(data stored in ACNUC10043 zone)

EMBL: AM990994

ID   AM990994; SV 1; circular; genomic DNA; STD; PRO; 4381 BP.
XX
AC   AM990994;
XX
PR   Project:PRJEA29427;
XX
DT   07-JAN-2010 (Rel. 103, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Staphylococcus aureus subsp. aureus ST398 pS0385-2 plasmid, isolate SO385
XX
KW   .
XX
OS   Staphylococcus aureus subsp. aureus ST398
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae;
OC   Staphylococcus.
OG   Plasmid pS0385-2
XX
RN   [1]
RP   1-4381
RA   Schijffelen M.J.;
RT   ;
RL   Submitted (23-APR-2008) to the INSDC.
RL   Schijffelen M.J., Medical Microbiologie, UMC Utrecht, Heidelberglaan 100,
RL   Utrecht, 3584 CX, NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1186/1471-2164-11-376.
RX   PUBMED; 20546576.
RA   Schijffelen M.J., Boel C.H., van Strijp J.A., Fluit A.C.;
RT   "Whole genome analysis of a livestock-associated methicillin-resistant
RT   Staphylococcus aureus ST398 isolate from a case of human endocarditis";
RL   BMC Genomics 11(1):376-376(2010).
XX
DR   MD5; aa3d67f82f935b62438193e1d073f41e.
DR   BioSample; SAMEA2272644.
DR   EnsemblGenomes-Gn; EBG00001052933.
DR   EnsemblGenomes-Tr; EBT00001655876.
DR   EuropePMC; PMC2900268; 20546576.
DR   EuropePMC; PMC3406130; 22685157.
DR   EuropePMC; PMC4959200; 27129960.
DR   RFAM; RF00242; ctRNA_pT181.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4381
FT                   /organism="Staphylococcus aureus subsp. aureus ST398"
FT                   /plasmid="pS0385-2"
FT                   /strain="ST398"
FT                   /isolate="S0385"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:523796"
FT   CDS_pept        join(3626..4381,1..177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSAPIG020006"
FT                   /product="replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSAPIG020006"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51148"
FT                   /inference="protein motif:PFAM:PF02486"
FT                   /protein_id="CAQ51148.1"
FT                   /translation="MAKITKNEQENSVKNYTKKPAYSNSRLNRHIMYTPEPKLHFDAMT
FT                   IVGNLNKNNAHKLSEFMSIAPQIRLWDILQTKFKAKALQEKVYIEYDKVKADAWDRRNM
FT                   RVEFNPNKLTHEEMLWLKQNIIDYMEDDGFTRLDLAFDFEDDLSDYYAMTDKSVKKTIF
FT                   YGRNGKPETKYFGVRDSDRFIRIYNKKQERKDNADIEVMSEHLWRVEIELKRDMVDYWN
FT                   DCFNDLHILKPDWSSLEKVKDQAMIYMLIHEESTWGKLERRTKNKYREMLKSISEIDLT
FT                   DLMKLTLKENEKQLQKQIEFWQREFRFWE"
FT   CDS_pept        155..1033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSAPIG020002"
FT                   /product="aminoglycoside 6-adenylyltransferase (AAD(6))"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:PSAPIG020002"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51144"
FT                   /inference="protein motif:PFAM:PF04439"
FT                   /protein_id="CAQ51144.1"
FT                   /translation="MNLDFGSEKTMRTEKEILNLVSEFAYQRSNVKIIALEGSRTNENI
FT                   KKDKFQDYDFAFFVSDIEYFTHEESWLSLFGELLFIQKPEDMELFPPDLDYGYSYIMYF
FT                   KDGIKMDITLINLKDLNRYFSDSDGLVKILVDKDNLVTQEIVPDDSNYWLKKPTEREFY
FT                   DCCNEFWSVSTYVAKGVFRREILFALDHFNNILRPELLRMISWYIGFNRGFDFSLGKNY
FT                   KFINKYLTDKEFNMLLATFEMNGYRKTYQSFKLCCELFKYYSNKVSCLGNYNYPNYEKN
FT                   IENFIRNNYEN"
FT   CDS_pept        1683..2645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSAPIG020003"
FT                   /product="protein rlx"
FT                   /db_xref="EnsemblGenomes-Gn:PSAPIG020003"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51145"
FT                   /inference="protein motif:PFAM:PF03432"
FT                   /protein_id="CAQ51145.1"
FT                   /translation="MATTKLGNTKSASRAINYAEERAEEKSGLNCDVDYAKSYFKQTRA
