAITKMSHLHLTSTDEFRNRVIQL
FT                   GENPNHVLNIGAMGVENVLKQDFLTREELAMELGIDFAEDYYVVLFHPVTLEDNTAEEQ
FT                   TQALLDALKEDGSQCLIIGSNSDTHADKIMELMHEFVKQDSDSYIFTSLPTRYYHSLVK
FT                   HSQGLIGNSSSGLIEVPSLQVPTLNIGNRQFGRLSGPSVVHVGTSKEAIVGGLGQLRDV
FT                   IDFTNPFEQPDSALQGYRAIKEFLSVQASTMKEFYDR"
FT   misc_feature    571223..572242
FT                   /gene="neuC"
FT                   /locus_tag="SSU0536"
FT                   /note="HMMPfam hit to PF02350, UDP-N-acetylglucosamine
FT                   2-epimerase, score 1.7e-95"
FT                   /inference="protein motif:HMMPfam:PF02350"
FT   CDS_pept        572307..572933
FT                   /transl_table=11
FT                   /locus_tag="SSU0537"
FT                   /product="putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45192"
FT                   /protein_id="CAR45192.1"
FT                   /translation="MKKVAFLGAGTFSDGVLPWLDRSRYELIGYFEDKPISDYRGYPVF
FT                   GPLQDVLTYLDDGKVDAVFVTIGDNVKRKEIFDLLAKDHYDALFNIISEQANIFSPDSI
FT                   KGRGVFIGFSSFVGADSYVYDNCIINTGAIVEHHTTVEAHCNITPGVTINGLCRIGEGT
FT                   YIGSGSTVIQCIEIAPYTTLGAGTVVLKSLTESGTYVGVPARKIK"
FT   misc_feature    572664..572717
FT                   /locus_tag="SSU0537"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 13"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    572718..572771
FT                   /locus_tag="SSU0537"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 0.7"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    572772..572825
FT                   /locus_tag="SSU0537"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 6.4"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    572799..572885
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00101"
FT   misc_feature    572826..572879
FT                   /locus_tag="SSU0537"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide repeat, score 58"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   CDS_pept        572942..574174
FT                   /transl_table=11
FT                   /gene="neuA"
FT                   /locus_tag="SSU0538"
FT                   /product="N-acylneuraminate cytidylyltransferase"
FT                   /note="N-terminal region is similar to SSU0530, 87.273%
FT                   identity (87.273% ungapped) in 55 aa overlap (4-58:9-63)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45194"
FT                   /protein_id="CAR45194.1"
FT                   /translation="MEPICLIPARSGSKGLPNKNMLFLDGVPMIFHTIRAAIESGCFKK
FT                   ENIYVSTDSEVYKEICETTGVQVLMRPADLATDFTTSFQLNEHFLQDFSDDQVFVLLQV
FT                   TSPLRSGKHVKEAMELYGKGQADHVVSFTKVDKSPTLFSTLDENGFAKDIAGLGGSYRR
FT                   QDEKTLYYPNGAIYISSKQAYLADKTYFSEKTAAYVMTKEDSIDVDDHFDFTGVIGRIY
FT                   FDYQRREQQNKPFYKRELKRLCEQRVHDSLVIGDSRLLALLLDGFDNISIGGMTASTAL
FT                   ENQGLFLATPIKKVLLSLGVNDLITDYPLHMIEDTIRQLMESLVSKAEQVFVTTIAYTL
FT                   FRDSVSNEEIVQLNDVIVQSASELGISVIDLNEVVEKEAMLDYQYTNDGLHFNQIGQER
FT                   VNQLILTSLTR"
FT   misc_feature    572951..573670
FT                   /gene="neuA"
FT                   /locus_tag="SSU0538"
FT                   /note="HMMPfam hit to PF02348, Acylneuraminate
FT                   cytidylyltransferase, score 2.4e-45"
FT                   /inference="protein motif:HMMPfam:PF02348"
FT   misc_feature    573824..574153
FT                   /gene="neuA"
FT                   /locus_tag="SSU0538"
FT                   /note="HMMPfam hit to PF00657, Lipolytic enzyme, G-D-S-L,
FT                   score 5.2e-06"
FT                   /inference="protein motif:HMMPfam:PF00657"
FT   repeat_region   574328..575386
FT                   /note="IS element, novel IS"
FT   repeat_region   574328..574338
FT                   /note="Inverted repeat"
FT   CDS_pept        join(574371..574850,574849..575244)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0539"
FT                   /product="transposase (pseudogene)"
FT                   /note="CDS contains a frameshift and deletion after codon
FT                   160. Similar to Streptococcus thermophilus IS1198
FT                   transposase UniProt:Q70C57 (EMBL:AR542664) (334 aa) blastp
FT                   scores: E()=8e-82"
FT                   /db_xref="PSEUDO:CAR45196.1"
FT   misc_feature    574840..575196
FT                   /locus_tag="SSU0540"
FT                   /note="HMMPfam hit to PF01609, Transposase, IS4-like, score
FT                   0.003"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   repeat_region   complement(575376..575386)
FT                   /note="Inverted repeat"
FT   repeat_region   575447..576346
FT                   /note="IS element, novel IS"
FT   CDS_pept        575494..575844
FT                   /transl_table=11
FT                   /locus_tag="SSU0541"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45198"
FT                   /protein_id="CAR45198.1"
FT                   /translation="MAYSLDFRKKVLAYCEKTGSITEASAIFQVSRNTIYQWLKLKEKT
FT                   GELHHQVKGTKPRKVDRDKLKNYLETHPDAYLTEIASEFDCHPTAIHYPLKAMGYTRKK
FT                   RAVPTMNKTLKK"
FT   misc_feature    575494..575838
FT                   /locus_tag="SSU0541"
FT                   /note="HMMPfam hit to PF01710, Transposase, Synechocystis
FT                   PCC 6803, score 6.5e-16"
FT                   /inference="protein motif:HMMPfam:PF01710"
FT   misc_feature    575548..575613
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2164.000, SD 6.56 at aa 19-40, sequence
FT                   GSITEASAIFQVSRNTIYQWLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        575862..576341
FT                   /transl_table=11
FT                   /locus_tag="SSU0542"
FT                   /product="transposase"
FT                   /note="Full length CDS is similar to Synechocystis sp.
FT                   (strain PCC 6803) transposase UniProt:Q55696
FT                   (EMBL:AP004311) (164 aa) fasta scores: E()=2.5e-16, 42.000%
FT                   id in 150 aa. C-terminal region is similar to to
FT                   Streptococcus pneumoniae IS630-Spn1, transposase Orf2
FT                   UniProt:Q97CV1 (EMBL:AE007319) (112 aa) fasta scores:
FT                   E()=6.6e-33, 76.786% id in 112 aa, and to Synechocystis sp.
FT                   (strain PCC 6803) transposase. UniProt:Q55696
FT                   (EMBL:AP004311) (164 aa) fasta scores: E()=2.5e-16, 42.000%
FT                   id in 150 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45210"
FT                   /protein_id="CAR45210.1"
FT                   /translation="MNNLSHLTPVYIDETGFETYFHRKYGRSLKGQLIKGKVSGRRYQR
FT                   ISLVAGLINGALIAPMTYKDTMTSGFFEAWFKTFLLPTLGKPSVIIMDNAKFHRMSKLK
FT                   DLCEEQGHRLLPLPPYSPEYNPIEKIWAHIKKHLRRVLPNCDTFLEALSSCSCFS"
FT   CDS_pept        576378..576563
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0543"
FT                   /product="putative transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus pneumoniae IS66 family element,
FT                   Orf1 UniProt:Q97PZ4 (EMBL:AE007441) (79 aa) fasta scores:
FT                   E()=8.5e-13, 63.934% id in 61 aa"
FT                   /db_xref="PSEUDO:CAR45212.1"
FT   CDS_pept        576544..576831
FT                   /transl_table=11
FT                   /locus_tag="SSU0544"
FT                   /product="putative transposase"
FT                   /note="Possible gene remnant. Similar to the N-terminal
FT                   region of several IS element proteins, for example,
FT                   Streptococcus pneumoniae IS66 family element, Orf2
FT                   UniProt:Q97PZ5 (EMBL:AE007441) (116 aa) fasta scores:
FT                   E()=1.9e-33, 84.211% id in 95 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45215"
FT                   /protein_id="CAR45215.1"
FT                   /translation="MTIRLSDLGQVFLVCGKTDMRQGIDSLAYLVKSQFNLDPFSGQVY
FT                   LFCGGRKDRFKALYWDEQGFWLLYKRFENGKLAWSNNEEEVKALTSEQVD"
FT   misc_feature    576562..576828
FT                   /locus_tag="SSU0544"
FT                   /note="HMMPfam hit to PF05717, Transposase (putative), IS66
FT                   Orf2 like, score 4.1e-35"
FT                   /inference="protein motif:HMMPfam:PF05717"
FT   CDS_pept        join(576891..577151,577153..577959,577962..578033,
FT                   578033..578440)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0545"
FT                   /product="putative transposase (pseudogene)"
FT                   /note="CDS contains frameshifts after codons 87, 356 and
FT                   380. Similar to Ruminococcus gnavus hypothetical protein
FT                   UniProt:Q8VRK5 (EMBL:AF439554) (538 aa) fasta scores:
FT                   E()=3.4e-28, 32.645% id in 533 aa"
FT                   /db_xref="PSEUDO:CAR45218.1"
FT   misc_feature    577288..577872
FT                   /locus_tag="SSU0546"
FT                   /note="HMMPfam hit to PF03050, Transposase, IS66, score
FT                   1.7e-11"
FT                   /inference="protein motif:HMMPfam:PF03050"
FT   repeat_region   578508..578598
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        578680..579465
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0549"
FT                   /product="putative transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus thermophilus (strain CNRZ 1066)
FT                   IS1239, transposase, IS30 family UniProt:Q5M0H3
FT                   (EMBL:CP000024) (332 aa) fasta scores: E()=4.8e-96, 94.253%
FT                   id in 261 aa"
FT                   /db_xref="PSEUDO:CAR45220.1"
FT   misc_feature    579019..579456
FT                   /locus_tag="SSU0549"
FT                   /note="HMMPfam hit to PF00665, Integrase, catalytic core,
FT                   score 6.6e-24"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   CDS_pept        579665..579823
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0550"
FT                   /product="putative transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus pneumoniae IS66 family element,
FT                   Orf1 UniProt:Q97QB1 (EMBL:AE007429) (79 aa) fasta scores:
FT                   E()=3.8e-11, 62.745% id in 51 aa"
FT   CDS_pept        579804..579857
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0551"
FT                   /product="putative transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus pneumoniae IS66 family element
FT                   UniProt:Q7WVV7 (EMBL:AY336008) (116 aa) fasta scores:
FT                   E()=0.00047, 88.235% id in 17 aa"
FT                   /db_xref="PSEUDO:CAR45223.1"
FT   CDS_pept        complement(join(579858..580088,580088..580432))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0552"
FT                   /product="putative tyrosine recombinase (fragment)"
FT                   /note="Probable gene remnant. Similar to an internal region
FT                   of Methanobacterium thermoautotrophicum XerC-like tyrosine
FT                   recombinase UniProt:O26979 (EMBL:AE000865) (311 aa) fasta
FT                   scores: E()=4.6e-18, 47.222% id in 144 aa"
FT   misc_feature    complement(579897..580049)
FT                   /locus_tag="SSU0552"
FT                   /note="HMMPfam hit to PF00589, Integrase, catalytic core,
FT                   phage, score 2.4e-21"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   misc_feature    complement(580154..580390)
FT                   /locus_tag="SSU0553"
FT                   /note="HMMPfam hit to PF00589, Integrase, catalytic core,
FT                   phage, score 5.5e-13"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   repeat_region   580798..580826
FT                   /note="29mer direct repeat"
FT   CDS_pept        join(580932..581084,581088..581483,581482..581829)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="SSU0554"
FT                   /product="D-alanine--D-alanine ligase (pseudogene)"
FT                   /note="CDS contains nonsense (amber) and frameshift
FT                   mutations after codons 51 and 182. The frameshift mutation
FT                   occurs at a poly T hexamer. Similar to Aquifex aeolicus
FT                   D-alanine--D-alanine ligase (ec 6.3.2.4) (D-alanylalanine
FT                   synthetase (D-ala-D-ala ligase) Ddl UniProt:O66806
FT                   (EMBL:AE000694) (291 aa) fasta scores: E()=1.8e-05, 21.127%
FT                   id in 284 aa"
FT                   /db_xref="PSEUDO:CAR45227.1"
FT   CDS_pept        complement(581824..584181)
FT                   /transl_table=11
FT                   /locus_tag="SSU0556"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45231"
FT                   /protein_id="CAR45231.1"
FT                   /translation="MSHWNQFLTEITYSIIQAHTDQKSLSLYIPFEDSLSKSLAFDTIS
FT                   QELLESEIDGNGTVLYSDFGDNNITDEYKLSFAEKFFKPISVSVNNSIQGFGTAGLSLK
FT                   YDSTEIEKKILNNSNNYRLIFLIQHWEWLGSELKLFFIRLLNNISHYEKQYNKSIIIVI
FT                   GGSELKNNDIRFSKNFDVHHFELNDLKDTLGNIIQTSNISDNLEDTLYPLTKGNLEKIY
FT                   NFILLSQNNSKIEKLLDDLLNTIEIDFRKNKIEIDFIYQLSVLPEYFNPYDAEEYFNLK
FT                   TFQIEKAIDILKKLLVLIPVKNRTNFYSLILIMKDKLLLTVEKGQKEIYRRYYHYLCGK
FT                   EPFNYRLKIEILSRLKESQEYLLSLYLLWYEYLLNQNEILESEKKSLYKLEFLTEETKS
FT                   IFFKCIKYKYTNGTNSLYNEILPENSLLSSILLKNDINFQGNTSQDFSFHSLCDTLYEN
FT                   ILAESAKDVIVEPIHYLSCIYMLLPHLIDKLNIDKLNEIDKFQVLNENIVKKFYTTKDI
FT                   EQNAQYLENIYLRKSFLYKDNDRSINDANKALKFFNDVDDEIEQYYTLGSLLGLLLVSS
FT                   NYERANQVKQEIETLSDKHNLPLYWKSKNNFVVLDFLSGMEGDFDYWKSRFESILTEYE
FT                   LNDVSKHLMYTNLCAISLYYSKTKGYRSYKTILEELMDVEDLADLEDTSIDDFYRYYFG
FT                   WFEFCLLLLESKHRQAKNKYNQLKDFSPIIFNSNKKLLIEKHRRYKKIFESNIKTGKEF
FT                   SEFLSQSKFASREWNYFRRGLMLTDIQYTSAL"
FT   repeat_region   complement(584192..584220)
FT                   /note="29mer direct repeat"
FT   CDS_pept        584398..585678
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="SSU0557"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45232"
FT                   /protein_id="CAR45232.1"
FT                   /translation="MKLRRSVEKLKGTIRVPGDKSISHRSIIFGSLAKGVTRFHNILRG
FT                   EDVLSTMQVFRDLGVKIEDNGDIVEVHGVGFDGLQAPKNDLDMGNSGTSIRLISGVLAG
FT                   QDFEATMFGDDSLSKRPMDRVTIPLSQMGVEISGQTERDLPPLTIKGNKNLKPIRYQLP
FT                   VASAQVKSALIFAALQAEGESVIVEKELTRNHTEDMIVQFGGQLEVNGKEIRIQGGQEF
FT                   IAQEITVPGDISSAAFWLVAGLIIPGSKIVLENVGINETRTGILDVIKAMGGKMTLSNI
FT                   DELAKSATITVETSELKATEIAGELIPRLIDELPIITLLATQAHGTTIIRDAEELKVKE
FT                   TDRIQVVADALNSMGATIEPTEDGMIIHGPTALHGAEINTFGDHRIGMMTAIAALLAKD
FT                   GEVVLERAEAINTSYPAFFEHLNSLMD"
FT   misc_feature    584407..585660
FT                   /gene="aroA"
FT                   /locus_tag="SSU0557"
FT                   /note="HMMPfam hit to PF00275, 3-phosphoshikimate
FT                   1-carboxyvinyltransferase, score 6.1e-142"
FT                   /inference="protein motif:HMMPfam:PF00275"
FT   misc_feature    584653..584697
FT                   /note="PS00104 EPSP synthase signature 1."
