(data stored in ACNUC10083 zone)

EMBL: AP003297

ID   AP003297; SV 3; linear; genomic DNA; STD; PLN; 137348 BP.
XX
AC   AP003297;
XX
DT   22-FEB-2001 (Rel. 66, Created)
DT   19-FEB-2008 (Rel. 94, Last updated, Version 16)
XX
DE   Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0698A10.
XX
KW   .
XX
OS   Oryza sativa Japonica Group (Japanese rice)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade;
OC   Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
XX
RN   [1]
RP   1-137348
RA   Sasaki T., Matsumoto T., Yamamoto K.;
RT   ;
RL   Submitted (19-FEB-2001) to the INSDC.
RL   Contact:Takuji Sasaki National Institute of Agrobiological Sciences, Rice
RL   Genome Research Program; Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan
RL   URL    :http://rgp.dna.affrc.go.jp/
XX
RN   [2]
RX   DOI; 10.1038/nature01184.
RX   PUBMED; 12447438.
RA   Sasaki T., Matsumoto T., Yamamoto K., Sakata K., Baba T., Katayose Y.,
RA   Wu J., Niimura Y., Cheng Z., Nagamura Y., Antonio B.A., Kanamori H.,
RA   Hosokawa S., Masukawa M., Arikawa K., Chiden Y., Hayashi M., Okamoto M.,
RA   Ando T., Aoki H., Arita K., Hamada M., Harada C., Hijishita S., Honda M.,
RA   Ichikawa Y., Idonuma A., Iijima M., Ikeda M., Ikeno M., Itoh S., Itoh T.,
RA   Itoh Y., Itoh Y., Iwabuchi A., Kamiya K., Karasawa W., Katagiri S.,
RA   Kikuta A., Kobayashi N., Kono I., Machita K., Maehara T., Mizuno H.,
RA   Mizubayashi T., Mukai Y., Nagasaki H., Nakashima M., Nakama Y.,
RA   Nakamichi Y., Nakamura M., Namiki N., Negishi M., Ohta I., Ono N., Saji S.,
RA   Sakai K., Shibata M., Shimokawa T., Shomura A., Song J., Takazaki Y.,
RA   Terasawa K., Tsuji K., Waki K., Yamagata H., Yamane H., Yoshiki S.,
RA   Yoshihara R., Yukawa K., Zhong H., Iwama H., Endo T., Ito H., Hahn J.H.,
RA   Kim H.I., Eun M.Y., Yano M., Jiang J., Gojobori T.;
RT   "The genome sequence and structure of rice chromosome 1";
RL   Nature 420(6913):312-316(2002).
XX
DR   MD5; 2fffa6c5a13d04db7983686ce1e90d49.
DR   ENA-CON; AP008207.
DR   ENA-CON; BA000010.
XX
CC   Genes were predicted from the integrated results of the following:
CC   GENSCAN (http://CCR-081.mit.edu/GENSCAN.html), FGENESH
CC   (http://www.softberry.com/), GeneMark.hmm
CC   (http://opal.biology.gatech.edu/GeneMark/), GlimmerM
CC   (http://www.tigr.org/tdb/glimmerm/glmr_form.html), RiceHMM
CC   (http://rgp.dna.affrc.go.jp/RiceHMM/), SplicePredictor
CC   (http://bioinformatics.iastate.edu/cgi-bin/sp.cgi), sim4
CC   (http://globin.cse.psu.edu/html/docs/sim4.html), gap2
CC   (http://www.tigr.org/software/glimmerm/), BLASTN and BLASTX. The
CC   genomic sequence was searched against NCBI NonRedundant Protein
CC   database, nr (ftp://ncbi.nlm.nih.gov/blast/db) and the cDNA
CC   sequence database at RGP or DDBJ. Protein homologies of the coding
CC   regions were searched against NCBI NonRedundant Protein database
CC   with BLASTP. ESTs represent the identified cDNA sequences using
CC   BLASTN with the corresponding DDBJ accession no. and RGP clone ID.
CC   Full-length cDNAs represent the identified cDNA sequences using
CC   BLASTN with the corresponding DDBJ accession no.
CC   A gene with identity or significant homology to a protein is
CC   classified based on the protein name to indicate the homology
CC   level such as same name, 'putative-' and '-like protein'.  A gene
CC   without significant homology to any protein but with full-length
CC   cDNA or EST homology (covering almost the entire length of partial
CC   sequence) is classified as an 'unknown' protein. A gene predicted
CC   by two or more gene prediction programs is classified as a
CC   'hypothetical' protein according to IRGSP standard. A gene
CC   predicted by a single gene prediction program is also classified
CC   as a probable 'hypothetical' protein and is included as a
CC   miscellaneous feature of the sequence.
CC   The orientation of the sequence is from SP6 to T7 of the PAC
CC   clone. This sequence of P0698A10 clone has an overlap with
CC   P0491F11 (DDBJ: AP004669) clone at 5' end and an overlap with
CC   P0471B04 (DDBJ: AP003261) clone at 3' end. Detailed information on
CC   overlap and assembly quality together with annotation of this
CC   entry is available at http://rgp.dna.affrc.go.jp/GenomeSeq.html
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..137348
FT                   /organism="Oryza sativa Japonica Group"
FT                   /chromosome="1"
FT                   /cultivar="Nipponbare"
FT                   /mol_type="genomic DNA"
FT                   /clone="P0698A10"
FT                   /db_xref="taxon:39947"
FT   misc_feature    complement(join(202..450,580..654))
FT                   /gene="P0698A10.1"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by GENSCAN"
FT                   /note="this category is not included in IRGSP standard"
FT   misc_feature    join(1608..1642,3224..3434)
FT                   /gene="P0698A10.2"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by FGENESH"
FT                   /note="this category is not included in IRGSP standard"
FT   misc_feature    join(5591..5603,5744..5886)
FT                   /gene="P0698A10.3"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by GENSCAN"
FT                   /note="this category is not included in IRGSP standard"
FT   mRNA            join(6457..6815,6898..7575)
FT                   /gene="P0698A10.4"
FT                   /note="supported by full-length cDNA(s): AK060684"
FT   CDS_pept        join(6553..6815,6898..7498)
FT                   /codon_start=1
FT                   /gene="P0698A10.4"
FT                   /product="putative myb2"
FT                   /note="contains EST(s):
FT                   AU082180(S0683),AU183276(E60862),AU082181(S0683)"
FT                   /note="contains full-length cDNA(s): AK060684"
FT                   /db_xref="GOA:Q8RUI9"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RUI9"
FT                   /protein_id="BAB92433.1"
FT                   /translation="MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAG
FT                   LLRCGKSCRLRWMNYLRPDLKRGNFTDDDDELIIKLHALLGNKWSLIAGQLPGRTDNEI
FT                   KNYWNTHIKRKLLSRGIDPQTHRPVSAGSSAAAASGLTTTASTAAFPSLAPAPPPQQHR
FT                   LHNPVHAAAPSNASFARSAASPPSEDGHSSSGGSSDAPRCPDLNLDLDLDLSMSLPSSP
FT                   PKTPAAASSTTASRHHHHQQQKTICLCYHLGVRNGDVCSCKAAAPSPAGPRAFRFLRPL
FT                   EEGQYI"
FT   CDS_pept        11914..12147
FT                   /codon_start=1
FT                   /gene="P0698A10.5"
FT                   /product="hypothetical protein"
FT                   /note="predicted by GlimmerM etc."
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8W3"
FT                   /protein_id="BAD82079.1"
FT                   /translation="MRPHAEAQSAAPCAAGRRGAVNPHTKHRSNQRAFSFGGDRICVLC
FT                   VGGKEQRGIDVVVAGWWGDDITDDRLAPARRT"
FT   mRNA            <11914..>12147
FT                   /gene="P0698A10.5"
FT                   /note="start and end point are not identified"
FT   misc_feature    join(13225..13280,13400..13433,13556..13642)
FT                   /gene="P0698A10.6"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by GeneMark.hmm"
FT                   /note="this category is not included in IRGSP standard"
FT   CDS_pept        complement(join(16704..16829,17007..17075))
FT                   /codon_start=1
FT                   /gene="P0698A10.7"
FT                   /product="hypothetical protein"
FT                   /note="predicted by RiceHMM etc."
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8W2"
FT                   /protein_id="BAD82080.1"
FT                   /translation="MQAEEDAPKPEEDAGREYACYLPGGVPKACRFQPSASREVTGSSK
FT                   FSRESMQHCTGPLLLRSLP"
FT   mRNA            complement(join(<16704..16829,17007..>17075))
FT                   /gene="P0698A10.7"
FT                   /note="start and end point are not identified"
FT   CDS_pept        join(17202..17328,18056..18165)
FT                   /codon_start=1
FT                   /gene="P0698A10.8"
FT                   /product="hypothetical protein"
FT                   /note="predicted by GENSCAN etc."
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8W1"
FT                   /protein_id="BAD82081.1"
FT                   /translation="MRRDTVVYGLFMPLEIWSELKVRGWATRRRRNSVIELSRGWRLAM
FT                   GIWGCAIVWEIVTRQANDDDVRREEDDDVGEER"
FT   mRNA            join(<17202..17328,18056..>18165)
FT                   /gene="P0698A10.8"
FT                   /note="start and end point are not identified"
FT   misc_feature    join(19424..19431,19465..19629,20505..20545,20966..21079,
FT                   21836..21852)
FT                   /gene="P0698A10.9"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by GENSCAN"
FT                   /note="this category is not included in IRGSP standard"
FT   mRNA            join(23068..24646,25086..25210,25302..25443,25546..26139)
FT                   /gene="P0698A10.10-1"
FT                   /note="supported by full-length cDNA(s): AK121856"
FT   mRNA            join(23120..24646,25086..25210,25302..25443,25546..26139)
FT                   /gene="P0698A10.10-1"
FT                   /note="supported by full-length cDNA(s): AK073077"
FT   mRNA            join(23165..24046,25423..25443,25546..26154)
FT                   /gene="P0698A10.10-2"
FT                   /note="supported by full-length cDNA(s): AK105447"
FT   CDS_pept        join(23333..24646,25086..25210,25302..25443,25546..25806)
FT                   /codon_start=1
FT                   /gene="P0698A10.10-1"
FT                   /product="cytosolic factor-like protein"
FT                   /note="contains EST(s): AU093915(E1276),AU162319(E60301)"
FT                   /note="contains full-length cDNA(s): AK121856,AK073077"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RYZ1"
FT                   /protein_id="BAB92436.1"
FT                   /translation="MAEEPQPEAAPAAVAATTEVAVAEKAPVEAEKEKKVEEETPAVEA
FT                   EAKEEKKDEAAAAAAAGGDEAGAIEGTGSFKEESNLVADLPDPEKKALDEFKQLIAAAL
FT                   AACEFNLPPPPPPPKAKVEAAVEETKAEETKAEEEPKAEEPAKEEEPKAEVAAAAAAPP
FT                   EAGTEEPKAEASSEEAKTEEPKAEAAADEPAKEESKAEAAPAEEAKPAEPEPEEKTVVV
FT                   TEEEAATKTVEAIEETVVPAAAAPAAAATEEAAAPEPEVQAAAAPEPVLIWGVPLVGDD
FT                   ERTDTVLLKFLRAREFKVKEAMAMLRSAVLWRKRFGIESLLDADLALPELDSVVFYRGA
FT                   DREGHPVCYNVYGEFQDKDLYEKAFGDEEKRERFLKWRIQLLERGILSQLDFSPSGICS
FT                   MVQVTDLKNSPPMLGKHRAVTRQAVALLQDNYPEFIAKKVFINVPWWYLAANKMMSPFL
FT                   TQRTKSKFIFASPAKSAETLFRYIAPEQVPVQFGGLFKEDDPEFTTSDAVTELTIKPSS
FT                   KETVEIPVTENSTIGWELRVLGWEVSYGAEFTPDAEGGYTVIVQKTRKVPANEEPIMKG
FT                   SFKVGEPGKIVLTINNPASKKKKLLYRSKVKSTSESV"
FT   CDS_pept        join(23333..24046,25423..25443,25546..25806)
FT                   /codon_start=1
FT                   /gene="P0698A10.10-2"
FT                   /product="cytosolic factor-like protein"
FT                   /note="contains EST(s): AU162319(E60301)"
FT                   /note="contains full-length cDNA(s): AK105447"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8X1"
FT                   /protein_id="BAD82082.1"
FT                   /translation="MAEEPQPEAAPAAVAATTEVAVAEKAPVEAEKEKKVEEETPAVEA
FT                   EAKEEKKDEAAAAAAAGGDEAGAIEGTGSFKEESNLVADLPDPEKKALDEFKQLIAAAL
FT                   AACEFNLPPPPPPPKAKVEAAVEETKAEETKAEEEPKAEEPAKEEEPKAEVAAAAAAPP
FT                   EAGTEEPKAEASSEEAKTEEPKAEAAADEPAKEESKAEAAPAEEAKPAEPEPEEKTVVV
FT                   TEEEAATKTVEAIEETVEIPVTENSTIGWELRVLGWEVSYGAEFTPDAEGGYTVIVQKT
FT                   RKVPANEEPIMKGSFKVGEPGKIVLTINNPASKKKKLLYRSKVKSTSESV"
FT   CDS_pept        join(27824..27925,28000..28080,28637..28857,28932..29064)
FT                   /codon_start=1
FT                   /gene="P0698A10.11"
FT                   /product="hypothetical protein"
FT                   /note="predicted by GeneMark.hmm etc."
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8W0"
FT                   /protein_id="BAD82083.1"
FT                   /translation="MSGSPPAAAAAAEIALASWANKLERDRVATRRWEGPAIAKPATIW
FT                   GPPIRRRSTATAVQTAFSYTTDAAAPLAGAGQSSQCLQDCGRESRAAYRQSKDSYSYSA
FT                   TLPARVRDPQRGRWPEQCNRGWDSSVTWRCRIRRVWFMLRAAAAAAASVLRQFNTMPDL
FT                   CNVQRAYEQIQCYVV"
FT   mRNA            join(<27824..27925,28000..28080,28637..28857,28932..>29064)
FT                   /gene="P0698A10.11"
FT                   /note="start and end point are not identified"
FT   mRNA            complement(join(<29294..32131,32235..32469,32585..32716,
FT                   32809..>33192))
FT                   /gene="P0698A10.12-4"
FT                   /note="supported by full-length cDNA(s): AK119315"
FT   misc_feature    complement(29294..33192)
FT                   /gene="P0698A10.12-4"
FT                   /note="contains full-length cDNA(s): AK119315"
FT                   /note="non-coding transcript"
FT                   /note="probably inactive due to 3'UTR too long in CDS"
FT   mRNA            complement(join(<29965..31215,31583..32131,32235..32469,
FT                   32585..32716,32809..>33188))
FT                   /gene="P0698A10.12-5"
FT                   /note="supported by full-length cDNA(s): AK103577"
FT   misc_feature    complement(29965..33188)
FT                   /gene="P0698A10.12-5"
FT                   /note="contains full-length cDNA(s): AK103577"
FT                   /note="non-coding transcript"
FT                   /note="probably inactive due to 3'UTR too long in CDS"
FT   mRNA            complement(join(30564..31215,31583..32131,32235..32469,
FT                   32585..32716,32809..33187))
FT                   /gene="P0698A10.12-1"
FT                   /note="supported by full-length cDNA(s): AK065991"
FT   mRNA            complement(join(30582..31215,31583..31693,31909..32131,
FT                   32235..32469,32585..32716,32809..33191))
FT                   /gene="P0698A10.12-2"
FT                   /note="supported by full-length cDNA(s): AK105063"
FT   CDS_pept        complement(join(31206..31215,31583..31693,31909..32131,
FT                   32235..32469,32585..32716,32809..33174))
FT                   /codon_start=1
FT                   /gene="P0698A10.12-2"
FT                   /product="putative DNA polymerase I 3'-5' exo domain"
FT                   /note="contains full-length cDNA(s): AK105063"
FT                   /db_xref="GOA:Q5N8X0"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8X0"
FT                   /protein_id="BAD82084.1"
FT                   /translation="MPPPAVSTAPVAPVVASSSSAAAAAPRRPRSLRLRVTPYASVSSS
FT                   SSPSTFAVSIPPPPPARHSRKQLVGRDGAPAKPAKPRVFFLDVNPLCFRGSQRSLGAFA
FT                   RWLALFFAHVSLRDPVVAVLDGEGGNEYRRRLLPSYKAHRPRGPGTGADSRVIDVLREC
FT                   NVPVVRVDGYEADDVVATLTEQVLQKGFRVVIGSPDKDFKQLISEDVQLVMPIPEIGRW
FT                   SFYTLRHYVAQYKCDPTADLSLRCFIGDEADGIPGIQHLVPGFGRKTAVKLLKKHGSLE
FT                   NLLNTAAVRTVGKDYAQDALVKHADYLRKNYEVLSLKRDVKVQLDDRWLSTRDSCNDSS
FT                   VLSDFILKFNEGQNIRGN"
FT   mRNA            complement(join(31357..31693,31909..32131,32235..32469,
FT                   32585..32716,32809..33205))
FT                   /gene="P0698A10.12-3"
FT                   /note="supported by full-length cDNA(s): AK065916"
FT   CDS_pept        complement(join(31579..31693,31909..32131,32235..32469,
FT                   32585..32716,32809..33174))
FT                   /codon_start=1
FT                   /gene="P0698A10.12-3"
FT                   /product="putative DNA polymerase I 3'-5' exo domain"
FT                   /note="contains full-length cDNA(s): AK065916"
FT                   /db_xref="GOA:Q8RYY9"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RYY9"
FT                   /protein_id="BAB92438.1"
FT                   /translation="MPPPAVSTAPVAPVVASSSSAAAAAPRRPRSLRLRVTPYASVSSS
FT                   SSPSTFAVSIPPPPPARHSRKQLVGRDGAPAKPAKPRVFFLDVNPLCFRGSQRSLGAFA
FT                   RWLALFFAHVSLRDPVVAVLDGEGGNEYRRRLLPSYKAHRPRGPGTGADSRVIDVLREC
FT                   NVPVVRVDGYEADDVVATLTEQVLQKGFRVVIGSPDKDFKQLISEDVQLVMPIPEIGRW
FT                   SFYTLRHYVAQYKCDPTADLSLRCFIGDEADGIPGIQHLVPGFGRKTAVKLLKKHGSLE
FT                   NLLNTAAVRTVGKDYAQDALVKHADYLRKNYEVLSLKRDVKVQLDDRWLSTRDSCNDSS
FT                   VLSDFILKFNEGQNIR"
FT   CDS_pept        complement(join(31845..32131,32235..32469,32585..32716,
FT                   32809..33174))
FT                   /codon_start=1
FT                   /gene="P0698A10.12-1"
FT                   /product="putative DNA polymerase I 3'-5' exo domain"
FT                   /note="contains full-length cDNA(s): AK065991"
FT                   /db_xref="GOA:Q5N8W9"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8W9"
FT                   /protein_id="BAD82085.1"
FT                   /translation="MPPPAVSTAPVAPVVASSSSAAAAAPRRPRSLRLRVTPYASVSSS
FT                   SSPSTFAVSIPPPPPARHSRKQLVGRDGAPAKPAKPRVFFLDVNPLCFRGSQRSLGAFA
FT                   RWLALFFAHVSLRDPVVAVLDGEGGNEYRRRLLPSYKAHRPRGPGTGADSRVIDVLREC
FT                   NVPVVRVDGYEADDVVATLTEQVLQKGFRVVIGSPDKDFKQLISEDVQLVMPIPEIGRW
FT                   SFYTLRHYVAQYKCDPTADLSLRCFIGDEADGIPGIQHLVPGFGRKTAVKLLKKHGSLE
FT                   NLLNTAAVRTVGKDYAQDALVKHADYLRKNYEVLSLKRYAFFSNHEYSNLMSGCPTLL"
FT   misc_feature    complement(34177..34410)
FT                   /gene="P0698A10.13"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by GENSCAN"
FT                   /note="this category is not included in IRGSP standard"
FT   misc_feature    complement(join(35312..35473,36485..36646))
FT                   /gene="P0698A10.14"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by GENSCAN"
FT                   /note="this category is not included in IRGSP standard"
FT   mRNA            join(36766..38148,39504..39906,40314..40415,40513..40972)
FT                   /gene="P0698A10.15"
FT                   /note="supported by full-length cDNA(s): AK103554"
FT   CDS_pept        join(37075..38148,39504..39906,40314..40415,40513..40736)
FT                   /codon_start=1
FT                   /gene="P0698A10.15"
FT                   /product="putative serine hydroxymethyltransferase"
FT                   /note="contains EST(s): AU101336(E11055),AU101337(E11055)"
FT                   /note="contains full-length cDNA(s): AK103554"
FT                   /db_xref="GOA:Q8RYY6"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RYY6"
FT                   /protein_id="BAB92441.1"
FT                   /translation="MDLSRPESSDLSLGFHSLGHARGHAVTGPLRLFDDMEDAKPEKSV
FT                   GGGGGGGGGGGEEEDGEEGGDQHFSLLGHALCVKRPRRALYGGGGGGGAGGGGGGGGEA
FT                   SSCSSSSSSLHPAKRQATAERGADLEARRGAVRAWGNQALAEADPDVHALMELERDRQV
FT                   RGIELIASENFVCRAVLEALGSHLTNKYSEGHPGARYYGGNQHIDGIERLCHERALAAF
FT                   GLDPACWGVNVQPYSCTSANLAVYTGLLLPKDRIMGLEPPSGGHVSHGYYTPSGKKVSG
FT                   ASIFFESLSYKVNPQTGYIDYDKLEERAMDFHPKILICGGSSYPREWDFARMRLIADKC
FT                   GAVLMCDMAHISGLVAAKECRSPFDYCDVVTSTTHKNLRGPRGGIIFFRRGKNLRRRTG
FT                   SFSQADENDYDFEDRINFAVFPSMQGGPHNNHIAALAITLKQVATPEYKAYIIQVKKNA
FT                   QALASALLRRKCRLVTGGTDNHLVLWDLRNLGLTGKNFEKVCEACHISINKMPIYGDNG
FT                   SISPGGVRIGTPAMTTRGCLEDDFEVIADFLIRATQIASNLMKEHGKMQKEFLRGLQNN
FT                   KDIIELRNQVENFASQFAMPGFDV"
FT   misc_feature    complement(join(41363..41604,42495..42501))
FT                   /gene="P0698A10.16"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by GENSCAN"
FT                   /note="this category is not included in IRGSP standard"
FT   mRNA            complement(join(43175..44004,44160..44537))
FT                   /gene="P0698A10.17"
FT                   /note="supported by full-length cDNA(s): AK058560"
FT   CDS_pept        complement(join(43375..44004,44160..44486))
FT                   /codon_start=1
FT                   /gene="P0698A10.17"
FT                   /product="unknown protein"
FT                   /note="contains full-length cDNA(s): AK058560"
FT                   /note="similar to Arabidopsis thaliana chromosome 1,
FT                   At1g22030"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RYY4"
FT                   /protein_id="BAB92443.1"
FT                   /translation="MNAFFTSLARGLDDLSSGGGLSSLPALLRAAALLRGLHSQLTLLV
FT                   GQLHLPPGGRWLDEYMDETARLWEACLAVKVGLAAVERYCAAASCAAAAMDDWLQDPSP
FT                   LSTRQVMRAISASRREAMAAEEENRALSEARIAPLSLQLDERLLLRAADARLSGFNGFR
FT                   GLLYALHNASSLLLLVLASGAVSCAAAAAGPCSADGAADAGGFVASIAMLQQRMAEEAD
FT                   ADGSAGAARGGIRMYEFRCARAAVEAAHEEVERAVAAGPRKQQCEDGDGGVKDKVDELK
FT                   AWLDVLRTGTDGLVCQLDDFLDDIVEGRKELSDLCSH"
FT   CDS_pept        join(44707..44858,45568..45628,51962..52465)
FT                   /codon_start=1
FT                   /gene="P0698A10.18"
FT                   /product="hypothetical protein"
FT                   /note="predicted by GENSCAN etc."
FT                   /db_xref="GOA:Q5N8X7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8X7"
FT                   /protein_id="BAD82086.1"
FT                   /translation="MADVSLARSLLLAVLCAVLWSGLWLRARRTSGARLMAASSRHRAL
FT                   PGFRRSAYRRGALVGEVVAPWGGPPTAPYHKRVPVGTPPQPSMGADERLKCIVIRISAG
FT                   TAAAAARVVVKSSGQELKKRNTRAAFNSAVRPLGSAAAAPPRIHPLRPRDSVALLAGSR
FT                   ADLVRYDACTVVGATRLHGRAGSPTTTRARAPARSSAGTGTETRLARTRAGGMRVPGAP
FT                   ARTDAETQHFVPGFGT"
FT   mRNA            join(<44707..44858,45568..45628,51962..>52465)
FT                   /gene="P0698A10.18"
FT                   /note="start and end point are not identified"
FT   misc_feature    complement(join(54662..54810,54928..54952))
FT                   /gene="P0698A10.19"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by GlimmerM"
FT                   /note="this category is not included in IRGSP standard"
FT   CDS_pept        join(57128..57577,58701..58828,59485..59632)
FT                   /codon_start=1
FT                   /gene="P0698A10.20"
FT                   /product="hypothetical protein"
FT                   /note="similar to Oryza sativa chromosome 5, P0636F09.16"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RYY1"
FT                   /protein_id="BAB92446.1"
FT                   /translation="MASGGGEHFLRQLSASNGGYGGAAQYQMGRGVVAEEEVELGGGGR
FT                   RRGSKRWSKKRAGRGGYGGGGGGKGDAAAAAAAAAAVAGRKRVMVVVDDTSGAKHAMMW
FT                   ALTHVANKGDFLTLLHVLPYAGAGRGEETPSLANSLGTLCKACRPEVEVEALVIQGPKL
FT                   ATVLSQVKKLEASVLVLSQSKPSHFCWLSCILRSSSEEFVEQCINQAECLTLAVRKQSK
FT                   GVGGYLISTRWQKNFWLLA"
FT   mRNA            join(<57128..57577,58701..58828,59485..>59632)
FT                   /gene="P0698A10.20"
FT                   /note="start and end point are not identified"
FT   mRNA            complement(join(61070..61531,61615..61789,61882..61945,
FT                   62024..62138,63206..63350,65615..65951))
FT                   /gene="P0698A10.21"
FT                   /note="supported by full-length cDNA(s): AK068371"
FT   CDS_pept        complement(join(61289..61531,61615..61789,61882..61945,
FT                   62024..62138,63206..63350,65615..65925))
FT                   /codon_start=1
FT                   /gene="P0698A10.21"
FT                   /product="CTD-like phosphatase domain-containing
FT                   protein-like"
FT                   /note="contains full-length cDNA(s): AK068371"
FT                   /db_xref="GOA:Q8RYY0"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011943"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RYY0"
FT                   /protein_id="BAB92447.1"
FT                   /translation="MAEASSSSAAAVPPLDPEAIAAVAEAAPPEEMTLVAKWKGNDYTV
FT                   RVVGDDTLGELKRRICEVTGVLPKRQKLLYPKFKLNECKDSELISSIPFKPNVKINMIG
FT                   TVEDEIFVDQEDDPEILNDYEIGQNEVTAIKDKDVYKQKLKRRASQYKIKILNPCRKGK
FT                   KLLVLDIDYTLFDHRSAAENPIELMRPYLHEFLSAAYSEYDIMIWSATSMKWVGMKMDQ
FT                   LGVLGNPNYKITALMDHLAMITVQSENLSEKKTFDCKPLGVIWAQFPEYNETNTIMFDD
FT                   LRRNFVMNPQNGLVIKPYKRTHSNRGTDQELVKLTQYLLTIAELEDLSKLDHSAWESFT
FT                   EENAKRRRHR"
FT   misc_feature    join(66174..66178,66354..66549)
FT                   /gene="P0698A10.22"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by GlimmerM"
FT                   /note="this category is not included in IRGSP standard"
FT   misc_feature    68511..68714
FT                   /gene="P0698A10.23"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by GlimmerM"
FT                   /note="this category is not included in IRGSP standard"
FT   mRNA            join(68715..69181,69259..69354,69452..69564,69683..69749,
FT                   69835..69927,70039..70182,70625..70713,70856..70961,
FT                   71168..71255,71339..71457,71730..71894,72166..72350,
FT                   72512..72612,72904..73013,73231..73338,73540..73650,
FT                   73735..73946,74031..74367,74711..75191)
FT                   /gene="P0698A10.24"
FT                   /note="supported by full-length cDNA(s): AK102715"
FT   mRNA            join(68936..69181,69259..69354,69452..69564,69683..69749,
FT                   69835..69927,70039..70182,70625..70713,70856..70961,
FT                   71168..71255,71339..71457,71730..71894,72166..72350,
FT                   72512..72612,72904..73013,73231..73338,73540..73650,
FT                   73735..73946,74031..74367,74711..74889,75013..75787)
FT                   /gene="P0698A10.24"
FT                   /note="supported by full-length cDNA(s): AK101399"
FT   CDS_pept        join(68981..69181,69259..69354,69452..69564,69683..69749,
FT                   69835..69927,70039..70182,70625..70713,70856..70961,
FT                   71168..71255,71339..71457,71730..71894,72166..72350,
FT                   72512..72612,72904..73013,73231..73338,73540..73650,
FT                   73735..73946,74031..74367,74711..74821)
FT                   /codon_start=1
FT                   /gene="P0698A10.24"
FT                   /product="putative beta-galactosidase"
FT                   /note="contains EST(s): AU089695(C1439),AU089696(C1439)"
FT                   /note="contains full-length cDNA(s): AK102715,AK101399"
FT                   /db_xref="GOA:Q5N8X6"
FT                   /db_xref="InterPro:IPR000922"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="InterPro:IPR041392"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5N8X6"
FT                   /protein_id="BAD82087.1"
FT                   /translation="MAGASSYFSLRRLLLLLLPLVPLLGATTAAAAGANSSVTYDHRSL
FT                   IISGRRRLLISTSIHYPRSVPEMWPKLVAEAKDGGADCVETYVFWNGHEPAQGQYYFEE
FT                   RFDLVRFAKIVKDAGLYMILRIGPFVAAEWTFGGVPVWLHYAPGTVFRTNNEPFKSHMK
FT                   RFTTYIVDMMKKEQFFASQGGHIILAQVENEYGDMEQAYGAGAKPYAMWAASMALAQNT
FT                   GVPWIMCQQYDAPDPVINTCNSFYCDQFKPNSPTKPKFWTENWPGWFQTFGESNPHRPP
FT                   EDVAFSVARFFGKGGSLQNYYVYHGGTNFGRTTGGPFITTSYDYDAPIDEYGLRRLPKW
FT                   AHLRDLHKSIKLGEHTLLYGNSSFVSLGPQQEADVYTDQSGGCVAFLSNVDSEKDKVVT
FT                   FQSRSYDLPAWSVSILPDCKNVAFNTAKVRSQTLMMDMVPANLESSKVDGWSIFREKYG
FT                   IWGNIDLVRNGFVDHINTTKDSTDYLWYTTSFDVDGSHLAGGNHVLHIESKGHAVQAFL
FT                   NNELIGSAYGNGSKSNFSVEMPVNLRAGKNKLSLLSMTVGLQNGGPMYEWAGAGITSVK
FT                   ISGMENRIIDLSSNKWEYKIGLEGEYYSLFKADKGKDIRWMPQSEPPKNQPMTWYKVNV
FT                   DVPQGDDPVGLDMQSMGKGLAWLNGNAIGRYWPRISPVSDRCTSSCDYRGTFSPNKCRR
FT                   GCGQPTQRWYHVPRSWFHPSGNTLVIFEEKGGDPTKITFSRRTVASVCSFVSEHYPSID
FT                   LESWDRNTQNDGRDAAKVQLSCPKGKSISSVKFVSFGNPSGTCRSYQQGSCHHPNSISV
FT                   VEKACLNMNGCTVSLSDEGFGEDLCPGVTKTLAIEADCS"
FT   misc_feature    79332..79819
FT                   /pseudo
FT                   /gene="P0698A10.25"
FT                   /note="probably inactive due to 5'exon missing in CDS"
FT                   /note="probably inactive due to including stop codon(s) in
FT                   CDS"
FT                   /note="pseudogene, putative retroelement"
FT   misc_feature    join(80096..80497,80685..80843)
FT                   /gene="P0698A10.26"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by FGENESH"
FT                   /note="this category is not included in IRGSP standard"
FT   CDS_pept        join(82040..82118,82777..82922,83536..83547)
FT                   /codon_start=1
FT                   /gene="P0698A10.27"
FT                   /product="hypothetical protein"
FT                   /note="predicted by GENSCAN etc."