FT                   LYGKENGVQAHTVIQSFKPGEVTAKECNEIGLELAKKIAPDYQVAVYTHTDKDHYHNHI
FT                   IINSVNLETGNKYQSNKEQRDFIKKANDQLCEERGLSVPEKSSEIRYTLAEQNMIDKDK
FT                   RSWKNDIRMAVEETKDNAVDFEEFNTLLKEKGVEITRVTKNNVTYRHIEEDKKVRGNKL
FT                   GDSYDKGVIENGFAIEKFRREREEEREYDEYADTFEVDWDAVAENSEDLRKRRIARTEE
FT                   TKQASNKIYIRDERTTGLERKGIAGNQVEFEKDDGGLSR"
FT   CDS_pept        2614..3069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSAPIG020004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSAPIG020004"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51146"
FT                   /inference="protein motif:PFAM:PF03904"
FT                   /protein_id="CAQ51146.1"
FT                   /translation="MKKTTEDFQGRGKKVHNDFVRLLQKNLNRVNAEDIEIEVRKDVYG
FT                   VREEIHSMLREVKQSHEHYQKRQKQLFTGIGAMLLVFMLFALIMTIGRDFMGFLHVDVL
FT                   QNAIASKIKASEGFISVLWYIAYGLPYILAIGLFIWLYEWIRARFHD"
FT   CDS_pept        3190..3381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSAPIG020005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSAPIG020005"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51147"
FT                   /inference="ab initio prediction:Glimmer3"
FT                   /protein_id="CAQ51147.1"
FT                   /translation="MGLLRVQRLNVNKAIGIKQQRGLKKMSKKKKINLAISIAQVVVQA
FT                   LILYNTYQQYKYSKKYSA"
XX
SQ   Sequence 4381 BP; 1685 A; 526 C; 860 G; 1310 T; 0 other;
     gaagaaagta catggggtaa attagaaaga cgtacaaaaa ataaatacag agaaatgtta        60
     aaaagtattt cagaaattga tttaacggac ttaatgaaat tgactttaaa agagaatgaa       120
     aaacaattgc aaaagcagat tgaattttgg cagcgtgaat ttagattttg ggagtgaaaa       180
     aacaatgagg actgaaaaag aaattttaaa tttagtttct gaatttgctt atcaacgaag       240
     caatgtaaaa attattgctc tcgagggttc aagaactaat gaaaatataa aaaaagataa       300
     gtttcaagat tatgattttg cttttttcgt atcagatatt gagtatttca cacatgaaga       360
     aagttggtta agtttatttg gagaattatt gtttatacag aaaccagaag atatggaatt       420
     attcccacct gatttagatt atggttacag ttatataatg tattttaaag atggcataaa       480
     aatggatatt acattaatta atttaaaaga tttaaatcgt tattttagtg attctgatgg       540
     tcttgtaaaa attttagttg ataaagataa tttagtaact caagaaattg ttccagatga       600
     ctcaaattat tggttaaaaa aaccaacaga acgagaattt tatgattgct gtaatgagtt       660
     ttggagtgtc tcaacgtatg tagcaaaggg tgtttttaga agagaaatat tatttgcttt       720
     agatcatttc aataatattt tacgtcctga attattaaga atgatttctt ggtatattgg       780
     ctttaatagg ggttttgatt ttagtttagg aaagaattat aagtttataa acaaatattt       840
     aactgataaa gaattcaata tgcttttagc tacttttgag atgaatggat atagaaagac       900
     ataccaatct tttaagcttt gttgtgaatt atttaaatat tattcaaata aagtaagttg       960
     tttaggaaat tataactatc caaattacga aaaaaatatt gagaatttta ttcgtaataa      1020
     ttatgagaat taattttatt agcaaccaca tttttggttg cttttgtttt gattttgaat      1080
     ttggttttga actatgagtg gctagcattt tgccactcat tttttgcgtt agcaaaaaca      1140
     taaagggtct gggattaatc ccagcaagcc ggtatattca gaacgaagtg gctagaatat      1200
     acgacgcttg ccaaaccact atattacttg agaaaatata gattatatta taagctatat      1260
     ttatgaaaag gaatattttt cgtcagaaag gtggtgggac ttgtgaacga acataaagat      1320
     aatttggcta gcgatttgtc tgttggggga aaccgtaaac ccaaccgcaa agagccaaaa      1380
     caaattagtt tcagagtgag tgaacaggaa tattcaaagt tgaaacagtc ggcagaaact      1440
     ttgaatatga cagtgcctaa tttcgttaag aaaaaggcac aaggcagtcg attagtgtcg      1500
     ccaaaattag acaaagaaac gcgacaatcg attgccaaag atttaagtca tttgggtagt      1560
     aatgtgaatc agattgctaa gtggtttaat caaaataaag ataaggctac acatttacca      1620
     gaagagaaat atcatgattt agaaaagcaa tttgatgatg tgaaaaagga gttgcataag      1680