FT                   /inference="protein motif:Prosite:PS00104"
FT   CDS_pept        585687..586178
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="SSU0558"
FT                   /product="putative shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45235"
FT                   /protein_id="CAR45235.1"
FT                   /translation="MPIVLLGFMGVGKTTTAHLLNLPVYDMDHIIEERIGMPIADYFSL
FT                   EGEASFRQLETEVLKGLLDLPSNCIVSTGGGVIKSEVNRELLLANREDNVLLTASFEVS
FT                   YQRIRKDRQSQRPLFLQCSKEEFEALYRERMALYQGLADTVIDTDKLIPEQVARKILCK
FT                   "
FT   misc_feature    585705..585728
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    585711..586172
FT                   /gene="aroK"
FT                   /locus_tag="SSU0558"
FT                   /note="HMMPfam hit to PF01202, Shikimate kinase, score
FT                   1.4e-54"
FT                   /inference="protein motif:HMMPfam:PF01202"
FT   misc_feature    585840..585920
FT                   /note="PS01128 Shikimate kinase signature."
FT                   /inference="protein motif:Prosite:PS01128"
FT   CDS_pept        586169..586996
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="SSU0559"
FT                   /product="prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45237"
FT                   /protein_id="CAR45237.1"
FT                   /translation="MQVAYLGPRGSFTHQVAQQVFPTADLQAFETITEVIKAYETGEVT
FT                   YSVIPVENSIEGSVHETIDYLFHQAEIHAVAEIVQPIAQQLLATSADKAVEVIYSHPQA
FT                   IAQGKKYIQEHFPQARIEITVSTAYAARFVAEHPEQPFAAIAPQAAAVEYGLEVIAQDI
FT                   QEISENFTRFWILGDKAPSIALEQVAKKVSLALTLPDNLPGALYKAMSVFSWRGISLTK
FT                   IESRPLKTALGEYFFILDLDNQSEELLTYSQKELTSLDITYKVLGNYLVYMTS"
FT   misc_feature    586175..586711
FT                   /gene="pheA"
FT                   /locus_tag="SSU0559"
FT                   /note="HMMPfam hit to PF00800, Prephenate dehydratase,
FT                   score 2e-65"
FT                   /inference="protein motif:HMMPfam:PF00800"
FT   misc_feature    586826..586849
FT                   /note="PS00858 Prephenate dehydratase signature 2."
FT                   /inference="protein motif:Prosite:PS00858"
FT   CDS_pept        587008..588333
FT                   /transl_table=11
FT                   /locus_tag="SSU0560"
FT                   /product="cell envelope-related transcriptional attenuator
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45240"
FT                   /protein_id="CAR45240.1"
FT                   /translation="MNKNNNILTHHEQLRLDYLQKNIHYLNDKESRELDYLLYKKELRE
FT                   RHGSPRQSLRSFTPTAYEDDYFEEDYFEEDDEQEELLPRYPERKSRKTRQAKPQRFQSP
FT                   RIGPKAKVPKPKKARKKGGFKRFIGFVLLAIALVIVAMGYSFFKGMNSVSEKPVAEVFN
FT                   GVDTSNGTNILILGTDGRVGESSGETRTDTIMVLNVNNTDNKVKLVSFMRDTLVDIEGY
FT                   EYKLNTAYTLGEQDNQQGAEEVRKALKNSFDIDIKYYAMVDFATFATTIDTLFPEGVTI
FT                   DAQFSTINGEVVSSVEVPNDLQLEENAPAYQTIQVGVQQMDGKTLLNYARYRSDDEGDF
FT                   GRTRRQQEVLSAVMTQAKNPMKLFSGSEAIGKVVAMTPTTVPQSFMWLQGPGLLLDAAN
FT                   GIERVTIPENGDWIDDYDMYGGMALRVDFEKYQQRLAELGLR"
FT   misc_feature    587386..587445
FT                   /locus_tag="SSU0560"
FT                   /note="1 probable transmembrane helix predicted for SSU0560
FT                   by TMHMM2.0 at aa 127-146"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    587575..588084
FT                   /locus_tag="SSU0560"
FT                   /note="HMMPfam hit to PF03816, Cell envelope-related
FT                   transcriptional attenuator, score 4.6e-67"
FT                   /inference="protein motif:HMMPfam:PF03816"
FT   CDS_pept        588399..589757
FT                   /transl_table=11
FT                   /locus_tag="SSU0561"
FT                   /product="putative RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45243"
FT                   /protein_id="CAR45243.1"
FT                   /translation="MLKKNDIVEVEVVDLTHEGQGVAKIDGFVFFVDNALPGEKISMRI
FT                   LKLKKNIGFGKVEQWQSFSQDRNQDLDFTYLRTGIADLGHLTYPAQLAFKKKQVENSLR
FT                   KIAGISEIAVADTLGMDSPLAYRNKAAVPVRRVNGQLETGFFRKNSHDLVPIEDFYIQH
FT                   KEIDALVLATRDLLRKLDLKPYDEKEQTGLVRNIVVRRGHYSGQLMLVLVTTRPKIFRV
FT                   ETLIERLTSQFPNLVSIVQNINDQNTNAIFGQEFRLLHGSETIADTMLGNEFEISAPSF
FT                   YQVNTEMAEKLYQTAIDFAELSADDVVIDAYSGIGTIGLSFAKQVKHVYGVEVVEKAVL
FT                   DSQKNAARNGIDNVTYVCDSAESAMQKWVADGVKPTVIFVDPPRKGLTESFIKASTSVK
FT                   PEKIVYISCNVATMARDIKLYEELGYKLTKVQPADLFPNTHHIEVVGLLEKRN"
FT   misc_feature    588399..588575
FT                   /locus_tag="SSU0561"
FT                   /note="HMMPfam hit to PF01938, Deoxyribonuclease/rho
FT                   motif-related TRAM, score 8.7e-07"
FT                   /inference="protein motif:HMMPfam:PF01938"
FT   misc_feature    588657..589751
FT                   /locus_tag="SSU0561"
FT                   /note="HMMPfam hit to PF05958,
FT                   (Uracil-5)-methyltransferase, score 2.3e-08"
FT                   /inference="protein motif:HMMPfam:PF05958"
FT   misc_feature    589143..589178
FT                   /note="PS00192 Cytochrome b/b6 heme-ligand signature."
FT                   /inference="protein motif:Prosite:PS00192"
FT   misc_feature    589539..589634
FT                   /note="PS01230 RNA methyltransferase trmA family signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS01230"
FT   CDS_pept        complement(join(589823..590026,590026..590091))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0562"
FT                   /product="putative transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to Streptococcus
FT                   pneumoniae transposase. UniProt:O33754 (EMBL:SPZ86112) (271
FT                   aa) blastp scores: E()=4e-20"
FT                   /db_xref="PSEUDO:CAR45246.1"
FT   CDS_pept        590317..591429
FT                   /transl_table=11
FT                   /gene="glf"
FT                   /locus_tag="SSU0563"
FT                   /product="UDP-galactopyranose mutase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45249"
FT                   /protein_id="CAR45249.1"
FT                   /translation="MKKYDYLVVGAGLFGAVFAHEAAKKGKKIKVIEKRDHIAGNIYTK
FT                   EVEGIQVHEYGAHIFHTSEKEIWDYVNQFAEFNSYTNTPVANYKGEIYNLPFNMNTFNK
FT                   LWGVVTPAEAGAKIAEQRAVLGGKTPENLEEQAISLVGTDIYEKLIKSYTEKQWEKPCT
FT                   ELPAFIIRRLPVRLTYDNNYFNDTYQGIPIGGYTQIVEKMLEHENIDVETNVDFFANKE
FT                   DYLATYPKIVFTGMIDEFFDYQLGELEYRSLRFETEVLDMENYQGNAVVNYTDSETPYT
FT                   RIIEHKHFEFGTQPKTIITREYSKTWKRGDEPYYPVNNNRNNHLYTAYKKLSEQQENVI
FT                   FGGRLGHYRYYDMHQVIGAALQCVRNEVGE"
FT   sig_peptide     590317..590379
FT                   /gene="glf"
FT                   /locus_tag="SSU0563"
FT                   /note="Signal peptide predicted for SSU0563 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.848) with cleavage site
FT                   probability 0.482 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    590329..590439
FT                   /gene="glf"
FT                   /locus_tag="SSU0563"
FT                   /note="HMMPfam hit to PF07992, FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase, score 4.4e-06"
FT                   /inference="protein motif:HMMPfam:PF07992"
FT   misc_feature    590758..591366
FT                   /gene="glf"
FT                   /locus_tag="SSU0563"
FT                   /note="HMMPfam hit to PF03275, UDP-galactopyranose mutase,
FT                   C-terminal, score 2.2e-115"
FT                   /inference="protein motif:HMMPfam:PF03275"
FT   CDS_pept        complement(591529..592074)
FT                   /transl_table=11
FT                   /locus_tag="SSU0564"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45250"
FT                   /protein_id="CAR45250.1"
FT                   /translation="MANVLFLVGSLRDGSFNHQMAKKAEAFLTDKAQVSYIDLAKIPLF
FT                   NQDIETPILPEIAELRAQVDAADAIWIFSPVYNYAIPGIVKNALDWLSRSLDLSNPKGP
FT                   SILQDKITTVSAVANSGHDHLFKDFQHLLPFIRTQIAGEFTGSTINPEAWGTGVLELSD
FT                   ETLTKLEQQVADLLAAIQ"
FT   misc_feature    complement(591793..592071)
FT                   /locus_tag="SSU0564"
FT                   /note="HMMPfam hit to PF03358, NADPH-dependent FMN
FT                   reductase, score 2.6e-25"
FT                   /inference="protein motif:HMMPfam:PF03358"
FT   CDS_pept        complement(592137..592586)
FT                   /transl_table=11
FT                   /locus_tag="SSU0565"
FT                   /product="MarR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45252"
FT                   /protein_id="CAR45252.1"
FT                   /translation="MRTVEQSLNENKHALHSLVVFRRAANTIAKSELETIKKYGLTVCQ
FT                   FGVMEALYNKGNLRIQDLIDKLLSTSGNMTVVIKNMIRDGYIYKTIDTNDRRASLIALT
FT                   PLGRETIEKILPEHYDHVGEIFSVLSSEEQDQLAEILKKFKNQQT"
FT   misc_feature    complement(592257..592466)
FT                   /locus_tag="SSU0565"
FT                   /note="HMMPfam hit to PF01047, Bacterial regulatory
FT                   protein, MarR, score 5.8e-18"
FT                   /inference="protein motif:HMMPfam:PF01047"
FT   repeat_region   592833..593732
FT                   /note="IS element"
FT   CDS_pept        592880..593230
FT                   /transl_table=11
FT                   /locus_tag="SSU0566"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45254"
FT                   /protein_id="CAR45254.1"
FT                   /translation="MAYSLDFRKKVLAYCEKTGSITEASAIFQVSRNTIYQWLKLKEKT
FT                   GELHHQVKGTKPRKVDRDKLKNYLETHPDAYLTEIASEFDCHPTAIHYPLKAMGYTRKK
FT                   RAVPTMNKTLKK"
FT   misc_feature    592880..593224
FT                   /locus_tag="SSU0566"
FT                   /note="HMMPfam hit to PF01710, Transposase, Synechocystis
FT                   PCC 6803, score 6.5e-16"
FT                   /inference="protein motif:HMMPfam:PF01710"
FT   misc_feature    592934..592999
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2164.000, SD 6.56 at aa 19-40, sequence
FT                   GSITEASAIFQVSRNTIYQWLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        593248..593727
FT                   /transl_table=11
FT                   /locus_tag="SSU0567"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45255"
FT                   /protein_id="CAR45255.1"
FT                   /translation="MNNLSHLTPVYIDETGFETYFHRKYGRSLKGQLIKGKVSGRRYQR
FT                   ISLVAGLINGALIAPMTYKDTMTSGFFEAWFKTFLLPTLGKPSVIIMDNAKFHRMSKLK
FT                   DLCEEQGHRLLPLPPYSPEYNPIEKIWAHIKKHLRRVLPNCDTFLEALSSCSCFS"
FT   CDS_pept        593786..594283
FT                   /transl_table=11
FT                   /locus_tag="SSU0568"
FT                   /product="putative membrane protein"
FT                   /note="Possible alternative translational start sites after
FT                   codons 8, 11, 19 and 20."