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8X5"
FT                   /protein_id="BAD82088.1"
FT                   /translation="MDWANLARASGGRKTSRPARCPQDEPEMDQVAMAIDRPIDRHLHH
FT                   QLRTCAHGRDETTRSGTEESKAFAWPLTRSPIA"
FT   mRNA            join(<82040..82118,82777..82922,83536..>83547)
FT                   /gene="P0698A10.27"
FT                   /note="start and end point are not identified"
FT   mRNA            join(83844..84191,84282..84634,85478..86105)
FT                   /gene="P0698A10.28"
FT                   /note="supported by full-length cDNA(s): AK063817"
FT   CDS_pept        join(84015..84191,84282..84634,85478..85931)
FT                   /codon_start=1
FT                   /gene="P0698A10.28"
FT                   /product="putative DnaJ-like protein"
FT                   /note="contains full-length cDNA(s): AK063817"
FT                   /db_xref="GOA:Q5N8X4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8X4"
FT                   /protein_id="BAD82089.1"
FT                   /translation="MGNPPELYHRILNIPRETSPQEIRAAYKSLVKKWHPDKHPPSSKP
FT                   EAEARFKAITEAYEALLDQQENRAVFGVCCNDGRAGEKAMACGVVGGGGAHIARTRSDD
FT                   FGARMAPGTPAREFKKVYSSGNSGGRRAFAEFSSSIMRKAPPLERKLDCTLEELCHGCK
FT                   KEVKFTRDVVTKNGSIVKKEVSQMVLVKPGWKKGNKITFEGMGDERPGCLPADAVFVIS
FT                   EKKHPVFKRVGNDLVLKAEVPLVSALTGWSFSFRLLSGKKVSCSFQDEIICPGYEKIIK
FT                   GEGMPIADQKGARGDLRVKFEIAFPKQLTDEQRDGLAQILRGCAWD"
FT   mRNA            complement(join(87002..87759,87864..88502))
FT                   /gene="P0698A10.29"
FT                   /note="supported by full-length cDNA(s): AK105949"
FT   CDS_pept        complement(join(87118..87759,87864..88364))
FT                   /codon_start=1
FT                   /gene="P0698A10.29"
FT                   /product="unknown protein"
FT                   /note="contains EST(s): AU096118(S12194),AU096119(S12194)"
FT                   /note="contains full-length cDNA(s): AK105949"
FT                   /note="similar to Oryza sativa chromosome 8, P0007D08.32"
FT                   /db_xref="GOA:Q5N8X3"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8X3"
FT                   /protein_id="BAD82090.1"
FT                   /translation="MADEFKIVLTRKERFLYLAKAVVFLVIFALGVVAGLWTATGPRRC
FT                   CSTYTNILFPSTTVYRYRGGGGGSFSEFVAPTRLMHDMTDEQLFWRATMAPASSGGAYP
FT                   FQRVPKVAFMFLAGRGVLPLAPLWERFFRGHEGLFSIYVHAPPGMVLNVSDDSPFYGRQ
FT                   IPSQETSWGSITLMDAEKRLLANALLDFSNDRFVLLSESCIPVQSFPVAYGYLTGSRHS
FT                   FVEVYYHKGKTCRGRYSRRMEPDITLPQWRKGSQWFELRRDLAVAALTDARYYPLFRRH
FT                   CRPSCYPDEHYLPTFVAMLHGADNSNRTVTYVDWSRGGAHPATYTAGDVTPELILSIRR
FT                   SEVPCMYNSRPTTACFLFARKFSADALEPLLNISSTVMQY"
FT   CDS_pept        complement(join(89967..90455,90555..90659))
FT                   /codon_start=1
FT                   /gene="P0698A10.30"
FT                   /product="hypothetical protein"
FT                   /note="predicted by GeneMark.hmm etc."
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8X2"
FT                   /protein_id="BAD82091.1"
FT                   /translation="MGRISLVGCVRGGAHRPAPTLAPIIHAGSSRTARGGNRAARLEAA
FT                   RWWELRHLLSPPPPPHPRPRRSLLSSLPAALMAASMVLVSVRFKAAGMVGAEASHLIVG
FT                   ASSNLVGAAFPPSPILCRLIPTLPSSNLATASSPFSAPPPPWPPHPRPPLLRPCRHLLS
FT                   SLPAVLRVAVRLMATSTVLGSAAKLLAASAALGS"
FT   mRNA            complement(join(<89967..90455,90555..>90659))
FT                   /gene="P0698A10.30"
FT                   /note="start and end point are not identified"
FT   CDS_pept        join(92335..92579,93310..93510,93603..93780,93890..94152,
FT                   94324..94593,94697..95834,95916..96002)
FT                   /codon_start=1
FT                   /gene="P0698A10.31"
FT                   /product="putative chloride channel"
FT                   /db_xref="GOA:Q5N8W8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002251"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8W8"
FT                   /protein_id="BAD82092.1"
FT                   /translation="MAVGTESGSGGVAESAPSTPMSAMTTTPISARSVRWESDMPDIEE
FT                   GGGGLERPLLRRRGTNTTSQMAIVGANVCPIESLDYELVENEVYKQDWRSRGKLQIFHY
FT                   QILKWVLALLVGLIVGLIGFFNNIAVENIAGFKLLLTTNLMLQNRYKAAFLWFISCNAM
FT                   LAAAAAALCAYFGPAAAGSGIPEVKAYLNGVDAPSILAPSTLFVKIVGSIFGVSAGFVL
FT                   GKEGPMVHTGACVASFLGQGGSRKYGFTWNWLRYFKNDLDRRDLITCGAAAGVTAAFRA
FT                   PVGGVLFALEEATSWWRSALLWRTFSTTAVAAMVLRSLIEYCRSGNCGLFGKGGLIMFD
FT                   VSSQVTSYTTMDLAAVVLLAIVGGLLGALFNFLLNRILRVYSYINEKGAPYKIILTVVI
FT                   SLVTSCCSFGLPWLTACTPCPPELAASGHCPTIGRSGNFKNFRCPPGQYNAMASLFLNT
FT                   NDDAIRNLFSGGTESEFGVPMLLAFFTAVYSLGLVTYGVAVPSGLFIPVILSGASFGRL
FT                   LGKLLGVLTGLDTGLFALLGAASFLGGTMRMTVSVCVILLELTNDLLLLPLIMLVLLVS
FT                   KTVADCFNKGVYEQMVRMKGLPYLEAHAEPCMRSLVAGDVVSAPLIAFSSVESVGTVVD
FT                   TLRRTGHNGFPVIEDAPFAPEPELCGLVLRSHLLVLLRAKTFTADRVKTGAAEVFRKLA
FT                   PFDFAKPGSGKGLTVDDLDLTEEEMAMYVDLHPIANRSPYTVVENMSLAKAAVLFRQLG
FT                   LRHMCVVPRTPGRPPVVGILTRHDFMPGYIRGLFPNVLRE"
FT   mRNA            join(<92335..92579,93310..93510,93603..93780,93890..94152,
FT                   94324..94593,94697..95834,95916..>96002)
FT                   /gene="P0698A10.31"
FT                   /note="start and end point are not identified"
FT   mRNA            complement(<93178..>95926)
FT                   /gene="P0698A10.32"
FT                   /note="supported by full-length cDNA(s): AK119459"
FT   misc_feature    complement(93178..95926)
FT                   /gene="P0698A10.32"
FT                   /note="contains full-length cDNA(s): AK119459"
FT                   /note="non-coding transcript"
FT                   /note="probably inactive due to 3'UTR too long in CDS"
FT   mRNA            complement(join(97016..98028,98072..98257))
FT                   /gene="P0698A10.33-2"
FT                   /note="supported by full-length cDNA(s): AK061090"
FT   mRNA            complement(97021..98344)
FT                   /gene="P0698A10.33-1"
FT                   /note="supported by full-length cDNA(s): AK069276"
FT   CDS_pept        complement(97152..98240)
FT                   /codon_start=1
FT                   /gene="P0698A10.33-1"
FT                   /product="unknown protein"
FT                   /note="contains full-length cDNA(s): AK069276"
FT                   /note="similar to Oryza sativa chromosome 8, OJ1770_H02.21"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LR17"
FT                   /protein_id="BAB92454.1"
FT                   /translation="MDGEIGEDMLTEILVRLPYKSLARFQCVATSWRRLISGDYLRRRL
FT                   PLITSGVLYQEGRGGGGGGGGEGRRRQAYTYACASGGGDHGGGVAEADMGFFPGHETST
FT                   IIDGCNGMLLYYASQPAAAFHVVNPTTRRWARLPPPRGKTLLSVLAFDPSASPHYRVVC
FT                   FTGWLPRGASVEVFDSEGGAWRDHELDFGLDTDAMSATMHYFDGAIHVLAYSGHVVRID
FT                   LGTMACAVTALPAPVSCRARAGHCRGRLRYASSDGTRLKFWELKNAATSEWALKHELGV
FT                   NDLVAGEASGACQAVTFLFMAFHPDREMVYLWTPWKLVAFDMEKRRVEEEWEVGPEKEK
FT                   EGAHLIQIWLFPFSRHLANSLA"
FT   CDS_pept        complement(97152..97961)
FT                   /codon_start=1
FT                   /gene="P0698A10.33-2"
FT                   /product="unknown protein"
FT                   /note="contains full-length cDNA(s): AK061090"
FT                   /note="similar to Oryza sativa chromosome 8, OJ1770_H02.21"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8W7"
FT                   /protein_id="BAD82093.1"
FT                   /translation="MGFFPGHETSTIIDGCNGMLLYYASQPAAAFHVVNPTTRRWARLP
FT                   PPRGKTLLSVLAFDPSASPHYRVVCFTGWLPRGASVEVFDSEGGAWRDHELDFGLDTDA
FT                   MSATMHYFDGAIHVLAYSGHVVRIDLGTMACAVTALPAPVSCRARAGHCRGRLRYASSD
FT                   GTRLKFWELKNAATSEWALKHELGVNDLVAGEASGACQAVTFLFMAFHPDREMVYLWTP
FT                   WKLVAFDMEKRRVEEEWEVGPEKEKEGAHLIQIWLFPFSRHLANSLA"
FT   misc_feature    complement(join(99637..99816,99921..99932))
FT                   /gene="P0698A10.34"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by GlimmerM"
FT                   /note="this category is not included in IRGSP standard"
FT   mRNA            complement(join(100863..101811,102070..102155,
FT                   102241..103586,103924..104342))
FT                   /gene="P0698A10.35-1"
FT                   /note="supported by full-length cDNA(s): AK072910"
FT   mRNA            complement(join(101502..101811,102070..102155,
FT                   102241..103586,103924..104385))
FT                   /gene="P0698A10.35-1"
FT                   /note="supported by full-length cDNA(s): AK121648"
FT   mRNA            complement(join(101502..101811,102070..102155,
FT                   102241..103586,103924..104382))
FT                   /gene="P0698A10.35-1"
FT                   /note="supported by full-length cDNA(s): AK073144"
FT   mRNA            complement(join(<101524..101811,102070..102155,
FT                   102241..103586,103924..104015,104042..>104385))
FT                   /gene="P0698A10.35-2"
FT                   /note="supported by full-length cDNA(s): AK065101"
FT   misc_feature    complement(101524..104385)
FT                   /gene="P0698A10.35-2"
FT                   /note="contains full-length cDNA(s): AK065101"
FT                   /note="non-coding transcript"
FT                   /note="probably inactive due to including frameshift(s) in
FT                   CDS"
FT   CDS_pept        complement(join(101580..101811,102070..102155,
FT                   102241..103586,103924..104137))
FT                   /codon_start=1
FT                   /gene="P0698A10.35-1"
FT                   /product="membrane protein CH1-like"
FT                   /note="contains EST(s): C97795(C62963)"
FT                   /note="contains full-length cDNA(s):
FT                   AK072910,AK100486,AK073144,AK121648"
FT                   /db_xref="GOA:Q8LR16"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LR16"
FT                   /protein_id="BAB92455.1"
FT                   /translation="MQRSRRALLKRKAAAAAKEEEEEAGVGVATAAAAGRRRRRRLYGF
FT                   SVSLVVACWVVLLLLNPLVGHGNGQRDEGIFADEGSSDPSFDSVEPTLSEGSVDSVVQQ
FT                   ENGENHALPGDSCAKPDENHVLSEETLLEKDQLCSNDEAQGDSMDALPKDNVDQGENLP
FT                   RTDDDSVVHPEGEVESEGVPRPARLSRVVPPGLDEFKTRAIAERGKGVPSGQPGNVIHR
FT                   REPSGKLYNYASAAKGAKVLEFNKEAKGASNILDKDKDKYLRNPCSAEGKFVIIELSEE
FT                   TLVDTIAIANFEHYSSNLKEFEMLSSLNYPTDSWETLGRFTVANAKIAQNFTFPEPKWA
FT                   RYLKLNLLSHYGSEFYCTLSMLEVYGMDAVEKMLENLIPVENKRLEPDDKMKEPVDQQT
FT                   QLKEPTEGKESSHEPLDEDEFELEDDKLNGDSSKNGAHDQVTETRPIQAGRIPGDTVLK
FT                   VLMQKVQSLDVSFSVLERYLEELNSRYGQIFKDFDADIDTKDALLEKIKLELKHLERSK
FT                   DDFAKEIEGILSWKLVASSQLNQLLLDNVIIRSELERFREKQADLENRSFAVIFLSFVF
FT                   GCLAIAKLSIGMIFNTCRLYNFEKFDRVKSGWLVLLFSSCIIASILIIQ"
FT   CDS_pept        join(105701..105734,106536..106747,107055..107256,
FT                   107349..107515)
FT                   /codon_start=1
FT                   /gene="P0698A10.36"
FT                   /product="galactosyltransferase-like protein"
FT                   /note="contains EST(s): AU056438(S20585),AU181077(S20585)"
FT                   /db_xref="GOA:Q5N8W6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8W6"
FT                   /protein_id="BAD82094.1"
FT                   /translation="MARNPTRTVYIGNLDEKVTERILYEILIQPGRVVDLCIPRDKETS
FT                   CPKGYAFAEYETEEIAQYAVQLFSGLVRLYGKTLKFAISGQDKPSSNGNNPVMPKLNPV
FT                   PLPKQPQFVHHSDMHVLHTPADPMVNGGTRDYGFSNYYPYSANPQALPVGPVHSYRGFS
FT                   NGTYDCSTCIFGSIVNGRYGDYVLNAAGHGAPRQPMLYPSY"
FT   mRNA            join(<105701..105734,106536..106747,107055..107256,
FT                   107349..>107515)
FT                   /gene="P0698A10.36"
FT                   /note="start and end point are not identified"
FT   CDS_pept        109031..109759
FT                   /codon_start=1
FT                   /gene="P0698A10.37"
FT                   /product="unknown protein"
FT                   /note="contains EST(s): AU078043(R10761)"
FT                   /db_xref="GOA:Q8LR14"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LR14"
FT                   /protein_id="BAB92457.1"
FT                   /translation="MKMESPGVQPAAAGEEEGGGGVFFCVAVTSRGRTDRLSYFQAEGD
FT                   GDDAEEVARATAALCLDHAPEHHHWHHHTVVGRRTFAFLAGDDGRTYFAVADPTPGSAE
FT                   TVRFLQRVRDAFGSCGGGGGGGATRRRNQRDDAVDAVVWQFVRALRASAGRGTAALFPG
FT                   DDSRGGGDASSADGDKDDEEEEDDRGGEAMAVAADGARRRTRRSWWRYSKVVIGVELVL
FT                   FLVLFVVWMIVCKGFNCVQR"
FT   mRNA            <109031..>109759
FT                   /gene="P0698A10.37"
FT                   /note="start and end point are not identified"
FT   CDS_pept        complement(join(111286..111451,111571..111631,
FT                   116245..116318,116596..116632,116729..116822))
FT                   /codon_start=1
FT                   /gene="P0698A10.38"
FT                   /product="hypothetical protein"
FT                   /note="predicted by GeneMark.hmm etc."
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8W5"
FT                   /protein_id="BAD82095.1"
FT                   /translation="MDVCTAIPGSNGKQCGVGPTTRRIIAGADLEAGSGSGSGAARRRK
FT                   SGSKYMVKMGLRTVPYRQRDDPGAPPLAEDADAEAQLFGIDRRMRKSRVSLALHCTARE
FT                   TEHAVFCVLVANWQLAKQMQVHVGSSDLAKETTADYSER"
FT   mRNA            complement(join(<111286..111451,111571..111631,
FT                   116245..116318,116596..116632,116729..>116822))
FT                   /gene="P0698A10.38"
FT                   /note="start and end point are not identified"
FT   misc_feature    120848..121246
FT                   /gene="P0698A10.39"
FT                   /note="hypothetical ORF"
FT                   /note="predicted by GlimmerM"
FT                   /note="this category is not included in IRGSP standard"
FT   CDS_pept        join(122443..122625,122797..122929,123760..123898,
FT                   124275..124311,126550..126841,127328..127446)
FT                   /codon_start=1
FT                   /gene="P0698A10.40"
FT                   /product="putative RRM-containing protein SEB-4"
FT                   /db_xref="GOA:Q5N8W4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR037366"
FT                   /db_xref="UniProtKB/TrEMBL:Q5N8W4"
FT                   /protein_id="BAD82096.1"
FT                   /translation="MSPPSVIGQFGDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEA
FT                   VVITDKNTGRSKGYGFVTFRDPDAAMRACVDPAPVIDGRRANCNLASLGVQRSRPPTPQ
FT                   HGGARSFRVMKSFSQQAGIQGGLGAAFPSHATFPHYAIPQGLPYHVYGYSPYSPDYSYP
FT                   TNYYNIYGGAQYPFYGAAAAAAAAAAGMVTGSSPFYPYFQFGQSGSTTTNYASGQGYNL
FT                   QYPQMFHFSTVASTAAAVTGFAQQYGGPLSLAASPQAQAGMTMALTAPTLPTPTQAAHP
FT                   YRLIPSHFAVSAAPEQPLA"
FT   mRNA            join(<122443..122625,122797..122929,123760..123898,
FT                   124275..124311,126550..126841,127328..>127446)
FT                   /gene="P0698A10.40"
FT                   /note="start and end point are not identified"
FT   CDS_pept        complement(join(130109..130252,130824..130918,
FT                   131051..131088,131694..131983))
FT                   /codon_start=1
FT                   /gene="P0698A10.41"
FT                   /product="putative SnRK1-interacting protein 1"
FT                   /db_xref="GOA:Q8L4C2"
FT                   /db_xref="InterPro:IPR037489"
FT                   /db_xref="UniProtKB/TrEMBL:Q8L4C2"
FT                   /protein_id="BAB92460.1"
FT                   /translation="MASGALARLLLGRRAAATPLLARPFAAKARASRRPQEPAFPSEDE
FT                   DDFAGGEVAAPAPTEGISKPLAEVLRELGKRVPEALVKTRVEDGFSLKYIPWHIVNKIL
FT                   NIHAPEWSGEVRSIVYSSDGKSVSVIYRVTLHGTDAEIYREATGTSSADDTGYGDPVQK
FT                   AEAMAFRRACTRLGLGLHLYHEDMS"
FT   mRNA            complement(join(<130109..130252,130824..130918,
FT                   131051..131088,131694..>131983))
FT                   /gene="P0698A10.41"
FT                   /note="start and end point are not identified"
XX
SQ   Sequence 137348 BP; 37882 A; 30579 C; 30489 G; 38398 T; 0 other;
     atggatgcat gcatgctttc atgcggtaca gtgctagagc tgtacagtgc acccctcgac        60
     gtggaggtgg aggtacgtac gcaggcacgc gggactcggc aacaaccacc accaccccga       120
     ccagtcgaga tcgactccgt accagcctcc tctgactgca tgcgagcatg cgactgctcc       180
     tagcatagca ccagtagaag tctagaacgt acggccgcgt cgtgtggcgg cagttggtgc       240
     ggggtacggg gggcggcgtc gccgtcggcg caacagtgtc acgcacagtg atatctcctc       300
     gcgcacgcgg tcgcgggcgt acgagcgcgg cgcgagctga gctgctccct tgttggggag       360
     ggggccccgg cgttcacggg gcgcgcgcgc ggcgcggggc ctgacaccgt accaacccgc       420
     caccaccgag cgcgcgaacg cctcacctac ctatacacac cgcggggtgg tggtggtgga       480
     cgcggcggtg gctcgctagc tcgcgcttcg gctggcgatc actttagcta gcgatcgaag       540
     tgcatgcacg gatgcacttc ggtgagagca acgtccgacc ggcaaatgga tccgaccgga       600
     atccattgaa gaccgggagt tgactggcgc gcactgtaca cgtggataac gcatgccttt       660
     cgggccgttg gatggaatgc aagcgcatca aaagtagagt gagtaattgg gagtgtaatg       720
     taaactctgg atgggacatt gtaaactctc gatagaatat tctctcgtta tttacatgca       780
     ttgaaatggt tataattttt cttaaagaaa ttaactagat agattaatat gtgatatatt       840
     acttaacaag catgcaggtt aaaattcagc ttttacattt taaaaaaata aattatgact       900
     agttaacgta tattaatagt caaatttgtt tttttcgtta caacttgtag attttaaatt       960
     tgactttaca tatttatgaa gtgaattatc agttatcaca tattaatcta tcttgatagt      1020
     tttttttaaa aaaaaactca taaccattta gatgatatgc aaataaacga ggggatgtca      1080
     ccaaagagag tttagctaga atagtttccc gtgagtagtt gttgctagat tgtggcattg      1140
     agcttgagcc actactagat ctttatggtt ttggacgata cggttgctag ctaggcctaa      1200
     cagctgcaag ccaccatttt atatgctgta tatataggtc actttcagct ccaatctcag      1260
     caatctgacc acataattcc atgaaaacga aaacatattt tttttaatac tatgaaaatt      1320
     cgtacgggca aaataaggtg cacagatcag tgtcggtgca gacgcaatga aggactgatg      1380
     gcgaattggc catcacacca cacagcactc tctagtgaca aagaaggaat tgtcgccgca      1440
     gagttcagcc ctctagctag ccctctcgta attgaatgga aagaaaagaa ggtttcttca      1500
     ggggcattta acttcttcag accgcatcta atccgtctaa acgcggcaaa aggctaattc      1560
     atcgtataat ctagctagac ctgactcgcg cgcactgttc caggccaatg gcgctcgcta      1620
     acctggacac tgccgagaac acgtgagtac cttgcagtgc aaatactagt actagaagta      1680
     cgtagaaccc tagaaccacg gaccatgtgt gggttcgtgt tcaagaaaga cgagagggag      1740
     aaagattttg gacccatgct gtggccctgt ttagttataa agtttttttt tccaaacttt      1800
     taactttcca tcacatcaaa cttttcatat acacataact tgcatggtgg tccgcgcaga      1860
     ttgcgcggct agcatcatta tattttctct tatataaaat catatatgtt ttctcattat      1920
     attattaaaa tatattacaa tgacaacata attttgaatt ttgcaataac ttttcaaaac      1980
     tactaatgtg taataactac tctagtctcc tcttctaatt ttccttattt tttaattctg      2040
     aatttcagct atttctaaat tgtatttcta tatggactct gctttttttt tctctgatta      2100
     atgtgagaat ttataggcaa tgagagcgaa cgtgtaggct cctttttatt ccgaatttca      2160
     gttggtttta attcaaatat gaactctata ttctacttct aatattcctt attttttaat      2220
     tccaaatttc tatttttttt tcttaattgt atttctatat ggactctata ctctacttct      2280
     aatatttctt aattttaatt ccgaatttcg gttatttcct aattgtattt ctatatggac      2340
     tctatactct acttctaata ttctttattt ttaattccga atttcagtta tttcctaatt      2400
     gtatttctat atggactctc tagtctcctc ttctaatatt ccttattttt taattccgaa      2460
     tttcaactat ttctaaattg tatttctata tggactctag tctcctcttc taatattcat      2520
     tattttttaa ttccgaattt cagctatttc taaattgtat ttctatatgg actctgtttt      2580
     ttctttttct ccgattaatg tgagaatttc taggtcatga gagcgaacgt ggagggtctt      2640
     tttttttcca aattttagtt agttttaaat tcctatatgg actctaaact ctacttctaa      2700
     tatttcttat tttttaattc cgaatttcta ttttttttct taattgtatt tctatatgga      2760
     ttctatactc tacttttaat attccttatt tttaattcag aatttctatt atttcctaat      2820
     tgtatttcta tatagaatct atactctact tctaatattc cttattttta attccgaatt      2880
     tctattattt cctaattgta tttctatatg gactctatac tcctcttcta atattcctta      2940
     tttttaattc cgaatttcaa ctatttctaa agtgtatttc tatatggact ctagtctcct      3000
     cttttaatat tccttatttt ttaatttcga atttcagcta tttctaaatt gtatttatat      3060
     atggactctg tttttttttt ctccgattaa tgtgagaatt tcgaggccat gagagcgaac      3120
     gtggaggctc ctttttctat tcctttaatt atataataga tttttctatc acatcgtacc      3180
     aatttcaaat aaactttcaa atttagtgtg atctaaactt cagtgtggat gaaagatcag      3240
     ccacaggttc tctccttcat caaggcgtag cactatccag gttgacgctt gacatgacaa      3300
     gcattcactc cgccgtacac cgactctctg tgtgtgttca gcacgcggat cccccggacg      3360
     cgctgactcc acctgcaaat cctcaacagt gcaaggggga tcgctctaga tgcgaccgca      3420
     atctaccaca ctgacgacga cgccattgct gccatcaaag agatagctta attaaaaaca      3480
     gtaaccactc ataaatggat gtgtttcagc ttagcttctt gctgcagaat cgtctgaacg      3540
     agaaggaaaa atgtccaatt tgatcatcgc ttcagtgaac tttggaaata aactcgagac      3600
     ttgttagctc gtgtttacac ctgcgccaca cgtacactag cctctgcctt tttgcactga      3660
     tcaaatctca tcgaatagcc gaccccaaca ctatcaatcc ttttccgttg tcaaaccgtg      3720
     cagattcaat cgactgccgc tgctacttgc taactacttc caacgatcca aggcaggcac      3780
     gcgcaagagc aagcatgcct ggagatctct tcttggtagt tagcttggtt gacccattaa      3840
     taccggccat ttgtgccccc caaaagtgct cgatctcttc attagtgact agtacttggc      3900
     cacgacaacc atctttagat ctgtaactac ttctataaag tgttcaactt cttctgtctc      3960
     gatcgatagc aacgtcgagt tcgatggcct gttcaccaga aatcaattaa tatgagaggt      4020
     tggccgccaa actggaagga aggttaagag agtatagttt aataggagta cgctacgatt      4080
     cggtatacgc tactcgtcta tacgcctctc atgagaatga ttgttatttc acgtcaccgt      4140
     cttcgttgtc gttggtatgt ctaaccgtat ttctgtttat ctatatatct atcctgcact      4200
     cgagaggcag ttgggtaact gtaatgacga agcgaatgga gaagtttacg ccggccatta      4260
     aagccgatga aaatgccgtt aaatctttgg gattggagat gcccttattt tcaacgaaaa      4320
     tcttcgggca cagtgccgtc gttgtcctat gatcctatca tcctaccccc aatctagcga      4380
     gtggtactat ccctgttccg acaagtgaaa acgactcgat ttgatccaaa aagatgaact      4440
     tttctcgacc agctagctca tcagccacga ggtatacgtc caaccaagcg ggtgtgtcta      4500
     gttcacgcta aaattaaaaa ttaaaagttt agttgaaatt taaacgatgt gatagaaaaa      4560
     ttagaagttt atgtgtgtag aaaagttttg atgtaagttg aaagtttgaa gaaaaagttt      4620
     agaactaaac tcggccaata ttgaacaaaa acatttggac ggtggatgtt gcgtcggagc      4680
     tggtccaata ttgaatccga gtagttccca acgcaaaggg gaactaggca tgttagtttt      4740