     atatggcaac aactaaatta ggcaatacga agtcggcaag tcgtgccatt aattacgcag      1740
     aagaacgtgc agaagaaaaa agcggcttaa attgtgatgt tgattatgct aaatcatatt      1800
     ttaagcaaac tagggcgtta tatggcaaag agaatggtgt tcaagcacat acagtcattc      1860
     aatcttttaa gcctggcgaa gtaacagcta aagagtgtaa tgagataggt ttagaattag      1920
     ctaaaaaaat tgcaccagat tatcaagttg cagtttatac acatacagac aaagaccatt      1980
     atcacaatca cattattatt aattcagtaa atttagaaac aggcaacaag tatcagtcaa      2040
     acaaagaaca acgtgatttt ataaaaaagg cgaatgatca gttatgtgaa gaacgtggtt      2100
     tatctgtgcc agaaaagtca tcagaaatca gatatacgtt ggcagaacag aacatgatag      2160
     ataaagataa aaggtcatgg aaaaatgata taagaatggc agttgaagaa acaaaggata      2220
     acgcagtaga ctttgaagaa tttaatactt tgctaaaaga aaaaggtgtt gaaatcacga      2280
     gagtaacgaa aaacaacgta acgtatagac acattgaaga agataaaaaa gtacgtggga      2340
     ataagttggg cgattcttat gacaaaggag tgattgaaaa tggctttgca atcgagaaat      2400
     tcagacgaga acgagaagaa gaacgagaat acgatgaata tgcagacacg ttcgaagttg      2460
     actgggacgc agtcgcagaa aattcagaag accttagaaa acgaagaatt gcaagaactg      2520
     aagaaacaaa acaagctagt aataaaatat atatcagaga tgaaagaaca acaggacttg      2580
     agagaaaagg aattgcaggc aatcaagtcg agtttgaaaa agacgacgga ggactttcaa      2640
     ggtagaggta aaaaagtcca taatgatttt gttcgtttgt tacaaaagaa tttaaatcga      2700
     gtgaatgcag aagatattga gatagaggtt cgaaaagatg tttatggagt tcgagaagaa      2760
     attcattcga tgttgcgtga agttaaacaa tcacatgaac attatcaaaa aagacaaaag      2820
     caattattta ctggtattgg tgcaatgtta ttagtgttta tgctttttgc tttgattatg      2880
     acgattggca gagattttat gggcttttta catgtagatg tattacagaa tgccatagca      2940
     agcaaaataa aggcttctga gggctttatt tcagttttat ggtacattgc ttatggttta      3000
     ccttatatac tcgctatagg gctatttatt tggttgtatg agtggataag agcaagattc      3060
     catgattaaa caaagtatga tcaggctttt atgccgagaa aatttattta tattgagaag      3120
     tacccttaac taaacttgca gacgaatgtc ggcatagcgt gagctattag cccgaccatt      3180
     cgacaagttt tgggtttgtt aagggtacag aggctcaatg taaataaagc aattggaata      3240
     aagcaacaaa gggggttgaa gaaaatgagt aagaagaaaa agattaattt agcaatatca      3300
     attgctcaag tagtagtgca ggcgttaata ctttataaca cttatcagca atataaatat      3360
     tctaaaaaat attcagccta ataaaaaaga cttagtctga atagaccaag ccttttgtta      3420
     gtgttatatt aatacacaaa taaaataaaa aagaagtcgc tcacgccctg accaaagttt      3480
     gtgaatgcga cttatcctaa agaaaaaaca gttgatgttt ttgttcttaa tttgtatatc      3540
     tagatattaa acgattttag tttattcttc aagatatata ttcgggtgag cgacttctta      3600
     aattaaaata aggagtcgat tttttatggc aaaaataacg aaaaatgagc aagaaaattc      3660
     ggtgaaaaat tacacaaaaa aaccggcgta ctctaatagc cggttaaacc gacatattat      3720
     gtacaccccc gaaccaaaat tacactttga tgctatgaca attgttggga atcttaataa      3780
     gaacaatgct cacaaactgt ctgaatttat gagtattgcg ccacaaatta gactttggga      3840
     tatattacaa accaaattta aagctaaggc tctacaagaa aaagtttaca tcgaatatga      3900
     taaagtaaaa gcagatgcgt gggatagacg taatatgcgt gttgaattta atcctaataa      3960
     acttacgcat gaagaaatgc tttggttaaa acaaaacatc attgactaca tggaagatga      4020
     tggttttaca agattagatt tggcttttga ttttgaagac gatttgagcg attattatgc      4080
     gatgactgat aaatcagtta agaaaactat tttttatggt cgtaacggta aaccagaaac      4140
     aaaatatttt ggtgttcgtg acagtgatag atttattaga atttataata aaaaacaaga      4200
     acgtaaggat aatgcagaca ttgaagttat gtctgaacac ttatggcgtg tagaaattga      4260
     attaaaaaga gatatggttg attattggaa cgattgtttt aatgatttac atattttgaa      4320
     accagattgg tctagtttag aaaaagtaaa agaccaagca atgatttata tgctaattca      4380
     t                                                                      4381
//

If you have problems or comments...

PBIL Back to PBIL home page