FT                   /db_xref="EnsemblGenomes-Gn:SSU0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45256"
FT                   /protein_id="CAR45256.1"
FT                   /translation="MEKKIFQLLEWMASKTGQLVMGSFILLSVVTFSIFTIWDIAAAPF
FT                   NNARSHAVGVATEYADLQTVNDFSIYNGTETYFCVFGVTSQGEEVAVLIPEASSTVYVY
FT                   SLAQGISQEEAQAIAKKNGASQVERTILGLRDGKPIWEVKSGTAYYLVEFETGNFIKRE
FT                   GL"
FT   misc_feature    593843..593911
FT                   /locus_tag="SSU0568"
FT                   /note="1 probable transmembrane helix predicted for SSU0568
FT                   by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        594280..595461
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="SSU0569"
FT                   /product="aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45258"
FT                   /protein_id="CAR45258.1"
FT                   /translation="MSKLSKRVLEMEESVTLAAGARAKALKAEGRDILELTLGEPDFVT
FT                   PKNIQEAAIKSIEDGKASFYTVASGLPELKDAVNTYFENFYGYSIERNQVVLATGAKFI
FT                   LYAFFAAVINPGDEVLIPTPYWVSYADQIKMNDGVPVFVTASEEHNFKVTVDQLEAART
FT                   DKTKVFLLNTPSNPTGMIYSREELEAIGNWAVEHDILILADDIYGRLVYNGNTFTPISS
FT                   ISESIRQQTIVVNGVAKAYAMTGWRVGFAVGNPEIIAAMSKIVGQTTSNLTTAAQYAAI
FT                   EAFTGPQDTVETMRQAFEERLNTIYPLLAEVPGFEVIKPEGAFYLFPNVKKAMEMKGYT
FT                   DVTEFTTAILEEVGVAMVTGAGFGAPENIRLSYATDMDTLKEAVARLHTFMKK"
FT   misc_feature    594370..595440
FT                   /gene="aspC"
FT                   /locus_tag="SSU0569"
FT                   /note="HMMPfam hit to PF00155, Aminotransferase, class I
FT                   and II, score 2.1e-89"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   misc_feature    594985..595026
FT                   /note="PS00105 Aminotransferases class-I
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00105"
FT   CDS_pept        595476..596822
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="SSU0570"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45260"
FT                   /protein_id="CAR45260.1"
FT                   /translation="MSRKLITINQVKDYVGQEVTIGAWVANKSGKGKLAFLQLRDGTAF
FT                   FQAVAFKPNFIEKFGEEAGTEKFDVAKRLSQETSVYVTGIVKEDERSKFGYELDVTDLE
FT                   VIGESQDYPITPKEHGTDFLMDNRHLWLRSRKQVAIQQIRNAIIYATYEFFEKNGFIKF
FT                   DSPILSGNAAEDSTELFETDYFGQLAYLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSK
FT                   TRRHLTEFWMMDAEYSFLSHEESLDLQEAYVKALIQGVIDRAPQALETLERDVDALKRY
FT                   IAEPFKRVAYDDAITLLQEHEADKDTDYEHIEHGDDFGSPHETWISNYFGVPTFVVNYP
FT                   ASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAKMDELGMDKSEY
FT                   EFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRMLHRLHP"
FT   misc_feature    595530..595793
FT                   /gene="asnS"
FT                   /locus_tag="SSU0570"
FT                   /note="HMMPfam hit to PF01336, Nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type, score 4.1e-19"
FT                   /inference="protein motif:HMMPfam:PF01336"
FT   misc_feature    595833..596807
FT                   /gene="asnS"
FT                   /locus_tag="SSU0570"
FT                   /note="HMMPfam hit to PF00152, Aminoacyl-tRNA synthetase,
FT                   class II (D, K and N), score 3e-98"
FT                   /inference="protein motif:HMMPfam:PF00152"
FT   misc_feature    596121..596177
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00179"
FT   misc_feature    596724..596753
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        597094..597321
FT                   /transl_table=11
FT                   /locus_tag="SSU0571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45262"
FT                   /protein_id="CAR45262.1"
FT                   /translation="MGIVSLRLNDAEEEIFRSYAIHTGKSLSELFKTALAEQIEDQLDY
FT                   EIGIKALKKFQENPVTHSIDDVLAELEDGL"
FT   CDS_pept        597311..597580
FT                   /transl_table=11
FT                   /locus_tag="SSU0572"
FT                   /product="putative plasmid addiction system, toxin protein"
FT                   /note="Similar to SSU1318, 51.765% identity (51.765%
FT                   ungapped) in 85 aa overlap (3-87:2-86)"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45266"
FT                   /protein_id="CAR45266.1"
FT                   /translation="MAYKLVLSDDALKQLKKMDRHVGMMLAKDLKKRLDGLENPRQFGK
FT                   ALVGDYKGLWRYRVGNYRVICDIIDNKMVILALEIGHRKEIYKK"
FT   misc_feature    597323..597571
FT                   /locus_tag="SSU0572"
FT                   /note="HMMPfam hit to PF05016, Plasmid stabilization
FT                   system, score 9.8e-15"
FT                   /inference="protein motif:HMMPfam:PF05016"
FT   CDS_pept        597986..599305
FT                   /transl_table=11
FT                   /locus_tag="SSU0573"
FT                   /product="multi antimicrobial extrusion (MATE) family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45268"
FT                   /protein_id="CAR45268.1"
FT                   /translation="MKQESLGKEIIRLALPATVENIFQTLVGFVDTLLIAQLGLVAVTA
FT                   VGLANTILNVYLAVYMALGVGATALIARSIGAGDRESLTFHVRQALVLSVGVGLLLGLL
FT                   SLVFGRQMLVLMGADAESLAGVQVFFYWVGGLTIFQALMTILGTILRASGDTVFPMKMS
FT                   LLTNGFNVVLDYFLIFGIGSWSGLGIVGTALGTVLARLLGTVLLYRKVQQTDLAVDLKQ
FT                   LFHLGSPKEMVVLTLPAATERLVMRLGQVVYFSLIVGLGTIVYASHMIAGNIESFTYMP
FT                   AYGLATAAAVLIGQALGKGDILTVRRVAFLSSAYGVAIMSLLGTILFFGAPSFALLFTK
FT                   DLEAVRQVVTALRIDAFNQPGLAVSLIMAGALQGLGDTKSPLYSTMIGMWGLRVSGVIV
FT                   LGQMFGLGIAGVWLSILIDLLLRAIFLTWRFIVQTRKLAE"
FT   misc_feature    598031..598513
FT                   /locus_tag="SSU0573"
FT                   /note="HMMPfam hit to PF01554, Multi antimicrobial
FT                   extrusion protein MatE, score 7.5e-39"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   misc_feature    join(598061..598129,598139..598198,598256..598324,
FT                   598367..598435,598472..598531,598541..598609,
FT                   598730..598798,598811..598879,598913..598981,
FT                   599195..599263)
FT                   /locus_tag="SSU0573"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSU0573 by TMHMM2.0 at aa 26-48, 52-71, 91-113, 128-150,
FT                   163-182, 186-208, 249-271, 276-298, 310-332 and 404-426"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    598697..599182
FT                   /locus_tag="SSU0573"
FT                   /note="HMMPfam hit to PF01554, Multi antimicrobial
FT                   extrusion protein MatE, score 2e-28"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   CDS_pept        599356..599733
FT                   /transl_table=11
FT                   /locus_tag="SSU0574"
FT                   /product="endoribonuclease L-PSP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45271"
FT                   /protein_id="CAR45271.1"
FT                   /translation="MKTIHTDKAPAAIGPYVQGKVVGNFLFASGQVPLSPETGEVVGET
FT                   IQEQTEQVLKNIAAILSEAGTDFDHVVKTTCFLKDMNDFVAFNEVYKTAFSADFPARSA
FT                   VEVARLPRDVKVEIEVIAVID"
FT   misc_feature    599371..599727
FT                   /locus_tag="SSU0574"
FT                   /note="HMMPfam hit to PF01042, Endoribonuclease L-PSP,
FT                   score 1.4e-65"
FT                   /inference="protein motif:HMMPfam:PF01042"
FT   misc_feature    599653..599709
FT                   /note="PS01094 Uncharacterized protein family UPF0076
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01094"
FT   CDS_pept        599755..600642
FT                   /transl_table=11
FT                   /locus_tag="SSU0575"
FT                   /product="P-loop ATPase protein family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45273"
FT                   /protein_id="CAR45273.1"
FT                   /translation="MSDKLHLVIVTGMSGAGKTVAIQSFEDLGYFTIDNMPPTLLPKFL
FT                   ELIRHSQDNNKIALVVDMRSRSFFSEIREVLDEIEGAEDLDFKVLFLDATDSELVARYK
FT                   ETRRSHPLAADGRVLDGIQLERELLAPLKNMSQNVIDTTELTPRNLRKVISEQFASQDN
FT                   QPSFRIEVMSFGFKYGLPLDADLVFDVRFLPNPYYKLELRNLTGLDAPVFDYVMEHQES
FT                   EEFYSHLLGLIEPILPGYQKEGKSVLTIAVGCTGGQHRSVAFAKRLADDLEKNWNVNRS
FT                   HRDKDRRKETVNRS"
FT   misc_feature    599767..600618
FT                   /locus_tag="SSU0575"
FT                   /note="HMMPfam hit to PF03668, P-loop ATPase protein, score
FT                   4e-130"
FT                   /inference="protein motif:HMMPfam:PF03668"
FT   misc_feature    599788..599811
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    600469..600492
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        600639..601613
FT                   /transl_table=11
FT                   /locus_tag="SSU0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45275"
FT                   /protein_id="CAR45275.1"
FT                   /translation="MRKPKITVIGGGTGIPVILKSLRDKDVEITAIVTVADDGGSSGEI
FT                   RQALQVTPPGDLRNVLLAMSDMPKLYEQIFQYRFADSDGPLAGHPLGNLIIAGISEMQG
FT                   STYNAMRLLTRFFHTTGRIYPSSEQALTLHAIFTDGTEVAGESKISKHNGMIDHVYVTN
FT                   SYNDDEPKASRQVVETIMESDMIVLGPGSLFTSILPNLMISDIGKALKETKAEVTYVCN
FT                   IMTQRGETEFFSDADHVAVLNAHLAEQFIDTVLVNIEPVPQEYMNSNQFDEYLVQVKHD
FT                   FAGLQKQANRVISSNFLRLENGGAFHDGDLVVEELLKILQVRP"
FT   misc_feature    600654..601541
FT                   /locus_tag="SSU0576"
FT                   /note="HMMPfam hit to PF01933, Protein of unknown function
FT                   UPF0052 and CofD, score 1.5e-141"
FT                   /inference="protein motif:HMMPfam:PF01933"
FT   misc_feature    600654..600698
FT                   /note="PS01036 Heat shock hsp70 proteins family signature
FT                   3."
FT                   /inference="protein motif:Prosite:PS01036"
FT   CDS_pept        601610..602527
FT                   /transl_table=11
FT                   /locus_tag="SSU0577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45278"
FT                   /protein_id="CAR45278.1"
FT                   /translation="MSFTVQVKEELLLQSSQNKSELSAIIKLSGSLGLASSGLTLSIST
FT                   ENAKIARHIYELLLHFYQIKAEIRHHQKPNLKKNRVYAVLIEDGVNEILNDLHLADSFF
FT                   GLETGISPLVLENDSWSQAYLRGAFLAAGSVKDPEKGKYQLEIASVYSDHANDLANLMQ
FT                   KFLLDAKVIERSKGTITYLQRAEDIMDFLLVIGAEETKTEFENVKLLREARNDLNRATN
FT                   AEAANIAKTVNASMKTINNIIKIMDTIGLDQLSGDLQEIAQLRIQHPDYSIQQLADSLT
FT                   VPITKSGVNHRLRKINKIADELTD"
FT   misc_feature    601616..602512
FT                   /locus_tag="SSU0577"
FT                   /note="HMMPfam hit to PF02650, Protein of unknown function
FT                   DUF199, score 4.1e-71"
FT                   /inference="protein motif:HMMPfam:PF02650"
FT   CDS_pept        602813..603508
FT                   /transl_table=11
FT                   /locus_tag="SSU0579"
FT                   /product="Crp family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45280"
FT                   /protein_id="CAR45280.1"
FT                   /translation="MISNEQYDYLRAHPTFERLTRDSFDQLAKHIRFRKIPKGQIFFYA
FT                   EDPRDYLFVLYKGYARIEQYDETDSFTYLDYIRQGGAFPFGDMFQDKPYHYTAIAITDL
FT                   EYFIVPMVLFETLSKINPSQMAYICQKLSKVLRFQELRLRNAMRSKASDRVVQALALLY
FT                   WDMCQREQFATLPFEIHIQEISRLAATTRETVSHVLKQLKQDGKIAYSHKQLTYLDIDY
FT                   FLENLTETH"
FT   misc_feature    602909..603181
FT                   /locus_tag="SSU0579"
FT                   /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding,
FT                   score 3.1e-17"
FT                   /inference="protein motif:HMMPfam:PF00027"
FT   misc_feature    603335..603436
FT                   /locus_tag="SSU0579"
FT                   /note="HMMPfam hit to PF00325, Bacterial regulatory
FT                   protein, Crp, score 5.2e-05"
FT                   /inference="protein motif:HMMPfam:PF00325"
FT   misc_feature    603347..603412
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1622.000, SD 4.71 at aa 179-200, sequence
FT                   IHIQEISRLAATTRETVSHVLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        603769..604998
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="SSU0580"
FT                   /product="arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45282"
FT                   /protein_id="CAR45282.1"
FT                   /translation="MSNHPIHVFSEIGKLKKVMLHRPGKEIENLMPDYLERLLFDDIPF
FT                   LEDAQKEHDAFAQALRDEGVEVLYLEKLAAESLVTPEIREQFIDEYLEEANIRGRATKK
FT                   AIRKLLMSIEDNQELVEKTMAGVQKAELPEIPSEEKGLTDLVESSYPFAIDPMPNLYFT
FT                   RDPFATIGNAVSLNHMYSETRNRETLYGKYIFTHHPEYGGKVPLVYNREETTRIEGGDE
FT                   LVLSKDVLAVGISQRTDAASIEKLLVNIFERHVGFKKVLAFEFANNRKFMHLDTVFTMV
FT                   DYDKFTIHPEIEGDLRVFSVTYENDTLHIEEEHGDLAELLAANLGLEKVELIRCGGGDM
FT                   VAAGREQWNDGSNTLTIAPGVVVVYKRNTITNAILESKGLRLIKIGGSELVRGRGGPRC
FT                   MSMPFEREDI"
FT   misc_feature    603796..604986
FT                   /gene="arcA"
FT                   /locus_tag="SSU0580"
FT                   /note="HMMPfam hit to PF02274, Amidinotransferase, score
FT                   4e-199"
FT                   /inference="protein motif:HMMPfam:PF02274"
FT   CDS_pept        604998..605438
FT                   /transl_table=11
FT                   /locus_tag="SSU0581"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45284"
FT                   /protein_id="CAR45284.1"
FT                   /translation="MPSIERTTIGSEEWQRAASIYVRYKVFVLERGIAKEDEFDQNDTE
FT                   ERVYANLFIGEEPVSTGRFLPVGPGQARLTRIATLPNFRGKGYGKMIISSLEAYAREAG
FT                   FHQLNIHSELTAKTFYESVGYQATSEVYQEDGEWCQTLTKFI"
FT   misc_feature    605154..605375
FT                   /locus_tag="SSU0581"
FT                   /note="HMMPfam hit to PF00583, GCN5-related
FT                   N-acetyltransferase, score 1e-10"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        605457..606470
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="SSU0582"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45285"
FT                   /protein_id="CAR45285.1"
FT                   /translation="MTNVFKGRHFLAEKDFTRAELEWLIDFSAHLKDLKKRNIPHRYLE
FT                   GKNIALLFEKTSTRTRAAFTVASIDLGAHPEYLGANDIQLGKKESTEDTAKVLGRMFDG
FT                   IEFRGFSQKMVEELAEFSGVPVWNGLTDAWHPTQMLADYLTVKENFGKLEGLTLVYCGD
FT                   GRNNVANSLLVTGAILGVNVHIFSPKELFPEEEVVALAEGFAKESGARVLITDNADEAV
FT                   KGADVLYTDVWVSMGEEDKFAERVALLKPYQVNMELVKKAENENLIFLHCLPAFHDTNT
FT                   VYGKDVAEKFGVEEMEVTDEVFRSKYARHFDQAENRMHTIKAVMAATLGDPFVPRV"
FT   misc_feature    605478..605903
FT                   /gene="arcB"
FT                   /locus_tag="SSU0582"
FT                   /note="HMMPfam hit to PF02729, Aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding, score 7.8e-68"
FT                   /inference="protein motif:HMMPfam:PF02729"
FT   misc_feature    605613..605636
FT                   /note="PS00097 Aspartate and ornithine
FT                   carbamoyltransferases signature."