     gaccatgaga caccttgccc caattcgtta attaacatat ggctaatcaa aactcgtaag      4800
     gcccagcgtg tgcagtgcag tgcagtgagg cagcaagcta aggcatgcaa ctacctaatc      4860
     agtgctatta aattgtggcc atgtggcaaa taagacaggg gaaggaggat tagagaaaac      4920
     ggtggttagt cacgcacaca tgacaaaacg caagagacac gagagacaga gaacagctca      4980
     gagggtagct agccaatcag tggcggttgc tccaccaaac tttggaaacg agtaccaaaa      5040
     actggtcgat gattccgttt cgctcatcat caccggctta ttttaatggg acattccccc      5100
     actaaaaagc tgagcggctt tctccgatcg ctaactacaa tcaggcatcc agaacgagtc      5160
     gttgataact ttaaaaaact actcctagtg ccgtgctgtg ctaccactgt aaaccctaaa      5220
     aaaaaatgcc acgctgtaac aaagttgtta ccggttactt gaactgagta aaagaaaagg      5280
     gaattgctat acgttatttg aatgaaattt gaatataaaa tcttctagat tttggttcat      5340
     tggatccata ctaagattca tgcatcggct tctcttctct aactgtagtg ggctcccttt      5400
     cttctccggt accggcgaca ctcccaactc cgatagggaa tatacggatt agggtttagg      5460
     gttggggtca ggataggaga ggaggttggg gagggggaag agcgggtttc ctcggggctt      5520
     agagggatgg cagtgggcgg tggacttcgg cgggcggcga ggtggtggcg gcaccgccga      5580
     agccgtaggg atggagaagg gcggtgggcc ggcgttggcg gcaggggcaa agcaagcatg      5640
     cgattaggag gcgacgacta ggtgatggtg gatccggcag ctgggagccg ccggagacag      5700
     ggaagatgat ggggcggggg catctcgcca tcaccacctt gagaagaaag agagggagga      5760
     agggggagcg gggaggggga gggggctcat cgaggggccc ttatcggcgc cgttgactcc      5820
     tttcggccag tcggcgaggc gggtgatagc gcggtggggc ggtggcggcg gtggattggg      5880
     cggtaacgcg atggcaatgg tggatcggaa tgctcgagga agcaaaggga acatgagaag      5940
     aagaggtagg gttaagggct tgcacaaaac ttaaagcaaa tttgatggtc taaaaatcga      6000
     atgatataag gtgggatttt atattagaag aggtataggc atcaaagaaa aaaaattggt      6060
     aaattttgta ctcgtagcta gtactggttc caaaatttaa ctgtcaaggc aagtacaagg      6120
     gaggtcgggg aggatgattg ggttgggtag agcggccaca ctattgcgga atttcgcgag      6180
     gccaagtgag ggtacaccag gacaccaggt actacaccag tactgggtct cacggcatct      6240
     cgcatcgcga tcagcggtca aatcccacac acacgccgta ggatccagtc aatggagaga      6300
     ggaaaagaaa accaaccaac acaacaacac agaaaagctt cgccaagtga atcacccaaa      6360
     aaaaaaaaac tcctctctac gactctacca acacgccgcc gtcgccggct cgctcgctcg      6420
     ctgcccatat atacgcgcgc ctcgcgtctc cacttcccct gctattacta ctagtacaaa      6480
     accaacgcga agctctcgtc gcgcacaacc aactcgacac cgcggcgagg cgaaccaacg      6540
     cgcggcgtgg gcatggggag gtcgccatgc tgcgagaagg cgcacacgaa caagggggcg      6600
     tggacgaagg aggaggacca gcggctgatc gcctacatca aggcgcacgg cgagggttgc      6660
     tggcggtcgc tgcccaaggc ggcggggctc ctccgctgcg gcaagagctg ccgcctccgc      6720
     tggatgaact acctccgccc cgacctcaag cgcggcaact tcaccgacga cgacgacgag      6780
     ctcatcatca agctccacgc ccttctcggc aacaagtaag ttgtaaacgg atttcaatgc      6840
     gctgtcatct gttcttgtgt tcttggtgct gatcgatcgt ttggttggtt ggcgcaggtg      6900
     gtcgttgatt gcggggcagc tgccggggag gacggacaac gagatcaaga actactggaa      6960
     cacgcacatc aagcgcaagc tcctgagccg gggcatcgac ccgcagacgc accggccggt      7020
     cagcgccggg agcagcgccg ccgcggcgag cgggctgacc acgacggcca gcaccgccgc      7080
     ctttccgtcc cttgcgccgg cgccgccgcc gcagcagcac aggctacaca acccggtgca      7140
     cgccgcggcg ccgagcaatg cgagcttcgc caggtccgcg gcgtccccgc cgtcggagga      7200
     cggccacagc agcagcggcg gcagctcgga cgcgccgcgg tgccccgacc tcaacctcga      7260
     cctcgacctc gacctgtcca tgagcctgcc gagctcgccg cccaagacgc cggccgccgc      7320
     gtcgtccacg accgcgtcgc gccaccatca ccaccagcag cagaagacca tctgcctctg      7380
     ctaccacctc ggcgtccgca acggcgacgt ctgcagctgc aaggcggccg cgccatcgcc      7440
     ggccggccca cgcgcgttcc ggtttctcag gccactggag gagggccagt acatatagca      7500
     cagcaggctt tagggaaaaa aaacctgtaa aaaacacaaa aaaaaacggt gggcaataga      7560
     gttttttcta agttctaatg gagatgactg atgttgatta gtttgattct tgatgtttat      7620
     cattaaccaa aaatctgatt cttttcctct tcccaatttt ctgatttgat ttagcagaat      7680
     cttacaaaaa gtaattggag atcataaaac aaaactaaaa tggaaattat aatgagcgag      7740
     actgtgagaa aatataaagt attgctgggt tgcgcatcca gttcgggcgt cccaagtgcc      7800
     gtttgtgtca tttgggacat atcgcgagaa tacagcatgt ggtgtgtttt cggtaggtag      7860
     gtacaaacta ctcctgcttg ggttatccga tagcaaataa aatccattaa tgactcatgg      7920
     tggttaggca ccggagaaag tgagactgac aatgttacat tttggtgtta aggtttggct      7980
     gttcgtttaa caatgacaac gacatgagat tctaaacgtg gtgatatata gtggtagtta      8040
     gccaaccaac cttagaaacc tatattggtg gtggtaacta aaatttactt ttgtttctat      8100
     tggaatagca tgccttaaaa aatactctct ctgtctcaaa atataatact tcctccatct      8160
     atttttgata gtcatatttc taaatctgaa aaatttattt ttgaatgaca tatttcaatc      8220
     caacaaccta tcatcttaat gattttcttg gatttaatgc gtgactctcc attcttccac      8280
     acaagattgg ctacatgggc atcgagaaat gtaaatatta atgaatcgct tatttacaaa      8340
     gaatgactag taacatattt aaatagatga taagtagaat tgcttatttt tggtctgtgt      8400
     gccaagatga aatatgactg tcaaaagtag atggagggag taacttgtag ctctcaagat      8460
     ttatcctaaa atataacaat atctccacca acattatctt cccaactaat cacaactctc      8520
     taccattcac ttctacctac tttcttaata accgtgtcta actctaaaac ttcttagagc      8580
     aggtacaaaa gtaaactatt agccagctgc aaacatattt taatgagata aaagatgagt      8640
     gagaagagca gcgggctaca gatctatagc cagttgcagc acggactcca agacgcaatg      8700
     tgtgtatgac atgggggact atatattaat agtatagtaa gcaactatta tatgaattgg      8760
     ctataaatga attggaggca gtagtaggct atattattaa acttgctctt atattatagg      8820
     acggatggag taggcagcaa catcatactc cctccatact cattaaggag gtcgtttagg      8880
     acagcgacac ggtcttcaaa acacaattga cttcttgttt ctataaaaat atttattgaa      8940
     aagtgatata tttatatttt tatgaaagta tttttcaaga caaatctata catataattt      9000
     ttacattttc aaactcaaca gcttgagagt tatttatgat ttatattccc aaggttcgac      9060
     ttaaacattg tgataaacga ttttttttat gagtacggag ggagtatttc taaaataaac      9120
     aattaaaatc gggtataggt tggtcagtac agagcatcaa ttatgttgca tatctgtttt      9180
     ccatctgata tataaaaaga aacaattata catgtttttg gctagaaaag atttcgttca      9240
     caagtaatac taataagaaa gctataaaaa gagccattat atttgagcaa aatggctcct      9300
     tctcgttaat tgctaccatc gataatcttg atagggtgtt tgatatagtt ggtaggaaat      9360
     gtccaaacta cgtatctctc tcatctctca ctattctttt tctcaaattt agccatagtc      9420
     ttaccaaaac ccatatcttg tgctttctct gtcaaaaaat attgcaactt aggatagagt      9480
     ttatattcct attcatattc tatgtttcaa tatttttaga tagaggtagt aacattttat      9540
     agtagtttcc tgagcaatat gtactttatg tagataatac atggaagtct ggaaccaaga      9600
     gatcgatata aagtcttggc atgcttggcc taatgtgtct catgaaacac atggcttatg      9660
     gaaaatagct gaataatcat tcgaaacttc ttatgttttt gttacttttg tcaaaactac      9720
     gaaaaggagt tccttgcagg taagttcgac atggacatgg atatgtttat tcttctcgtg      9780
     actatggata tccactcgat taccctgagt ccctgatcca ctctttctgc gctaatgttt      9840
     gagggtatct ggtttaattt tctactttgt caaatgaatc aaaagaaatt aggcaacttt      9900
     taacatgacg aggcaattcg ttgattcata accgattttt ttgttcggca acttcttaat      9960
     actgcagccc aatgtggcga atacttagcc aaacacgtgc ttattttttt ccgagctggc     10020
     atgtgtcaag tacccagtgg atcttcttag ttttgggaag atggaccaac tccacagata     10080
     cctggaagtt tcgtgtcaga tttgtagtgt gacacctgaa gcaggaaaga ttgattatgg     10140
     agtccccatc tttaaattcc attaattata gtaatgctag tatgtgtcaa tgtgtgtaag     10200
     gtcaatgttt gattcatttg ccatcatatt tgaaacgaga atatttgaag tcagacgccg     10260
     aatcgattgc ccccaataca aaaacggtca gagcatagat gatggtccgt ggccggcgac     10320
     acgtatgctg tccgtctcgt gactttacca accacctgta ccttgttgct gctgctcgtt     10380
     acgcttcctt gttgcaagta cgcgaaatga tctgtcagtg tgatctctct cgtggcgcgg     10440
     ctgcaatgtg aacctacgaa caagggagat gattgcctga ttacctcgtt ccggattcag     10500
     ctaaaaacgt ggttttcaag actatatgct gttgacaaaa gagtgcagaa actaaaactg     10560
     tatagtcatg ttactacctc acgaacccgt aaaatctgca agcttccttt ccagatcagt     10620
     ggactttcat ggctaccggg aggatttttc tctcgaggtt ccgtaccatc tactcccaca     10680
     aaccacaagt tgtttgcata tactcatcac gggttaacta accaaggggg cacacgttct     10740
     tttccgacgt tttttttatt cttctccccc ttgttcttct ccatgtttat ctgcagcaac     10800
     aagctgtaga taccgtcaca agtgcgtgac agattccgtt acgtgacctc atgggataac     10860
     tccctgtacc aaaccgcttt ttttcttcct tttttttttt tttgccttca ccaaaagtca     10920
     tcgtcgtcat cgccttgttt gcccatgatg gcttacgtac gcctcggtgg cgaccggcgc     10980
     cccggggttc ctcgcgccgt ggcgcgtctc tcgccacgta cgtctcgtcg atcgcgcccc     11040
     gcggaaactt tgagagattt tacgttctct ccctagccgg aatcggctgt cgccgtcggg     11100
     cgcggctagc gatcgagaga taccatcgcg gagatggcag tggcacgcgc gagccgcaag     11160
     gtggatttgg atgagggggg aaacgtgtgc gcgaatgcgc gatcgcggca aaagctgcgg     11220
     cgcagtgcgt gacacatgcg cgataatcgt tggagactgg ctggccggtg ctgtgcgcga     11280
     gcgggatcgt gaaaggtttc cgcgtgttac aaaagttagt tgtagttgat acgttgaaac     11340
     gacgactaac ctttctaatc attttagtca ttaatcacca aacatatatt agacgaagac     11400
     atacgttgtt tagataataa aatgacaaca cacgttatat atcgttaata aatattgtgt     11460
     gttttatatc atcatctgac gtgttttagg tgatcaatga ctaaagtgat ggggaagatg     11520
     aactgtcgtt ccggactaac ttctccaaca tcgcagaaat cgtctcttct accgttcacc     11580
     gccgtccgga atgcgtaatc cttgcttgaa ccgaactgaa aaacgtcgcc cgtcatccga     11640
     ccgaagggac ccaaggtttg gtatcttcgt ttgaactttt ggcatgcttt tatgtcttat     11700
     gctaacagaa gatagccatc gcgtcgaatc aagaaaccaa aaatatcggc tcatggtggg     11760
     ctaataccaa aaccgctacc accacagtac tactacctag tatttagtat cacttgactg     11820
     tcaagacatg aaagcaggaa cagcgactca tcctcggggg gtgatctgat ctcatctcat     11880
     ctctaggccg gcagcaagtg gtactactaa ctgatgcgac cccacgcgga ggcgcaaagt     11940
     gctgctcctt gtgctgctgg gcgtcgtggc gccgtgaatc cccacacaaa acaccgttca     12000
     aatcagcgag cttttagctt tggaggcgat cgcatctgtg tgctgtgcgt ggggggaaaa     12060
     gaacaacgtg ggatcgatgt ggttgttgct ggttggtggg gcgatgacat caccgacgac     12120
     cgcctcgcac cggcgcgccg cacctaaccg ggcaatccac cggtggatcc atcgaaatcg     12180
     cgagctgtag ctgttcccgg cacgcgttcg gccttgggcc ccggcccccg cgacggcacg     12240
     cgatttccgg gtcgcgtttg gccttggcac gctgtaactt ggaaaaagaa aaccggccac     12300
     ttgggcacgg atgatgcatg catggatgga ggagtagtga tctaatgatc taatccatat     12360
     cgccaaccta atcgtcatct tcttgatgaa ggccgcaact ggctaattag ctcgtgacag     12420
     gaaagaatgt tcagataaca ggtgatagat gcgagaaggg tccagcaggt catcaggttt     12480
     gcaagtttgt tttctccagc tcagtttgta atttggtcga gaattatatg tcgagtttat     12540
     catcagttta ataaatgtcc tttgaacata gtacagtggc cggtcgggcc aagaaaactg     12600
     gctttcgaaa cgaattgctt cacgctggtg ccgaggcaaa gcatcatggt catggaaagg     12660
     tgcctgcccg gctgtcctac tgcgtttgtg ttgtttcttg atggatggat catgatcact     12720
     cccttttcag tttagaatca tacgtgcagg cgtccgagaa gagaatttag ttctttgatt     12780
     agtttaggcc ttttcaaata ctgcacagta ctagtttcca cacaaactga tggagttggc     12840
     agcaccaatg tcaaaaagga agtctatgca ctttgatagt atccgttttt tcatatttaa     12900
     ggataatctc tgtcttgatc aatcattgac tgaaaaaaca aaggtgaaag gatcattagt     12960
     actagctttc taataaaatc agctaataaa gctcccaagt cgacgtgtgc atgcttaaca     13020
     gaaacaaaat cagctaaaag cacttcttgt ttaatagagg ttggtcatac ctactcctac     13080
     cattttgccc aaacagtgag ctgtggtagg ccataagccc atgataagca gcctgtcctc     13140
     ttctccgcat cttcctggtc atgtgacttt gggacctctt ctcagaagtt tcaacattct     13200
     ttaatcacaa ccgccagtga gttaatggca gatggcaaca aacagaattt gggcttaact     13260
     gaaggcattt ggttgcagag gtaagccatg tgctttgaag ggggcaaaac cggcaaagac     13320
     tatgctgaaa ccaggctaac ctgctgatat ctgaccattt ttagagtgtt tgatactcct     13380
     acttgactgt catttgcagc gacggtccat ttggacaaag aaatgctcct agagtgtttg     13440
     actacttgtt gtaggagtat gtatgtaact gtataagaat gtgcaactgc agatcttgtg     13500
     gaagctggaa caaataataa ggcgtggaat tggccgtctt gcttctgcat tacaggaata     13560
     tggaggccgt tacagcgtcg acaacagaca ctttgcagcg acatctgcaa tgtcccatga     13620
     caagtggaag aacacactgt agaaattcct gtgatgaagg ctccagactg gagtactctg     13680
     ttaaaaaaaa agccaaatta ggtgaggatt ttacatcaca tagtacaact aatcaggata     13740
     taaggttgtc cagttttgtt gtttcagact ttcaggtgat atcaaatccc catgtaaagt     13800
     cccttttgat tcgtagcaat gaaaaaaaat gaaggaacag aaaaagacgt gattctgaca     13860
     ggaatataag tgtaaaatag ggagattgca aaacacagaa aaaacataaa aatgatcgtt     13920
     taattgagcc gtaggaaaaa tataagaatc aaataagaga gataaactca aagatttttt     13980
     ttttcaaaag gttggacctc ttgcaatgaa ccattccaca ggaattactt agaatttgga     14040
     aaactccaat cttttgattc aaatagaaaa aattttaata ggatttcaat cgtataaaat     14100
     tcctctgtaa attcttagat tcaaatgggt ctaaattgtt ttttctgtga tggagcgagt     14160
     atagaccagt cggagtcaac aagtcagctt gcagttagcg gcatttaatc ggaccagtcc     14220
     taaaattcca acgtttcacc ggcattgtgc agtgcagcgc tgtgtcgcag agggagcata     14280
     tcaaatcctt cttggaggtg ctatactgcg atgcagcagc ggcccctctt caaaagttca     14340
     aacctgatga gatgggagtg ctgtgccagc atttatttcc tctgtttaca aaatcaaatc     14400
     agtatagaac gtgacatatt taaatacaat gagccctctt tgattcaaag gaaattcata     14460
     taaattttag aggatttcat tcctatagga attttttcta tatatccctt tgaatcaaag     14520
     taatggattt tatagaatcc tatgaaattc ctatggattg cctaatgcca tgcaagtttt     14580
     ggaggaattc taacatgagg taaaacctct tgaaaacttt tctttgagtc tttatctctc     14640
     ttctaattcc tgtttttttc ctgcggtcca atcaaacgac cattcctgta ttttgcaatc     14700
     atctgtttta cacttacatt cctatcaaaa tcctgcgttt tttctattcc tatattttct     14760
     catttctgcg attcaaaggg gccttcaatc tgaatagata tgttcagatt catagtacta     14820
     ggatgtatca catccagtac attgattttt tatgggacga agggagtagt atggttctca     14880
     tcagacaaga aacacttagg ccccctttga ttcaaaggaa attcatagga attttaaagt     14940
     atttcatttc tataggaatt tttcctatat agccatttga atcaaaggaa tgaatcctat     15000
     agaatcctat gaaattccta tgaaacgcct ctttccatgc aagttttgga ggaaatttag     15060
     catgaggtag aacctcatgt taagaatcct ttgattcttt atctctcctc aaattcatat     15120
     atttttccta cggctcaatc aaacggtcat tcttatgttt ttcctgtgtt ttgtaattct     15180
     ctgttttaca cttgtattct tgtgagaatc atatgttttt cctattcctc cgaattttca     15240
     ttcatgtgaa gtactccctc catccaaaaa aaagacaaac cctaggtttc cgtgtccaac     15300
     tttgactgtc cgtcttatat gaattttttt tataattcgt attttcattg ttgttagatg     15360
     ataaaacatg attaatattt tatgcgtgac ttgtcttttt aatttttttc ataatttttt     15420
     caaataaaac ggagggtcaa acgttaaaca cagaaaccag gtttgtcttt ttttttattt     15480
     ttgagacgga gggagtagga gtaaaatggg actttggaag tagaggtaaa atggtcagat     15540
     gctcgaaaag ctgggacatc ataggtagag tctgccaaaa agagtgggct agtactcttt     15600
     tgacgcactc cagtcctttg gtgtcagttg gaccggtatg tataggagct ggtacaccat     15660
     ggtagaatga cacccattta ttccttttca gtttatggaa aaggctgtgt ttagttagcg     15720
     aaaaaagttg aaagtttaga ctgtatttag ttcgttgaaa gtttgagaaa agttgaaagt     15780
     ttgaaaaaaa atttagaagt ttatgtgtac ataaaagttt tagatgtgat aaaaagttgg     15840
     aagtttgggg tagttagggt gaactaaaca cggccaaaaa aaacttctat tacatgttac     15900
     ctccttcaaa aaaacgaatt tagaatagga tgtataaaca caccctacag aaactaggtg     15960
     ccgtgtgaat acattttctt ttttcttttg ttgaagacgt gaatactttt gtcttggcaa     16020
     aatgcaaaca aactaatgag tagaccgtat ggttttcaga cttcaggcta gtatgccctt     16080
     tctactcctt ccatgtttct cactatcctt gccgtgccaa tgtggtcact gtctatggca     16140
     tgtgcggacg tgccgattaa ccgggccaca gtgccatttt gttaactgaa tcaggtcggc     16200
     gcgatataaa gtcttgctct ccccatggat tcacggtaca gcgatggctc cacgtcgccg     16260
     tcgtttcgtg ccacgcgacg cgacacgcat cgccggctgc taacctcgag attgccttgg     16320
     ccgcggtcag ctctccagct gctttcagtt taatcctgca aattttcgtc ggggtgtggt     16380
     gcagccgtgc aggttaggtt cgcgggaaca tgccctcatt gactcttgcg agtatcatgg     16440
     cactgtgtgt tttctacaca tgtgtttcta ttgtcgtttc cgtgtctgga taccagctcg     16500
     ttgcttgact tgctaggatc ccttcttgtc tgctggttga ggcagggaaa gatgccacca     16560
     agttttgcct accggagtac tcctatactg taccttgtca aacctactgt ctgacgacaa     16620
     cgtcgttgtt atgtactccg cgtcagtagt gctggtgcac aacgctctgc tcctttcgtc     16680
     aaataccgac ctgtttttat tcctcacggc agggaacgga gcagtaatgg tccagtacag     16740
     tgttgcattg actcccttga aaacttggac gagcccgtga cctcgcgtga cgctgacggc     16800
     tgaaacctgc aggctttggg cacgccgccc ttgaaccaat ctccgttatt ccccatgaga     16860
     aaaagattag aggtgattta ttctacactt attatggagt gaaattattc tcctcaatta     16920
     tctcctctcc aaatcgaacc aggccaattt aagtactacc ttgtattagt cgtattcgta     16980
     cagtactcct gtataatacg gagtacgggt aagtagcacg cgtactcgcg gcctgcatcc     17040
     tcttcgggct ttggtgcatc ctcttcggcc tgcatcctcg cgtaccaata tgtggcctgc     17100
     tggaccacac acggacctag caatcacagt gcagaccaat tattgtgggc cgcatattgg     17160
     tcacaaggcc gacaaataat acggccctca agtaagtagc aatgcggaga gacaccgttg     17220
     tttacgggct cttcatgccg ctggaaatct ggtccgaact gaaggtgagg ggttgggcca     17280
     caagacggcg gcgtaactcg gtaattgagc tttcgagagg gtggcgatgt acgtttgggc     17340
     tgtgtgattt acacaagaca gtttttcctt tttaggagaa aggctttgtg tacttggcga     17400
     gtgggctgga tttccaccgg tggtttcctt ttgtttttgc cttttttttt ttatcatggt     17460
     gtccttttgt tttttttggg aataagttta ttttagatcc cttaacttga cagcaacttc     17520
     gattttcgtc cttgaagaaa aaacaagtac aacgggaccc accgttgtca aaattggtgc     17580
     aatataggtt ccatgacagt atagtgggtg ttttttatct gatgtggcaa tttgacccga     17640
     gtcaaccgtg ccgagtcaat gtgggtccca cattggccac agttcagttg ttggaggact     17700
     tggagctgga gtaggccaat tgcgtcgttg tgggcggttg cggcgaaagg ttgggacatc     17760
     gggcggcggc gagctcactc gtgacaggcg gaggtgatgg cacgttcact agtagaggtg     17820
     gggacgactt cacaggtgtt tgggtcgatg tcagtggagg cggtgaaggc gtcactagag     17880
     aaggacaacg tgcaatgagg tggacgacaa ccggcatcca tgaaccgttg tgccccctac     17940
     tccagcggcc accacggtcg cctcactcca gcaactcctc cgctagtcct cgctcccgcc     18000
     gcatctcatc gctgacaagc tctcttcatc ctcctcctct gtgtggccga cacagtggca     18060
     atggggatat ggggttgcgc cattgtgtgg gagattgtga cgagacaagc caacgatgac     18120
     gacgtcaggc gcgaggaaga tgacgacgtc ggagaggaac gatagcgaga gaggggccta     18180
     cagccaccgc cagcctagcc gccaccgggg accagcttcg tctagggcga tgctgacatc     18240
     ctccccctcc ccgacaagcg tccctcaacc ctgcttcatc ggctggcggg attggactca     18300
     taaaaagaag gggagagaaa agggcaaagt gaaagagaga gggggaagaa caagctaggg     18360
     gaaccctgac atgtaaggcc cacgctgatt tagattgcca catcggacga aatcaaatcg     18420
     aactgactgt caagttaagg gacctaaaat aaacttattc ctttgttttc cgtaacacgt     18480
     atgtgcaact ggttcttcta gtttgcagtt tgagacaact caaaagctta gaagtccgag     18540
     tacagcggaa atagaaatat gaacagagga acaatcgtat gcaaacatag gtgatgttct     18600
     tttctttttt tttcttttga agataaagat gagaataaag attaagtttt tttactaaaa     18660
     caatatggta ttaacatatg attgattgag ttttaattat tataaacttg aaaaatatat     18720
     tattatgata ttttagagca actttcatat agaaagtttt cacacgaagc gcaccgttta     18780
     gcagtttgaa aagtgtgcca cgaaaatttt tatcctcact tttgttggag aaaaaaaaga     18840
     cctatgaaaa gaaaagtata tgaaattgtg cagccttgtt gcaggtgtta atatcgcatc     18900
     aggcactggc agtacagcta ctccatacca tgaccgtttc ccatctatga ttatcccata     18960
     aatatatgca tgtcaagttg acatttgaca acccaagttt gttcccaccc aacgcggacc     19020
     aatcaaataa ggccatgttt aattcgcgaa atgaaaattt ttagatgtta cattgggcgt     19080
     ttgattcgat gttggaaggg gttttcggac acgaataaaa atactaattt cataactcgt     19140
     ctgaaaaccg cgagacgaat ttattaagcc taattaatcc gtcattagca catatgggtt     19200
     actgtagcac ttatggctaa ttatagacta attaggctca aaagattcat ctcgcgattt     19260
     ccatacaaac tgtgcaatta gttttttatt ttatatctaa tgttctatgt atgtgtctag     19320
     agattcgatg tgattttttt ttaaaaaaat tggaaactaa acaaagcaac aagacataaa     19380
     caaaggcaga acaaaagaaa gctacgccag gtcgctcgac tccatggctg tgtaagaggt     19440
     cgaatttatc ctattttcta aaagaaagaa gatcaacttc gacaagttga tatgtggtag     19500
     gaccctagtt atcaacggat caaccctaca cagatcacct cgaccaatcg ataagtccga     19560
     cgacacggca acacggctac ttgttcccag actggcacga cgactgtata atatatgcga     19620
     ccgtataacg tgcgtaattg atgctcaatt cggcgaggaa acagaagaaa aaaaagaaac     19680
     aaaaacgaat ggaatccaga tgggataccg atcatgtgcc ggccgtataa tcttcagact     19740
     tgaggacaaa cacgacacat gaacacagag acgttagagg caccatgcat ctccaggtcc     19800
     cacgttttca ggaatccaat cagggatggc cgagtcagtc agtagtggag gtcacatttt     19860
     cagtttcagg ttagagactt cattttattt ttcttttcat tttgattagt tgaggtagtt     19920
     cagtgctcaa ttaagtcatt tacgattaaa ttaactatgc atcaactact actaatctat     19980
     caccaattgg agctttggaa aaggagagga aatgctagta cgatatcgaa gaatgatgtg     20040
     gtcaggttgg taatggttgt ctacagaaaa gaaaagagaa aagaaaacga aaagggttgg     20100
     tgatggtttg tctgtcccag ccatgagcga gctgtacacc gcctaatcac acctccaaac     20160
     accggtttaa ttcaatcgtt gtcccaatca atcatcctgg gggaccttaa ttgcagcatt     20220
     ggtttatgcc tggatcaatc atcgatccat tttctctgta ttagttggga gctaatccat     20280
     ctcatcttgg gacttaattt ggagcaaagc tccaaaaata tattccatgc atggggtatt     20340
     atattattga attgtgctac tgcaaatgag gccatttttc tgagcatgga actgaaacca     20400
     tcatgtagaa ggggacctgg ctcttttatg gataccaatg gttgatcaca tcctacaggt     20460
     gcccgtgtca cccccggaaa tgagggatta gctttgctaa ttaggtgttg cttttggtgg     20520
     tacgacattg ttgccgtgca tgcaggtaag cgtcgtggaa atgaatgcgc tgagttagtg     20580
     gcatgcatat gcatatgtac tgcaaaatgc tagtatatat ttttgtatat gatgattgtt     20640
     cagttgccaa ccaacagttg gttgcataaa gaacagtaca tgatatgaca ctgacacgcg     20700
     agattgcagt tagattttcg gttcgatggg ttgtcacaga gattccgttt agtttaggcg     20760
     ttgtcaaatg ttctagttct accaacatta ttcccctttt atttgaggtt tcaatgtctg     20820
     aatgtctgaa tgcgtgcttc aaaattgccc atgtttgtgc cgttgatttg gtagaggaat     20880
     tcgcatcggt tgtgacgaag aaaacatggt cgagatggtt aaaacgacaa taggatccgg     20940
     tagccttgat ccgtcggttt catagaaaat gaccacgtgg aacttaggga aatacggatc     21000
     atcctccaac gtctagatca gcagcggctt tgcataggat tctcatggcg aagagatacc     21060
     ttctctgttt ctttaccagg tgagaaaaaa ataaaggtac ataggatccg tgcaagtttc     21120
     ggtcatgcat ttgacatgtc agtgagccag tcttacatgt acaaagatgg gttttctgcc     21180
     tctaaaaata cagttctatt tcgtcagttg cagagatagc agccaatcgg actgcaataa     21240
     gacgcctggt cggttgccca acgggcggtg aagtgaatct cctccatgaa agtatccatg     21300
     tgatcgaata gaaacagatt tgtcgattgg gtatttggat tctttttaaa gatgatattt     21360
     gaactagtga cagtagtaga tagagagtcg aaccaaattt gtgaagtcta gatgaaactc     21420
     aatacagtta ttacatgcct attctatttc gcactcctgg ggagtatggc tgtatgggtg     21480
     actgcctaga gtgatggcgt acattagaca tccaatgtta gagactcaga ggtcactaga     21540