FT                   /inference="protein motif:Prosite:PS00097"
FT   misc_feature    605913..606440
FT                   /gene="arcB"
FT                   /locus_tag="SSU0582"
FT                   /note="HMMPfam hit to PF00185, Aspartate/ornithine
FT                   carbamoyltransferase, Asp/Orn-binding region, score
FT                   7.3e-79"
FT                   /inference="protein motif:HMMPfam:PF00185"
FT   CDS_pept        606588..607535
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="SSU0583"
FT                   /product="carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45286"
FT                   /protein_id="CAR45286.1"
FT                   /translation="MANRKIVVALGGNAILSSDPSAKAQKEALVQTAKHLVKLIKNGDD
FT                   LIITHGNGPQVGNLLLQNLAADSEKNPAFPLDSLVAMTEGSIGFWLQNALENELLKEGI
FT                   EKDVASVVTQVIVDKNDPAFENLTKPIGPFYTEEEAKAEAEKTGATFKEDAGRGWRKVV
FT                   ASPKPVGIKEIGTIRTLLNAGEVVVAAGGGGIPVVQEADGTLTGVEAVIDKDFASQCLA
FT                   ELVDADLFIVLTGVDYVFVNYNKPDQEKLETVTVAELEEYIKQNQFAPGSMLPKVEAAI
FT                   AFVNNKPQSKAVITSLENLGALIESDSGTIIVKG"
FT   sig_peptide     606588..606659
FT                   /gene="arcC"
FT                   /locus_tag="SSU0583"
FT                   /note="Signal peptide predicted for SSU0583 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.985) with cleavage site
FT                   probability 0.932 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    606597..607475
FT                   /gene="arcC"
FT                   /locus_tag="SSU0583"
FT                   /note="HMMPfam hit to PF00696,
FT                   Aspartate/glutamate/uridylate kinase, score 9.2e-96"
FT                   /inference="protein motif:HMMPfam:PF00696"
FT   CDS_pept        607878..609380
FT                   /transl_table=11
FT                   /locus_tag="SSU0584"
FT                   /product="C4-dicarboxylate anaerobic carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45288"
FT                   /protein_id="CAR45288.1"
FT                   /translation="MSEKVKKGFKLPSSYTILMLIIAFMAVMTWVIPAGQYQVDEAGRL
FT                   VAGTYEKVAQNPQGIYDVFMAPVRAMLGHGATEAAINVAFFIIMVGAFLGVVNETGALD
FT                   VGIASIVKRFKGREKMLIYILMPLFALGGSTYGMGEETMAFFPLLVPVMMAVGFDSITG
FT                   VAIILLGSQIGCLASTVNPFATVVASDAAGVSVADGMIWRFVFFVVILAMGVLFVANYA
FT                   EKVKNDPTKSLVYKQREADMQHFNVAATQEVNAELSPAQKRVLWVFVLTFVLMICSFIP
FT                   WEDLGVTIFTQFNDWLIGLPFIGQVIGSSTAALGTWYFPEGAMLFGIAGIVVGLVYGMS
FT                   EERLVKSFMFGAADIFSVALICAIARGIQVIMNDGMITATILHMGEEGLQGLSSQVFII
FT                   LTYLFYLPMSFLIPSSSGLAGASMGIMAPLGEFVNVPASLVITAFQAASGLLNLVAPTS
FT                   GIVMGALALGRVEIGTWYKFVGKLIVGIMIASIAILVIATFF"
FT   sig_peptide     607878..607985
FT                   /locus_tag="SSU0584"
FT                   /note="Signal peptide predicted for SSU0584 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.981) with cleavage site
FT                   probability 0.352 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    607908..609374
FT                   /locus_tag="SSU0584"
FT                   /note="HMMPfam hit to PF03606, C4-dicarboxylate anaerobic
FT                   carrier, score 9.7e-204"
FT                   /inference="protein motif:HMMPfam:PF03606"
FT   misc_feature    join(607914..607982,608100..608168,608238..608291,
FT                   608319..608387,608406..608465,608475..608543,
FT                   608667..608723,608766..608834,608838..608891,
FT                   608919..608987,609048..609116,609213..609281,
FT                   609300..609368)
FT                   /locus_tag="SSU0584"
FT                   /note="13 probable transmembrane helices predicted for
FT                   SSU0584 by TMHMM2.0 at aa 13-35, 75-97, 121-138, 148-170,
FT                   177-196, 200-222, 264-282, 297-319, 321-338, 348-370,
FT                   391-413, 446-468 and 475-497"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        609499..610839
FT                   /transl_table=11
FT                   /locus_tag="SSU0585"
FT                   /product="petidase family M20/M25/M40 protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45291"
FT                   /protein_id="CAR45291.1"
FT                   /translation="MRTSFIQSSHQEACIQAIQELVAFPSVLQEHQADTPFGQAIQDVL
FT                   EHTLALTEKMGFKTYLDPAGYYGYAEIGQGEELLAILCHLDVVPAGDLSQWQTPPFEAV
FT                   VEGDYIIGRGVQDDKGPSMAALFAVKALLDAGVQFNKRIRFIFGTDEETLWRCMNRYNQ
FT                   LEEVATMGFAPDSSFPLTYAEKGLLQAKLHGPGHPCLSIEAGTAYNVVPAKASYSGHLL
FT                   AGVIAELDQLGFDYEIKDDQVTVLGISRHAKDAAEGVNAIVRLAKALEHFENHPALDFI
FT                   VNAVGEDATGFKLFGDVTDEPSGTLSFNIAGLTISAKKSEIRLDIRIPVTADKEALVST
FT                   LQAKAQSCGLTYEEYDYLASLYVPLDSQLVSTLMSVYQDKTGDLTSEPISSGGATFART
FT                   MPNCVAFGACFPDTEQTEHQENERMPLEDLYKTMDIYAEAVYRLTAE"
FT   misc_feature    609736..610824
FT                   /locus_tag="SSU0585"
FT                   /note="HMMPfam hit to PF01546, Peptidase M20, score
FT                   3.5e-27"
FT                   /inference="protein motif:HMMPfam:PF01546"
FT   misc_feature    610768..610833
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1124.000, SD 3.02 at aa 430-451, sequence
FT                   MPLEDLYKTMDIYAEAVYRLTA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        611210..615469
FT                   /transl_table=11
FT                   /locus_tag="SSU0587"
FT                   /product="glycosyl hydrolase family protein"
FT                   /note="Internal region is similar to Clostridium
FT                   perfringens endo-beta-galactosidase C UniProt:Q8XNF8
FT                   (EMBL:BA000016) (845 aa) fasta scores: E()=1.6e-168,
FT                   55.637% id in 816 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45292"
FT                   /protein_id="CAR45292.1"
FT                   /translation="MKKETSKFTKKVILGQLLICTSFLVWAGQTVAAEEVSQGEPVAIN
FT                   NETPPVIEAKPLVEATPSTETEPSTPEEKQEEPQVAGKNVVEGKKPVTNSQHQMVSELS
FT                   TVPSVSIKNPDAATDGSAYGSSDDANSNTKIIAGKETGEPDNGYSKWDHVYVQYDFEKE
FT                   VPVHTVKIHRNTYDNAVSTFKDVKVELSTSADFSPETTEVIFKQADVEETIANKGQPQV
FT                   IQLPAPINARYIRIWGRGHYIQNTNSSWKGYSNGVLFNEIEVLAQVEADAGTNEEPQTE
FT                   LVNLAKLKKPYFYGKAPTNPEAINDGKFDENYTTQESIGDKAYLQYEFRNVYTIEEIKV
FT                   QLAPGEYRNFRIDLDDDYNDGNNYNTIYKNENFTIDKEQIITIKTPKNSKARYVRFRGT
FT                   RVDDTPLRYSEIQIMGRGKSYDESAPEYVPPKSEYDTLVWSDEFNGDKIDESKWQIIDG
FT                   MWNHAAIYNRKAVSIKKDGDKSYLSIRSTNHKDKKTLVEAVGHDRYDDKELPDKVTWSS
FT                   GRLESKDKYSFQFGRMAVRAKVNDSKGIWPAIWMLAQDETGHDEIDVLEYLGQNPWYAW
FT                   TTNHFGILAKNKKSDGSAYKNYEAWSQEFHVYEVEWTPDVIKWYIDGKFVFQTDRGKDR
FT                   DGMHTRPMFPILETQVGDGWVGDVDYKRNMTKQDSEYLVDWVRIYQKADQSKVRFDNLD
FT                   DAKPNDYVIKPQQKLGHLVTVSNGKAAHENKNNFYYGGQPRYETSRLYADGDGENALVY
FT                   KIANPEALHLTTYYKTLEDYSVYNKEAGANEGKSVRKHLINAKDGEIDFTVYSSVDGKS
FT                   WNKENVTVVDNFVEATPAYARTTFDIRNIRKGTKFVKIVFPTVKGISYKLEDGTEKGLQ
FT                   ASDVQLAKVTFVATHPEAEPEKPIVDQEKLALSKVFSLDAGRKYFSVNQIKEIIDLISS
FT                   YGYTDMNLLLGNDGLRFLLDDMNLTVGDKVYDSEAVRKAIINGNKHYYDDPNGTTLSQS
FT                   EMDDILAYAKEKNISIIPTINSPGHMDAIVEAMEELGIKSPKFSYNGKTSARTVDLKND
FT                   QAVAFTKALIDKYASYFAGKSKIFNIGLDEYANDATNASGWHILQTQGDYGKFIQYAND
FT                   LAAIVKKHGLEPMAFNDGIYYNHDTSSGTFDKDIIASFWTGGWGGYDVASSKFLHEKGH
FT                   KILNTNDAWYYVIGREAEGLGWYNLDQGLRGTKSTRFDQVPKSENTKVPIIGSMVAVWA
FT                   DDPSKPYSYDSIKKLLHSFTENNSDYFLAEYRDLREEVGKIPTDLNSYTPESVATLKEV
FT                   LNKIDWKLSRNNQAFVDGYLAEVKAAREALVPVTAKGDSVKAEPLPEGKLPLITAKGKS
FT                   VQAEPRPAFKGYLTSNYGPSVTPLSLVSKPSSEQSNSKQAASQKKELPNTGVVDGLGFS
FT                   LLGMIGLAFASRRRKKE"
FT   sig_peptide     611210..611308
FT                   /locus_tag="SSU0587"
FT                   /note="Signal peptide predicted for SSU0587 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.945 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    611555..611995
FT                   /locus_tag="SSU0587"
FT                   /note="HMMPfam hit to PF00754, Coagulation factor 5/8 type,
FT                   C-terminal, score 0.0029"
FT                   /inference="protein motif:HMMPfam:PF00754"
FT   misc_feature    612068..612442
FT                   /locus_tag="SSU0587"
FT                   /note="HMMPfam hit to PF00754, Coagulation factor 5/8 type,
FT                   C-terminal, score 4.3e-06"
FT                   /inference="protein motif:HMMPfam:PF00754"
FT   misc_feature    612581..613243
FT                   /locus_tag="SSU0587"
FT                   /note="HMMPfam hit to PF00722, Glycoside hydrolase, family
FT                   16, score 1.7e-33"
FT                   /inference="protein motif:HMMPfam:PF00722"
FT   misc_feature    613547..613570
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    613928..614902
FT                   /locus_tag="SSU0587"
FT                   /note="HMMPfam hit to PF00728, Glycoside hydrolase, family
FT                   20, catalytic core, score 7.8e-15"
FT                   /inference="protein motif:HMMPfam:PF00728"
FT   misc_feature    614393..614416
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    615353..615463
FT                   /locus_tag="SSU0587"
FT                   /note="HMMPfam hit to PF00746, Surface protein from
FT                   Gram-positive cocci, anchor region, score 0.0002"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   misc_feature    615377..615394
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        complement(615760..616233)
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="SSU0588"
FT                   /product="arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45297"
FT                   /protein_id="CAR45297.1"
FT                   /translation="MNKIESRHQLILSLIMEKKIHTQQELQELLEVNGVSVTQSTLSRD
FT                   IKMLNLVKVNEDDSSHYVINPIAPTRWEKRLRLYMEDALVMLKPIQHQVVLKTLPGLAN
FT                   SFGSILDAMEIPQIVATVCGDDVCLIICEDVEGAQACFEHLKQFTPPFFFSKL"
FT   misc_feature    complement(615790..615999)
FT                   /gene="argR"
FT                   /locus_tag="SSU0588"
FT                   /note="HMMPfam hit to PF02863, Arginine repressor, score
FT                   8.9e-27"
FT                   /inference="protein motif:HMMPfam:PF02863"
FT   misc_feature    complement(616024..616233)
FT                   /gene="argR"
FT                   /locus_tag="SSU0588"
FT                   /note="HMMPfam hit to PF01316, Arginine repressor, score
FT                   1.2e-18"
FT                   /inference="protein motif:HMMPfam:PF01316"
FT   CDS_pept        complement(616282..617310)
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="SSU0589"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45300"
FT                   /protein_id="CAR45300.1"
FT                   /translation="MNTADFDFDLPEELIAQVPLEKRDSSKLLILDREKRSMVDSHFDH
FT                   IIDQLNPGDALVMNNTRVLPARLYGYKPETMGHVELLLLKNTQGDQWEVLAKPAKRLKV
FT                   GTTVAFGDGRLTATIVEELEHGGRIVEFSYEGIFLEVLESLGEMPLPPYIHEKLEDRER
FT                   YQTVYAKENGSAAAPTAGLHFTQELLEKIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEH
FT                   EMHSEFYNLSAEAAQTLNQVKDSGGRIVAVGTTSIRTLETIGNKFDGRLQADSGWTNIF
FT                   IKPGYTFRIVDAFSTNFHLPKSTLVMLVSAFAGREFTLDAYKHAVEERYRFFSFGDAMF
FT                   IQ"
FT   misc_feature    complement(616663..617310)
FT                   /gene="queA"
FT                   /locus_tag="SSU0589"
FT                   /note="HMMPfam hit to PF02547, Queuosine biosynthesis
FT                   protein, score 1.8e-118"
FT                   /inference="protein motif:HMMPfam:PF02547"
FT   CDS_pept        617656..618360
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="SSU0591"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45303"
FT                   /protein_id="CAR45303.1"
FT                   /translation="MKIHVVNNQVEGATVALDILREKLNGGTKVLGLATGSSPLEFYRL
FT                   IRESDLDFSDVTSVNLDEYVGLGEESDQSYIHFMKENLFNTKPFKQSYLPNGLATDVVA
FT                   ETERYNKILAEHPVDFQILGIGRNGHIGFNEPGAPFDGQTHLVELAPSTIEANARFFDN
FT                   PEDVPKQAISMGIANIMAAKTIVLMAYGQEKADAIKATVEGAVTEDVPASVLQNHDNVI
FT                   LILDQAAASKLV"
FT   misc_feature    617698..618351
FT                   /gene="nagB"
FT                   /locus_tag="SSU0591"
FT                   /note="HMMPfam hit to PF01182,
FT                   Glucosamine/galactosamine-6-phosphate isomerase, score
FT                   1.8e-41"
FT                   /inference="protein motif:HMMPfam:PF01182"
FT   CDS_pept        618827..619171
FT                   /transl_table=11
FT                   /locus_tag="SSU0592"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45305"
FT                   /protein_id="CAR45305.1"
FT                   /translation="MKHIVTKRNYKVGACAMALALLMTTAGGAVVNAEQHLESSVGLVQ
FT                   RGDVLLKLKESNQSFNEGEVGNLEPVNPTVPPMASSVQKSWFSSFWGGVKTFWNALCCS
FT                   VGLTGLKVSK"
FT   sig_peptide     618827..618925
FT                   /locus_tag="SSU0592"
FT                   /note="Signal peptide predicted for SSU0592 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.342 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    618860..618919
FT                   /locus_tag="SSU0592"
FT                   /note="1 probable transmembrane helix predicted for SSU0592
FT                   by TMHMM2.0 at aa 12-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        619570..619884
FT                   /transl_table=11
FT                   /locus_tag="SSU0593"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45307"
FT                   /protein_id="CAR45307.1"
FT                   /translation="MKQLVTKRSYKIGLSAMALVLLMTTAGGATAHASTGTYSVETRGD
FT                   AKVYRLLETPAGSFTQGGIVLKPVNNSTTKPSETKSWFDSFWSSVKTFWEAICRGVGWC
FT                   "
FT   sig_peptide     619570..619668
FT                   /locus_tag="SSU0593"
FT                   /note="Signal peptide predicted for SSU0593 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.988 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    619603..619671
FT                   /locus_tag="SSU0593"
FT                   /note="1 probable transmembrane helix predicted for SSU0593
FT                   by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        620316..620651
FT                   /transl_table=11
FT                   /locus_tag="SSU0594"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45312"
FT                   /protein_id="CAR45312.1"
FT                   /translation="MKRIVTKRSYKVGLCAMALALLMSTAGGVTAGAQGHNFTSSDSSA
FT                   MRNTQVLVKGNTSNRSSHDGPVKIAMPRAAGSKKQKTWYESLWSTIKKFFEQLRHGFHL
FT                   ERLFKNG"
FT   sig_peptide     620316..620414
FT                   /locus_tag="SSU0594"
FT                   /note="Signal peptide predicted for SSU0594 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.750 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    620349..620417
FT                   /locus_tag="SSU0594"
FT                   /note="1 probable transmembrane helix predicted for SSU0594
FT                   by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        620761..621105
FT                   /transl_table=11
FT                   /locus_tag="SSU0595"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45313"
FT                   /protein_id="CAR45313.1"
FT                   /translation="MKQANSKLVALTLITTLAVTSVIATTVHAEEKVTADQTVAGKHKP
FT                   ITGEQLQKAIGDRNPNSIQIQAKFENTNFKNQGITFIGKAEIPSKSSEKSSWFWELWTR
FT                   FTTFVKGIFS"
FT   sig_peptide     620761..620847
FT                   /locus_tag="SSU0595"
FT                   /note="Signal peptide predicted for SSU0595 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.998 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    620779..620847
FT                   /locus_tag="SSU0595"
FT                   /note="1 probable transmembrane helix predicted for SSU0595
FT                   by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        621720..623255
FT                   /transl_table=11
FT                   /gene="dltA"
FT                   /locus_tag="SSU0596"
FT                   /product="D-alanine--poly(phosphoribitol) ligase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45315"
FT                   /protein_id="CAR45315.1"
FT                   /translation="MISSMLERVEHFATENPDYPVYHYLGQLYSYGDLKADSDSLAAHI
FT                   DSLDLPANSPVLVFGGQEYQMLAIFVALTKAGHPYIPVDSHSALDRIEAILEIAEPSLV
FT                   FAVADFPLETSLPVLGLSEVEAIFEKKSTYQLIHPVSEDDTYYIIFTSGTTGKPKGVQI
FT                   SHDNLLSFTNWMIRDKEFALPERPQMLAQPSYSFDLSVMYWAPTLALGGTLFALPKELT
FT                   LDFKTLFAAIQTLPFKIWTSTPSFVDMALLSREFDGEHLPDLTHFYFDGEELTVKTAQK
FT                   LRERFPKAVIVNAYGPTEATVALSAVAITDEMLVNYKRLPIGYTKPDSPTFILDEDGQV
FT                   VPNGQQGEIVVSGPAVSKGYLNNPERTEAAFFQFDGLQAYHTGDLGVMTDEGLLLYGGR
FT                   MDFQIKYNGYRIELEEVAQHLNKSTYIEAAVAVPRYNADHKVQNLLAYVVPKAGIMEQF
FT                   DRELELTKVIKQELKERMMDYMMPSKFIYRDSLPLTANGKIDIKGLIAEVNAQ"
FT   misc_feature    621807..623012
FT                   /gene="dltA"
FT                   /locus_tag="SSU0596"
FT                   /note="HMMPfam hit to PF00501, AMP-dependent synthetase and
FT                   ligase, score 2.7e-113"
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   misc_feature    622161..622196
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    622926..622952
FT                   /note="PS00697 ATP-dependent DNA ligase AMP-binding site."
FT                   /inference="protein motif:Prosite:PS00697"
FT   CDS_pept        623252..624493
FT                   /transl_table=11
FT                   /gene="dltB"
FT                   /locus_tag="SSU0597"
FT                   /product="putative activated D-alanine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45318"
FT                   /protein_id="CAR45318.1"
FT                   /translation="MMEFFKQLPQLEPYGNPLYFFYLVLALVPIFIGLFFKKRFPLYET
FT                   GVSLAFIVLMFTGTKTMQLLSLLAYIIWQTMLIFFYKHYRQRANQSWVFYLIVCLAVFP
FT                   LTWVKLAPTFSQHGAIFGFLGISYLTFRSVGMVIEMRDGLLTEFSLGSFLRFLLFMPTI
FT                   SSGPIDRYRRFTEDYKQIPERTELLNMLDQTVHYIMMGFLYKFILAYFIGHTLLEPLKA
FT                   VALDQGGWFNLPTIGVMYLYGFELFFDFAGYSMFAIGISNLMGIRCPINFDQPFKSRDL
FT                   KEFWNRWHISLSFWFRDFVFMRLVKTLLKHKVFKNRNTVSNVAYLLNMLLMGLWHGVTW
FT                   YYIAYGLFHALGLIINDAWIRKKKSINLARKKAGQEPLPDNRWTSFAGMFVTFHTVMFS
FT                   FLIFSGFLDKLWFK"
FT   misc_feature    join(623288..623356,623399..623467,623522..623575,
FT                   623588..623656,623831..623899,623957..624025,
FT                   624215..624283,624404..624472)
FT                   /gene="dltB"
FT                   /locus_tag="SSU0597"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSU0597 by TMHMM2.0 at aa 13-35, 50-72, 91-108, 113-135,
FT                   194-216, 236-258, 322-344 and 385-407"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    623570..624448
FT                   /gene="dltB"
FT                   /locus_tag="SSU0597"
FT                   /note="HMMPfam hit to PF03062, Membrane bound O-acyl
FT                   transferase, MBOAT, score 7.3e-92"
FT                   /inference="protein motif:HMMPfam:PF03062"
FT   CDS_pept        624536..624775
FT                   /transl_table=11
FT                   /gene="dltC"
FT                   /locus_tag="SSU0598"
FT                   /product="D-alanyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45322"
FT                   /protein_id="CAR45322.1"
FT                   /translation="MDVKETILNIIEELFMEDVSEMMDEDLFDAGVLDSMGTVELIVEL
FT                   ESRFNITVPVSEFGREDWNTANKIISGVVELMHA"
FT   CDS_pept        624768..626033
FT                   /transl_table=11
FT                   /gene="dltD"
FT                   /locus_tag="SSU0599"
FT                   /product="putative D-alanyl-lipoteichoic acid biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45324"
FT                   /protein_id="CAR45324.1"
FT                   /translation="MRKQLWQIFGPVICATFLVILTLLFFPSSSRSNFKEEKQDAVALS
FT                   YISFKSKYKKNRALGDKNHRFVPFFGSSEWSRFDSMHPSVLADAYQREYTPYLLGQRGA
FT                   ASLTQYFGMQQIGAHLKNSQAIYVVSPQWFSPKGASSKAFEQYFSSDQATHFLQTSAKD
FT                   DYDRYAAKRFLELKSDCSLTGMFQKVASGKELSKWDREQLNWQAYLLEKQDALFSRFAD
FT                   SGSNLGLVETEAMKLPETFSYDRLSKVANEDGSRSTQSNDFQIDDRFYRNRLQSKIKKL
FT                   KQSQTKISYLQSPEYNDFQLVLNEFAKHQTDVLFVIPPVNERWMNYTGLNKDMYRATVA
FT                   KIKYQLTSQGFNHIADLSEQGGIDYFMQDTIHIGWQGWLELDKYVHPFLTEQQAPVHYQ
FT                   LKKEFLTSEWAAYKGDLNLFLK"
FT   sig_peptide     624768..624863
FT                   /gene="dltD"
FT                   /locus_tag="SSU0599"
FT                   /note="Signal peptide predicted for SSU0599 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991) with cleavage site
FT                   probability 0.626 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    624780..624848
FT                   /gene="dltD"
FT                   /locus_tag="SSU0599"
FT                   /note="1 probable transmembrane helix predicted for SSU0599
FT                   by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    624873..625061
FT                   /gene="dltD"
FT                   /locus_tag="SSU0599"
FT                   /note="HMMPfam hit to PF04915, DltD, N-terminal, score
FT                   2.3e-31"
FT                   /inference="protein motif:HMMPfam:PF04915"
FT   misc_feature    625062..625550
FT                   /gene="dltD"
FT                   /locus_tag="SSU0599"
FT                   /note="HMMPfam hit to PF04918, DltD, central region, score
FT                   5.8e-60"
FT                   /inference="protein motif:HMMPfam:PF04918"
FT   misc_feature    625551..625943
FT                   /gene="dltD"
FT                   /locus_tag="SSU0599"
FT                   /note="HMMPfam hit to PF04914, DltD, C-terminal, score
FT                   1.1e-74"
FT                   /inference="protein motif:HMMPfam:PF04914"
FT   CDS_pept        complement(626122..627237)
FT                   /transl_table=11
FT                   /locus_tag="SSU0600"
FT                   /product="putative low temperature requirement A protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45326"
FT                   /protein_id="CAR45326.1"
FT                   /translation="MSEITAKRVSNYELFYDLVFVLATSSLTGLLHGNHIGFKEVTTFI
FT                   TTNLIIMTLWMNETIYLNKYGERDFLDIFTIIPSMYLIGNMSLNFSNDFAQTALPFNTF
FT                   LTLSYVIILLQYYLRGRRIGFNEDIKATLQMLATYIVVFAGATLLVIFKLWTNDERMLI
FT                   VYIIPFLISFFFQKRMSHDPINFPHMVERCQLITIITFGEIVIAIIKNYPLLELPLEGI
FT                   LLFFAMATLFIFYISQTYLTIDHHRKADATVLLYAHLVIVLGLNFFTVAMELFPSHHND
FT                   LALPMLIVGNLIFYSGILSTSFYNQQVHQVGRRGLFIYALILLIGNVALLLDGHSNILL
FT                   FVILNLLSHAMVAYHVIRFGKANHSLLGEDM"
FT   misc_feature    complement(join(626167..626226,626239..626292,
FT                   626326..626394,626422..626481,626515..626574,
FT                   626587..626655,626713..626757,626785..626844,
FT                   626878..626946,626974..627030,627049..627117,
FT                   627145..627204))
FT                   /locus_tag="SSU0600"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SSU0600 by TMHMM2.0 at aa 12-31, 41-63, 70-88, 98-120,
FT                   132-151, 161-175, 195-217, 222-241, 253-272, 282-304,
FT                   316-333 and 338-357"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(626170..627222)
FT                   /locus_tag="SSU0600"
FT                   /note="HMMPfam hit to PF06772, Bacterial low temperature
FT                   requirement A, score 8.7e-51"
FT                   /inference="protein motif:HMMPfam:PF06772"
FT   CDS_pept        complement(627310..628266)
FT                   /transl_table=11
FT                   /locus_tag="SSU0601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45328"
FT                   /protein_id="CAR45328.1"
FT                   /translation="MGLLQDGKWVDQWYDTKSTGGKFIRSVTQFRNWITPDGQAGPTGE
FT                   GGFKAESGRYHLYISLACPWASRTLIMRKLKGLEDHISLSVVHPLMLENGWTFEDGPGV
FT                   IKDTLFNSDYLYQVYLKADPHYSGRVTVPVLWDKKTNTIVSNESAEIMRMFNSAFNDIT
FT                   GNYDDYYPANLQAEIDAMNDFVYPNINNGVYKAGFSTSQAVYEKEVKNLFAALDKLEEH
FT                   LADKNYLVGNQLTEADIRLFTTLVRFDPVYFGHFKCNIKALVDYPNLWNYTKRIYNHAG
FT                   IAETVDFDHIKQHYYGSHKTINPTGIVPVGPDLDWTL"
FT   misc_feature    complement(627427..627741)
FT                   /locus_tag="SSU0601"
FT                   /note="HMMPfam hit to PF00043, Glutathione S-transferase,
FT                   C-terminal, score 1.1e-10"
FT                   /inference="protein motif:HMMPfam:PF00043"
FT   CDS_pept        628405..629121
FT                   /transl_table=11
FT                   /locus_tag="SSU0602"
FT                   /product="putative ribosomal small subunit pseudouridine
FT                   synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45331"
FT                   /protein_id="CAR45331.1"
FT                   /translation="MRLDKCLEKAKVGSRKQVKKLFKAQQIKINGQAAQSLSQIVDPEL
FT                   QTIQVSGKKVALEGSAYYLLHKPAGVVSAVTDQEHQTVIDLISPQDSREGLYPVGRLDR
FT                   DTEGLVLITNNGPLGYRMLHPSHHVDKVYYVEVNGCLAEDASKFFASGVTFLDGTRCQP
FT                   ADLTVLEASLDHSRATIKLAEGKFHQVKKMFLAYGVKVTYLKRISFGGFELGDLERGTY
FT                   RQLTPNEMEHLFTYFD"
FT   misc_feature    628405..628545
FT                   /locus_tag="SSU0602"
FT                   /note="HMMPfam hit to PF01479, RNA-binding S4, score
FT                   2.8e-05"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   misc_feature    628585..628992
FT                   /locus_tag="SSU0602"
FT                   /note="HMMPfam hit to PF00849, Pseudouridine synthase,
FT                   score 2.2e-10"
FT                   /inference="protein motif:HMMPfam:PF00849"
FT   misc_feature    628702..628746
FT                   /note="PS01149 Rsu family of pseudouridine synthase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01149"
FT   CDS_pept        629135..629614
FT                   /transl_table=11
FT                   /locus_tag="SSU0603"
FT                   /product="putative glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45333"
FT                   /protein_id="CAR45333.1"
FT                   /translation="MSIYDFTVQKQDGTDQSMAEYQGQVLLIVNTAPGCGLAPQYKELQ
FT                   ELYDSYKDNGFVVLDFPCNQFLNQAPGSAEDINQICSLNYGTTFPRFAKIAVNGSEASP
FT                   LYRYLKKEKSTLLGGRIEWNFTKFLVDRQGRVVKRYLPTTSPLKLKEDIELYLEK"
FT   misc_feature    629141..629464
FT                   /locus_tag="SSU0603"
FT                   /note="HMMPfam hit to PF00255, Glutathione peroxidase,
FT                   score 4.6e-46"
FT                   /inference="protein motif:HMMPfam:PF00255"
FT   misc_feature    629309..629332
FT                   /note="PS00763 Glutathione peroxidases signature 2."