     tcagtacatt ggacgaacag gtttcattag caacttggtt agttggtctc catccgaacg     21600
     tgttgaaata ttacagtgaa atatctaaag tagtgaaaac actaatgttt ctccaatcct     21660
     gattgagcca cgttatccgt tcactatgaa tattacattg gagtatgcat atgcatgcgt     21720
     tctatataat tcaacaaata ttaagttcat ttccaacgtt aacttttaaa tcgtatgaat     21780
     acatataaaa aatttacccc taaactactt ttcattgatt cggttttttt ttcagccttg     21840
     gagcaacgat gacgctgcat gtgatggagg gaggacggaa atttcgagcg gtagagtcgg     21900
     gtaagattgg ctaaacctga ttgcgacttg ctaatacaat atttcttggg tctcgtcttc     21960
     gtttccttct ctttggccga gtcactaaca ccagtggcgc taaagtctgc agctgcagag     22020
     actatggcac actgtcttgg gttaaaatat catggcacct agacacctgt ttccaaagtt     22080
     aagatcttag gaagaatcca agatggttta gaaaacgcta attataagaa aaaaaaaccg     22140
     ttctttctag aactcatctg cttgtcctgt gcgatggatc gagatgagat gacggagagt     22200
     ttctgatcga tcgatgtggc cctgcatttc tggtgaacac caatggatgc ctggcaactc     22260
     tactggagtg cttccaaaat ggtgttgaca agaatacgtt gattagttca tgtttgcttt     22320
     cttaatcgag atcagatcac agagctttcg atccgttagg tacaaagcat gctgagcata     22380
     actctatggc cgtcatttga actgaacttt aaaactgaac agacagtcag atttgcaata     22440
     tattcaacca tgccaagtta tgctagctct gaattcctat tgcttcttca gctgaaaata     22500
     aatcagatct ctctcctgag aaattcagct atcagggacc tgcagcatgt aaggctgcgt     22560
     ttgttccttc agtatgatac gtaaaacgaa aagctcatca acatataatt gattaaatat     22620
     taattataac aaacttaaaa atttatttga ttattcaaaa agttatatag atttttttaa     22680
     aatatattgt tttatagttt aaaaacgtgt taacaggaaa cgagaaaatt atactacgga     22740
     gttgaaaaaa aagaacatgc actaaatcct ccttattcca atataaatct aatcgtatgc     22800
     attcaaaact acatttcagt ttttgtattt tgtagtttct atcagcattg gattctgcta     22860
     aagtgctata aatcggcagc ccccttccga tttccgccgt ccatttcatt tttacccaaa     22920
     gaaacaaaaa aaagtacaaa cagaaattct taaaaaaaaa cccagcaaat aacacgtcat     22980
     taaacggaaa ctaatccgtt acatgacgtg ggccccaccc agccgcgcca gcccacctat     23040
     tcgttcggct tctcccccgc ccccgccgcc cgcctcgttc gcttctctct tccccttcct     23100
     tccattccag ctagcaaccg caagtccgca acgcgagaaa cgcaggcagc aaagcaagcg     23160
     aacccaaagc tggcctcgca ctcacactga cagccttgct ctcctcctcc ccctatatct     23220
     ctcctccctc cctcgccgcc tcctccccaa tcctccaaac cctaatcccc cacctcactc     23280
     tctctcgatc tcgtgctctc ctcctttcgc gagcgcgttc tttggagggg agatggcgga     23340
     ggagccacag ccagaggccg cgcccgccgc ggtggcggcg acgaccgagg tggcggtggc     23400
     ggagaaggcg cccgtggagg cggagaagga gaagaaggtg gaggaggaga cgccggcggt     23460
     ggaggccgag gcgaaggagg agaagaagga tgaggcggcg gcggcggcgg cggcgggagg     23520
     tgatgaggcc ggggcgatag aggggaccgg atcgttcaag gaggagagca acctggtggc     23580
     ggacttgcct gacccggaga agaaggcgct cgatgagttc aagcagctga tcgccgccgc     23640
     cctcgccgcc tgtgagttca atctgcctcc ccctccgccg cctcccaagg cgaaggttga     23700
     agccgccgtt gaggagacca aggcggagga gaccaaggcc gaggaggaac ccaaggctga     23760
     ggagccggcc aaggaggagg agcccaaggc cgaggtggcg gcggcggcgg cggcgccgcc     23820
     ggaggcagga accgaggagc cgaaggcgga ggcgtcgtcc gaagaggcca agaccgagga     23880
     gccgaaggcc gaggcggcgg ccgacgagcc ggccaaggag gagtccaaag ctgaggcggc     23940
     gccggctgag gaagccaagc cggccgagcc ggagccggag gagaagaccg tcgtggtcac     24000
     cgaggaagag gcggccacca agacggtgga agcgatcgag gaaaccgtcg tgcccgctgc     24060
     tgctgcgcct gctgccgccg ccacggagga agccgcggcg ccggaaccgg aggtgcaggc     24120
     ggcggcggcg cctgagcccg tgttgatctg gggcgtgccc ctggtaggcg acgacgagcg     24180
     caccgacacg gtgctcctca agttcctgcg cgcgcgcgag ttcaaggtga aggaggccat     24240
     ggcgatgctc aggtcggccg tgctgtggcg caagcgcttc ggcatcgagt ccctcctcga     24300
     cgccgacctc gccctgccgg agctcgacag cgtggtgttc taccgcggcg ccgaccgcga     24360
     gggccacccc gtgtgctaca acgtctacgg cgaattccag gacaaggacc tgtacgagaa     24420
     ggcattcggc gacgaggaga agcgggagcg cttcctcaag tggcgcatcc agctgctgga     24480
     gcgcggcatc ctgtcgcagc tcgacttctc gcccagtggc atctgctcca tggttcaggt     24540
     cacagacctc aagaactcgc cacctatgct cggcaagcac cgcgccgtca cccgccaggc     24600
     cgttgctctg ctccaggaca actaccccga gttcatcgcc aagaaggtac taatgatttc     24660
     actgccattg attagtgcta tttgcgtagc tatttctttg caactgaagc aattttagag     24720
     tagctatttg tgtttgtagg attcaattct taattaatgc atttgtagtt taacgttgca     24780
     agtgaatgat tgggctaaaa ctttgttctt taggcaatgt gataaaggtt ggaactttta     24840
     gggtgtcact gctagctctt ttgcaccaat tttagtactg gcctgagttg actgttgtct     24900
     tttggcgtgt gctttgttgt taatcatagc gcgagctggg atcttttcct tttgttctat     24960
     ctttttctgg tacgatcaga tgagggagtt ctgtaaggct gttaatatac caatttgtag     25020
     ttcattccaa tagtttcagt taatgaaatg tgatcaaatg tttttggttg ggtcatggtg     25080
     tgcaggtgtt catcaatgtg ccatggtggt atctcgctgc caacaaaatg atgagcccgt     25140
     tcctcacgca gcgtaccaag agcaagttca tttttgccag cccagccaaa tcagctgaga     25200
     ccctcttcag gttttgcaca cagaaaccat tgagaatcaa tgcttttggt attttcgatc     25260
     ttccaagttt aatttgctca tgtattgcta tctaaacgca gatatatcgc accagagcaa     25320
     gtccctgtcc aattcggagg tctcttcaag gaagatgatc ctgagttcac cacctcagac     25380
     gccgttaccg agctcactat caaaccttca tcgaaagaaa ccgttgagat tcctgtcact     25440
     gaggttggtc cttgtgtacg tgccaaatta cctagaacaa tctttagatg cactgatcgc     25500
     tgatactgat tatttcccta tatatgaaat ttgcaacctt tgtagaattc cacgattgga     25560
     tgggagctcc gggtgcttgg atgggaggtg agctacggag cagagttcac tcctgatgcc     25620
     gagggtggat acacagtcat cgtgcagaaa acgaggaagg tgcctgcaaa tgaggaacca     25680
     atcatgaaag gcagcttcaa ggttggcgag ccaggaaaga ttgtgctaac gatcaacaac     25740
     cctgcatcaa agaagaagaa gctcctctac agatccaagg tcaagagcac cagtgagtcc     25800
     gtttgaggtt gcagctgcct gatcaccaga ttcaccacaa tggcagctga actcattccc     25860
     tgatggaaga gaaacctttt ggttttggtt ctttaattta ttggttttgc tgttttggtt     25920
     cacattttgt atttgtttaa ttaaaaacca aagtgagctt gtttttgtga tagttggaag     25980
     gagagggttg atatgatata atgacatcgt gatggtttgt tgagggcaga ggacaaaaat     26040
     tgtggaagga ctgaagaata tctgctgctt tgtatatctg tctgtacatt gcatctctgg     26100
     attctcatgg acatgttaaa tttagaagta cttgtcatca ttcaccaatc catgttaccc     26160
     tttatatttc tcctcttaat ttccttgtct ctcagaatct gagggaatta tataatcttg     26220
     atttccattc tctaaccttt tgcttgccca tttcctgcaa gtaaggatca attgcaaaat     26280
     gatcatggtt tcacttgcaa aatgagaact accctccatc catttctttt ctgtatctcc     26340
     tgttgactga aaagaaaaca tgttttttga cttctccctt ttgtaaatta cttactgcct     26400
     gacttgcctt aaacgaacaa acagcatgag gacaagatgt gcaggccaag caggaaagcg     26460
     attaggcatc ttccaggtgt ttgtgctgct aatgatggcc ataaactaag cgtgggtgga     26520
     gcaacatcca gaaccttgtt ccaaggctgt catcgtgtcc ctcaaaacaa tccgccagcg     26580
     ccaatcagcc acaggagaaa cagctgttgc agataaacaa ggcaaaagaa caatgcagca     26640
     gtgcaagaaa ctctctcctc tcctcctttg accacgacag caaaggaaag aataaaaaaa     26700
     acatagggcc aaaaggcctc atatccagtt tggccatgtg cagtgcaagg gagctttgaa     26760
     aaaaattccc ttggaggacg agcagaagag agctttcagc tttgtgtgtg tgcgcccggg     26820
     cattccggcc agccatttcg acaggtttgg ttttgagtct caagtgttga caccctgtgt     26880
     gttgccctct tgtctttgct tgaaccaatg agactggcta gaggcaaagg tcccatacct     26940
     gcatggctgc atatggctgt gtttttaatg gcgagaggaa gaagaagaag acgacctgat     27000
     gattgatgat tagtggtggc aaggcaatgg catcgacatg caccatttgt catgtttgac     27060
     gtttgcgtgc ccatttattc agcggccaca ggacgtgtct ccggttgtaa gaaaggttgc     27120
     cagtatcaag atactactag gtagcatcgt tttgcttaaa tagtatcata tcgtagaatc     27180
     atatcggaat attatgagat tttctttttt tacgtttaat taatacttaa attaattgca     27240
     tatagccatt ctatataaaa aatatagtaa taatatatgt catgcaaata tagacattta     27300
     tcaagagaaa ccacgttggt tttgatatat ttaactgatt tctatataaa cttgagcata     27360
     tttatttaca ttatttttaa accatcttat tttaaataat attttgtagt atcgtaggga     27420
     tcgtacaatc gggatatcac ctaagatttc gtaggatcgt atagtaatga atagtaggat     27480
     cgagatacta tgaaatttag gatactatgt gggatcggta tcgttttcac atggtagaat     27540
     cgtagtatcg taatatacta ttataataat cgggatattg aaaaccttgt gtaagtaggg     27600
     actcgcccat atgccagaca gacagcacca tgagtttatt tcttcctccg tgtcaaccgg     27660
     ctgacggctg gcctcaacct cacctcgctt gaggagtact tcctcctttc aaaatgtaaa     27720
     gtggcccact ttacattttg aaaatgaaac ggagtgagtg ctactgatag gagttgagat     27780
     gagcacggtg gaagcctcag taattccgtc ctcgcgcgcg cgcatgtctg ggtccccgcc     27840
     ggcggcggcg gcggcggcgg agatcgctct cgcgtcgtgg gctaataaat tggaacgcga     27900
     cagagttgca acaaggcggt gggaagtgcg catccatggg ggcagttgga acgatacttg     27960
     gaccagtgac cagtccggat tgggctcgcc gcggtgcagg gaccagctat agctaagcca     28020
     gcgacaatct gggggccacc gattaggcgc cggtccacgg ccacggccgt ccagactgcc     28080
     gtacgtacac cggactcccc ctcccgtccc cgacgaggac atggtcggtg agacgctaat     28140
     agtaataact tttgaggtat tttgtagtac tacgttctca gtgacagtgc atttgagtag     28200
     cgggttgatg cgtttgcccg tacacggaca cagctcgtgc atgcgtgcgt gcgtgctgct     28260
     cgctcccaac tggcgtccgc gcggaccggt cacgccgcac gcgcaaccgg ggagacggac     28320
     ggacagagcg gcaaggcgga tctgacacgc gagcacgcgt gaggacggcg cgcgattaaa     28380
     acggctccga ttccttcctc cctcctgcgt tttttttggt cgttctccgc tgctcgtctc     28440
     gtcctcccgc gcgcgccgca gagggtatca tgtggccgcg gactcgcggt cctcctaacc     28500
     gggcgccggg cgcgtgaggc gacggggtcg cgcacgcatc tcgccttggg ctgggctggg     28560
     cttcgcttgc agctcgaacg tgttggtgtg tgctgcgggg ggtttcgtga ctgaggtgtc     28620
     cctgtcgttt ctccagttca gctacacgac ggatgccgcg gctccactcg ctggtgctgg     28680
     tcagtccagc caatgcttgc aggattgcgg ccgtgaatca cgcgcggcgt atcggcaatc     28740
     aaaagactcg tactcctact ctgccacgct gcccgcacgc gtacgcgatc cacagcgcgg     28800
     tcggtggcct gagcagtgta atcgtggatg ggattcctcc gtaacttggc gatgcaggta     28860
     aattaaacct gtgttggttg gtgaccccat atcgtgtggc tacaaagctg tttggtttat     28920
     gatttgtgca ggattaggcg tgtctggttt atgcttcgtg ctgcagcagc agcagcagca     28980
     tcggtgcttc gtcagttcaa cacaatgcct gacttgtgca atgtccagag agcatatgag     29040
     cagatccagt gctatgtcgt ctagagatta atgtgctcta gtaccttttt ttccccaaga     29100
     tatgacatga aagtcacaca gactgtttgc cagccggtcg gctgcgtgct tgcattgcac     29160
     cacaaacccg tactgttaat tgctaacaga tgtaaggtga gcagaagcca gcaattggca     29220
     atctggcatg acaaaggaga gcgtcgagtt atttcggctg ccatcaaaca caagagctaa     29280
     aaacacagca catgatgagg ataagtgagc cacttcattt caactatcag tagaccaggt     29340
     acaaccagat acatttgggt acccaaatct gccagccaga ccgccaacaa gtagcgtgtt     29400
     tcgcattatg cataggtgct aaaggagatg ttttcagtgc tactcctgct cccaattagg     29460
     caaccgcaat taggattagc actccatttg gcgaggtata aaggcgagaa tataacagct     29520
     aggaaatgaa agtgaatcgt tttgtactcc agctccaaag ttgtactagt agtgagtgaa     29580
     gaaagaaagc agggaaaggc gaaaacctaa agcataccat gttttcggga actgcaaaag     29640
     ttctgttcgg tgctcgctcg ctctccagtt caactcttgc atcctcactg cagattgatc     29700
     atcatgaccg attgtaaatc ctaaatctcc tgtcgttaat tatgtacctg cagatttgac     29760
     agtactatat tttgtgccag agcaacagaa gtaccactca tcgactcaag agctgggtta     29820
     agttagacag taaaacaaca ttctgaaaca ggctgaaaaa aactgactca cgattgcccg     29880
     agaaagtgag gaaacagttg aaacctgaaa gcgctgaatt ctgtatacac aagtagtagt     29940
     actggagtac tctactgaag atgggcatga cttgaaggct gaacctcgga ttccatttca     30000
     tggcaacggt tgcaaaaccg atgcccacta tttgggctat taaccctttt tggagccttg     30060
     tatgagtata cgcgaccaaa gtcaccgaga ttcaggccac gtgtctcggg gcaacgagat     30120
     gctctttcga aaacccttta caacgttcgg tgttcatccg ttgattatcc ttgcaacgtt     30180
     taaggttgca gaattaggat atccaatgat ctttttttag ataatgtggt tgattaataa     30240
     aagaagaagc gacattagtc gcttaatgat gacagttcct gttgaagaaa aataaagggt     30300
     tctctgtcca tgggtgttag cagatttcac aagccaaaca tattactctt tattatctaa     30360
     aaaaacaagc atattactcc ggtcatacat aagtgacatt ttagataatg acacaatcat     30420
     caatgcactt gttttacaat atagaactta tactacaaca agtatagcaa agttataata     30480
     ttttgaaaat atttttgaga cgagtctaac catattactt ttgaatgctg aattgaaata     30540
     tttaaacaga aattgacaat caaggtttaa acatattggt tgtacgcatt tcaaaatgtt     30600
     atttatttgt gaccggaggg agtagtaccc taaactgccg ctacacctta ataacattgc     30660
     agaatgccag aaagaaaaaa ccctgaagat ccaattctca ctaaaagcat cggaggacac     30720
     ttcatatcaa tatatcatca cgactgccct tcagaatgca cactttgcta cttcttgaat     30780
     cttcttggtt taagctatgt tgatagtgtg acagacgaga agaattgagt aggcagctgt     30840
     ttgatgactc agtatagctt gcacataacc acgcacttgg tatcaaaatg tgggttggta     30900
     cttggttaga tactactcct tgctcttcta gaaccttgaa cggctactga tacaaaatta     30960
     cagtcctagc actagactac aacattaacc aaactgaaga ggcagtacat ctcacgtatg     31020
     ctatatctag cccagggcat gagtgacttg ggggaaaacg actgtaatgc tggcaatgcg     31080
     atttctactc tgcatctata atgaactgca tttctgaaat gatactacaa caataggccg     31140
     ctaaaagaag aataacttat caggaatccc gtagcaagga gttatttgat ggatccaaga     31200
     atacactaat ttcctctgca aaaagaagaa gaatatacta atttcagttt actcctagaa     31260
     ccaaccacac caaaaagatt gacttcacaa gtttctgcat atagccaagg tgatccaggt     31320
     actctgagtt gggcaagtaa attcatctat ttaatggcca gtgtagaaag atttccattt     31380
     tcatattttt accagaaagg atatgttaca aaattctctg aaaaaaaaac taaaaaaata     31440
     ccaaaacaag tgaacggcac aatcagagtg acaggaacta gctatttcta actaatattt     31500
     caactaccaa ctcctcgttt ttattgaatt tacatagaga ttgtgatgaa gaaacatggt     31560
     cggtacagaa tttgagtttt acctgatatt ctgcccttcg ttaaatttaa ggatgaagtc     31620
     agacaaaaca ctgctgtcgt tgcaagagtc ccttgtggat aaccatctgt catcaagctg     31680
     aacttttaca tccctgtgct aggagaaagc ataagttcat ttgctattag gagtgctacc     31740
     tacacttcaa gatagacttg ataaaagaaa ctgtaggtaa gctctgcagc tcagtagggc     31800
     attaaaccat ctatatggca acaaagaatg aagacattaa gtacttataa caatgtagga     31860
     caaccagaca taagatttga atattcatga ttactgaaaa aagcatacct cttcaagctg     31920
     agaacttcat aatttttccg caggtaatct gcatgcttaa ctagagcatc ctgggcatag     31980
     tccttgccaa cagttctaac tgcagctgta ttaagcaaat tttccaatga accatgtttc     32040
     tttagaagtt tcactgcagt tttccgacca aaaccaggaa caaggtgctg tattcctgga     32100
     ataccatctg cttcatcacc tatgaagcac cctgtgcaga atagcttcga tgcatcagtt     32160
     agctagattt cctaataatg ataaaattaa ctttacattg taggataata cataaaatat     32220
     agacatatac tcactgaggc tcaaatctgc ggttgggtca cacttgtact gtgcaacata     32280
     atgcctcagc gtataaaagg accaacggcc aatctcagga atgggcataa ctaactgaac     32340
     atcttcagat atcagctgct tgaagtcttt atctggtgag ccaatgacaa ctctaaaacc     32400
     tttctgtaaa acttgctctg ttaaggtagc cactacatca tctgcctcat acccatcgac     32460
     tctgacgacc tgaatttgcc gtttgcagat ttgttcagcg tcagaaactc agagctctac     32520
     ctaagaaaac gttgccgatt tctcgatttt agtaatctgt atataaaaga tctggttcac     32580
     ctaccggaac attgcactcg cgaagaacat cgataacgcg cgaatcggcg cctgtaccag     32640
     ggccacgagg tcggtgcgcc ttgtaggacg gtagcagccg ccgccggtac tcgttcccgc     32700
     cctccccgtc caaaacctaa cacgaagcag agataatttc ataagtgact agctgagagg     32760
     agcatgtaag gacgattcct tcgttggggt ctgggagtgc gtgctcacgg cgacgacggg     32820
     gtcgcggagg ctgacgtgcg cgaagaagag cgcgagccag cgcgcgaagg cgccgaggct     32880
     gcgctgggat ccgcggaagc agagagggtt gacgtcgagg aagaacaccc gaggtttcgc     32940
     gggcttcgcg ggggcgccgt ccctgcccac cagctgcttg cgggaatgcc tcgctggagg     33000
     cggcggtggg atggagacgg cgaaggtgga aggggaggac gacgaggata cggaggcgta     33060
     cggggtcacg cggaggcgga gcgagcgagg tctacggggc gccgccgccg ccgccgatga     33120
     cgacgacgcg acgaccggag ctaccggcgc cgtgctcacg gcgggaggtg gcatcgcgat     33180
     ggcgctcggt ttggtgggaa gcggagatgg ggatgtggat aaagggggct gaaataaaaa     33240
     aataaaaaaa aggagagatc caaatattgc tgggcttttt actaaacttc atctaagtta     33300
     tgggccaaaa gcccatttgc taataagctc tcaaggccat gatgtatttg gcccagtact     33360
     gcttcctaaa tacctacttc ttccgtccca aaatataact acctagtaca tgatgagaca     33420
     ttatcgtagt actaggtaat gtcccatcac gaatctggag tccagattcg tagtactaga     33480
     taatgtccca tcatgtaata ggtagctata ttttggaacg gagaaagtag tataaacaag     33540
     gctgagtaag ttgagttgag tgagagatgt gcatgtgtgt acaaggaaga tcacggcaca     33600
     gcagggatca agacatgagt gaatttatgt aaataagtcc aacagtgtat ttacaaacag     33660
     aaaataatat gtgaataaat cttttatata tgtgttctta gcaatctaaa agtaaaggct     33720
     gaaaaataaa cttcaatgag aaaaccctaa aatcaactac aaatttaagg ttaaaaaaat     33780
     caaattttgc atgataagca taagcataag cgaaaagatg aagcttttag ataaaatgaa     33840
     taagttctct ctctaggtcc ctcaatttat cgtccaatat gatttttttt tgtcctcggt     33900
     ctagaaaata ggatacaaag catcttccaa cttataaaac tgtacaaacg agtttcctca     33960
     tcagtattga ctccggtttt agctaacgtg gcgcatacat ggatcatttg actagttttt     34020
     cgttgccacg tggcattaac atagtgtttg catggcaatt caatgcggaa aaataataaa     34080
     atatgtgggg cccacatatc ggttacacaa acaaaacaaa aaaacaagtg ggcccatgtg     34140
     gccacacatg tcatcatcac tacttccctc ttctctctat atttctagtt ttcttttcct     34200
     ttttgttttt tcttgcttct tccccgatgg catccggcgg ctagccgtga gcagcaaaga     34260
     gaagggcggc caatgggagc gccgcgccgc cggagtggga gatgtcacgt ggaggtcggt     34320
     gttggtgtca gccatggagc gcgcaagctc ggtggcaaag atgaagccgt tgtcatcgcg     34380
     gtcaaaggcc cttcctgtca acgatgtcat cgccgctacc gacctcccaa ccccctcacc     34440
     agcctcgcca agaggaggtc gagcgagtgg atccgcgacg attaggtgtg aattttttgc     34500
     gcgtgacgtg tgtgaaaatt tctttctagc aatttttccc ttcatgcata aatttcagga     34560
     tgatccgatg atcacaaatc taaaagtttc gagggtaaaa aacttgcgaa agttttctag     34620
     caatatatgg accgccataa agtatatggg tcgaaacctt tattctcatc tctaacctac     34680
     cccgtcccaa aaaaaaaaga ctaaccctag tatgtgtccg gatttgtttg ctaggattgg     34740
     gttttttatg ggacggaaca gtaaaaactt tgcaaccatg tacctctact agtgaaagta     34800
     ttcagaggga gacatatcac ggcgtgacaa aaccgacaag tattcatgta ctatcttttg     34860
     aaaataactt tattctttta gacattgtta ttatcgtttc ccggcttgaa tccaaccagt     34920
     aatacgctga aatatcctag acttgatttg tggtacagat tcactgaacc tggactaggt     34980
     tgtctggcta gcaacaacag ggaaagttca gtgtatctat gacctgtgac agtgaagacc     35040
     agaagctaga cttcttttga tgcttatgct ttgccggcaa gtctcttttg cccgttttct     35100
     gtggtaagta ggagtacaaa attctattaa tgcttatttt acgttacaat tccattaatt     35160
     ttagtagcga aaaagattag tcctgataat aaacattgtt tgatgtaaac ccagctggta     35220
     cagtactgta ctactgctac cacctttatc ctaaaatata gaatgagact cactattgga     35280
     ctatgaatct ggatatactt tatgtccgta ttcatagtcg ataggtctca tcgttactat     35340
     attttgagtc ggagggagta tttttgaaag gatccctcct ggtacttctg ttttcactga     35400
     agaggttggt acgtttgcta gctaactgct gtgtgcaaag gaattggata cgaggtactg     35460
     gaattccgct ttcctgaaag tatagaaaag gtgcgcatta ttggaggata atctatctcg     35520
     tatctgtttt tttttttggc aaagaataca aatattgcct tcatacgcca ctgaattttt     35580
     cccaaaaatg taagctgatt catcattcat ccaccatatc catggtgtgc aagaatgcaa     35640
     agcgcaggga tgtcccaatc tgtgacatgt gcaggcacta gcacatcaaa cgcaagctta     35700
     tccaacttaa aaaaaatgga cactaactca taatattttt attgagttct taaaaaaact     35760
     cataatatcg caacgaaacc cggacgcttt acatgtgcat cacgttggac cgccgtgatc     35820
     ttagaaacag ggccaaagtt cttctgtaca gtactaccgg tctactccac ggtgtcactg     35880
     tcaccccaga aacctagtaa aagggaagaa ctgccttgtt ttagtttagt gctattctaa     35940
     ctttgtcatt tttgtattaa aaaaattgtc atttttagta gctatagaaa gaatttggtt     36000
     attgccagaa cttttggcaa aaaaaaaaaa aagattagcc cttcgtttcg ttactaccaa     36060
     agctatacgt tatagaatca aataagtcaa ataattagca atgccaatgt cttagctaac     36120
     caagcagacg gctaatattt ggaaattatc tatgaattta cctagtttca tcgtccaaaa     36180
     ataacttcgt agcaatacaa agataaaata ataagaatgt tttctacttt gttcataggg     36240
     gtgagggtac gttcgttgtg agtgtctacg ttgtactgtg taattaatac aaagataaaa     36300
     taataagaat gttttctact ttgtttatag gggtgagggt acgttcgtgt gagtgtctac     36360
     gttgtactgt gtaatttttt ttaaaaatat actatattaa aattacaatt gatcccactg     36420
     tatcgagttt aatttatcct tcatttttac taactttttt ttcttgtcat gtaacaaatt     36480
     ttacctgcag tatgtcggaa gtcaatcgtc gattcgtcga cacggcccag aaaaagggcc     36540
     cagcccacac ggggtagccc gaccggcacg tgtcggcggc aggtgcgtcg accacctccc     36600
     agccggtttc ccgtccaggt tcttcccccc gtcgtccgtg ctccatgctc caagccgcat     36660
     ccgcgtctct cgtcacgccc acaccaccac ccaccaaccc tccccttccg tcttcatcaa     36720
     tagtagtacg cctcccctaa aaacaaaaca aagagaagtc caccacacat cccccccccc     36780
     ccttcccctc ctcaccttcc cttctccggt tctcagattc cacccaatcc gccgctgcgt     36840
     cgcgtgtgct gttcggcgaa attccaagcc ccaattcccc acatctcatg gttctctctc     36900
     ccatcgcctc cgccgacgtc gaccgcctcc tttgctgctg tcgccggtgt tgttgctgtc     36960
     gccggtgttg ttgttgttga gggggtaacg gtggtggtgg tggtggtggt gaggggttag     37020
     aggggctagg gttgcggatt tgcggccaat tggttggggg atttcgaagg gggaatggat     37080
     ctctcgcggc cggaatcgtc ggacctgtcg ctgggtttcc actcgctcgg ccacgcccgc     37140
     gggcacgcgg tcacggggcc gctgcggctg ttcgatgaca tggaggacgc caagccggag     37200
     aagagcgtcg gtggcggcgg aggaggaggg ggaggaggag gcgaggagga ggatggggag     37260
     gaagggggcg accagcactt ctccctcctc ggccacgcgc tctgcgtcaa gcgtccacgc     37320
     cgcgcgctct acggaggcgg aggcggaggc ggggcaggag gtggaggagg aggaggaggg     37380
     gaggcgtcct cctgctcgtc ttcctcctcg tcgctgcacc cggcgaagcg gcaggcgacg     37440
     gcggagcgcg gcgcggatct ggaggcccgc cgcggcgccg tccgcgcgtg gggcaaccag     37500
     gcgctggcgg aggccgaccc ggacgtgcac gcgctgatgg agctcgagcg cgaccgccag     37560
     gtgcgcggga tcgagctgat cgcgtcggag aacttcgtct gccgcgcggt gctcgaggcg     37620
     ctcggcagcc acctcaccaa caagtactct gagggccatc ccggggctcg gtactatggc     37680
     gggaaccagc acatcgacgg catcgagcgc ctctgccatg agcgcgccct cgccgccttc     37740
     ggtctcgacc ccgcctgctg gggggtcaac gtccagccat actcctgcac ctctgcaaac     37800
     ctagctgttt acacaggtct cctcctgccc aaggaccgta tcatggggct cgagccgcct     37860
     tccggtggcc atgtcagcca cgggtactac acaccaagtg gtaagaaggt gtctggagca     37920
     tccatattct tcgagagctt gtcgtacaag gtgaatccgc agactgggta tattgattac     37980
     gacaagcttg aggagcgggc aatggatttc caccctaaga ttctcatatg tggtgggagc     38040
     tcatacccca gggagtggga ttttgcacgg atgaggctca ttgctgataa gtgcggtgcg     38100
     gtgctcatgt gcgatatggc acatatcagc gggcttgttg cggccaaggt aaataactac     38160
     cataaaggat catttattta tgttgtatga aatgtagcag aattactcaa atcacgactg     38220
     aaaagcctag ttgttagtat ggtttgctgc tagctgccca gaaacgtgtt gaagaagagt     38280
     ttcaatcttt ggctaccttc attacctggc tatctgttaa gtcctgttga tttgaaccat     38340
     tcaacatcac aatgcaagat tttctttatc atgtttctaa tgtgacgatt aggctgatac     38400