FT                   /inference="protein motif:Prosite:PS00763"
FT   CDS_pept        complement(629633..630634)
FT                   /transl_table=11
FT                   /gene="fhuG"
FT                   /locus_tag="SSU0604"
FT                   /product="ferrichrome transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45336"
FT                   /protein_id="CAR45336.1"
FT                   /translation="MIRHHNYLKIFTFLLILLFIIFLLSLSIGYSNSSFSDFIDIMSGR
FT                   ASSSTLLIIGRIRLPRIIASIIGGASLALAGLLLQTLTRNPLADSGILGINAGAGLVVA
FT                   LFVGLSSKISPVLLSLMPLFAMMGGGLTIFLVYWIARKKLYGIHPARLIITGVGISSML
FT                   SGIMVSIISQLDDFKMEYIVQWLSGRVNGGDWKTIAIYTPLLLLVWMATFSRSRSLNIM
FT                   NLNDQTAMALGLHLQRERRITLILATALASLSVILVGNITFVGLIAGHIVRKWLGNDHR
FT                   VIIPATMIIGSFILLLADTIGRVLLVGTGIPTGIIVSLIGAPYFLWLLKQEG"
FT   misc_feature    complement(629642..630586)
FT                   /gene="fhuG"
FT                   /locus_tag="SSU0604"
FT                   /note="HMMPfam hit to PF01032, Bacterial transport system
FT                   permease protein, score 2.2e-85"
FT                   /inference="protein motif:HMMPfam:PF01032"
FT   misc_feature    complement(join(629654..629722,629741..629794,
FT                   629837..629905,629993..630046,630113..630181,
FT                   630215..630283,630311..630379,630398..630466,
FT                   630548..630616))
FT                   /gene="fhuG"
FT                   /locus_tag="SSU0604"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SSU0604 by TMHMM2.0 at aa 7-29, 57-79, 86-108, 118-140,
FT                   152-174, 197-214, 244-266, 281-298 and 305-327"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(630542..630634)
FT                   /gene="fhuG"
FT                   /locus_tag="SSU0604"
FT                   /note="Signal peptide predicted for SSU0604 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.408 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(630631..631656)
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="SSU0605"
FT                   /product="ferrichrome transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45339"
FT                   /protein_id="CAR45339.1"
FT                   /translation="MNKLVSSRYPKTKPKNIWLVFFIICLSFIAGVYLSLRFGAISYSH
FT                   QQLIETLKHPLTNSSAQDVIIDLRLPRMVAAILVGAAMAQAGAMMQGITRNPIADPGLL
FT                   GINAGAGLALIVAYALFGGLHYSQILLICLLGSCLAAGLVFGLAYQVQKGYNQLRLILS
FT                   GAMVASLFSAIGQAITIYFDLSTAVIGWQAGGLVQVNWKMLAIIAPLIIIGLILAQLFS
FT                   HQLTILSLNETVAKNLGQRTLLMTLVLLGIVLLLSASAVALVGSLSFIGLIIPHFIRMF
FT                   TGKNYKLLLPLTAFAGASFLIWVDLVCRSINPPVETPISAVISIIGLPCFLWLIRKEKH
FT                   F"
FT   misc_feature    complement(630646..631578)
FT                   /gene="fhuB"
FT                   /locus_tag="SSU0605"
FT                   /note="HMMPfam hit to PF01032, Bacterial transport system
FT                   permease protein, score 5.2e-102"
FT                   /inference="protein motif:HMMPfam:PF01032"
FT   misc_feature    complement(join(630652..630705,630724..630792,
FT                   630835..630930,630991..631059,631117..631185,
FT                   631204..631272,631282..631350,631387..631455,
FT                   631540..631608))
FT                   /gene="fhuB"
FT                   /locus_tag="SSU0605"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SSU0605 by TMHMM2.0 at aa 17-39, 68-90, 103-125, 129-151,
FT                   158-180, 200-222, 243-274, 289-311 and 318-335"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(631537..631656)
FT                   /gene="fhuB"
FT                   /locus_tag="SSU0605"
FT                   /note="Signal peptide predicted for SSU0605 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.717 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(631670..632599)
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="SSU0606"
FT                   /product="putative ferrichrome-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45341"
FT                   /protein_id="CAR45341.1"
FT                   /translation="MKKFLAIFSLFVGLVFLTACSTSSSSTDVELSSMPKIEGITYHGD
FT                   IPKNPKKVVNFAYSYTGYLLQLGIDVSSYSLDLEKNSPVFGDKLKDVPQLTTADTEAIA
FT                   AQKPDVILVFSGDDNLETLKEIAPVIEITYGKSDYLKMLTDIGQIFGKEKEAQAWLDQW
FT                   DKKVTTAKEELKGLIDTSSTFTVMDFFDKNIFLYGNNFGRGGELIYRALGFAAPAKVQE
FT                   DIINKEGWFGVSQEALPEYVGDYVLVNVNDKTKEAAASLKESDIWKNLPAVKNGHVIEI
FT                   DYNLFYFSDPMSLDLQIDAFVSEIQKLQ"
FT   misc_feature    complement(631748..632452)
FT                   /gene="fhuD"
FT                   /locus_tag="SSU0606"
FT                   /note="HMMPfam hit to PF01497, Periplasmic binding protein,
FT                   score 4e-45"
FT                   /inference="protein motif:HMMPfam:PF01497"
FT   sig_peptide     complement(632525..632599)
FT                   /gene="fhuD"
FT                   /locus_tag="SSU0606"
FT                   /note="Signal peptide predicted for SSU0606 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.467 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(632540..632572)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(632612..633397)
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="SSU0607"
FT                   /product="ferrichrome transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45343"
FT                   /protein_id="CAR45343.1"
FT                   /translation="MSSIQAENIQVSYDNRIIIDELSTSIPKGSITTIIGANGCGKSTL
FT                   LKALTRIIPVQEGAIYLDGQAISQLPTKEVAKKLALLPQVLEATEGISVYELVSYGRFP
FT                   HQNGLGHLTDQDREKINWALEVTRTAPYARLPVDDLSGGQRQRVWIAMALAQDTDTIFL
FT                   DEPTTYLDLNHQLEVLELLKELNQSRQKTIVMVLHDVNLSARFSDYMIAMKEGDIRYHG
FT                   SVSNMMTTEILRDIFSIEPQLMQVAGQDYPILLTYDLKK"
FT   misc_feature    complement(632750..633313)
FT                   /gene="fhuC"
FT                   /locus_tag="SSU0607"
FT                   /note="HMMPfam hit to PF00005, ABC transporter related,
FT                   score 1.1e-50"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(632936..632980)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(633269..633292)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(633549..634994)
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SSU0608"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-dia
FT                   minopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45345"
FT                   /protein_id="CAR45345.1"
FT                   /translation="MITIERVLEILKADANFRHIKQNDQTDSTWTDVQFDALSYDSRTV
FT                   SPMTLFFAKGLAFKKEFLEKAIEAGLAFYVSEINYEVGIPAIIVHDIKQAMSLIAMEFH
FT                   GHPQKQLKLLAFTGTKGKTTAAYFAFNILKQSKKPAMLSTMNTTLDGKTFFKSTLTTPE
FT                   SLDLFAMMAEAVKNGMTHLIMEVSSQAYLVKRVYGLTFDVGVFLNISPDHIGPIEHPTF
FT                   EDYFYHKRLLMDNSRAVIVNAGMDHFEVVKEQVSSKDHDFYGPTSENQISQSAGFDFTA
FT                   TGKLAGHYDIQLIGGFNQENAIAAGLACLRLGASLEDIHTGIAQTNVPGRMEVLTQQNG
FT                   AKVFVDYAHNGDSVKKLIDVVLEHQTGKVFLILGAPGNKGESRRKDFGLLLNDYPQIEV
FT                   ILTADDPNREDPAAIAEQIRAHMTRTSNFILDREEAIRTAMSQTSSPKDAVIIAGKGAD
FT                   AYQIVNGEKAAYDGDLEVAKQYL"
FT   misc_feature    complement(633750..634013)
FT                   /gene="murE"
FT                   /locus_tag="SSU0608"
FT                   /note="HMMPfam hit to PF02875, Mur ligase, C-terminal,
FT                   score 3.2e-21"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   misc_feature    complement(634068..634655)
FT                   /gene="murE"
FT                   /locus_tag="SSU0608"
FT                   /note="HMMPfam hit to PF08245, Mur ligase, central, score
FT                   3.5e-32"
FT                   /inference="protein motif:HMMPfam:PF08245"
FT   misc_feature    complement(634683..634895)
FT                   /gene="murE"
FT                   /locus_tag="SSU0608"
FT                   /note="HMMPfam hit to PF01225, Mur ligase, N-terminal,
FT                   score 0.0039"
FT                   /inference="protein motif:HMMPfam:PF01225"
FT   CDS_pept        635141..635890
FT                   /transl_table=11
FT                   /locus_tag="SSU0609"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45346"
FT                   /protein_id="CAR45346.1"
FT                   /translation="MFYSYLRTLLTFLLWAINGNIHYHDREKILPQEENYILIAPHKTF
FT                   WDPVFLGYAAAPKQFIFMAKKELFKDRGFGWWISKCGAFPIDRDNPGMAAIKYPVNMLK
FT                   KSDRSLVMFPSGSRHSSELKGGVAVIAKSAKVKLMPATYVGPMTIKGLLAGERIDVAFG
FT                   NPIDVSDIKRMDDAGTAEVTSRIEAEFKRLDDHAASFQTKKKPNILTYIYRIPVLLLVA
FT                   LILGLTYAFSYIASFFWQPSTQLDKNK"
FT   misc_feature    635198..635572
FT                   /locus_tag="SSU0609"
FT                   /note="HMMPfam hit to PF01553, Phospholipid/glycerol
FT                   acyltransferase, score 4.3e-25"
FT                   /inference="protein motif:HMMPfam:PF01553"
FT   misc_feature    635789..635857
FT                   /locus_tag="SSU0609"
FT                   /note="1 probable transmembrane helix predicted for SSU0609
FT                   by TMHMM2.0 at aa 217-239"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        635953..636615
FT                   /transl_table=11
FT                   /gene="comEA"
FT                   /locus_tag="SSU0610"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45349"
FT                   /protein_id="CAR45349.1"
FT                   /translation="MDTIKTYIEMLKEYKWQIALPAVAGLLMATFLIFSQPAKSDQTGL
FT                   TDFPQTEQASSSQEQTEETSTEESEELSQLTVDVKGAVEKPGLYTLEAGARVNDAVEAA
FT                   GGLTSQADPKSINLAQKLSDEAVVYVASKDENISVVASTTASSAMSPEEKSTSLVNLNT
FT                   ATEADLQTISGIGAKRAADIIAYREANGGFKSVNDLNNVSGIGDKTMESIRPYVTVE"
FT   sig_peptide     635953..636072
FT                   /gene="comEA"
FT                   /locus_tag="SSU0610"
FT                   /note="Signal peptide predicted for SSU0610 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.926) with cleavage site
FT                   probability 0.880 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    635998..636066
FT                   /gene="comEA"
FT                   /locus_tag="SSU0610"
FT                   /note="1 probable transmembrane helix predicted for SSU0610
FT                   by TMHMM2.0 at aa 16-38"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    636421..636510
FT                   /gene="comEA"
FT                   /locus_tag="SSU0610"
FT                   /note="HMMPfam hit to PF00633, Helix-hairpin-helix motif,
FT                   score 5.7e-07"
FT                   /inference="protein motif:HMMPfam:PF00633"
FT   CDS_pept        636599..638836
FT                   /transl_table=11
FT                   /gene="comEC"
FT                   /locus_tag="SSU0611"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45351"
FT                   /protein_id="CAR45351.1"
FT                   /translation="MSRLSKLPCQPVHLAVLAVAAYFAVHSFSLLTMCLLSLVLAVFGV
FT                   RQGKTVFLKTLPLLTLCGLFFGCQKVQWERAAQSAPEQVTTVQVIPDTIDINGDSLSFR
FT                   GRADGQNYQVFYKLTSQEEQTYFQNLADLVQLEVEAEVSLPAGQRNFKGFDYQAYLKTQ
FT                   GIYRTVKLTAIKKIVPVQSWNVFDWLSTWRRQALVYVKTNFPAPMSHYMTGLLFGELDS
FT                   DFDQMSDLYSSLGIIHLFALSGMQVGFFIDKFRWILLRLGLTKETVDKLQIPFSLVYAG
FT                   LTGFSVSVVRSLVQKILGNLGLRKLDNFAVTVFICLLILPRFLLTAGGVLTFTYAFLLT
FT                   VFDFEDLGQVKKAAVESLSISLGILPVLMTYFYAFQPLSILLTFVFSFVFDVLLLPGLS
FT                   VIFLLSPVVKMTWVNGFFVFMEKIIVWVADLGLRPWILGKPSELVLLLLLVSLFLLYDF
FT                   HRRKKWLLGLSLVLALLFFITKHPLENEVTVLDIGQGDSIFLRDMRGRTVLIDVGGRVD
FT                   FAAKEAWQERSRQANAERTLIPYLHSRGVDRIDSLVLTHTDTDHVGDVLEVAKQVQIGR
FT                   IVVSPGSLTVPDFVATLKKINVPVHVVKVGDRLPIFDSYLEVLYPDGTGDGGNNDSIVL
FT                   YGRLLETNFLFTGDLEQGELDLIETYPNLPVDVLKAGHHGSKGSSYPEFLDHIGAKIAL
FT                   VSAGENNRYKHPHQETLERFDSRNIQVYRTDQQGAIRFRGWKEWKIETVRR"
FT   misc_feature    join(636665..636733,637286..637351,637409..637468,
FT                   637529..637597,637655..637723,637742..637810,
FT                   637901..637969,637988..638047)
FT                   /gene="comEC"
FT                   /locus_tag="SSU0611"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSU0611 by TMHMM2.0 at aa 23-45, 230-251, 271-290, 311-333,
FT                   353-375, 382-404, 435-457 and 464-483"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    637241..637981
FT                   /gene="comEC"
FT                   /locus_tag="SSU0611"
FT                   /note="HMMPfam hit to PF03772, ComEC/Rec2-related protein,
FT                   score 4.6e-43"
FT                   /inference="protein motif:HMMPfam:PF03772"
FT   misc_feature    638078..638695
FT                   /gene="comEC"
FT                   /locus_tag="SSU0611"
FT                   /note="HMMPfam hit to PF00753, Beta-lactamase-like, score
FT                   1.1e-10"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS_pept        638853..638981
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0612"
FT                   /product="putative transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to an internal region
FT                   of Streptococcus criceti putative transposase
FT                   UniProt:Q93RH3 (EMBL:AB042239) (287 aa) fasta scores:
FT                   E()=1.4e-08, 66.667% id in 42 aa"
FT   CDS_pept        639161..639817
FT                   /transl_table=11
FT                   /locus_tag="SSU0613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45355"
FT                   /protein_id="CAR45355.1"
FT                   /translation="MSVKDFMTRKVVYISPDTTVAHAADIMREQDLHRLPVIENDKLVG
FT                   LVTEGTIAEASPSKATSLSIYEMNYLLNKTKVKDVMIKNVITVSGYASLEDAAYLMYKN
FT                   KVGILPVVDNGQLYGVITDRDIFAAFLHVSGYGEEGVRARFLVENKAGELEKIIRLVAD
FT                   KDYNIVSTVQLATKSGKVVIEVQIDGKVDVEEVRTLFEGAGIQVDSLVPTVAKNI"
FT   misc_feature    639173..639553
FT                   /locus_tag="SSU0613"
FT                   /note="HMMPfam hit to PF00571, Cystathionine beta-synthase,
FT                   core, score 2.1e-40"
FT                   /inference="protein motif:HMMPfam:PF00571"
FT   misc_feature    639581..639763
FT                   /locus_tag="SSU0613"
FT                   /note="HMMPfam hit to PF01842, Amino acid-binding ACT,
FT                   score 0.0071"
FT                   /inference="protein motif:HMMPfam:PF01842"
FT   CDS_pept        639911..640738
FT                   /transl_table=11
FT                   /locus_tag="SSU0614"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45357"
FT                   /protein_id="CAR45357.1"
FT                   /translation="MGHKYKKYKKYGKNNSGLVALLVLLAIGFVMSFWYILLPTGLLIG
FT                   YFYKREAIQRFLNRDSIKRLQVLALSIRSGYEKHQELLVEKGEDKVVLQLRNRLLGQLF
FT                   ELDQLYQKFGKYLNGYESKEVVDTLQLKYHLKLPEAKTEKNTDTQVSTGGNAVMDEQGM
FT                   IADLAPEILETYCNIQRDNLVILEKLEKATDKREELTAIHEANMNRFNDILQGYLKIKK
FT                   SPKDYFNAEERLVQAKSAMEMFDKDLDDTIKQFNEADMKDFEVSLRMMKREEE"
FT   sig_peptide     639911..640015
FT                   /locus_tag="SSU0614"
FT                   /note="Signal peptide predicted for SSU0614 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.969) with cleavage site
FT                   probability 0.319 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    639956..640024
FT                   /locus_tag="SSU0614"
FT                   /note="1 probable transmembrane helix predicted for SSU0614
FT                   by TMHMM2.0 at aa 16-38"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        640744..642015
FT                   /transl_table=11
FT                   /locus_tag="SSU0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45358"
FT                   /protein_id="CAR45358.1"
FT                   /translation="MSGFNFDIDQIANNSLSTKDKTTELIQATPTGDNSKVSFLAQLTP
FT                   EQQTGIRAKAPQLVDNFLANQNVLLDFGKEAVEEVNATVNHILSEQKKIEIPQVDELLA
FT                   NTNRELNGFVAKYKDISTTAELEKKPGFFQHLFKQTKNDLQEFYFDSQTIEKKMDSMAA
FT                   SVVKQEEVLARNIVSAELLIENNTKSIENLVGVIAFIEATGQEAAQRAKAEQERLAGLQ
FT                   PTTVDYQVASEKLARVTEVANILEQQHSEYMSRLYVAWTTTPQMRNLVKVSSDMKQRLG
FT                   MLRRNTIPTMKLSIAQLGILQQSIKSSQTADAIVNANNAALQMLADTSKEAIPMMERTA
FT                   QNPTLSVASVTKLAESLVAQNNGIIAAIDEGRQKRRELEAAIVRSAETINDSVKLRDQK
FT                   IIAALLEQGKEAQSEAEQPLETNQ"
FT   misc_feature    641761..641787
FT                   /note="PS00221 MIP family signature."