     tatagtcctg atgaaactat tttgcagtca gttatcaatg tatcgtattc aaactgagtt     38460
     tgagcatagt aatcatagaa catttttatt tttagagaac ctaaggttac atttctagtc     38520
     atgttcacat aagttaaaga taactactac agaattatat tttctgtgag tcaacgttga     38580
     tccatgctag ttctgggatt ttcccctggt gatggaaatc atgctgatga actaagttac     38640
     tagcacatgt tatcgctatt aaccacaata ttcaaactga gttgatactg tagtcctgaa     38700
     gaaactattt tgcagctagt tatgtatcat attcaaactg agtttgaaca tagtttatca     38760
     tagaacattt tgatctttag ggaacctaag gcaggagtaa catttctagt catgtttaca     38820
     tctgttaaag ataactatat aactatattt tctgcgagtc cacatcgatt cgtgctagct     38880
     tatggggttt tcccctggtg atggaaatca tgctgatgaa ctaagttact agcatgtgtt     38940
     atcgttatta accgcaatat cttatcaata ttcattccat taagaaactg cagtctccat     39000
     gtacgtctta ctgctgtttt aatattaata cacaatataa tattttcaaa gcatttttca     39060
     atgtcatttt tatatggcaa cttgagatag tttcacatat atgttatgtc aaactttgag     39120
     aatgatgact aggttataca tttagaaaca tatagaatag cttttgttag aattatcctt     39180
     aatcagtttg ttgcattttt catgtttgct tagatgctac ctacacttgc tactcttcag     39240
     aaatgtttta tttccttaat gtgtggcatc attgtgtgaa gccgggggtc tgccccctga     39300
     atcaaaataa ataactacaa aagttcttag ttggttctac tgctaaatct agctagttca     39360
     atgttcttga tgttcatatt gtaatagtga tattgttgca tgctccttac tgttgcgaga     39420
     ttcttattta tacaagatgc tcatactgtg gttgctgagc atttattgac tactgacagt     39480
     ttatttcttg ttaacttttg caggaatgcc gtagtccctt tgattactgt gatgtggtta     39540
     catcaactac tcacaagaat ctgagaggtc ctagaggtgg tataatattt ttcaggagag     39600
     ggaaaaactt aaggaggcgt actggatctt tttctcaagc ggatgagaat gattatgact     39660
     tcgaggacag gataaatttt gcagttttcc cttcaatgca aggaggaccc cataataatc     39720
     atattgcagc cttggcgata actctgaagc aagtagcaac acctgaatac aaagcataca     39780
     tcatacaagt taagaaaaat gcccaagctt tggcatcagc cttactcaga agaaaatgca     39840
     gattggttac tggtggcacc gataaccact tggtactttg ggacctcaga aatttaggct     39900
     tgactggtat aattctgcct actgttttct taattaatct gtttgtaaac ttgtgatcag     39960
     ggggtgtgtt aatttcatag tgggtgcctg gaaactgaaa tatctctgct atgctaatgt     40020
     agcttagcac ttagtttttg gaaaaaaagt ctatacgtac ttagtttttc ttattaaatt     40080
     cttactaact ctgacgtgtg tcatgctatg agtacatcta gttatgttat aacttccatc     40140
     tagataaacg aaacggttga tatcatcgtt tgtaagagtt ttgtaaaaaa aaatccattc     40200
     tttaattgct taaagtcatg tctctagtac tattgctctt tgacacttta tttctacaat     40260
     ttagatgtgg aaatgcatgt ggtttctaat gtattgtgtt caaattttta caggaaagaa     40320
     ctttgagaag gtctgtgagg catgccacat ctccataaat aagatgccga tatatgggga     40380
     taatggctca atatctcctg ggggtgttcg gattggttag tgcatacacc atggctgttt     40440
     tttcttactg ttttgtcatt tctacataaa acatagacta ttgtattcta cttactgtca     40500
     tgttacatac aggaacacct gcaatgacta ctagaggttg cttggaagat gactttgagg     40560
     tgatcgcaga tttcctcatc agagccaccc aaatagctag taatcttatg aaagaacatg     40620
     gaaaaatgca gaaggaattc ctgagaggcc tacagaacaa taaagatatc atagaactcc     40680
     gtaaccaggt tgagaatttt gcatcgcagt ttgcaatgcc aggttttgat gtatgagtgt     40740
     gcatgtatgt gtacatatct tggtgaggtt gtccagattc atcaggaatt agcaaccgtt     40800
     tcactctttg ccgaagtgtt tctttcaaca ggagcagaat agggaaagat cgttttttct     40860
     tttgttggaa attggtcttg actgaagctg tacatgcata cttctgagtt gtcatttatg     40920
     taacgtattg aaccttcata taacggcttt gtataggaga taattttcct ccatgcgtaa     40980
     ggatcttaaa tctattttgt gtttatgtct agcctgaact gtattgatcc agatgttaca     41040
     gggtagttgt gatatcagta gctgacttac gtgcgccctg cctgcatgtt gttgttgata     41100
     accagaagcc ctgaacaacc aagacattac agtgagacta gtagtaacac tatcagtata     41160
     gcactgacgc attgacaata atggctgtca agatctgact atttgttgta ctggagtact     41220
     cctactcgct aaacgctgta agccaagcac agtgcaggtt gcatcatggt actcccctgt     41280
     tcgctgtata gggagaaacc catcatgaag atttggtata gctggcatgt taggtaggag     41340
     taggagtagg agtagtagca gcctaattcc ggttgcagct gagatgggtt atcatctcct     41400
     cttttgaccc ttgcctgccg cctccctcgc tcggttttgt ttttgcccgt acttgaccat     41460
     tgatacgctt cttttcggcc atgatttgct tcgctccggt ttgttgccga tccatggaca     41520
     tcacatcggt ttgctccgtt tttcctccgt gcaaatgatg gtgtgcggcg tccgatccat     41580
     cgatcgatcg cccgatccgg ggggcttaag gcgaagaaag ccacgacaca ggtccttttc     41640
     ttcaatgcgg agcagaaagc ggcgcagctt ccagctgccg ttccagaacc cctttaatca     41700
     ttgcgaccat ctgctctgct tcttgggaca tcaatccaat cagacaaaca ccaaaagccg     41760
     gaggagtaga ctagcaggtc gcagctgcag tcgcagtgtg tgttgtgttt tacactgatg     41820
     gtgttcagtt gctcatctct ctgactctca atcactcctc ccgaatccct tttatctttc     41880
     tgggtgtgtt tagttcacgc caaaattgaa ggttggttga aattgaaatg atgcgacgga     41940
     aaagttggaa gtttgtatgt gtaggaaagt tttagtgtga tgaaaaagtt ggaagtttga     42000
     aggagtttga aactaaactc ggcctctgtc tagcatctct cctgattaga gacaatgaaa     42060
     cattagttaa gctttccttt tgttgccttt tcttttctca ttgaggggga tataaggaat     42120
     ctaaacccct tttctccccc tattcttgtt ctagtggagt ccttaatgat gacttatgag     42180
     gaagtgagct cgccactacc agtaaagaac tgatcactag gtataaggga caaaaacaat     42240
     tgagagagaa aagagggcga gatcttggca tttcacactt ccttttaagg tcttctcgtt     42300
     tctcagtatc aagtttcaca gtgattgatt aatcacctaa cctagaaaaa gaagttgctg     42360
     atagcaaatg gatgtgtctt agcatagatt catcagtcat cacaagggct ttttaaggtt     42420
     tttggttcaa gcctatccca attcatgata gctgacagtt ctaatatgaa caagagacaa     42480
     ttagacatac tcacatacca tgtcatttta gtatctattt taaaatgaga gacataataa     42540
     attactccct cctttataaa ttgatcatca tataatagaa tctaaaattt ctcaaattga     42600
     tcattgtata actatatgga caaggatttt ataggaatac aattaatgca gtatgagaga     42660
     acgtgtgcgt gctagggtat actcttaatt gacatggagt tttaatcgat gcatacatta     42720
     tgagagaatg tatgcataat atctttattg atgtgattta aattatactt agttttggtg     42780
     tataaactta tacgatgatc aatttataaa ggagaaagta gtatggtaga cgtaattctc     42840
     atgcagatgc ttcatgcttc ccatgagaaa gaaagaatgg gactcttgat gctgaagctg     42900
     gaagctacgg tctactgggc gtaggagaga accaaagttt cggccatttt tcgcattatg     42960
     gtagaactct gatagtagcc cgacctacgg cacgtctgcc tccccaggcg aacaaacaaa     43020
     aggcgacccc ttccgtcgtg caactgcaac tgcctgtgct actcctgcaa tgcaacaaga     43080
     aagatttcct ttctctctca tccccatcat gcctctcctt tcatggcacc tttcatggca     43140
     gagacgcagc aacaggatgg aaacaacagc agcagcagca acaacaacat catgagcaaa     43200
     atgctgtgac agcgacacac tctgtctcat cgagtaccac taactactac tcgtactcgc     43260
     tactgaagat tatgcttgct actactacgt acagtacgag tactctacca cgcgaagcat     43320
     gaagcatttc atgccatcat ccatggcgat gatgatggtg ttgcagtcga tcgatcagtg     43380
     gctgcaaagg tcggagagct ccttcctgcc ctcgacaatg tcgtcgagga agtcgtcgag     43440
     ctggcagacg aggccgtcgg tgccggtccg gagcacgtcg agccacgcct tgagctcgtc     43500
     gaccttgtcc ttgacgccgc cgtcgccgtc ctcgcactgc tgcttgcggg ggcccgccgc     43560
     cacggcgcgc tccacctcct cgtgcgccgc ctccacggcg gcgcgcgcgc accggaactc     43620
     gtacatccgg atgccccccc gcgccgcgcc ggcgctaccg tcggcgtcgg cctcctccgc     43680
     catcctctgc tgcagcattg cgatggacgc cacgaacccg ccggcgtccg cggcgccatc     43740
     cgcggagcac ggccccgctg cggcggcggc gcaggagacg gcgccggagg cgaggacgag     43800
     gagcagcagc gagctggcgt tgtgcagcgc gtagagcagg ccgcggaagc cgttgaagcc     43860
     gctcaacctg gcgtccgcgg cgcgcagcag cagccgctcg tcgagctgca gcgacagcgg     43920
     cgcgatcctc gcctccgaca gcgcacggtt ctcctcctcc gccgccatgg cctccctcct     43980
     cgacgcagag atcgccctca tcacctgcac cgatcaaaca aatctccata aacacaaaaa     44040
     aacagagcat ccaacaaaga acacatagta gcgatcaatc gatcaaacac acaaacagag     44100
     caagaaccac taatggcgtg tcgcagcaca gaaacaaaca cgtttcgcaa ccaaccaacc     44160
     tggcgagtgg agagagggga agggtcctgg agccagtcat ccatggcggc cgcagcacaa     44220
     gacgcggcag cgcaataccg ctcgacggcg gcaaggccga ccttgacggc gaggcaagcc     44280
     tcccagagcc gcgcggtctc gtccatgtac tcgtcgagcc accgcccacc gggcggcagg     44340
     tggagctgcc ccaccagcag cgtgagctgc gagtgcagcc ccctgagcag cgccgccgcc     44400
     cgcagcagcg ccggcagcga cgacagcccg ccgccgctgc tcaggtcgtc cagccctctc     44460
     gccagcgacg tgaagaaggc gttcatggcg aaatccccac agcaagaaag atcgaacacc     44520
     ggtcgatcga tgcgtctgga aggtcgagct ccggctggct atatatagcg cgcggtgcaa     44580
     gaagggcaag gaggagacga tcggggagga ggaggaggag gcggggggcg tggaggggca     44640
     atgatgggtg tctagacgag ggggagaagg gtgatgatga ggttgggggg aggcagaggc     44700
     acagccatgg ctgatgtctc gctcgctcgc tcgctgctgc tcgctgtgct gtgtgcggtg     44760
     ctctggtctg gtctgtggct ccgcgcgcgg cgtacgagcg gggcgcgttt aatggctgcc     44820
     tcctcgcgac accgcgcgtt gccgggtttc cggaggaggt taggcttaac cgccgtcttt     44880
     cttcggtttc actgcggatg ttgtgggaaa caattttaat ttctagaggg catcctcgta     44940
     tttttaaaac acaacagaaa cataggtaat cataaaacac gcatactcat cgctataaat     45000
     aaacacgcac acaatacatc tataaacatt ttttaaaaaa gttactgtat atacgattat     45060
     gtagcgttac acaaccaaat cccatggtat tttctagccg tttctaacga agtaacacgt     45120
     gacattcact atctgttagc aatcgtataa ttatcgtaca tataaatcgt atacatagca     45180
     ttttcgattt ttgaaacact agaccgacat atcctcgtca atcatgaacg tctcactatc     45240
     gatgattacg tcgcctgcac cgaaagaata tcacccatct taagcctaga actttaatgg     45300
     gtgatttggt tccgtcacaa gaaaactaac tagttaaact acgtttagtt cgctagttat     45360
     ttacatatta tcaaaataat taggaaaagt ataaaaattt aacgagatca aactccataa     45420
     gcctacaata ttaatcaagt taaattttag agtggcatat cacatattaa tatatcttgt     45480
     cagttttaaa aaatatttta taatgcaaac ataatgttac tagtagagtt caagatccat     45540
     tccccatgtg tttttagcca tttctagcgc gtaccgcagg ggggcgttgg tgggggaggt     45600
     tgttgctcca tggggtggcc cgcctacggt aggggggaaa aacataccta ccagattatc     45660
     agcttttggt gaaatttctc caccggaata ttgcgctttc tgcatagttc agcggtcaaa     45720
     atggcatggc atggaacgtc cagtccttga ctacggaaac aaaacaatcg agcactagaa     45780
     acagtcttgg agagggactt ggtcgtgtgt ggtttgtatg gttcactgaa cttggagagt     45840
     atagtagtag tagacttttt tttttggcat tgaatatttg caaatagttc agctgctcta     45900
     gcgatgccat tgagtggtta tgttggctaa aatgtcaaac caactgcaca ttgtagccac     45960
     ctctagttac agttaccaag gattctctca tccatccttt agattttttt gttattcttt     46020
     caacatttgt tcatttaaaa atttgaaaat aaatcgtcca taccaaccaa atttaaggcc     46080
     aaatgtcatg ccaaagaatt tttgtagcgc aaaaagccaa gatgtggcga tggtgattta     46140
     ctatactatt gtggagtaac caaatcatta ccacaccata gtttttaacc catgtggtaa     46200
     cattgtcttg tcatgccact aaatattgtc actttgatta tgttgccacc tactgacttg     46260
     actcttagca tctgcagccc catcgtttgg ctttttccct ataaaaataa atttatattt     46320
     tatatatgtg ttattggtgg cctaaaagct aatactgaaa aagaaactat aataaaaaaa     46380
     atctcaaaat taagtttaaa aatttaaaaa ttgccttttt ttggctgatt aggccatccg     46440
     ataggagcct atttgttggt ttgcgcagcc aagatttaaa ttttaaactt aattttaagt     46500
     tgaatttggg atgttttcta tcattgtcta tttttcaata ccgtctttta gtctgtgaat     46560
     aacataattt ttatctataa atcatttctg attgcttcgt tcatacttct ataacaacca     46620
     atggcatgga ccaggataac aaataagcaa aagccactat atgaagcggc aaaatagaaa     46680
     tatccttttt aacattatac aaaaacatca atttttttta aaaaggctct tttccataga     46740
     ggaaaaatat attattgctg tgaggaatat agagttttca gttctctcag taaaaaaaac     46800
     tgtttttcta tagcttggta ggattaactt attttagcca cagggacaga tatgatgagt     46860
     gatggtgcaa tttaattaat gagttaattt tactttgggc tatgttttat tgccaaagtt     46920
     ttattttgga ccaccattta tctaatcttt tcactttgga ctaggtaact ttacctttgt     46980
     cgcataatgg accaccccaa aacacatttt catttcttcg atgacttcga gcaaattgtt     47040
     aacgacatac cagcaaactt tcatatctat atgcatgata tactttgtcg aaagagacgc     47100
     tagacatcac aagcgaaaag agttagggtt gtccattgtg caacaaagat aaagttaact     47160
     agttcaaagt gaaaagatta cgtacagggt ggtacaaaat aaaactttga taataaagta     47220
     caattcagtc ttaatcttat ttgtcacaac aacgcagata gtacaaagta gaggcaactt     47280
     gttctgcttg cgaattgtga actgcatcag tattctgcct ggtactacaa atatcatcag     47340
     aaaaagcagt ttcctttttg taggttgtgg atcacgctcc gacaacacag cgtagggtta     47400
     aattaagcta tgcgatattt agtaccatca atcccatcag tccatttgac atcccaagca     47460
     tgcgttattc gattcaatct tatacctccc tttcctcccc ctttattccc tttccaactc     47520
     agagatgcaa atcttatcct gccaaagcca ctacatatca tagctcactc gaattctctt     47580
     ctacagttca tcccaactcc cattagcaag gagctaaaga tcttcactac ttttacacca     47640
     acgaaaaaca attatactca ttctgtatct tcagacaaga tcacaagagt ccagagacat     47700
     ctagtcgaaa ttattgcaat acacgaacag ttacctaggt aaggctattt tgtactttta     47760
     tagaattcca gtagaaaaca tcctgagctt taaatcatgc actattctcc tgtttattcg     47820
     ggttgtcaaa ttgacccctt ttttgtttcc cctcctttac atgaacagtg gctaatactt     47880
     cctccgtctc agattacaag acgttttaac tttagtcaaa gtcgatcaaa ttgtttcaag     47940
     tttgattaag tttataaata aatatagtaa tatttataat actaaattag tttcatcaaa     48000
     tcaataatta aatatatttt cataataaat ttgtcttgag ttgaaaatgt tactattttt     48060
     ttctataaat ttgattaagt ttaaagcagt ttgattttga ccaaactcaa aacttcttat     48120
     aacatgaaat ggagcgagta gcaaattaac tggcgccatt gtgtggcatg atttcagcgt     48180
     tgtctgcttg ccatttggcc gtctcagtaa gtttcagacg aagagttaac tgtcagggct     48240
     agtgtactca gatcaccact ccctgctcag agagggacaa ttacccgaca tgcatgggat     48300
     tagcatggtt ttcggtctga gcagcgaact tcttgtgatg cgcctttgcg cctttgtgtt     48360
     cccatcttgt caagcactga aagatgatca atcctaatcc tgctctttgt gcgcgtaaag     48420
     cctgtggaga cacggcaaaa cagcctcgtc gagcagggac atgaatgatg ataccagcca     48480
     tggaaggtgg tcatggcagc tcccaagcaa gaggacaaaa acggaaggct ttttcttcag     48540
     aaatgagaac tctgaactct gaatgtctga atggaacttc tttgtatgct gcataatttc     48600
     ttttggaaac atctgaaagc agggttgtgg ttaattaaaa aaccggtcta ctagaccatg     48660
     aacatggaac aggagcccct agctactatg cttaccgtaa acgcatgcaa gaaacacttt     48720
     tgtattgtca cctgctgtaa tgagacatct ttgcaataac tacagcaatt tgagctaaaa     48780
     ttggtcaaca ctatcatgct tagggtcccc aaattaaact gcacttttga ctaagaattg     48840
     gcagaagcta gcggcagcaa attgttcctt tccattggac atattcccca actcattatt     48900
     taacgacgct tttccattcc acttgatacg ctagaagaac cgtgtggttt atcatatctg     48960
     caaaccaaac ggatgcaatc gctaatcaca tggataaatc ttcgcaaaag ggagagattt     49020
     cgggtgtgtg cgtgcgcatg cgttgttaga gctgctactc gtgggatctt ggagaatgtg     49080
     atgcttgtag aaagaaacag ttaaggggta taaacaaatg ctggagaagc aaacaggatc     49140
     ctaaaccgtg atctcgcgta atctaatcac ggtctattgt atcgccaaca tgtgataggt     49200
     gtctagaagc ttgcatttta atactaccgg caaagcttga tttgcctctg ctaatgtgat     49260
     ccaaacatga taaaccggtt ttgtatccat ccctgaatta ggtattctct tgccttctga     49320
     cagtgtgatc caaacatgat tatccggtct gtatccatcc ccgaattagg tactgtcaaa     49380
     tacagtgaat acactattgt catgtgtatg cattctgaat ataaaatagc ccaaaatgtc     49440
     atgtgtgacc aagtttttta tgaagaacac atgagcaaat cagcgtgcat tatacagtgg     49500
     agtacactta atcctgcatt tattttgttt gctaaggaga cagggagacg atggagttgg     49560
     aaggcatgag atttgcgctg caccaaccca catggatgaa ggattcaagg gggacaaaga     49620
     ctgctgctga gcctcttgag tgagtcccat catggtcact catggcagta attatggccg     49680
     caattatgcc tgcccaaaag cccacagggc gggcagggcc aaatgcaagt atgcaaccga     49740
     ccctaatgga ggggattagc aataatttcc tcgtttgatg cttttgacca ccgatgatat     49800
     cagcactaat cacaggggtg gattgtacac aacacactac acaaaggcca aagggatcca     49860
     tgcatgatgg tgctgcgttt gtagggcact cggcctagac agaacccccg aaaaggctgc     49920
     aaaatctgct gcagctgcaa tgtgagctga gagtgaggcc gatcgagctc gagctcgagc     49980
     tcgagctctc ctctcccctt cgattctttt tggacagtgc gtgagctaat ggccccggcc     50040
     taagctctcc tctccccttc gattcttttt ggacagtgcg tgagctaatg gccccggcct     50100
     aattcaatag ggccagtatt taatagtacg ggcagtctct ttttccctgc agggcttgtc     50160
     ttggccggtg ggtaacacaa tctcagaatc agtactgcta atgatccgct tggtttttaa     50220
     taccgctaca actactagca ctactattcc tagttgcaga acggagagtt gagctaggct     50280
     gtaaagatcg cggagcacga gtaattcttg cttggatgca tggacagatg gatgcgtgtg     50340
     tgcatgggtg cagctgcagt ggcgccgtca tcatgtggtt caatattggg gcgagcgaaa     50400
     tctatcattt gtcgggccga cacgccagca tggacggatc gacggacgct ggctggtctc     50460
     agccgttgct cctgcagcct ccgcgtcgac ggggcggagg aagacgagaa cgagacagcg     50520
     agtgtgtgcg cagccagccg gccaggcaag gcatgattcg gtccggtctg gctggctccg     50580
     atcggcagcg cgcgcgcgcg gcgctgtcaa ccatgtggcg ctgcgcctcg cggggaaacg     50640
     acacggcgcg cgcgcgcgct gcgtgacgcg ttcgtttcgg ttgcatgcga atcgcggggc     50700
     ggatcgatcg tgccggattt gagtcatttg gcgggggggg gggggggggg gggggttggg     50760
     gtgctggtta tggctgcccg ctcggcgccg gcgttggtgg attcctcgtg tgcttctttc     50820
     ggattgatcg atcttgttgg ctgcccgctc gggaaatggc ttggtgcgtt tgcgtcagga     50880
     gtggtcgccg gctcggccgg gtgggtcgat cgagttgtag gggccgccgg ccgcagcatc     50940
     acatgctcgc ctgctgcttt gctttcatct gctgcgcaga ggtaaagggg ttattagtga     51000
     acggacaaga tctacaagtt ttcagtcatg ccggcacgga ctttccatcg ggcctggtcc     51060
     agtaaaaaac caaaaaaccg cgggcctaac cgcctaagtc atgtatgcaa tcgttgtgtg     51120
     ggctagaacc aaactcctgc gctttcgaag cccaatacca accgaatagc agcgacgacg     51180
     taacgcggcc cgtacgcatg cggtccgctc tcacagtcac agcgtacgcg agcggagcac     51240
     ctcgcggcgc ggcccaaacc aaccaagtgc acgttctgcc tgcgtcgcgt ctcctacacg     51300
     ttgccccagc tgtagattgg cggcccacac gcaaccggcg gccgattcgg tgtcacccgc     51360
     cagttcgcca ccgaggaggc gtcacgagtt gcaatgaacg atgcaatgga tgttgacgtt     51420
     gcaggctcag aagatgcaac gagttttgaa gttttccggt cgcgttgcag ctgctccggc     51480
     tttgctgacg cttttctttt gctactcgcc tgatgataga accttatagg ttgacaacaa     51540
     cgagagcgaa acaaggtgca ttgttgtcgg ttgtccgctt ccggttgtct acgacgaaca     51600
     ggcgctgaac cgtggtggat tcatcaacac gactacagta ccatctcact tcccttacgc     51660
     actgcacagt ggactctgcc ggcgctctct cgcaaagctg gactttgcaa cagtcgcaaa     51720
     ctcgagtaca aatctggact tcagctggtg caccgctgcc gctagatctg tgaatgcaag     51780
     tctgcaacca caacacttta aggccctagc tatcggtctg aaacagagag acgctcattc     51840
     aactataccc tgttactatt actatatgtc tcaactctca aacttgcgta aacttatcaa     51900
     ggatgtgccc acaggtgaac aggccacagt ctacagattc ttgtctttgt ccggttaaca     51960
     ggccccgtat cacaaacggg tcccggtggg gacaccgccg cagccgtcga tgggagcgga     52020
     tgaacggcta aaatgcatcg tgatccggat ctcggccggg accgctgctg ctgctgcgag     52080
     agttgtagta aaatccagcg gtcaggagct caagaagcga aatacccggg cagcattcaa     52140
     ttccgctgta cgcccgcttg gcagcgccgc tgctgcacca ccccgcatcc atccgctgcg     52200
     gccacgagac tcggtggcat tgcttgctgg ctcgcgcgca gatctggtcc ggtacgacgc     52260
     gtgcacggtg gtgggggcga cgcgtctgca cggtcgcgcg ggctccccca ccacgacgcg     52320
     cgcccgcgcc cctgcccgat cgagcgccgg gacggggacg gagacgcgat tggctcgtac     52380
     gcgcgcgggg ggcatgcgtg tgcccggcgc cccggcgcgc acggacgcgg agacgcaaca     52440
     ttttgtcccg gggttcggga cgtgacgtgc tccaccgatc ggggttcttg tcgctgaata     52500
     tcggtgaagt gtcggctcgg ttggagacga gtagccccgg tgtcgagtta ctgttcctct     52560
     ctttggattt actctactgg ctatatatac cgtgttggct gtttacccgc cggtaattgg     52620
     aggtttgcta cgatgcgtac aactactcaa gcgagtaaaa acaaattctt ttaccagtgg     52680
     ctgcatccat ggttgcactg catcaaacgt tcgtgcataa agctgagctc aaatcattac     52740
     gtactccctc cattcaaaat tgatctacat atttcatagg tacactaaga ccaaaaaaac     52800
     taataactct ctcatactat atttattcta gcaacaaact ctatgcacca tccctactat     52860
     tttcctagac aatagcaaat caatatattg catgtgttat aaatacttat aaatacttgt     52920
     gtgcatagat gcatgtatca atgttcattt actccaatgc acaaataacg aatagactta     52980
     atgaatgaac acaaatatat agatcattta gtaataacct caaaaaaaac tatatgtaga     53040
     tcaatttgga atggagggag tagtatgtac cgctgtgaaa ctgtgaccac tcctcatccc     53100
     gagaggcgag agtcacggtc atcgtagggt acaaaaccac aaatcacgat gaaaaatgcg     53160
     tgtgcatgtc cgatgaaaag gaaagaagga aaaaagaacg aaaatgatat acatatgacc     53220
     ctgttgtccg gctactgtgt atgactctgg tcacatggaa agacacagac ggtaaaagtc     53280
     tcactccgta atagaatctg acatacgtag tgatgccata acggagtcgg acgctagtcg     53340
     aacgctggat tcgtatgtat agcagcgttc aacaaagaaa tgcgtgtgca cgttcgattt     53400
     taatcagcga attattggtg tggaatttcc gtgcctgaaa catgggcacg catctgttaa     53460
     ataattaatc gactctcggg ctcaccgctc acgcgaatgc aatcaagcgc caggtgatta     53520
     acaccgtaca ggggcagtta gcacagcgga gtacgtcacg attttaattc agggcttaaa     53580
     tgaggttctg actgccagcg tggaatagta ctccgtgctt gtgagttttg acgtggagat     53640
     ggaagcttca caagctagcc ttcgattgct tgtgcctgga agagaaaaaa caatttcagg     53700
     gccctttgaa tcgtaggaat gaaaaaacag aggaatagga aaaacacagg attctgatag     53760
     gaatacaatt gtaaaacaga ggattgcaaa acacaggaaa aacacaggaa tggcagtttg     53820
     attggaccac aggaaaaacg caggaatcag atgagagaga tagactcaga ggaaatgttc     53880
     caagaggtta gacctcttgc taactttcct ccaaaatgtg cataggatta cccattccat     53940
     aggaatttta aaggattgga taggattcaa tcctttgtct caaaggcctt cataggattt     54000
     tttttcatag gattgaaatc ctccaaaatt cctacatttt tcctacaaat caaagtggcc     54060
     tcattttttg gccttcaacc tcacaagagc cacagttacg tgacatttcc tgcccactct     54120
     ctgccttgat ttgatgtttt attcgttctt ggccttttct taatagtact agaaacggtt     54180
     cctttaatgg agtagtatag ggtgtgttca gttgacgcta aaattagaag ttttgttgaa     54240
     attgaaacga tgtgacgaaa aaattaaaaa tttatatgtt tagaaaagtt ttgatgtgat     54300
     aaaaaaaatt aaaagtttga agaaatagtt tgtaactaaa ctcggccaca gccgatcgat     54360
     caaacaagga tctcgtgtag tagtgttgaa tctaattata cattctatac acgccaagta     54420
     ggaatattgt atagtgtaga tccacggctc aataatgtct ccatacacat atataaaaat     54480
     cgattagtag tactaggtgc aacgaatttc cacggcgcaa catttacacc tgatgttcat     54540
     ttgtaacatt ttcccggtcc acagagcagt aaaaactcag gctatgcact tcatggcttc     54600
     tttatttcct tgctccattt gggttgccct cgcagcaaaa ccggcaagta gcaacagtaa     54660
     cctagacgag agcagcatgt ctccctgtaa taaattctgc aagcaaacta agcacaatat     54720
     gggctctctc gcagtagatg agctctgtgg cttgcatgca gtagtatatt tgccaattgc     54780
     aatgcaagcc tgcccatggc atgcgatcat cttgtgcaga tgacacaaac aatatcaggt     54840
     cgcccttgaa gcaattgcgt gtactaaaaa atggcaaggc tgttccgtcg aggagcgagg     54900
     aatacgtaag aatctactcc tacgtaccca gctgccatgc tgctgcagcc atgcagagca     54960
     acagaggggc tagttgtctc gtccatccat attcactgag cggccatgaa gtactattca     55020
     cttctcacga taaattacac agaccgtaga gatatgcgtg ttcatccagc tagccttgcg     55080
     tgcgtgagaa ttgtcagaga catatagtag tactattaag ttatttaagt gtgtttttag     55140
     gtgttaataa cttgcagact ggtcccagga aatctatatg gttttagggt gtgtcttagc     55200