FT                   /inference="protein motif:Prosite:PS00221"
FT   CDS_pept        complement(642052..642918)
FT                   /transl_table=11
FT                   /locus_tag="SSU0616"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45360"
FT                   /protein_id="CAR45360.1"
FT                   /translation="MVRLKNILLILLGAGLFAFGLNYLIMPNRLFEGGATGLTLIIYYL
FT                   FHIQPWIMNIVINIPLFILGWKILGKKTLYLSILGTFSVTFWLAIFEKIHFSINLQQDL
FT                   ILVSILGGILMGLGLGTIFRAGGTTGGSDIIARIGHKFLPYSIGQIILAVDILILTLIV
FT                   IVFKDLRTVLYTLMMVAIASKVIDFVTEGGYGSKGVMIVSQKSDQLAQAIDCEIERGVT
FT                   FIKAQGFYSKADVNMIYSVIYKSQLQEMKELIHRIDPHAFITITDAHEVLGEGFTLDRD
FT                   KKPIERH"
FT   misc_feature    complement(642361..642609)
FT                   /locus_tag="SSU0616"
FT                   /note="HMMPfam hit to PF02588, Protein of unknown function
FT                   DUF161, score 4.3e-22"
FT                   /inference="protein motif:HMMPfam:PF02588"
FT   misc_feature    complement(join(642421..642489,642550..642609,
FT                   642646..642699,642733..642801,642844..642900))
FT                   /locus_tag="SSU0616"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0616 by TMHMM2.0 at aa 7-25, 40-62, 74-91, 104-123 and
FT                   144-166"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(642655..642903)
FT                   /locus_tag="SSU0616"
FT                   /note="HMMPfam hit to PF02588, Protein of unknown function
FT                   DUF161, score 1.3e-23"
FT                   /inference="protein motif:HMMPfam:PF02588"
FT   sig_peptide     complement(642823..642918)
FT                   /locus_tag="SSU0616"
FT                   /note="Signal peptide predicted for SSU0616 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.966) with cleavage site
FT                   probability 0.703 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        643093..643731
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="SSU0617"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45362"
FT                   /protein_id="CAR45362.1"
FT                   /translation="MRNGFFITFEGPDGAGKTTVLQQLLPALQELGPEVVTTREPGGVA
FT                   IAEEIRNIILNPANTAMDDKTELLLFIAARRQHLKEKILPPLAQGKLLLIDRFIDSSIA
FT                   YQGFGRGLDIGDIHWLNQFATDGLKPDLTLYFDIDTEEGLARIARNADRDVDRLDMEKA
FT                   DMHRRVRQGYLSILEQEPERFVKIDASQPLEAVVANALAVIKKRFAERT"
FT   misc_feature    643117..643692
FT                   /gene="tmk"
FT                   /locus_tag="SSU0617"
FT                   /note="HMMPfam hit to PF02223, Thymidylate kinase, score
FT                   3.6e-64"
FT                   /inference="protein motif:HMMPfam:PF02223"
FT   misc_feature    643123..643146
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    643372..643410
FT                   /note="PS01331 Thymidylate kinase signature."
FT                   /inference="protein motif:Prosite:PS01331"
FT   CDS_pept        643728..644612
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="SSU0618"
FT                   /product="putative DNA polymerase III, delta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45365"
FT                   /protein_id="CAR45365.1"
FT                   /translation="MKIEELRNLQPYVFQRFVTILEQRRLAHAYLFSGDFASFDIAIFL
FT                   SQSLFCQEKEGILPCQKCRSCRLIEANEFSDLTVIAPQGNVIKTDTIRELVKNFSQSGF
FT                   ESNKQVFIIRDAEKMHANAANSLLKVIEEPQSAIHIFLLTNQEEAVLPTIKSRTQIIGF
FT                   PKNIPAMERMLEEEGLLKTQANLLAQLVSSQEEAKKLAENKNFLDLMGQAKKFTDLLLV
FT                   EPTRAYLQVGILVSLAVEKAEQGRLFDLLSLILSEKMMESANVREKMDAVLKAKKMWQA
FT                   NVSLQNSLEYITL"
FT   CDS_pept        644632..644949
FT                   /transl_table=11
FT                   /locus_tag="SSU0619"
FT                   /product="initiation-control protein YabA"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45366"
FT                   /protein_id="CAR45366.1"
FT                   /translation="MDKKEIFDALDDFSQNLLTTLAEVDAIKKHLQGVIDENTTLRLEN
FT                   SKLRERLEKEDKTGHKSSNFGKENLENIYEDGFHICTFSYGQRRDNDEPCMFCVELLNR
FT                   D"
FT   misc_feature    644632..644943
FT                   /locus_tag="SSU0619"
FT                   /note="HMMPfam hit to PF06156, Protein of unknown function
FT                   DUF972, score 1.9e-53"
FT                   /inference="protein motif:HMMPfam:PF06156"
FT   CDS_pept        644951..645814
FT                   /transl_table=11
FT                   /locus_tag="SSU0620"
FT                   /product="tetrapyrrole (corrin/porphyrin) methylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45367"
FT                   /protein_id="CAR45367.1"
FT                   /translation="MKVQKSFKGQTSFGTLYLVPTPIGNLQDMTFRAVQILKEVDIIAA
FT                   EDTRNTGLLLKHFEVETKQISFHEHNAHEKIPVLIDWLKSGQSIAQVSDAGLPSISDPG
FT                   HDLVGAAIAEDIPVVALPGASAGITALIASGLAPQPHIFYGFLPRKSGQQKEFFQEKKT
FT                   YPETQIFYESPYRVADTLENMLTVYGDRQVTVVRELTKLYEEYQRGSISELLEYLEENP
FT                   LKGECLIIVEGAGEEVYPSADEVDLKAEVEREIASGIKPNQAIKEVAKRYQLKKQEVYD
FT                   IYHGLG"
FT   misc_feature    644993..645595
FT                   /locus_tag="SSU0620"
FT                   /note="HMMPfam hit to PF00590, Tetrapyrrole methylase,
FT                   score 5.6e-43"
FT                   /inference="protein motif:HMMPfam:PF00590"
FT   misc_feature    645227..645262
FT                   /note="PS01296 Uncharacterized protein family UPF0011
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01296"
FT   CDS_pept        646284..647375
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="SSU0621"
FT                   /product="putative phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45369"
FT                   /protein_id="CAR45369.1"
FT                   /translation="MTIYNFSAGPAVLPKPVLERAQAEFLDYNGSGMSVLEMSHRSKDF
FT                   DDIIKGAEATLRELMAIPDNYKVIFLQGGASLEFTMIPLNFAQGKKAYYLVGGSWGKKA
FT                   YTEAVKLSKTIAFEPILLGSTEDITYAELPTFDKNDIDPTAAYVHLTTNNTIEGTAVYD
FT                   IPDTNGVPVIADMSSNILAARYNVEDFAMIYAGAQKNIGPAGVTVVIVREDFLNDQPML
FT                   SSMLDYRIQAENDSLYNTPPAYSIYISKLVFEWVKEIGGVDEMEKINREKSGLLYDYID
FT                   QSNFYTNPVRKKEERSVANIPFVSPSEELDAKFVKEATAAGFKNIKGHRSVGGMRASLY
FT                   NAFPRQGVVELIEFMKKFAVENA"
FT   misc_feature    646290..647336
FT                   /gene="serC"
FT                   /locus_tag="SSU0621"
FT                   /note="HMMPfam hit to PF00266, Aminotransferase, class V,
FT                   score 2.1e-21"
FT                   /inference="protein motif:HMMPfam:PF00266"
FT   CDS_pept        647375..647932
FT                   /transl_table=11
FT                   /locus_tag="SSU0622"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45371"
FT                   /protein_id="CAR45371.1"
FT                   /translation="MEIRLAHPNEMEAIVNILEDARAFLATSGINQWQGEYPNKENIFD
FT                   DILSGRGYVGLVDGKVAAYAAVHRGQEAEYEAIYEGKWQHNHPVYTTFHRIAAADEFRG
FT                   QGIIQTFLQGLIEGQKGPDFRCDTHEQNKTIQHILKKLGYVYCGKVPIDGERLAYQKIK
FT                   QKSERSLYQEISEDDRWLLGNN"
FT   misc_feature    647531..647809
FT                   /locus_tag="SSU0622"
FT                   /note="HMMPfam hit to PF00583, GCN5-related
FT                   N-acetyltransferase, score 0.0016"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        647986..649167
FT                   /transl_table=11
FT                   /locus_tag="SSU0623"
FT                   /product="putative D-isomer specific 2-hydroxyacid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45373"
FT                   /protein_id="CAR45373.1"
FT                   /translation="MVFSVRTFNNINQIGLKELGNKFQIDGDHAANPDAFIIRSENLHG
FT                   FDFPENLKAIARAGAGTNNIPIEEATEKGIVVFNTPGANANAVKEAVIASILLSARDYI
FT                   GATAWANTLSGDDVPKQVEAGKKQFAGTEISGKTLGVIGLGAIGARIANDARRLGMNVL
FT                   GYDPYVSVETAWTISSHVKRVDDLKEIFTNADYITVHVPLTDKTRGLFNADSFCQMRKG
FT                   TTLINFARGELVNNADLFEAIEAGVIKNYITDFGTEEVLNKDNIIVFPHVGGSTEEAEL
FT                   NCAIAAGQTIRRFMETGEIINSVNFPNVKQFLDAPYRITLINKNIPNMVATITTAVSEL
FT                   GINIDNIINKSKGDYAYTLLDLDEADKVKIEQLVAKFEATDAIVKVRVIQNKN"
FT   misc_feature    648136..648900
FT                   /locus_tag="SSU0623"
FT                   /note="HMMPfam hit to PF00389, D-isomer specific
FT                   2-hydroxyacid dehydrogenase, catalytic region, score 9e-18"
FT                   /inference="protein motif:HMMPfam:PF00389"
FT   misc_feature    648262..648804
FT                   /locus_tag="SSU0623"
FT                   /note="HMMPfam hit to PF02826, D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding, score 4.6e-49"
FT                   /inference="protein motif:HMMPfam:PF02826"
FT   misc_feature    648376..648399
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    648400..648483
FT                   /note="PS00065 D-isomer specific 2-hydroxyacid
FT                   dehydrogenases NAD-binding signature."
FT                   /inference="protein motif:Prosite:PS00065"
FT   CDS_pept        649170..649676
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="SSU0624"
FT                   /product="putative methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45375"
FT                   /protein_id="CAR45375.1"
FT                   /translation="MLYKQVYHSPLGPMSLIASDKGLRGAWFEGQKYFERGLNEKAILA
FT                   SHPILDQTARLLDQYFSGDQVDFSNLPLEAVGTNFQEHVWQLLKIIPMGQTTTYGQLAQ
FT                   QLGLRSGQAVGGAVGRNPYSIIVPCHRVLNQKGQLTGYAGGLDKKIWLLRHENPEFEVK
FT                   DDFIL"
FT   misc_feature    649398..649652
FT                   /gene="ogt"
FT                   /locus_tag="SSU0624"
FT                   /note="HMMPfam hit to PF01035,
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase, DNA
FT                   binding, score 6.6e-35"
FT                   /inference="protein motif:HMMPfam:PF01035"
FT   misc_feature    649548..649568
FT                   /note="PS00374 Methylated-DNA--protein-cysteine
FT                   methyltransferase active site."