     agtattgaaa acagtgcgct tcttcttctt ctcttcttgg ctgaccctaa gctagcttca     55260
     aaaacaaaac agtggaaagg ggcagtaggg ctagcatagc acatgcatgt ataaaaacag     55320
     gagtttaatt tgtatcattt tccaaaggaa aaaaatgcat ttggaatgct tacggtgcat     55380
     gatacgtata tgtggatgtc ctgccaagaa tcccgcacat tacgattgat gccgtattga     55440
     ccaatccatc tcttggtttt tggagctaac aataatgcca acgaaaaccg gcagattctt     55500
     tttgcgcgcc cgggcatgca cgaaacatat ccgtaagcat gtgaaagggt atagtatagg     55560
     ccaccggatc aacaacagta gatagtacac atacgtatat acgtcgattc gattattact     55620
     gtggcattaa tttaccactt cagcctcagt gtactgcaac agtgagtaaa aataatctct     55680
     tcacactgag atgatcaaag gcccaagatt aattaataaa cacgagcata tgcactttga     55740
     ggatttgaaa agtctggatt ttcagtttgt tttccttcta gttcattatt tggatataat     55800
     tatgggctct ttgaatctaa gtaagaatat actagctagt agattattta ggttgtgttc     55860
     ttttattgaa gttaccaact caacaactct cgcctttctt gtacacgctt tttaaactac     55920
     taaacggtgt gtgtttttat aaaaaaaaaa tacgtaaatt gcttttaaaa aatcatatta     55980
     atctattctt aaaaataact aatacttaat taattatgca ctaatgagtc ggtccgtttt     56040
     aacgtgcatg aaagattagt tcccaacgcc ttaaaacgaa tacagcctta aagagctaaa     56100
     attctaggag aatttgaggc tgccagagcc tagaatccct ctggacacgg cctatgtact     56160
     tcaggaacat atcctatcct atatgtacac aagcattctc gtgcacacta actaataaat     56220
     tcccaaaaat tctttaaaaa acacatatgt atttttatag tattacatct acgtgtaaag     56280
     tttcatcttt aaattcatca tacataaaat agacttatag tcttaaaatt gtcagttttt     56340
     cttaggacta aaatataata aatttaatgt taacatattt tacacgtaag tataatatta     56400
     ttgaaagtat atgcacatat ttttctaaat ttttcgataa tatttattag ttgatgtacg     56460
     cgtgaagctt atgtatacat gatatattat cgtgtcactc tgcacagata tgcagcagta     56520
     ctcttttgtc tgcattaagt ttttttctgc acgtatatac tactccctcc gtttcaaaat     56580
     gtttgacgcc attgacattt tagtacatgt ttgaccgttc gtcttattta aaaaaattaa     56640
     gtaattatta attcttttcc tatcatttga ttcattgtta aatatatttt tatgtaggca     56700
     tataatttta catatttcat aaaagttttt gaataagacg aatggtcaaa tatgtgctaa     56760
     aaagtcaacg gtgtcaaaca tttcgaaacg gagggagtat accactagga gattactgtg     56820
     ccgagctaga accttaaaga tgagctagag taagtaatca gtggaggagt attcactaat     56880
     cagctagcac gggtgcaaca cgctctcgtg accacccccc catcccctct ccttggctcc     56940
     cactctttaa gcggcccttg tcctttcagc tcctcggtcc ctccccctcc atctcactcc     57000
     cttatatcgc tcgctcactc gctagctcgc accgcgccgg ccgggagcac gcacgcacgc     57060
     attgccatcg ccgtgcgcgg aggaggagag gagatcgagg tctcgaggtc gttggttggt     57120
     tggttgcatg gcgagcggtg gcggggagca cttcttgcgg cagctgagcg cgagcaacgg     57180
     gggatacggt ggtgcggcgc agtatcagat ggggcgaggg gtggtggcgg aggaggaggt     57240
     ggagctcggc ggaggaggca ggaggagggg ctcgaagcgg tggtcgaaga agagggcggg     57300
     gaggggcggg tacggcggcg gcggcggggg gaagggggac gcggccgcgg ccgcggcggc     57360
     ggcggcggcg gtggccggga ggaagcgggt gatggtggtg gtggacgaca cctccggggc     57420
     caagcacgcc atgatgtggg cgctcaccca cgtcgccaac aagggggact tcctcacgct     57480
     gctccacgtc ctcccgtacg ccggcgccgg cagaggcgag gagaccccct ccctcgccaa     57540
     ctccctcggc acgctctgca aggcctgcag gccagaggta gcgtatacgc gtatacgtac     57600
     atcatacgtg catgatgttt cttttttttt ctttattttt tttagaggga tgcatgtcat     57660
     tttgtgtgct gtttttactt ttgtgctcta atatgtgttt tcaaattaca aaattttagg     57720
     cgcttcgatt agagaatcat gtgtctgatc tctgctgtct agctttggtc attctggatt     57780
     tggaagcatc tgcttggagg caatgcacga gggaattatt actgctagct cacaaagaat     57840
     tagaaaaaaa agcttttgtt agtgtactgg ctcatgagaa cttgactaaa ctgaaggata     57900
     aaaataaagt ataatttact gtacggtttg tagagttatc aatcctgaag gtcacctgag     57960
     agggatagtt gtaaagtatt atttgttggg ggacaatcat acagtagatc agatcagata     58020
     tcagaacata catgaaaagg ggatcgtatt ccacttttca tggatgaacg gatcttgcat     58080
     cttggcaggc caaaaaggtt cgagtctttg ataaaagtta aaaagtacta cctccgttcc     58140
     ataataagtg cataagtgca gctccgttcc ataataagtg cagccataag tttccgcgct     58200
     caactttaat cgtccgtttt atttgaattt tttttataat tagcattttt gttgttatga     58260
     gatgataaaa catgaatagt actttacttg tgacttatgt ttttaaattt tttcaaaaat     58320
     tttttaataa gacgaacggt caaagttggg cgcggaaaac catggctaca cttattttgg     58380
     gacggaggaa gtaattagaa aagaacaatt tgtggggctc atgctcatcc caggttctaa     58440
     aaccattagt aaaatgcatc agtaaaatcc tacctaaacc ggccgtaaac aatggcatta     58500
     tgagatcata tcatcattcc ttccttgatt tgcttgcatt gcttgaatca aaagtcagca     58560
     cttcaatgta gtagtgtact actagtagta catccctgcg taagagcaac agtaccgtgc     58620
     atgaagccat gaactattcc tttgtcctac tatagcatgt gcaaaggagg gctcatacga     58680
     aatgggtgtg aatgtggtag gtggaggttg aagcacttgt gatccaagga ccaaagctgg     58740
     ccactgtcct cagccaagtg aagaaattgg aggcgtctgt gcttgtgctc agccaatcca     58800
     agccatccca tttctgttgg ttgagttggt aagcatttct cacctcctac cactgtagct     58860
     ctatctttct catccctatt ggatgtgtta aaaatgtgag gctcaggtca actatgaatg     58920
     gaaactggcg gggagaatat agtatcatgg tgtcagtcag tccctagtgt tattttaaaa     58980
     caatgcccag attaatgcat atggctaggt tccaatagaa acctttagtt gtacatcatt     59040
     ttttatatcg tacaagtatc agtttatcag gatacataat taccactaga tctaaattta     59100
     tggggagaga tctggtcatc ttttatgata agcaggccca ctaacaagca atgagtaaac     59160
     tgtttgggaa ataatcctcc ttcaccaccg ttcaatagca gggtcccctg cctttcggga     59220
     aaataacacc aggcagcagc ctccatgtgc tatccataaa tcacagatgc tttccttgtc     59280
     cttttttggt cacaactcaa ccaaatgaaa gcaagactcc tacacttcac tcacctaatt     59340
     tttgctacgt tcacgtggac aatgtaacaa tcaccatcac caacacattg aagttgagtc     59400
     aggaaaagtt acttttcatc ttgtcgtaaa ctatagctat ggtccttgtt gagcaaatgc     59460
     aaatgtctgc ctgcgatttt acagcatcct gcggagcagc agcgaggagt tcgtcgagca     59520
     atgcatcaac caggctgagt gcctgacgtt ggcagtgagg aagcagagca agggcgtcgg     59580
     cgggtacctc atcagcacac ggtggcagaa gaacttctgg ctcctggctt gacaaagcca     59640
     aggactattc aattttctgc caaggctttc aagtctctac ataatcatat ttttaccccc     59700
     gtatatctgc cattctgttt taactgagtg cgccataaaa gcctccccgc tgccatgttg     59760
     cgtcaccgtg caagtgttac catccgttgt aaagcccaaa ggagccctag atctgaccaa     59820
     accctacttc ccatcttctt ttcaagttca gtttgtgtaa tcttgtgctg tactattgtg     59880
     taatgttgca taaatggccg ttttctgttg tcacgtgttt tacactttta ctttcataac     59940
     aactcctcaa cttaacacta ctgctacaaa ccaagaaatc aagagcaaca tcaggttatt     60000
     ttccataact gaaggtcgca tttccaatgc aacagctaga aacatgaaga tctaacagct     60060
     agtaacattt ttagttcaaa tcttgaactg gagtgtggct actgaggggg gacctcgctt     60120
     agctctctct cacttaggag caggagagga cgagaggtgc agttgcattg gttggtttca     60180
     ggcttgggcg tggtcctctt taccgctatt ctctgaatcc tagcacacac ctgcccgtgg     60240
     ggcaccgcct tcaatggtcg tgggcctagg gggcaaacaa ccaggcaagg atcaagatcc     60300
     ccagtttgcc accaatagcc tgatggcaaa accaacctcc tcaaaatatt gcagctaatg     60360
     cttatggtag ctcatactag tcatactaca tctcacactt ctcacttaag gactggtaac     60420
     tcacaattta tgcacagatt gttatacaat agatagtaga tcattttttt taagaaaatg     60480
     gaaatggttt acatctccag attctaccat aaggcgcacg gccaatagat aatagatcaa     60540
     catggataga tacacaagcc cgattcttct atggtcgatg gaatttacgg taacggaggt     60600
     ctaaagcaga cagggaagag tactaataca gagatcagtt ctagtacata gctcagctaa     60660
     gccaaagaaa gtatttatca agttcgtccc gcgcggggac agagcactac taaaacggag     60720
     acaaatgcag ccactaacca gggaccattg gctgtcctga ttacctacat agagatacca     60780
     aacaggctgc agcaccatta tggtacttga aatgatacgt tggaagagcc agttagccag     60840
     aggctagcct tgctcatcat taccacgcca tactggcagt ggtaactcaa acccagtcaa     60900
     gtcccccatg ggagtcaagg gacaagctca tgattctaca gtcccattaa ctcttgcaga     60960
     acactgccca tgcaaatgca agctagatgc cagacagtga ggacaagaat tgatagacaa     61020
     aaaccaaatt gcatatgtaa atgaaaaatg agcatagtgc aaagcttcta ggtttaacgt     61080
     tgaaatgcac acaggaaggt taaaaaataa ctgttgcagt ttggaaatgt ttttgtgcag     61140
     atcgaacgca gggatatatg tagagtattc taagtagcat tgtggttgtc atggtcaatc     61200
     caagatattc tagtctatgc agttaatagc agtgatcaaa aaggagggcg aacttttctt     61260
     tcctgctgat caatacactg agaaaaaact acctgtgtct gcgtctcttg gcattttctt     61320
     ctgtgaagga ttcccatgca ctatggtcaa gcttgctcaa atcttctagc tctgcaatgg     61380
     taagcaggta ttgtgtaagc ttcaccagct cttgatcagt gcctctgttt gaatgggtcc     61440
     tcttgtatgg tttgatcaca agaccattct gtggattcat gacaaagttc cttctgaggt     61500
     catcaaacat gattgtgttt gtttcattgt actgcatatg aaagaaacag aagcaatgag     61560
     caaataattc aatgagaatc agtcacaaat tcacagtacc acgccactac taacctcggg     61620
     gaactgagcc caaatgacac caagaggctt gcaatcaaaa gttttctttt ctgacaggtt     61680
     ttcagattgc acagttatca tcgccaagtg atccataaga gcagtaattt tgtagttggg     61740
     gttgccaaga actccaagtt ggtccatctt catccccacc catttcatgc tgcattcaaa     61800
     ggccaattgt atttttcttt acttgtttca cagcacaacc ataaccagtt aactgataga     61860
     tcaggatcac aaaacgctta cctagttgct gaccatatca tgatatcata ttctgaatat     61920
     gcagcagaga ggaactcgtg tagatctgtg aagaggaata tggcatcaat cctcatgaca     61980
     gctcattgga aaacataata gtggtgatgg gagatgccct tacatggacg catcaattcg     62040
     atagggttct cagcagcgga cctatggtcg aatagagtat aatcaatgtc taagacaagc     62100
     agttttttcc ctttgcggca tggattcaat atcttgatct acagaaatag gaagaagaaa     62160
     agataaataa taaattcgac gtctatgtac atttaacaag atagcaatta gatcagtgac     62220
     ctgctttcac aaccaacagc atcaaaaagc actatacttg tatgagtagt agattattac     62280
     attaagtaga agacacacgc cagagtcaga taaaaaatac tccctccatt tcatattata     62340
     agtcgtttaa ctttttttct aatcaaactt ctttaagttt gaccaagttt atagaaaaat     62400
     ataatagtat tttcaacaca aaacaaacat attatctaaa tatattcaat cctagattta     62460
     atgaaactaa tttgatattt taaatgttgc tgaatttttc tataaacttg ttcaaacttg     62520
     ataaagtttg actaggaaaa aaatcaaaca acttataata tgaaacggag ggagtagcaa     62580
     atagacaagg tgacaacaga tagtgggtaa tagagcagat gccagcctat agaggaattt     62640
     caaaaactac ttactattct actccaagtg cctatatgat acctttcagc acaataagac     62700
     atctactaca aatcccaagc atgcaaaaca acaattagaa gtaaaactag tacatctaca     62760
     tagctagatg aggaattgac gataacttgt ggaacatagt agcacattgc agtaacctga     62820
     aaatcgctat agcgcccaca aatgtccaaa atctctatcc acaaaaacta cctcccctag     62880
     gggcttagac ttatggatca ttgctaagaa aagaagtttc tggctatggc ttcaatcagc     62940
     accacacaag agagagaata accctcgtca ctgttatggc tttggtctat gagcaagtga     63000
     aaccacaaaa tatttctaga atcgacatgc tgacatacta acaacctgaa ccacgctagg     63060
     aaatattacc aacttcatgt aggtcaaagg aacaagcact aagatgtggc tcaggctgtc     63120
     agaacaaaca ggatattgtg gaaccataaa agcatggata aggaagaagc atatgacagg     63180
     aaacgaaaat gacacgggaa tataccttat attgacttgc acgccgtttt agtttttgct     63240
     tgtagacatc tttatccttg atagcagtaa cttcattctg gcctatttca taatcattga     63300
     gtatctctgg atcatcttct tggtccacaa atatttcatc ttcaacagtg ctgaaagata     63360
     tacaaaatta atgcaaagta aatagaaagc accttcaaat gggacataag tacatggtgt     63420
     acaaattcaa attttcaaac agaaccatta tctttgagat gtaacgcagc aaaagagtga     63480
     tttgaaccat tgaaaaaaaa aaccctgaaa acttgaatat gctgctgttg actgttgagt     63540
     aaagccagag tgctaaatca atattaagag gaggtccatc tcccatggtt catcttggaa     63600
     atgataaaaa cagatctgaa tcaggaaagg tatcaaagct ctcacctcac agtgcctcac     63660
     tagaaaaacc acaagtgtca caccaaagta tattcaaggt aaatgcttca caaacttcct     63720
     ctgcaagccc tccataaggc atgttttttt ccctaaagag gaatactaca ttacaagtgt     63780
     tcataattag cgcaattaca tgcatttttc tcaccatcca agcatccact actgatccta     63840
     caaatggaag tactatggag tggacaaaat attagaaaca aaaaggtgtg tcaaatgaaa     63900
     gttctttgta acagccgtcc caatataaat agcataagat cctcctagtc ttctacacca     63960
     ttagaaggtt atcacatgaa tgaacaataa taatcaatct acacccaatt tacaatttgc     64020
     cagctataca accttactgt gtataattaa gatctctact acataaaagg gacatattag     64080
     tggtggtggt ggtgagtctg ccatcacaat actattcctt gagttggtgc gattcatgcg     64140
     gataataagg aacctcttga actaattggg tttttgtgga tagctcattt gtgcacatgt     64200
     gctgtaatag ggttatctca ttgatttatg gttggaagta tatatgttct ctgagaaaca     64260
     tatacaactt ttcatgttta gctcttctgg tatatttact tgagatctgt tgcaaagcat     64320
     gagtttagtt agcaataacg aatcatgatc caaccatgtg cagaatatcg gattacatca     64380
     gtggctcaaa ccacatagca cataagcatt taacagtcaa gaacatactg acatataaat     64440
     tagtttgcaa attttaccaa gaaataacat tcacataagt ggcaaagcat aatgagtaac     64500
     ttcacattat aaaacagaat aaaaggaagc taatcgaatt atgtccatag gtagggtttc     64560
     aagttcaaca aagcaaactt tcagaatagg acacagatct ataccctaaa cgaaaatttt     64620
     gaccatatac cctccgtttt gattgaaatt gaggattcac cctgctgacc cacatgtaaa     64680
     tgaccttaga tgactcaaac atgtcattgg cataggaggg taaatcctca attttccatc     64740
     taaacggtaa atgatctgat ctcccggcct aaatggtatt gtccaaactc gaaacagact     64800
     ttctttaaag ttcaagttca acaaagcaca ctttcagatt agaacacatc aacacagatc     64860
     ataggcttaa atggtactgt acaaacagac taactagttt gcccctggat catcattcag     64920
     gttcttcaat caccaccaaa aacatgccaa ctgaacatat aacatcaacc accatccaat     64980
     ttcgcatcac tatcagaaac acatcagaaa agaaacgata acgggcctct agagatttaa     65040
     gaaaaacaac atcctgctgt ttttctattt aaaaaaccca ctaatccata atcattttgc     65100
     agccattggt aacactaatg catcaattta acaataaatt cacatgctcc acggatgatt     65160
     ccattgcaac tacagcactc ccgaatgtgt tcaaactgtg aggaatcaag gtttgagaag     65220
     gttattcctt cctctcagat gaacaccaca taacctcagt cactccacgt tactccacgt     65280
     ccattcgtga aactaatcta atagacaaac gtctccacat actgctactg gatgtcaatc     65340
     ccaaacttca aataccgttc ccagcatctg agaacccata ggaaataaac aacaatttca     65400
     aatcatgaac aacgcgatgc cactggatcg aatagatcgg tcgaatcacc aaccgaaatc     65460
     caacattccc ccgaattacg agctaatcat ccagttcaac gacgagtaac caaatgtttt     65520
     cgcagtcagg tatctgcaga acacgagcga gagtagacac gggacggcac atggaggtgt     65580
     agggttcgag gaggaaggag ggtattgcgc ttacccgatc atgttgatct tgacgttggg     65640
     cttgaagggg atggaggaga tgagctcgga gtccttgcac tcgttgagct tgaacttggg     65700
     gtagagcagc ttctgccgtt tagggagaac ccccgtgacc tcgcagatgc gccgcttcag     65760
     ctcccccagc gtgtcgtccc cgaccacccg caccgtgtag tcgttccctt tccacttcgc     65820
     caccagcgtc atctcctccg gtggcgctgc ctccgccacg gcggcaatcg cctccgggtc     65880
     cagcggcggg accgccgccg ccgaggacga ggacgcctcc gccatcggct tggggtctga     65940
     agaaacaagt ggaggttttg ggggaggaga acgagaatga tgtgtgctct acagctctac     66000
     tgttccttct gtacggggcg gagaataaca ggaggccagg cgtttacgta accgccactg     66060
     gaaggcggaa gcggaattgt tgaacagcag atcgaagata gcgaacggat gggctaacct     66120
     gcactcagtg gcggattcaa aaatttttat gagtcgggca agtctaacaa caaatgaggt     66180
     atatacaagc ctatataatt catagataac tttagtatga acatttgttt taaaagtttg     66240
     tgttgagcgc gtttactgtt gtactagttg cattgtactg tcttgccggt gactaagaaa     66300
     ggtgattact aagataatta ggcactaatt tactggtgaa ttgttgcgtg cagctggtgg     66360
     agccagggcc attgcctgtt caagccgggc tttggctccg ccactgcctg cactgttatt     66420
     ggagatccat actccctcca tcctatcttc ttatatagtt ggtacccatt aagagacatt     66480
     tacttctata aagtaagaca tgcaagaagc cacatcatca acaattttaa gccatcagat     66540
     catatttagt acaaatttta taaaaaaaca aacctaatac gagaatacta cggagaatgg     66600
     attatcatat tatgtttgtt ttttatggga tgaaaaaagt gtcacctaga tgtaacacat     66660
     tttagtacta tagatttgga tatactcaaa tgtcgtatta tgtttgtttt ttattgacga     66720
     aaaaagtatc atctatagct gcagtccaac catgcgattt taggctttaa ctctaccttt     66780
     aaaaagagcc gagcatgtta gagtgatctg aaaagataaa ctaaaaagat gaagcgggat     66840
     tcagactact ccaaagctat acttgagatt tcgctcttgg agttagctag agtgttatca     66900
     aataggttat aagggcatta taagtgacta actgatgtgg ttgacccaat ttaggccttg     66960
     tttagttcca aactttttat tcaaactttt aacttttcca tcacatcaaa actttcctac     67020
     acacataaac tttcaacttt tccatcacat cgttccaatt tcaactaaac tttcaatttt     67080
     ggcgtgaact aaacacactc ttacccgatc gatcattcac ataaactcct ctctctccct     67140
     cctaaccacg ctcctctcct ctcctaagtc ccaacaacgc ttggctcgat gactgggctc     67200
     taaattagat tgtgctctgt atgtctggtg aacaaagaga tgttgtgatt gattgaaatt     67260
     agaatgtagg tgaaaaaaat gttactactt ttaggataaa ttttaaatat tgtgtattat     67320
     tttttttttg atggaatcct gagtacttgc atttgcgact gtaatctaga cgttgtgcat     67380
     ttgagtaacc atcaaccact tgtatcttca acattgattt tgttatgatg tcactccctt     67440
     cgttttgaac tacttattat ctgagatttg ttctaagtca aatattttca attttgacca     67500
     ttaattacta gaaatttata tagcttaacg acatgtgaat catatatcat aaaattgctt     67560
     tctctaatga atttgaaaac ataaacctaa atcttatgat gttaaattat atgatttttt     67620
     aaaagaaaat acggtcaaag gtaagaatat tcgacctagc taaaataatt ttaaatagag     67680
     agaattgtat tcataacaat aaatatatta ttataataaa actaaatcaa tttttaacac     67740
     aattcaacgc gttagaaggg ctaaacaaca tgatttgtta gtttgctaaa atttgtagcg     67800
     cctaaatctg gaacaaaaca aattccaatg gcatatttgg ttcgctgcaa tttctaacac     67860
     tattagattt tggcaccatc tgattttggt aagataacaa accatacatg ctttaaaaat     67920
     accactatct taccaaaaaa atacgcagca acaaattcaa acctacgcaa tactataatt     67980
     tccccttgaa attcggaaat gtaacaaaca cttgactcta caccctacct tgtcaaaatg     68040
     tgataatggc aaatatttat attttgcatg tctgaggttg gcttcaacat gcccctgccc     68100
     tggagcttcc taaaagtatc caaagtgaaa tttaaataaa acactagata tgtgaaaagt     68160
     ggtgattgtt catttttgtg atcgaaagct gttttttttt tccttcgggg attttgtttg     68220
     tatgttgaag ttggaaagta gatgtggaac cctaattgaa gtcgatttct ggtagtacaa     68280
     gtttgagttg agaagttagg atcaaacttg ttgaaagctg tgacagagcg ccgttcgctg     68340
     gacacagatc ctgaacgcat cttcactcca ctacccctgt acaggctgtg catcacacgg     68400
     gggtcgtcac gaaaacgtgg cactcgtcca ggagacggga cgggggtcca ccgccgaagc     68460
     agcggtcgct ctcatggact catcgtcacc cgaggcccga ccaaggtcac atgcgcggat     68520
     gcgccccgcg actccgcgac gccgacgcga tccacggttc cccggcttcc cctccctccc     68580
     cgcgtcgcgt cgcgtacggc atatccatcc ccaatccgct gcgtccgcta tcccccgaac     68640
     ccatcggcca cggccagctg cagcgcacgc acgcaccgtc ctcgcgccgg ctgcccaacc     68700
     caagccgcga gtgacactgc gtgcgtgccc atcgcgtgtg tcgcgttgcg tttgcttgcg     68760
     cggaacggcg ggagagatgg ggcgtccaca ccgtcgtcgg gactgtgggc acggcgcggc     68820
     acaccgagag aggtgccgca tccaatccaa acaactgcac tccactgtcc ccactccccc     68880
     ggcgcggcgt ctccctcccc acgctatttt ataccaccac caccaccacc gcgtggtact     68940
     tgctcatacg ccgtatcgac caccaccctc gacggcggcc atggcgggcg cctcctccta     69000
     cttctcgttg cggaggctac tcctcctgct gctgccgctg gtaccgttgc tcggcgccac     69060
     caccgccgcc gcagcgggcg ccaactcgag cgtcacgtat gaccaccgct ccctcatcat     69120
     ctccggccgc cgccgcctcc tcatctccac ctccatccac tacccccgca gcgtccccga     69180
     ggtatgcacc ccaccccgaa cgccagcacg cgcgcattgc ggtggtacta ccggtaacct     69240
     cgctgctcgt gctcgcagat gtggccgaag ctggtggccg aggccaagga cggcggcgcc     69300
     gactgcgtcg agacctacgt gttctggaac ggccacgagc ccgcccaggg ccaggtccgg     69360
     gccgcctctc caaaatttgt gatggattta gcatgttcga tccgtgataa acctgtgtgt     69420
     tttgtgtgcg attggtgaat gctgattgca gtactacttc gaggagcggt tcgatttggt     69480
     gcgattcgcg aagatcgtca aggacgccgg gctgtacatg atcctgcgca ttgggccgtt     69540
     cgtcgccgca gaatggacct tcgggtttgc ctcttcgtta tactgatgca gtgtcacgat     69600
     tggttgtagt tgtgcagaat tatggtgatt cgatttctct gggttgatgg gtttatccgt     69660
     ttatgtgtgc gtggatgtac aggggcgtgc cggtgtggct gcattacgcg cccgggacgg     69720
     tgttccggac gaacaatgag ccgttcaagg tgtggcgggc ttgtgaattt cgtggcgttt     69780
     tatttgggga gtttgcaagt ttggtgatgg ttatactgac atttacttac gcagtctcac     69840
     atgaagagat tcacgacgta cattgtggat atgatgaaga aagaacaatt cttcgcttcg     69900
     cagggtgggc acatcatcct agctcaggtc tggacattgt catactaatc ctaattgggg     69960
     cgctgaaaca tcaatctgtt tctatcaact ttgagatagg tgtacttcac aattgacggc     70020
     agaattggtg cactgtaggt tgaaaatgaa tacggagata tggaacaagc gtacggagct     70080
     ggtgccaagc catatgcaat gtgggcagct agtatggctc tggctcagaa tactggtgtc     70140
     ccttggatca tgtgccagca gtatgatgcg cctgatccag tggttagttt ctaacattca     70200
     acacattttg cttaatgaaa catttcaacc atgaattgct ccatgaaaca tactggcagt     70260
     cagtgtatgg tgtaaaattc tttgaaagac cagcacatct gctatatttt gtcactgaca     70320
     gtgtatggta taaaatcctt tgaaaagttt tttcaaaatc tgagagattg tggtaggcaa     70380
     actgaacagt gaacagcaga taatctgtgg cacttgaaat cgtaacctcg caattggtgt     70440
     ttttgtactg ctatagctat caggattgtc tttccataac gtcttcaagt attcttcccg     70500
     tcattgtgtg attcataaca tcttggcata ttcatgtgat tgatactgat gtaaataaag     70560
     tttttgcata tgcagtaact tttcttttgc ggttacactc acgcattcaa atttactttt     70620
     gcagataaac acttgcaatt cattctactg tgatcaattc aagccaaatt caccaaccaa     70680
     gccaaaattt tggactgaga attggccagg atggtaacga ttttgacata ttagcaacag     70740
     actccatcta gtacttctca tgtctttata gcacaatatg gagttaatat tgtagatgtt     70800
     ttaaaagaga agctaattga tgtgctgctg cttgtttctt cctatttgaa tttaggttcc     70860
     agacctttgg cgaaagtaat ccccacaggc cccctgaaga tgttgcattt tctgttgcac     70920
     gtttttttgg gaaaggtggc agccttcaga attactatgt ggtaattgct gttgcagaag     70980
     ttacatttta atttgataaa ggcacactga taattgtttt ctgttgattg cactaccaaa     71040
     gatttacagt caagttcaag catcttgata catttttagt catttgaata caatttgtca     71100
     gtatgaataa ctagtggaag ctccatattt ctgaaagttg aatcaagttt tctctatcct     71160
     tttgaagtac catggtggaa caaatttcgg tcgcactact ggagggccat tcattactac     71220
     tagctatgac tatgatgcac cgatcgatga atatggtttg gatttattgc tgttattaat     71280
     tccatcaaac tattaagcct aaagagttct tagtagtatt agttgatctg aaatgcaggc     71340
     cttaggagac ttccgaaatg ggctcatcta agggaccttc acaaatctat caaattgggc     71400
     gagcataccc tgttgtatgg taattcgtca tttgtttctc tggggcctca acaagaggta     71460
     ggttttatcg ttataacctt tgacctaaat ctggtttcaa tattatatga aagcttgcat     71520
     caaaacttct tatggatatt aacttcaacc catctctgct gtaaggagca ttgtacattt     71580
     aaatgctgct tatgtctacc atactgtaac ccattggtgt tttaatgcac actgctattc     71640
     actttttgct cctgtattta tcccctgatt aaatcattat tttcttctac caacttatgg     71700
     aattgatagt gtcccatttt tgcttgcagg ctgatgttta cactgatcaa tcaggaggat     71760
     gtgttgcatt cctttctaat gttgattcag aaaaggacaa agttgttact ttccagagcc     71820
     ggtcgtatga tcttcctgct tggtcggtca gtatcctgcc tgactgcaag aatgtggcgt     71880
     tcaacactgc aaaggtattt gattttctat gtcaatggtc ttctgaatta caacatgcat     71940
     tgctgcaaaa aatgtttttc ttaaaagaaa aaaagccttg tcaaaacaaa acggatagca     72000
     cccttctcaa caaatggaac atggatagca aaggaattaa aaaggagcaa aataaatggc     72060
     aaatatcaga atattttatg cttaatccga gttatataaa aagtgccata ttgcacgaag     72120
     ttcttttctc ccaaataatt gtagctcctg gctcttcatc tttaggtgcg atctcaaact     72180
     ctgatgatgg atatggtccc tgcaaatttg gaatcatcaa aagttgatgg gtggagcatt     72240
     ttcagagaga aatatgggat ttggggtaat atcgacttag tccgaaatgg atttgtagac     72300
     catattaata caacaaaaga ctctactgac tacctatggt acacaacaag gttggtatac     72360
     tgcagtctgt ttcatatata ctacttctat tgcaaataga tatgcatgta acaatccaaa     72420
     aaagagatct tagtattgtc catattataa gtttttttaa ctatgaactt tcagttaatt     72480
     atgtggtctt tattctttgt ggaatatgca gttttgacgt agatggaagt catctggcag     72540
     gtggcaacca tgttcttcat attgaatcca aaggccatgc tgttcaggct ttcctgaaca     72600
     atgagcttat aggtttgttg cttaccctta ctttgctgag agaccatcat caaatcacca     72660
     tccaatacca ttttcagttc agccgaatct tctgaatgcc caatcatttc catataatca     72720
     aaatatatcc ctgaaatgag agttttatat aattgtcacc tcttcttctt catctttttt     72780
     tccccaaaaa gacaaccata tatatcttca gcagcacttt ctttgcatat atacacttta     72840
     cagttctctt caattattga gttcttctgt ttaatgtcat tactacttgc aaatctttct     72900
     taggtagtgc atatggtaat ggctcaaaat caaatttcag cgtggaaatg cccgtcaatt     72960
     tgagggctgg gaagaacaaa ctttccctat tgagtatgac tgttggtttg caagtaagtg     73020
     cctacgttta ctgagtttta catacgagtg tatgactaaa cttgaggcat atcctttaca     73080
     tgcaaattgc tatttatggc atgtcaattg tacccacttt tgtcaaaaga aagttctaac     73140
     tgtaccctat agtttgttaa gcctgctatt ttagcttcaa gttaaaaatg cttgaatcat     73200
     ctgattgata aaaactgtgt gccttttaag aatggaggac ccatgtacga atgggcagga     73260
     gccggcatta caagtgtgaa gatctcagga atggaaaaca gaataattga cttgtcttcc     73320
     aataaatggg aatacaaggt acaagattgt tgaatttgtt cagatatttg tgtaatgaac     73380
     tcaattgatg ataaagtagt atactgttcc ttcaaagcca ttctataatt tttctcctct     73440
     ctttctatgt acttgggttt gctttctatg atgacatatc cagtatttgg ggcaaggtga     73500
     ggtgtaatgt ttatgtgaat cttatgtatt tgttggtaga ttggattgga aggggaatat     73560
     tatagtttgt tcaaggctga taaggggaag gacataaggt ggatgccaca gtctgagcca     73620
     ccaaaaaatc aaccaatgac atggtacaag gtagccttct tcggtctata ttttccatac     73680
     gtgtttttct catcgtacta cttgcggtaa actactaatg caacatactt ctaggtaaac     73740
     gttgatgttc cccaaggaga tgatccagtt ggattagata tgcagtctat ggggaaaggc     73800
     ctggcttggt tgaatggaaa tgccattggg aggtattggc ccaggataag tcctgtcagt     73860
     gacaggtgta cttccagttg tgactataga ggaacgtttt ctccaaataa gtgcaggaga     73920
     ggatgtgggc agccaactca aagatggtat gtgacgattt ttggcacagc tcacaatacc     73980
     ttttttttca tacttctcac atttcacatt tctgtttgca tttggtcaag gtaccatgtc     74040
     ccacggtcat ggtttcatcc atcaggaaac acccttgtga tttttgagga gaagggaggg     74100
     gatcctacaa agatcacatt ctcaagaaga actgtggcaa gtgtgtgctc cttcgtgtca     74160
     gagcactacc cttccattga cttggaatcc tgggatagga atacccaaaa tgatggtaga     74220
     gacgcagcaa aagtacagtt gtcttgcccc aagggtaaaa gtatctcttc tgttaagttt     74280
     gtgagttttg gaaaccccag tggaacctgc agatcttacc aacaaggaag ctgccaccat     74340
     ccgaactcaa tatctgttgt tgagaaggta atatgcacag ttcttgcaca aaaagtgcac     74400
     atctaatcta aaacttgaga gcctttgatt ctgactttct gatatacgtc gatgcatgtg     74460
     gatttagatc catcagttct gacttgtagc catagagcaa ctggaattat attatgtttt     74520
     tactgttcca aaccagggaa cactgggttg ggcacatagg agggtaaaaa ctttccattt     74580
     caaaggagcc atgagttccc tatgagttgt ccaataacta tttctggact gaagttatat     74640
     ggagatcttg atattactga ccatcaaact ttataattgt gctgaactgt tgtttacttt     74700
     atcttggcag gcctgtctga acatgaatgg ctgtaccgtc tccttgtcag acgagggatt     74760
     tggagaagat ttatgccctg gggtcaccaa aacacttgcg attgaggcag actgctctta     74820
     aggagtttaa ctcagcaatg agatccatcg ctacagattc gctcatcaac ttgaagctta     74880
     tagtgcttgg tacagtagca tactacaaca acttcgaagt gaaatcctac ctagatttag     74940
     attacgacct gttatgagca tgatttggca ctttgtttct ttgacttctc ttttgctcaa     75000
     caatatgtcc aggtaccctt gacgggtcgc cattgtggat gctaaccatc cacccgagca     75060
     aaggaattaa ttgcactgca ttcccaggtt tgcaatggac tactgtatga ttcagaaaca     75120
     tgaaggcatg aacgagcttc tatgagccca aaaggaatgg gatataatat aatatgatat     75180
     attgcgatgc ccatgaaaca tttcataatt gtcattttct tcgtgtttag acttgctgat     75240
     atgtagacac cagatcgcac tggagaaagt tcttggattg ctctcttcat gttgtgtcgc     75300
     gtcatgatat ttctggatta acctgtgaat gaatctatgg ttgaggcagc aggtggtcaa     75360
     cacagtagtt catctctcgt tatgattggg gagacaaaaa taagttgctc actgtgcggg     75420
     tactgtgatg ttgctaagat cacagtgcgg aagaaaccac tagcttgtgg ctccattggc     75480
     cgtagattct ggataagatt aagtaagatc tgcattccat tccatggcgt acggaatgga     75540
     tgttattaaa tctttgatta gccatggatt aaggagccgg ggcctttgac tggatgccgc     75600
     ttcatgtttt ccttgtcatg tgagtattat ttaggggccc tcgaattaag tcctaatcac     75660
     ccacagcctg ttcccttcct cttctccctt cttccgtagt ggtttcatga ctccattgat     75720
     aggccatggt acttgtacag tatcagggaa taaataaata ttggaggaat catctccatc     75780
     gaaaaggaaa acagagattt cattctccct tgttccaatc tcttgcaatc atgagagtga     75840
     tttctgttga gtgcttcagt ttgagtgatt tttgtctgcc gtttcagtaa ggttcgtgaa     75900
     ccaaagccgc cgaaagtaca ccgcaaagca attcagagag aaaaatgatt ccagattggt     75960
     ttcagtaatc tcaactccgc tttaaataat atggtttgat cgtgaaatca cataaaacta     76020
     tgattgaacg atggttttca tacaattatt ccattttgat ttgattgatc ccttggtgtt     76080
     tataatgtca tgagagagag gaggcaataa gggtgtatag tatatgaaca acgagatgag     76140
     gaaaccaatc aagaagattg aatatgacat gtagggccca ccactgatga tatctgccgt     76200
     tgatcaacta cgggacatgg atcggaacag gaacaacagg gaaaccgcat cccctttggc     76260
     tggtgaagaa taggaaatca cagtttctat tggaattcat cgatagatgg ctagttgaaa     76320
     tttgaagcgc gaaaagttcg tcaatggaca tgtaagaatt aggatactag acaacattgg     76380
     ttgttgggaa caatattcgg atgttaggtt tgagaggttg gtgtcaattt ttgaaagccc     76440
     catataccgg tttgaaacgc ttggtacttc gtgtacgtgc accagcgggc actcagtaac     76500
     catcatatgt ttggtttcct agagaaaaat ggactcgagg tttggataat tgggttggaa     76560
     atatatgcaa agtggttcat gtcatggaga gagacacgtt atattttcag taaaacgtaa     76620
     cgaaaatacc ctccaaatat tgtgtacata cactgacatt atgacatgcg tatggttttg     76680
     tatagttaaa tgtggataat ttagaaaagt accttgtgga atcatcattt gtgaaacata     76740
     caagtattta agaaagcaga ggcagagcgt atttaaacac attgctctct tgtttttcca     76800
     tcattgactc attcgagtaa tgatcggtga catctcagcg aacagaatct tttctcttac     76860
     tccggcaagt tcattccaga aagataaaag agtatttgcc gaaaaagcat ttcccaataa     76920
     gtttcaggct cgaaaaccat cttgtgcaaa atttaaagtt cttgcaaaag attttatcca     76980
     tttagagcct tgtaaggtaa gtcttcaaca ttgtatttct gaagactagc caactaattt     77040
     gtttttgcta agattagccc ggctgttcat ctgtcatcca cttattaatt tcagacatta     77100
     agcagtatta tgacttgtga gataatgcat acaggtgtgt attgaatact aaggactgta     77160
     ctagcgcatt ggaagaatat ccagaataga ttgcaaggca ggcccagcca tttctccgct     77220
     ctgagcaata ttaggatata ctaattgcag accaagcgtg tcgtacatat atattgtaat     77280
     agcagcgggc attgcatgat ttggtgtaaa tatgcagggc ccgggacatg aatgatttgt     77340
     gctatctttt aacacaagcc tctcatctga agattgatgc aagtaaagat aaggctccct     77400
     gtggtgaacc agtgtgtccg gttcggtgcg tgggtgattc tccatgtttt gggctttgcc     77460
     cctgtggtgt gagagcctcg ggctctcttt ttcttttttc tgtacagact ctgaattttt     77520
     cttcttctta atacaaagtt tggccggcaa agccggcccg gcgacaagat aaggctcccc     77580
     cttgtagcaa gaaagattgg caactttagc aatcacatcc ttgaagattg gggggggggg     77640
     gggggggggc agaagtttct tgtttatgcc acttgttcaa aacttcaatc aaacaatata     77700
     tcacagatca atcagagcct cttttgtaaa gataatctga tggaatgcat acaatatttg     77760
     aacaaaagaa aaattagtgg ttctgcttct gcatagtttg gaggttctat agccgtctag     77820
     gcaaaaaggc agctagatat ctttccccaa tctgccgaca cttgagtggg agacacctct     77880
     gttaactatg atgtcgtata ctgatgttgc atcaggtcgt ttcacaggta ccaacaaaga     77940
     catgaaggaa aaccaagtta agggaaagga agaaagaaaa tgattccaat agttaattgc     78000
     tcggtttacc ttggagctca tggattattt gtgatttgga cgccagcagt gtgcgtgcca     78060
     aactgtcatc acattgctct aatcctcttt tgtgataatc ctaatagttt gaagagatga     78120
     cgtaacgaag aatctaatca tgctctcctg gcttcgagtc cgacctacaa tatcattgtc     78180
     aagtgactgt attctaagca acatttacta ttatacagtt tccagtagga gggcaaagga     78240
     caaaatcgaa gtcatcatca gctagggaga catatcttaa ttttctatca ggaaaaggca     78300
     agcccaaagg agatgaaaat actacgcacc tagataggct ccaacaactt gtaatataca     78360
     ggccaatgat ttgccaaacg aaatatatat atcatattgt gaactttttt cttgagagat     78420
     atctgtatat tttcggaggg gggggggggg gggtcccctg tctagccaat agccacaact     78480
     ttagcatttt tggtaagtcc ttggtaagta taaaatacta ttcttcattg catacacaac     78540
     ttttccatga ttgtaccacc gatagttcgg aaaaaaaaag aaagaaaatg taccaattct     78600
     gaaaaatgga gatatcaaat gttcaagtta acctatgaac aaatttaatt aaaaacaatt     78660
     tatttattca tctacttgtt tgagagctag aaatttcatt gttgtttccc tctttgctca     78720
     gtttctcccg atcaagtgac aagcctaaaa cttgaactca agtgaatagg ttccactagt     78780
     ctaactagtt aattgagcta cacttatttc gctccatcta aaaaaatcct caaataggat     78840
     tatttcagta tggtccagtg tttttcctag gttgaagaga tctaattttg acaaataaaa     78900
     aatatatcat caattaaata tattttcttg cggggaatat catcaactat atatgatcct     78960
     gggtatatcg ttttcaaatg ctaagaacga aattgctaaa gagaaaatga ccaaatcatt     79020
     ggattctttt ggcttcaatt tatcattgga tcccccatgt tcttgtctcg acattactcc     79080
     cagtatttct tcgagtgaaa tagcatggat gcaaatgctg atcccatcac aactaacaaa     79140
     gatacatagc acatgattgc tcactcaccg ctgacagagc taagcgattc ggatcttctt     79200
     ttccactggg tctacacaat ttcaccccaa cttccccctt ctgtaactaa cattcgtttg     79260
     agtgtccaaa tcacgaatta aatgttgatc tgatatgaaa gccatcctat gtgtattcga     79320
     acagctctca gggctgaaaa taaactttca taaaagtaag atttttttgc tttgggaaag     79380
     ccaaggaagt ggaggatcaa tatagataac tatttggctg taattctgga tctttcccgt     79440
     ttagatatct tggtattcct attcattatc ggaaactctg gaatgttgat tggaaaggag     79500
     ttgaagatag atttgagagg aaactcagca catggaaagg caaaaacatg tcatatggtg     79560
     ggagattggc ccttctaaac tcagttcttt cgagccttcc cttgtttatg ttatccttct     79620
     tttgaaattt cacgaggtgt gcttcaaaga ctggattact ttgggtcacg tttttttttg     79680
     gagtaatgat gaccggaaaa gaaaatatag actaactaag tgggaaaaca tatgtcgacc     79740
     aaaagatcaa ggtggactag gtgtccataa ccttgatata aaaaatagct gcttattaag     79800
     caaatggctt ttccagctgt ttaatggtga aggcctatgg caagaccttt tgcgaaataa     79860
     atacttaaag ggtaaagctc tttctggtat gtctagcaag ataggtattt ctcagttctg     79920
     agccggttta atgaaagtca aagaccaatt tcttaggttt ggttctttta gatgtggcaa     79980
     tgggacaaac ataagatttt gggaagacac gtggttggga tcgcgtgctt tcaaagatca     80040
     ataccctaca ttatctaatg tggctcgaaa gaagcagtct actgtggcag aggtcatgag     80100
     cacaacgccg ctaaatatct cttttagaag agctattgtt gaccaaaagc taatcgagtg     80160
     ggacgatttg atcctcaggc tagctaatat aactctgtca aatgaaaatg actgctttgt     80220
     atggtcgctc cataagaatg gtcaattttc cgtcaaatct atgtataccg caatcatgaa     80280
     ctgtaatgtt cggatcaaaa agagaattct gtgggacttg aaaattccac taaagatcaa     80340
     ggtctttatg tggtttcttc acgagaaagt aattctaacg aaagataacc tggctaaaag     80400
     aaaatggggg gagacaaaca ttgttctttc tgctatgcac aagagacaat ccaacatctt     80460
     ttctttgagt gtcatgtcgc tcagtttgtt tggagatgtg tgttttttgc ttttaatatc     80520
     ccccaccccg taacgccaga aacattttcg gtaattggct tagaggggta tctaggtcca     80580
     ttaagaagat gattgtaatt ggagctagtg ctgtatgttg gtcaatttgg cgttgtcgca     80640
     atgataaagt ttttaatggt aaacaattat ctaaccctat gcaggttatc ttcatgtctt     80700
     cctactggct ccacttttgg tctacaatgc tactacagga ggagcaggat actatgcgca     80760
     atggtgctac actcttggaa tcggtagcca agggtctctt attccactat gggtggcgta     80820
     gttccataag aattgctagc taaaatattt tatgtggttt aacgctagtc aataattaaa     80880
     ggggagttgg ggatttgtcc tatcacctta tttctcattt tgatttactt ttatcttata     80940
     tttttattac tattaaactt atagctgtgt gtcttataac agaagccgta gatgtaatcc     81000
     attttcatta tctaaaaatg ttgatctgat ttagacttgt catatggggg tcaaaccagt     81060
     tcacctttca tgtttcactc agccacaggg acgcccatgt tgcagcctct ctcgctgtca     81120
     cttcgtcgct actactaccc ctgtcgaata gtctttctgg tatgattgac tcatttctgt     81180
     tttctgtagg tttgttgtgg atgtctgctt tgctgggtga agctagcgtg agctagccga     81240
     tgatttattt tccaaggaat gcgttgcatt gaatcgttgg gtagtaatat ggtcttaatt     81300
     cggcaggatt gtcggccaaa agtgaccccc caactgcaag caacgttatg gcttcttgga     81360
     ccttcacgtg actgtcccta gtgaggcgat tactactgaa catagtggag tgagtgagtc     81420
     tcctggtacc ctccttgctc gatctctgta tatatgtaca aggatttctt ggcaggtaga     81480
     tcgggcgcgt caaagtattg taactgcgat cgtttactac gtccggttga gttacggatc     81540
     gtttactacg tccgttctgt tcggcattgg cttccatgag ttacggatcg gggtttgttt     81600
     cgatgccaca tgtccaatta cgctccggga agggaacatg agaaacgaga aacgaggata     81660
     gcccatcgaa cagaacggaa ccgacccaaa ctagcggcgc cgagccgaga cgtagtacgt     81720
     gacaaagatc gcgacacagc gtggacgagc aaccgccgcg tacgcgcgac ctacctgtgg     81780
     ctcctcgcgc gcgccgagcc tagccgccac ccgcgcgcac cccgcgcgta cgtggtgaaa     81840
     tccacccgat gcgtaacaca tccatgagca attaagtaga taaaattaca aacagatcag     81900
     tgttagtaag aatttaataa gaaaaagtta gtacgtatag ccttttccca catccaggcc     81960
     cgcgaggcag ccgcagcgcg cgacggcaaa cgcggggatc gccgtgctct cacaagccca     82020
     cacaacccgc cgggccgcga tggattgggc gaatctcgcg cgcgcaagcg gggggcgcaa     82080
     aacgtctcgc cccgcgcggt gtccgcagga cgaacccggt gtgcggtgcg gagcgcggcg     82140
     tgtgcgactg tattacacta cgtagtagta cgtgggacaa acatctttgg gctcgcgctg     82200
     cggcgcccgc cgcacggacg attcggtggg gggttcacca tatgctcgtg gcggcttgtt     82260
     aattcgccgg ggattgcatc ctgaatcctg atcctgatca cccaccccaa tcgagattcg     82320
     agaagctaat aacggacagt ttgtccctcg aatcgcgaat cgatccggtt ttcggtttcc     82380
     ctctactgta ctgcacgtgt tcgtcgatcg caggcatcct cgcaatcacc ccatcaatcg     82440
     agagatcagt atatttttta ctacaagttt acaaccaact ccaaaattaa tctaccacgt     82500
     gagatcgcat cgctccagat ccgaagaagt tactgcaact accactacac caacaactac     82560
     agcatgtcca acgccccagt ggccactggt ggtcagttcg tcacgcacct tggctccaga     82620
     ccctgcgaca gaatacgtac gcaccgctgg caaattttgt tgccaccctt actacacaac     82680
     gtgctcattc aatttccatc ggcccggacg atcaagatcg gtacgtgtat gtgtacccgc     82740
     ctacacgtcc gtatacgtgg cgtcgcgtct gcacagagat ggaccaggtg gcgatggcca     82800
     tcgaccgacc gatcgatcgc catctccacc accagcttcg cacatgcgca cacggccgtg     82860
     acgagacgac gcgctcggga acagaagaat ccaaggcgtt tgcatggcca ttgactagaa     82920
     gcgtacgtgc cccgctcgca gtttctaaaa tccaatcgag tacgcgtagt agctcatata     82980
     attttatatg acaatctgtc tgatagtgta caaagaaaat tttatatgtg ttgtggtgac     83040
     tcagccagcg tgataggctg acaggcagca cagtgcgagg agagccactt gatctgaatg     83100
     gggggatcaa gtagagacac acacacacac atcatatgca cgagcaaagc attttcattt     83160
     gggccggtac ggacaaggca ataattgcta accgtgccgt tcttattccc caatcattca     83220
     cctccatcag ataaaaccat cttgtaatca tgcactactg caacacacag aacactccag     83280
     ctctcgtcgg ccgtacacgc agtaagtctt tggcgccttc tccctctgta gttggcacct     83340
     ttcttcagga ctatatatta taaaaaacat tacgacggct ttttacgatt ccgtcttacg     83400
     gcaaaaatcc gttaatgatg gatttggttc taaaattata tttgtagtac tagtagtacc     83460
     cctagatcag tttgtgtatt ccaatttttg taactaaaca aactaatgaa tctgctaatt     83520
     ttttatttct tgtagcccat agcttagaac atactctttt tgtaaaaaaa aacacaatcc     83580
     taattacgaa atagacatgc acttattcaa ataatgctca gaattgaatt tttttatagg     83640
     gttgtaacca tcaaaattct ttttctcctc cactggagaa gtagatggta ggcagtccac     83700
     tccactccag tccttgtcca ttgccaattc acccctcatg ccgctatgtc cccacatgca     83760
     attttttccc tccctctctc taaacaccag ttcaaataaa tgcccctaca taaaagccac     83820
     tcttctctct cactcactca ctcacccaca cagccacact cgctgtgttt ctcctctgcc     83880
     gcttaaccac ctccctccgt aacaaactcc tcatttcgct cccctccctt gctcttcttc     83940
     ttcttcttct tcttcttcct cctccgcgac caccaccgat ccatccatcc accgtgtctt     84000
     ctcttccctc tccaatgggg aaccctcccg agctgtacca ccgcatcctc aacatcccca     84060
     gggagacctc gccgcaggaa atccgcgccg cctacaagag cctcgtcaag aaatggcacc     84120
     ccgacaagca cccgccgtcc tccaagcccg aggccgaggc ccgcttcaag gccatcaccg     84180
     aggcctacga ggtgagcccc tagccgtgcg ttgcgtgcgt gcgttggctg tagattgcga     84240
     cggcgtcgtg tcgtgatgtt gggcgattct tggttgcgca ggcgctcctt gaccagcagg     84300
     agaacagggc ggtgttcggg gtgtgctgca acgacggccg cgcgggcgag aaggccatgg     84360
     cgtgcggcgt ggtcggcggc ggaggggcac acatcgcgag gacgcgcagc gacgacttcg     84420
     gcgcgaggat ggcgcccggc acgccggcga gggagttcaa gaaggtgtac agctccggca     84480
     actccggcgg gcggcgcgcg ttcgccgagt tctccagctc aatcatgcgc aaggcgccgc     84540
     cgctggagcg caagctcgac tgcaccctcg aggagctctg ccacggctgc aagaaggagg     84600
     tcaagttcac ccgcgacgtc gtcaccaaga acgggtatac ccctttcttc ctccacctaa     84660
     tccgtgagcc aagattgatt ggagctttca cctgaattct ggcgagcaat cgcttgtcat     84720
     ccatccatcc attttcctct tttaaaacta acaattcgat gcaaccggaa caaccctgat     84780
     gtgattcgct cacttgcatg ccaattttaa tggatcgatg cttggaaact tcagagtagg     84840
     caagaattca gaatttgttc tgatggcgac atccattccg ctttgtgcct ccccaattct     84900
     ctgcactgtt cggaacaaaa tgatccatga acagtgaaac agcacgacca cttccttcct     84960
     ttccaggcta tggcgcactt cttttttaca gtggagggtg actgctttat tatagcctgc     85020
     atttgtcagt ggaatattta gcttactttg gaacacatga aaaccttttt acacaagttc     85080
     cctttggtgt gtaccttttc tcttccgggg tatctatcct attcttgcaa cattatccta     85140
     cctaacacaa agcataataa cagcagtgtt gatcagggtt tagtacatgt taagatccaa     85200
     tcttgaggag ataaaatctc aactcaagtt gctttcgttg ccacttatgc gtatacgtgt     85260
     ttgtcgaggg cttagaatac agtagttttg gatctagcat ctagcaaagt ggaccatttg     85320
     ggcaataagc actatccaca ttttcttttg catgttgatg gtggtggtag tctaggaagg     85380
     ttcagtgaca gtgactatta agcacctttc ctccttggat tctctctttc agtgttgctg     85440
     gactaatcac cttcaatgga tttacaatct tggacaggtc aatagtcaag aaggaggtga     85500
     gccagatggt gctggtgaaa ccagggtgga agaaagggaa caagatcaca tttgaaggca     85560
     tgggggatga gaggccaggg tgcctaccgg ccgatgccgt cttcgtcata tcggagaaga     85620
     aacaccctgt cttcaagagg gtaggcaacg acctggtgct gaaagccgag gtgccattgg     85680
     tgagcgcgct caccggctgg tccttctcat tcaggctcct gagtggcaag aaggtgagct     85740
     gctcatttca ggatgagatc atctgcccag gatatgagaa gatcatcaaa ggggaaggga     85800
     tgccaattgc cgatcagaaa ggagcacggg gtgatctaag ggtgaagttt gagatcgcgt     85860
     tcccgaagca gcttactgac gagcaacgcg acggtcttgc tcaaattctg agaggatgtg     85920
     catgggattg atgagattga aatgcaaggt ccaagtgtat caaattttct cagccttgtg     85980
     ttaaacaatc agaatgagta cataaagaga gatgcccttg tatatacagg tataatatat     86040
     gatgaaaacc aagtcttctg tggatagtac atgcctttcc agatgagctg tatgggttta     86100
     ttttgatgag atctcgccct cttctttttg tccatatata atggcccatt taattaatta     86160
     ctaaccccac ttcatttatt taagtatcta aaagtgaagc ttcatactat cattctacta     86220
     ccgtacccaa tgccactccc acctgctatg tccacctgtt ctccaggctc attgtctttt     86280
     gcgaaaagca ctaacaatca ttcgcctaat tgtcgattgt tctcgtcagt tacaacggac     86340
     gtgctggtaa cagctttgcc taatcccttc cttggctgat gaactgcagc tttactttgt     86400
     gcttttcccc cctgcttttg ctgcactagt tgacaggctg cagttgctga aaccccaagg     86460
     gattcaaggg tcatcacact gcttacatat gatatgttgc caatgggcca tttcttgggc     86520
     cagcgaagca tcggccgatc cgagaaaatc gacgaactgg accacagcca tgaatagatc     86580
     gatcgttcat actcgagtga agtgcgaaga aattgaatgc gatgatctag ttgttggatc     86640
     acaaagttga gaaaagagct ggaatggttg ttggtgcagt gcaggctccc ccatcagaat     86700
     gttgggcccc tgcgtgttcc ttgattagaa agcacaacca aatcgtcccc tgttgcagca     86760
     cgcagacgca gtggttggtt gttgtttcaa tgccaattag ccaatgcacc tttggttagg     86820
     cggcagcggc aacaagctgt tgatgctgcg actctgcaag ttggggtgat gcactgatac     86880
     cacgagacaa gtagacaggc tggggcttgg tcagtcaatg aggccggtgt gctgctgcac     86940
     tgtgcctaac caacctccat tttgcattgt cgcatcgcac tgtaggaaat tcgacaaaat     87000
     tcccgcaaaa tgaacacttt cttcttcttt ttcccctttt gcttgacagg tacaattggt     87060
     acctgaatat gttgtgtgaa atcctatgtt acaaacaata gttggcggcg aggagaacta     87120
     gtactgcatc accgtcgatg agatgttgag cagcggctcc agcgcgtcgg cggagaactt     87180
     cctcgcgaac aggaagcacg ccgtggtcgg ccgggagttg tacatgcagg gcacctcgct     87240
     cctcctgatg ctcaggatca gctccggcgt gacgtcgccg gcggtgtacg tcgccgggtg     87300
     cgcgccgcct ctggaccagt cgacgtacgt cacggtgcgg ttcgagttgt ccgcgccgtg     87360
     gagcatggcg acgaacgtcg ggaggtagtg ctcgtcgggg tagcacgacg gccggcagtg     87420
     ccgccggaag agcgggtagt acctggcgtc cgtcagggcg gccacggcga ggtctcgcct     87480
     gagctcgaac cactgggagc ccttcctcca ctgcggcagc gtgatgtccg gctccatgcg     87540
     gcggctgtac cggccgcggc acgtcttgcc cttgtggtag tagacctcca cgaagctgtg     87600
     gcgcgagccg gtgaggtagc cgtacgccac cgggaagctc tgcaccggta tgcagctctc     87660
     ggagaggagg acgaaccgat cgttggagaa gtccagcagc gcgttcgcca gcagccgctt     87720
     ctcggcgtcc atgagtgtta tggatcccca tgaggtttcc tgcaagcaag ccatgaaatc     87780
     gcgaggatca gatcatgatg ctttgctgcg aatgatggcg tcgcgctgtt gttcggcatt     87840
     gtgtttgtgt cgtgctcgtg cacctggctg gggatctgcc ggccgtagaa cggcgagtcg     87900
     tcggacacgt tgagcaccat cccgggcggc gcgtggacgt agatggagaa gaggccctcg     87960
     tgtccacgga agaatcgctc ccagagcggc gccagcggca ggacgccgcg gccggcgagg     88020
     aacatgaagg ccaccttggg cacgcgctgg aacgggtacg cgccaccgga cgacgccggc     88080
     gccatcgtag cgcgccagaa cagctgctcg tccgtcatat cgtgcatgag ccgcgtcgga     88140
     gccacgaact ccgagaagct accgccgccg ccgccgcggt agcggtacac ggtggtgctc     88200
     gggaaaagaa tgttggtgta tgtgctgcag caccggcgag gcccggtggc cgtccatagg     88260
     ccggcgacca cgccgagcgc gaagatcaca aggaacacga cggctttggc gaggtagagg     88320
     aacctctcct tcctcgtgag cacaatcttg aattcatcag ccatggcggc cttcatgctt     88380
     gtcacagtgg aatgcaacaa aatgcagacg tacaacactg tacaattagc taaacggcaa     88440
     aagctatcaa agagtgaatc aaactacact atggccagtt caaagtacag ctgcttctgc     88500
     ttgacatgga tgaacaagga gaggagattt taacgacgcc atagatgatc catagcttgg     88560
     aagactagct agcataagat accaagatga actaggccgc actccaatct ccaattcctg     88620
     attcttccat ctggagcttc aagaacacga gacacggaca tagaacgaga aaggtatata     88680
     tactttgaga tcaatttaag aaaggcatga atatacgcag agaaaaatgc caaaaagaga     88740
     ggaggattca aggaaaagga agttgcgctt ctaggactgc atgtttgttc tttcaaggac     88800