FT                   /inference="protein motif:Prosite:PS00374"
FT   CDS_pept        649660..650013
FT                   /transl_table=11
FT                   /locus_tag="SSU0625"
FT                   /product="ArsC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45376"
FT                   /protein_id="CAR45376.1"
FT                   /translation="MILFYEYPKCSTCRAAKAELKSLGLEFEAIDIKSTPPSAEELKAW
FT                   MEATGLELKKYFNTSGNSYRELGLKDKFDSLSLEQALNLLANDGMLIKRPLLIQDGKIL
FT                   QIGYRTKYENLGL"
FT   misc_feature    649672..650007
FT                   /locus_tag="SSU0625"
FT                   /note="HMMPfam hit to PF03960, Arsenate reductase and
FT                   related, score 3.8e-31"
FT                   /inference="protein motif:HMMPfam:PF03960"
FT   CDS_pept        complement(650030..650929)
FT                   /transl_table=11
FT                   /locus_tag="SSU0626"
FT                   /product="cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45377"
FT                   /protein_id="CAR45377.1"
FT                   /translation="MDHKIIERKSLTVSSVVNGLSGLAGIAVYIMTDLNALLLDGVFSL
FT                   IAFISSLVAVYISKNSHRKTETFPQGLYFLEPLYAIMKSLATLLLLVFAVLETSATAFA
FT                   YFVHGIGHQMTTGPVLPYTITMFFVCMGLYLYNRHMSAKVNHLSTIILAEAKGNLVDGL
FT                   ISGAIGIAILLLYLVPINSWFGFLHYTGDFFLTLALAIISFKEPWNLLVASFKELANGT
FT                   IHFPEIHDSIYQLLEPYLKEDSNDVEIHIFKQGMKIRVKINLHNVHHEIIQKLLEDKPQ
FT                   MLYLLKKHHEYISIEYAL"
FT   misc_feature    complement(650063..650899)
FT                   /locus_tag="SSU0626"
FT                   /note="HMMPfam hit to PF01545, Cation efflux protein, score
FT                   1.3e-05"
FT                   /inference="protein motif:HMMPfam:PF01545"
FT   misc_feature    complement(join(650285..650353,650390..650458,
FT                   650519..650587,650600..650668,650756..650824,
FT                   650834..650893))
FT                   /locus_tag="SSU0626"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSU0626 by TMHMM2.0 at aa 13-32, 36-58, 88-110, 115-137,
FT                   158-180 and 193-215"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(651116..651943)
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="SSU0627"
FT                   /product="exodeoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45379"
FT                   /protein_id="CAR45379.1"
FT                   /translation="MKLISWNIDSLNAALTAESPRALLSRAVIDTLVTEDADIIAIQET
FT                   KLSDKGPTKKHLEILESYFPGYANTWRSSVEPARKGYAGTLFLYKNHLTPTITFPEIGA
FT                   PTTMDSEGRIITLEFDDFYVTQVYTPNAGDGLKRLADRQIWDVQYADYLAKLDSHKPVL
FT                   ATGDYNVAHKEIDLANPASNRQSPGFTDEERQGFTNLLAKGFTDTFRHLHGDVLNAYTW
FT                   WAQRSRTSKINNTGWRIDYWLVSDRIADKVSKSDMIDSGARQDHTPIVMEISF"
FT   misc_feature    complement(651125..651943)
FT                   /gene="exoA"
FT                   /locus_tag="SSU0627"
FT                   /note="HMMPfam hit to PF03372,
FT                   Endonuclease/exonuclease/phosphatase, score 3.6e-45"
FT                   /inference="protein motif:HMMPfam:PF03372"
FT   misc_feature    complement(651209..651244)
FT                   /note="PS00728 AP endonucleases family 1 signature 3."
FT                   /inference="protein motif:Prosite:PS00728"
FT   misc_feature    complement(651275..651325)
FT                   /note="PS00727 AP endonucleases family 1 signature 2."
FT                   /inference="protein motif:Prosite:PS00727"
FT   misc_feature    complement(651806..651835)
FT                   /note="PS00726 AP endonucleases family 1 signature 1."
FT                   /inference="protein motif:Prosite:PS00726"
FT   CDS_pept        652099..653760
FT                   /transl_table=11
FT                   /locus_tag="SSU0628"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45381"
FT                   /protein_id="CAR45381.1"
FT                   /translation="MKRKLFVFAWLALVLEMLIYYWYQLPALNILSVDFWIFFLQSVGL
FT                   VWLILSTFSSKGAFQKVTKISGRQRQVDTYQIKTSQLPAYLKWLGRIWVLVVLGLLGLG
FT                   LINSRVFRAKDYAAVISVKDADFKADFPETDISKLALLDRASAEKIGDTYLGTIDKVSQ
FT                   FGISDDYRQITIGQQPFRVSPLEYKNFWKWLSNHQDGIGYYVKVNQTTGKAELAKLSKA
FT                   MHYSDSEFLLNDTLRHLRLQYPTTIFGKPSFEVDDQGNPYYIATIYEPKFGLSSNDPIG
FT                   AIVLDAVTGESKKYGLEDIPEWVDRVYSANNVISRVDDHYTYQNGFWNTIFSQTGVKNT
FT                   TDSYNYISIGSDIYLYTGITSATADSSNLGFILVNMRTREITNYKLASATETAAQKSAE
FT                   GEVQEKGYKATNPSLVKLADTAYYLVSLKDDAGLVKSYALVDAEDYQQVTVNNDIALLI
FT                   SQVTGTDASSLSGLTVTENGEVGEQTEVISGKVEALASQIIGGATIYYIESEGKIYKVK
FT                   ATEDSTDRLPFIKVGDHFSGQLDKKNYLKNFKVNPE"
FT   misc_feature    join(652111..652179,652207..652275,652348..652416)
FT                   /locus_tag="SSU0628"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSU0628 by TMHMM2.0 at aa 5-27, 37-59 and 84-106"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        653920..655308
FT                   /transl_table=11
FT                   /locus_tag="SSU0629"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45382"
FT                   /protein_id="CAR45382.1"
FT                   /translation="MSLFRKKQAVGRHSQMRRHLGLVDLIFLGIGSMVGTGIFTVTGLA
FT                   AAQYAGPALIISIVIAAISVGLTALFYAEFASRIPTNGGAYGYLYSVFGEFPAWIAGWL
FT                   TIMEFLTAVSSVASGWGAYLKGLLANFGIAMPTALNGTFNPAAGTYVDLLPVLVLIFVV
FT                   GVVLLNSKAALRFNSALVVLKFSALALFILVGLFFIKPENWSNFSPFGFGAIYGGQAGI
FT                   MAGASLMFFAFLGFESISLAIDEVKKPEKNVPKGIVLSLSIVTILYIVVTLVLTGMVHY
FT                   TKLNVADAVAFALREVGLDWAASYISIVAILTLITVCISMTYALSRMVYSISRDGLLPK
FT                   SLSRLTQTSKVPKNATILVGIFAAICAGIFPLASIASFLNICTLAYLIMLALGIIRLRQ
FT                   VEGLPKDGQFKTPLVPLLPILSIIICLSFMFQYSLDTWLAFGVSLVIGILIYFCYGYRH
FT                   SEAK"
FT   sig_peptide     653920..654054
FT                   /locus_tag="SSU0629"
FT                   /note="Signal peptide predicted for SSU0629 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.234 between residues 45 and 46"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(653980..654048,654076..654144,654181..654249,
FT                   654355..654423,654457..654516,654559..654627,
FT                   654688..654756,654826..654894,654988..655056,
FT                   655066..655119,655156..655215,655228..655287)
FT                   /locus_tag="SSU0629"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SSU0629 by TMHMM2.0 at aa 21-43, 53-75, 88-110, 146-168,
FT                   180-199, 214-236, 257-279, 303-325, 357-379, 383-400,
FT                   413-432 and 437-456"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    653989..655203
FT                   /locus_tag="SSU0629"
FT                   /note="HMMPfam hit to PF00324, Amino acid
FT                   permease-associated region, score 9.8e-24"
FT                   /inference="protein motif:HMMPfam:PF00324"
FT   CDS_pept        join(655433..656092,656096..656260)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0630"
FT                   /product="putative membrane protein (pseudogene)"
FT                   /note="CDS contains a nonsense mutation (amber) after codon
FT                   230. Similar to Streptococcus pyogenes (serotype M3)
FT                   hypothetical protein sps0152. UniProt:Q879N6
FT                   (EMBL:BA000034) (302 aa) fasta scores: E()=8.7e-13, 28.622%
FT                   id in 283 aa, and to Streptococcus pyogenes (serotype M3)
FT                   hypothetical protein spym3_0148. UniProt:Q8K8R2
FT                   (EMBL:AE014139) (287 aa) fasta scores: E()=8.4e-13, 29.032%
FT                   id in 279 aa"
FT   misc_feature    655433..656065
FT                   /locus_tag="SSU0630"
FT                   /note="HMMPfam hit to PF06161, Protein of unknown function
FT                   DUF975, score 7e-06"
FT                   /inference="protein motif:HMMPfam:PF06161"
FT   misc_feature    join(655487..655555,655652..655720,655826..655894,
FT                   655952..656020)
FT                   /locus_tag="SSU0630"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSU0630 by TMHMM2.0 at aa 29-51, 84-106, 142-164 and
FT                   184-206"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    656105..656263
FT                   /locus_tag="SSU0631"
FT                   /note="HMMPfam hit to PF06161, Protein of unknown function
FT                   DUF975, score 1.1e-15"
FT                   /inference="protein motif:HMMPfam:PF06161"
FT   misc_feature    656147..656215
FT                   /locus_tag="SSU0631"
FT                   /note="1 probable transmembrane helix predicted for SSU0631
FT                   by TMHMM2.0 at aa 15-37"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    656507..657325
FT                   /locus_tag="SSU0632"
FT                   /note="HMMPfam hit to PF06161, Protein of unknown function
FT                   DUF975, score 2.4e-10"
FT                   /inference="protein motif:HMMPfam:PF06161"
FT   CDS_pept        656510..657343
FT                   /transl_table=11
FT                   /locus_tag="SSU0632"
FT                   /product="putative membrane protein"
FT                   /note="Possible alternative translational start sites after
FT                   codons 9 and 10"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45385"
FT                   /protein_id="CAR45385.1"
FT                   /translation="MTSDIVSRAMMTRERTRGTTLLFFPSILLSIVYAIPATIFRLLTF
FT                   LELRQNSAFVEGRLVSSIRLTYLGELGFALLLQLFIGLSCFHLLELLRGDRQEFSLKDS
FT                   FSFLKTEWKKPICTTFLYYYLLLFIAGLPANLGATLFIKGFTMSSLMVLSPGAMAELAV
FT                   HQPSQLMKIGAPIFLLGMIIYLFVYYTYSQVVFVLYDHLDNASYTGPLAVFRESRFLMK
FT                   GNYWQRIWLDLSFLGWFIGELLTLHLLSFFVTPYYHLSRTIFYEKLKKQRLSAVE"
FT   sig_peptide     656510..656611
FT                   /locus_tag="SSU0632"
FT                   /note="Signal peptide predicted for SSU0632 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.963) with cleavage site
FT                   probability 0.953 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(656561..656629,656708..656776,656867..656935,
FT                   657035..657103,657212..657280)
FT                   /locus_tag="SSU0632"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSU0632 by TMHMM2.0 at aa 20-42, 69-91, 122-144, 178-200
FT                   and 237-259"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(657361..658236)
FT                   /transl_table=11
FT                   /locus_tag="SSU0633"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45387"
FT                   /protein_id="CAR45387.1"
FT                   /translation="MKTEFINEKAQSAFNLNIVTSPIVAIILLLVGDSLGAVIFTPISF
FT                   LLPFSETLSVSFELFAFAFISLMVILWARYIEKSPWVGLGFTKKGAGKDFLLGWGIGAA
FT                   MLTTCTLIMWGLGAIEFTSIQFSTKLVGEFIILILAWSIQGTTEEILTRGWMFSSLSAR
FT                   HNIPIGIIVSSLFFTFLHLGNNAISLIPILDLTLFAVLACLIMLKTGNIWVIGGLHAAW
FT                   NCFQGNVFAFSVSGTDAGQAFIQIGITGPEWLSGGKFGVEGSVISLLVQGIMICWLVYD
FT                   LYFKPKTSSL"
FT   misc_feature    complement(join(657397..657462,657490..657558,
FT                   657577..657645,657688..657747,657808..657876,
FT                   657886..657954,658012..658080,658108..658176))
FT                   /locus_tag="SSU0633"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSU0633 by TMHMM2.0 at aa 21-43, 53-75, 95-117, 121-143,
FT                   164-183, 198-220, 227-249 and 259-280"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(657547..657834)
FT                   /locus_tag="SSU0633"
FT                   /note="HMMPfam hit to PF02517, Abortive infection protein,
FT                   score 1.2e-07"
FT                   /inference="protein motif:HMMPfam:PF02517"
FT   CDS_pept        658359..658970
FT                   /transl_table=11
FT                   /locus_tag="SSU0634"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45388"
FT                   /protein_id="CAR45388.1"
FT                   /translation="MELSQWLKSFQLKDNRLVGPFFYGTPLALRFEIGPADEAEELSRA
FT                   IYLERAYARAVELFEQASSEYDYVLLSLLRQEDRDIDTYLWHFSSKFNFNKVPESELIE
FT                   VEDWTGDVLVFERYLFPVTDQDLNALLREIVKADHGGFNYLSSSVLFLSSQDNIIYHCY
FT                   DNRGVDIAVLADDKRLELFTDCHDLLLDYDMEEMERRVRG"
FT   CDS_pept        658987..659079
FT                   /transl_table=11
FT                   /locus_tag="SSU0635"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSU0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAR45391"
FT                   /protein_id="CAR45391.1"
FT                   /translation="MIYHLLDKSTSQVNTGSKKSTVKPVENMVE"
FT   CDS_pept        join(660235..660636,660635..661912)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSU0640"
FT                   /product="type III restriction-modification system,
FT                   modification enzyme (fragment)"
FT                   /note="Probable gene remnant. CDS lacks a translation start
FT                   codon. Similar to the C-terminal regions of Salmonella
FT                   typhimurium type III restriction-modification system enzyme
FT                   Mod UniProt:P40814 (EMBL:STRESM) (652 aa) fasta scores:
FT                   E()=1.4e-41, 41.648% id in 437 aa, and Bacteroides fragilis
FT                   (strain ATCC 25285/NCTC 9343) putative modification enzyme
FT                   of type III restriction-modification system UniProt:Q5LG95
FT                   (EMBL:CR626927) (635 aa) fasta scores: E()=3.4e-116,
FT                   54.880% id in 543 aa"
FT   misc_feature    660391..660636
FT                   /locus_tag="SSU0640"
FT                   /note="HMMPfam hit to PF