     catgggaagt actactacta ttgctacata taagacatgg tgattttgtt tacgataagg     88860
     catatggatg tggattttca tccctcgagg ggacatcccc tgttgtttgt atgtcatcta     88920
     aatagttatc atttttttta aaaacaattg acaacataga ttaatatgaa atatatcact     88980
     ccacaaacat gcaagaccaa ttgaacttct ataagttgca acaaaaataa caaattaaac     89040
     tgaaaataat tatcgcacat tcgtaactat atttgttatt tttgttacaa cttgtagaag     89100
     ttgaatttaa acttgcatgt ttgtggagtg atatatttca tattaatcta tgttgccaat     89160
     ttttttttat ttttttataa ctatttaggt gacatgcaca aaacgagagg atatccctcg     89220
     aggaatgatt tcattttccc aaggcatctc tctccttgat aatgtacaag agaagctgta     89280
     cgtccatgtt gtcgcagaat ggcagttagt ttcgaggaca aagcaagcat agaaatccac     89340
     taaaaacagt gcagaatgtc cggatcatgc agcatcgcag tcgcaatcta caaaaacgaa     89400
     taaagccagc ttgatctacg ccccaagaaa tcgtggattc tgaccaatac caatgtgctt     89460
     tcgagacttc caatctccca tggcaagctg gactctcggt gtcttcgagg cttggtagca     89520
     gttgaaagag tacgagtcag tattagggcc agatttgtag tggcctgctt ggtagcaggc     89580
     cagcctttca ggagacgcag agaccaagtg gaataagtct actttacctc tcttaactca     89640
     tgcgcatggt tgaattgcat cttcaaccgc aaaaccgggt ataatctatc ctccaactca     89700
     caaaaccatt ccaaattgac tccttggacg gtttgggaga cgattttgtc ctacgtagcg     89760
     tctttgagac tctgttgaca tgctgagtca acacgtgagc cccacatgtc agtgcaaggt     89820
     gtggccggtg aaaactcacc gagggaggag gaggcagtca ccgccgcgcg gcttgcaccg     89880
     cccacgccca acgccctcac ctcacctcac ctcctccacc acccaccggc cgccgccatc     89940
     aaaccggccg acggagatgc cctcgactag gaccccaacg ctgccgacgc tgccaacagc     90000
     ttagctgccg accccaacac cgtcgacgtc gccatcaacc tgaccgccac ccttaacacg     90060
     gcggggaggg aggagaggag gtggcggcaa ggtcggagga ggggaggcct gggatgagga     90120
     ggccagggag gcggcggtgc agagaaagga gatgaggcgg tggcgaggtt agaggagggg     90180
     agggtgggga tgaggcggca gaggatgggc gagggaggga aggcggcgcc gacaaggttg     90240
     gaggaggcac cgacgatgag atgagacgcc tccgctccca ccattcctgc tgccttgaac     90300
     cgcaccgaca ccaacaccat tgacgctgcc atcaacgcgg cgggaaggga ggataggagg     90360
     ctgcggcgag ggcgcggatg aggaggtggt ggtggggaga ggaggtgccg cagctcccac     90420
     catcttgctg cctcgagcct cgccgccctg ttgccctact gctgagctct ggcgcagatg     90480
     aggcagcgat ggcgaggtca gaggaggcgt cggcgaggag aggagacgcc acggcgagat     90540
     tcctgtcacc ccacccctct tgccgtcctg ctactccctg cgtggatgat gggtgccaaa     90600
     gtaggagccg gcctgtgagc tccacccctc acgcagccga ccagtgagat cctccccatg     90660
     cacagccatt ggccgacgag gtcttcccac gcacgcggct ttcccggccg atgaggtcct     90720
     ccccaatgtg tggcgcggcc ggccggcaag gtcctcccct gcgggtggcg cggccttccg     90780
     gctaggtcct ccctacacgt ggcatggccg gcggcatcgt ctgtgctaat ggaagaggag     90840
     agaagaggac tagatgaaag agagagaggc ggggagatga ggtggaggcc tactggcaag     90900
     tgggtcccac ctgtgactca gcgagccgac tgccacgtca gacaaaacca cctacgaaac     90960
     tgctcaggga gtatatttgc aacggttttg gaaattaggg gcgggttata cccagttttg     91020
     cggttgaggg atgtgattca gccaggggca tgagttgagg gaggctgaac agacttattc     91080
     cgagacgaag ttgataggcg acgaagccca cagcccacct attggtgaga tggtgcgagc     91140
     cgtaactctg gcgcgctcgc gccggtccat gtcacgtcaa gcaaatcagg attaccggtt     91200
     ctattcataa gcacgctgct tgctattatt tagctgaatt ttaattaata ttgtatcatg     91260
     tttttatcat attcatattc atttaagttt gagattcgta ttagaatcaa attcctagtt     91320
     atatttttaa ttttgaattt taattaattg gagtttacac ggactcttct tttattacta     91380
     ctactatgtt attatatttt attccgaatt ctagcgattt atgtatttga gtttagagtt     91440
     cttgtcggaa tcgaaattct tctaaaaaaa cctaataaaa acatctgccg aacctaacat     91500
     agtatgcgga tcattgtgga taaaaaacgg tggcgagaga gagagcccgt ccctaattaa     91560
     ccgccgttcc tctcgcgcct caccaccgaa tcaccctttt gccttcgcaa ttctgggcct     91620
     gcaaccacat cgcttcgccg ccgtatccct tctcttcttc ctcttctccg agcgctcgca     91680
     tcgcaccgca attcaatgcc cgcgcttcgg tgtgagatcg acctagccgg cctccctgac     91740
     gacgattgaa gatcgaacct accgtgtaag ctcgttgatt ctgttgacgc cttgtttttc     91800
     tttttttttt agggttgttg acgccttgtt gattgattca tggtaaatgt tgctgttagt     91860
     ttgattggtg tactcccttg cagcattgcc ttgatcgatg agttttaact gcattattaa     91920
     tagttaattc ttttcctaat ttgttctcgg agatgaattg acaaattcaa tcacaagcta     91980
     atgcgggttg ttcccatgca agttcaacat aacatatcct gaatatattt ttgttgaaaa     92040
     aatatcatac ggagtattcc gaatcatata catgtacttg tatgtttttt tccgtataac     92100
     acattatcca aacaatttta ctacagaata tttttcttaa tatatctctc gttaactaac     92160
     tcttgtctta atcttacata tacagtgcaa gatcttgtat agtttgcaaa atccagctgt     92220
     ctaacgaaga acatgtaaaa gatcttgtat ctgcatggat ttcgatgcga ctacctaaag     92280
     tgccaggtaa ataactgaaa taagctatcc ataagcgggg aatccagtac gacgatggct     92340
     gtaggaacag agagtggctc gggcggcgta gccgagagcg ccccctcgac gccaatgtcg     92400
     gcaatgacaa caacgcccat atcggcgagg tcggtgaggt gggagagcga catgccggac     92460
     atcgaggagg gaggcggcgg gctggagcgg ccgctgctgc gccgccgcgg caccaacacc     92520
     acgtcgcaga tggccatcgt cggcgccaac gtctgcccca tcgagagcct cgattacgag     92580
     tacgtgtgtc aatcgtgaca tctctgcctt cctctctaac tctcgcgagt tttttttttc     92640
     tttaggcctt gttcagttaa tccgcgaggg aggattggag gggatttatt ccacacctat     92700
     cgcggtgtgg aattattccc cctcaattct ctccaatact tttcaatctc ctttaaaccg     92760
     aacaagccct tagagattca tggtaccggt atttattttc gattagattt gtttcgatgt     92820
     ttcatgtatg ttttaatatc tattttttat tatagacgcg cttcatgcta atgatggaat     92880
     actatatttg gtttgactac ttcccaaaat ggttgaactt tttaactttg accgtcaata     92940
     ccaatttagt agctttataa aatatagtaa atttggtatt tacatgcact ttctgaaaga     93000
     cgtaaaattt gtcttataaa gtataataag tttttttttg gagcggacgt ataataattt     93060
     ttttatacaa tgatagtgca tacgccatta tttttgttta taaactaatt aactaagcat     93120
     ttgagaagtc agtgactgtc aaaagtttta cttaaatctt atgactagag ataggataat     93180
     tttacaaggg acaacccaaa gtatgttatt atgaacacta gtttgagttt gactacaatt     93240
     ttacaagtga ggtgatcaat gtaagtgtgg taattaatgg attttccata ttgactaatg     93300
     atgacacaga cttgtggaga atgaagtgta caagcaggac tggagatcaa gggggaaatt     93360
     gcaaatcttc cactatcaga tccttaaatg ggtcctagca cttcttgttg gattaatagt     93420
     tggcctaata ggattcttca acaacattgc cgtcgaaaac atagccgggt tcaagctgct     93480
     cctgacgacc aatctaatgc tccagaacag gtagagtcca cccttccaat gcggttcatt     93540
     gcaattgatg aacaaaacca gtcaaaaatt ttttttgagc tcaacatttc ttggtacttt     93600
     aggtacaagg cggcctttct atggtttatc agctgcaatg caatgttggc agcagccgct     93660
     gcagcattgt gcgcttactt tggcccagcg gctgccggat ctggcatacc tgaggtgaag     93720
     gcctatctga atggtgtcga cgcgccgtcc atcttagcgc ccagtaccct cttcgtcaag     93780
     gtatgtatga tcctgattga aacattcaat ctttctaact ctaatttgat catcacgaca     93840
     ccgattttcg atgtgcattg gatcatgttg gtgagctttg tacttgcaga ttgttgggtc     93900
     tatatttggg gtgtctgctg ggtttgtgct gggcaaggaa ggtcctatgg tgcacactgg     93960
     ggcttgtgtt gcctcctttc taggacaagg cgggtcgcgc aagtatggct tcacttggaa     94020
     ttggctcagg tacttcaaga atgatttgga ccgcagggat ctgatcacct gtggagctgc     94080
     agcaggagtt acagcagcct tccgcgcccc tgtcggcggt gtcctcttcg cacttgaaga     94140
     agcaacatcc tggtaattcc ccaaaataaa aaccaagttg catctgaaat accattttgc     94200
     cagatatgct acagtacacc cagcatgtct tttgaattgt caattgtaat ctttgcacat     94260
     tgtcaattga aaatccacat cccaattact caattgaaac tattaacctt tgcgctttct     94320
     caggtggcgg agcgcgcttc tctggaggac attctccacg acagcagtgg cggcaatggt     94380
     gctaaggtcc ctaatagagt actgccgcag cggcaactgt ggcctgttcg ggaaaggagg     94440
     gctgatcatg ttcgacgtaa gttcacaggt gacatcatac accaccatgg atctcgccgc     94500
     ggttgtgctg ctcgccatcg tcggcgggct acttggagca ctcttcaact tcctcctcaa     94560
     tcggatcctt cgtgtgtata gctacatcaa cgagtaatct tcacccgaat caatgcattt     94620
     caaaattttc aatcatctgt tgcaacttcg gcaagatgat cactgagctt tgcatgcatt     94680
     tgggttaatt ttgcaggaaa ggcgcgccgt acaagatcat tcttacggtg gtcatctcgc     94740
     tggtcacctc gtgctgctcc ttcggcttgc cgtggctgac ggcgtgcacg ccatgcccgc     94800
     cggagctggc cgccagcggc cactgcccga ccatcggccg ctccggcaac ttcaagaact     94860
     tccggtgtcc gccggggcag tacaacgcca tggcgtcgct gttcctcaac accaacgacg     94920
     acgccatccg caacctcttc agcggcggca cggagagcga gttcggcgtg cccatgctgc     94980
     tcgcgttctt caccgccgtc tactcgctcg gcctggtcac ctacggcgtg gccgtgccgt     95040
     cgggcctctt catccccgtg atcctctccg gcgcgtcgtt cggccggctg ctcgggaagc     95100
     tgctcggcgt gctcaccggc ctcgacacgg ggctcttcgc gctgctcggc gcggcgtcct     95160
     tcctcggcgg gacgatgcgg atgacggtgt cggtgtgcgt catcctcctg gagctcacca     95220
     acgacctcct gctgctgccg ctcatcatgc tggtgctgct cgtctccaag acggtggccg     95280
     actgcttcaa caagggcgtg tacgagcaga tggtgcgcat gaaggggctc ccttacctgg     95340
     aggcgcacgc cgagccgtgc atgcgcagcc tggtcgccgg cgacgtcgtg tccgcgccgc     95400
     tcatcgcctt ctccagcgtc gagagcgtcg gcaccgtcgt ggacacgctg cgccgcacgg     95460
     ggcacaacgg gttcccggtg atcgaggacg cgccgttcgc gccggagccg gagctgtgcg     95520
     gcctcgtgct gcgctcccac ctcctcgtgc tcctccgcgc caagaccttc accgccgacc     95580
     gcgtcaagac cggcgccgcc gaggtgttcc gcaagctcgc gccgttcgac ttcgccaagc     95640
     ccgggtcggg caagggcctc accgtcgacg acctggacct caccgaggag gagatggcca     95700
     tgtacgtcga cctccacccg atcgccaacc gctcgccgta caccgtagtg gagaacatgt     95760
     cgctggccaa ggccgccgtg ctcttccgcc agctcggcct ccgccacatg tgcgtcgtgc     95820
     cgaggacgcc gggggtaata gagcttacca acttagctga atcctacatg cttttccgcc     95880
     atttttgcat ctgaatcttg atgatgattt tgcagaggcc gccggtggtc gggatcctga     95940
     cgcgacacga cttcatgccg ggttacatcc gcgggttgtt tccgaacgtc ctccgtgagt     96000
     agcggccatg gcgagcgcgc gaacgaattc ttttgcacat atcttttttt tctgcttttg     96060
     gaccttatta ccaactggag tagattagct tagatttgat gtttaattag cacccaagtg     96120
     aacgagcggt ggctgcaaaa ttctatgaac tcgcaaagcc tgagagtgag agttcagcta     96180
     tatgaggtga gaattaaatg tcataggttt aatggagctt tgtaattaac tgatgatctt     96240
     ttcgaaaaaa caactcgtcg atgatgccga taatgaattt gatttcagtc aatttgttgg     96300
     tgtaattatg tgaatggaat agtcttggcg taatcactct caaacgcatg cagtggcttt     96360
     gctggtatca tcatcagcgg acgccgttgt cgctaccgtt gtgaaatggc aatcggtcaa     96420
     ttgcagtgat ttgtcactgc taaccgctca tattctagcc gaagctaaga caatttaatt     96480
     ggtgtatcta gcacttcgta cacaaaactg tcatatcttg ttagccgaag ctgctcctat     96540
     ctgttctaaa ttgtagatcg tttaggtctc tagtaagtca atttttttta aaaaaatata     96600
     gcaatattta catttataag gaaattaata tattaatgtt tggttttgtg aaaaggttgt     96660
     ttgaatttat aaaaagtttg cttggattta tgaataattt gcttgaattt atgaaagggt     96720
     tggtgttgtg aatgttagta ttttttttat ttataaaact agtcgaaatc taaaatctta     96780
     taatatggaa ggaagggagt acacaacaac caacgagcgg aaacaccgag tattcatttg     96840
     aaattcaaga attttacata aattttgcaa gaaacaattc aattttgaat tttgtaaaaa     96900
     aaaacaaatc aattttctta tggaaacaga agaactgtcc actatcctga tgggattaga     96960
     gatgaatttt actccataga acaaacgaat agcatatatt ttttcccttt tttttctttt     97020
     gattgtcttg taccttcttt gtacagttgg acactcgaac ggaacggcat tgtgcccaat     97080
     gttgcagaca agcattgggc ccacatgcca ttgtcaacat cgccggccag cctatcagcc     97140
     acatagacca atcaggccaa gctgttggcc agatggcgcg agaacggaaa cagccaaatc     97200
     tgaatgagat gcgcgccttc cttctccttc tccggcccga cctcccactc ctcctcgacg     97260
     cgcctcttct ccatgtcgaa cgccacgagc ttccatggcg tccacaggta caccatctcc     97320
     ctgtccgggt ggaacgccat gaacaagaag gtgacggcct ggcaagctcc gctcgcctcg     97380
     ccggcgacga ggtcattgac ccccagctcg tgcttcagtg cccactccga tgtggccgcg     97440
     ttcttgagct cccagaactt gaggcgcgtg ccgtcgctgg acgcgtaccg gaggcggcca     97500
     cggcagtgcc cggcgcgcgc ccggcagctg accggggccg ggagcgcggt caccgcgcac     97560
     gccatggtcc cgaggtcgat gcggacgacg tggcccgagt aggccagcac gtggatcgcg     97620
     ccgtcgaagt agtgcatggt ggccgacatg gcgtcggtgt cgagcccgaa gtcgagctcg     97680
     tggtcgcgcc acgcgccgcc ctcggagtcg aacacctcga cggacgcgcc gcgggggagc     97740
     cacccggtga agcacaccac cctgtagtgc ggggacgcgg aggggtcgaa cgccagcacg     97800
     gacagcagcg tcttcccgcg cggcggcggc agcctcgccc accgccgcgt cgtcgggttc     97860
     acgacgtgga acgccgccgc cggttgcgat gcgtagtaca gcagcatgcc gttgcacccg     97920
     tcgatgatgg tggacgtctc gtgcccgggg aagaatccca tgtcggcctc cgccacgccg     97980
     ccgccgtggt caccaccccc cgacgcgcac gcgtacgtgt acgcctgcct cctcctccct     98040
     tcgccgccgc cgccgccgcc gccgccccgg ccttcctggt acagcacacc ggaggtgatg     98100
     agcggcagcc tccggcggag gtagtcgccg gagatgaggc gccgccacga cgtggccacg     98160
     cactggaacc tcgccagcga cttgtacggc agcctcacca gaatctccgt gagcatgtcc     98220
     tccccaatct cgccgtccat ctcctcgatt cctcctttcc acctactgat cgaccaccct     98280
     gcacctcacc tcaccttaca actccaagct atcgcttcca aaacaacagt agcaacaaca     98340
     tccaagaatt aatggcaacg caagcgacgc acatatatta gcaaagccgt tgggctaaaa     98400
     atcaagagat tatgcagctt ccgagtggtg cacaagaaca gcatgagtat tatctgtact     98460
     caaaatggat gctgctgctt gcgaatgcgg agaactgagt cgatgccttg ccgttccgcg     98520
     ctggacatat atatctgcgt acgccattcg gatttgggat atatcgtcgg gtttctgctt     98580
     cgttttttat tgagtgttgt ggcgggacgc gaggattgct gcgtctgcag cgttgcttac     98640
     gcgtcctttt gggttcaaaa aggaaaatgc gcgccgcact gttgttcaga aagagaaaga     98700
     tggatgttcc actagcgcgt ctaacaaaaa tggacggtta attttcatca tgagaatttg     98760
     ataaactgag aaggagacat ctgaagttag gtgtgcatgt cttgcttccg ttgttgtttc     98820
     agagagtact ttagtattat acttgtatgt tactgaaggg gattgcgtgc agtgaactgt     98880
     gacagtgtga ccggtagtcg gtaaatgaag tggccaaaaa aggaaggaaa agaataagaa     98940
     aatgttgaga gatctttttt tgaaaaaaag aaagttggtg tgattgtgtg gcaaaacaac     99000
     acggtcgatc ttcagagtct ttaacagata cagaagaaca ctcatcttct ttgaaaaaaa     99060
     atcttatatg ttcgttttta taaaggggca gaagaacttt ctttcttctt ggacttgtct     99120
     ccaagcaagt gaacacataa tggaaccatg gtcagacggc cacgttaaca gttggggctt     99180
     atcgcaagct gccatttggc gtacacatct ctcgtcagat atccatcacg ccgagcggtg     99240
     cctacctaca aaactagcta gcatacacgt atatcttcca acccaatcct tttctttatt     99300
     tacataaaaa caaacagcaa gatgcaatga tgcacatcga aagacccttc tgtttcaggc     99360
     ttcaaggctg ggatatctgt tacttggacg ccatgcaaat cacagctttg tcgcactata     99420
     tctcgagctc tcaagtcgtc gatgatttcc tgaatccagg agaggaatcc ggcgcttgtc     99480
     cagggcacga gttttaccat ggtctatgaa ttttgtgtgg atgccactca aagtttcatc     99540
     tttgatcttg cgtcgtccag agtttaattg gtgcaaacac accgacgctg acagcgacct     99600
     gcctattgtt cttgtctctg gttgggtaac gacgggtcac gggccggtgc aagctgtgtg     99660
     tttgcaacgt ttcttggagt gtgcaacttg gattctctgc ctgggccatt cttgtgcttg     99720
     gaagttccaa tcatcgtaca gtgcaggagc taagttatgt tcatcacttt gctgatgatc     99780
     gatggcatcg aagagagaga gagagagacg tgtcatctga aggaaaacgt gtaggcatat     99840
     gccgattctg agggagactc atgtagtagt gtttaaagtg tatgatattt tatctagtac     99900
     tgtaccatta atgagcatac ccctgaattc attattcata agtggaaatt ctgtttgttt     99960
     tcatgttttc atttttgaaa aacaaaaaac atttctaagt gtgatgttca tacattgagg    100020
     aatggaaata aggccttaca ttgggcttca agagtcagta gtggtctggg ggctctggcc    100080
     tctgggctga tacgtagccc tgccttgatt gggtgggcca agtgagttat aatctaagca    100140
     ggtgggctca gatcttctga tgctcggctc ttcccatcac ttcccatcag gcaccaattc    100200
     cccaaccata cccggatacc cctaaataaa ttatcgaaac catagcacaa atgcaggcac    100260
     caatgcccaa cctggcaacc agtctgctgt ttatagcaat ccaaagccaa gatggcaatt    100320
     aagatgtaag gcatagtccc gtacggactt cattcgcagg aacaaagtgg tcaaaagata    100380
     cgatgagtaa tttactccca agcaattaga ttatgaatga ttacccagct aggaggctaa    100440
     atctgcagca tgctttgttg ataatacaag taaacttttt ttttgaacat ttacaagtaa    100500
     acttgagata gagataacag aagcaagctt gaaaaatgga agcacctttt gcgtaaaaaa    100560
     aaaggaagct attataggtt gtttttttag ccaccagccc accgtatcaa gttgctccag    100620
     acggaagagt ggtatttaag ggaataacaa aagaagcaag caaaagtaat gctgaagttg    100680
     acataagaga atgtcgtaca aaactgtgga taactgggat atccatgggg gcaagaaagc    100740
     caacagtttg ctaatgaaag cagatgaatg tatattctat gaaacaagtt gaccagtaac    100800
     cagggatcac aaataagtac tgtatcgtgc aataggtagt ccctaaaata aatgtcagac    100860
     atcatggaag cctacttact ttaatttata gatatgtgca aaagtctcct ataatttata    100920
     gatatgtgca aaaatggcta tcaagagatc tggaactgga agcaaccaac aaatttacag    100980
     caaaccagtg caaagtactg tttcaactaa aagagctgta catttgtagt acatgtttga    101040
     ggtcattgac ttcattcagt accgttagca gttatcaatg cggcctctca agctggaagc    101100
     aaacggagta ctgccttgta aagcaacatg atgttgaggc catgtgcacc aggcaggaag    101160
     gccactcaga ttaagaacat cgagtgcaca gcgatcatgc caagatatat attactccat    101220
     ctcttcttgg aatatacaag gaagcacatg gaggcctgtc atggttctga acttataaaa    101280
     gaaattgcct ggctccaggt gcatgcacat gctttccagg tagatttgct tctacattcc    101340
     actggagagg accatgcagc tgacaaaaat aatctagcac tggtagcttg ctgcaactta    101400
     aaaatgacct gggtaccaca gccttttcct tttctaccct ccaaactgag atcgccgacg    101460
     agttataata actacactcc cttgtgtaag atctcaaaga tgcattgtaa tagattttga    101520
     attagacacc tcaggcaatt acaaagcgca gccgcaatta tatggagttg ataggtacat    101580
     cactgtatta tcaaaatgga ggctataatg caactgctga acagcaacac aagccatcca    101640
     gattttaccc tatcgaattt ttcaaaatta tataatctac aggtattaaa tatcatgcct    101700
     atagacagct tagcaatcgc taaacatcca aaaacaaaac tcaggaatat tacagcaaag    101760
     cttctattct ccaagtcagc ctgcttttcc cgaaatcttt caagttctga tctgcagaga    101820
     caccataaca tgaatcacaa agttataatc atcccaagcc gacataatta ttcattaata    101880
     ccaaagcagt tcaagtagtt tatctgaact ctcaatagta cgattagaag ctataattag    101940
     ctaacagaaa aaagaattaa ggaaaacact ttttgacaag caaacacgga agccaactcg    102000
     ggatagacct atatctcgaa tacgagaata gagtaaaaac acaaaaggga aaacggtaac    102060
     tatacaaacc tgattatgac attatccaag agtagctggt ttaactgtga ggaagcaact    102120
     agtttccatg agagaatccc ttcaatttct ttcgcctgaa atgaatgaat atatgataag    102180
     gcaaagaaag taatgccaac aaaagaagaa agaaaaatac atgtgaatag aaaagcatac    102240
     aaagtcatct ttgcttctct caagatgctt cagctccaat ttgattttct ccaagagtgc    102300
     atctttggta tcaatatcag catcaaaatc cttaaaaatt tgcccatatc tgctatttag    102360
     ttcttctaga taccgctcca agacagaaaa gctcacatca agagattgca ccttctgcat    102420
     tagtacctta agaactgtat ctccaggaat cctgccagcc tgaattggcc ttgtctcggt    102480
     aacttgatca tgagcaccat tctttgatga atcaccgttt agtttatcat cttctagttc    102540
     aaactcatct tcatccaggg gttcatgtga ggattctttt ccctcagtgg gctccttcaa    102600
     ttgtgtttgc tgatcgactg gttccttcat tttgtcatca ggttccagcc ttttattctc    102660
     aactggaatc aagttctcca gcatcttttc caccgcatcc attccataca cttcaagcat    102720
     actgagcgtg cagtagaatt cggaaccata atggctaagc aagttgagtt tcagatatct    102780
     agcccacttt ggctcaggaa aagtaaaatt ctgagcaatc ttggcatttg caacagtgaa    102840
     tctcccgagt gtttcccagc tatctgtggg ataattcaga ctgctcagca tttcaaattc    102900
     tttcaagtta gaagaatagt gctcaaaatt tgcaattgcg attgtatcta ccaaggtttc    102960
     ttcagacagc tctataatga caaacttccc ctctgctgag caaggattgc ggagatactt    103020
     gtctttatcc ttgtctagga tgttagaagc acccttggcc tccttgttga attccaggac    103080
     cttagcccct ttagctgccg aggcataatt gtacaacttc ccactaggct cccttctgtg    103140
     gatcacattt ccaggttgac cactagggac accctttcct ctttccgcaa tcgctcgtgt    103200
     cttgaattca tcaagaccag gagggacaac tcgtgataac cttgctggtc ttggaacacc    103260
     ttcgctctcc acctccccct ctggatgaac tacagaatca tcatctgtcc gtggaagatt    103320
     ctcaccctga tcaacgttat ccttgggcag agcatccatg ctatcaccct gtgcctcatc    103380
     attggagcaa agctgatctt tctccagcag tgtctcttca gaaagcacat gattttcatc    103440
     gggtttagca cagctatcac ctggcaacgc atgattttcc ccattctcct gctgtacaac    103500
     tgaatcaaca gagccttcgc tcaaggtagg ctcaacagaa tcaaacgagg gatcagagct    103560
     tccttcatcc gcaaaaatcc cttcatctgc agaaatcaga cagcaccgaa catgagccca    103620
     atcgacaccg agaaatacgc ataacgtcaa tttgaaaatt attgacatgc gatatctttc    103680
     aaaaatggta aaattaaagc ggaaatttca tcaggacatc aaaaaaccat gatgtttatt    103740
     cagaattcag aaatgaaacg cgcatatata gatctatgtt gtaaccgcgt aatattgcga    103800
     ttcacgttcg gccgattcag cgaacgacca tcttccccaa ccaccgttcg caccaccacg    103860
     caaccaccca ccaagcacga tcgatcaaaa attgattccg cgaaggccaa aacgaaatcg    103920
     tacctcgttg accgttccca tgaccgacga gggggttgag caggagcagg acgacccagc    103980
     aggcgacgac aagcgagacg gagaagccgt acagccgccg ccgccgcctc ctcccggcgg    104040
     ccgccgcggt agccacgccc acccctgcct cctcctcctc ctccttcgcc gccgccgccg    104100
     ccttcctctt cagaagggct ctccgcgacc tctgcattcc tccgccctca catctgcgcc    104160
     acacaacacg ccacctcacc accgacttcc cctccctccc tccgccccgg cccacgcaga    104220
     ggaagagcac ggggcacggg acgaatcccc agctgccgcc ccgccccggc cccgctcaga    104280
     agaaccgccg cggcggcgag gtccgatgct gcgccggcga aggggaaggg ggttggatcg    104340
     ccgcgtggcg gtggatgggc gggggctttt gaggtggctc catcggagga aggggaggaa    104400
     ggcgttgatg gcttttgtac cgcgagatct tgtcggcttc tccacccccg ttcgcacttg    104460
     tgaaatcgtg agacctgtcc aatccccaat gccaacctgt ttgttaccgg tgcgcgtggt    104520
     ggtgaggtgg attcttctgg actctttggc tcccttgttt attccgtcca gcgtggagga    104580
     gtacaatctt attaccgttt gctgggtgga ctagttcaaa ttcaaaagcc agagagagaa    104640
     atcatgtcca tttcaggctc accgtttgct ttttggttac ttgccgcagt cgaaaagtta    104700
     aattttgatt tgattttaag gatttttttt ctcattttaa acaatctccc attagctttt    104760
     aaatccgtaa gaacgcatat gtgagagttt tcctctacct ataaattatt tattgattgt    104820
     tatttttttc gcgaacgctt tattgattgt taaaaatcag tgccaaacaa tcaagttgtt    104880
     tagtctcaaa tgtgtagatt ttgtttaatg gccagtggtg gtatcttttt ttttttctaa    104940
     ctacggcaga tgtcacccgt gcaaaaataa aactaaatta tcatgtgatt gtagcattat    105000
     atatttatat tactacaaga ttatatagta ggagtaaaca tcggtataca tcatatataa    105060
     aaacatgggg tactgagtgt gtaaccatga tgctttagat aaaataattt aagccgactt    105120
     tgatatgtta cgcaaacaaa gatggttgta ctagaagaaa agaattttgc agccaataaa    105180
     tatacggagt actagtagta ctacttcaat tgtaggtttt gtcgagttgt agttggatgg    105240
     ttccacgtca attccggagt tgaagcatac acgtcacagc tgtgcttgct tggtacacgt    105300
     agggtgcacg ccacgcgtgt cagccaacag cgagcctcca cgtggactca aggagtagca    105360
     ctgtacgtct tcccttctct ctctcctcgg gtcaataata gttaacccgt tgactcgatg    105420
     ggccgtgttt tcaccagcgc ggcggaggcc catttattca actaccgata aaggggccca    105480
     cacaaccagc ccagcatcat ctccgtctcc gtttgcaccg aggcctcggg gcaagggccc    105540
     aacccgtttc cgaatctcga ggcgcaagag gccatcgaac ggcggagcct taaagcccca    105600
     acttgtccgt gcggtttctt actttcgtgg gctttttttc tccctcttga ttgcggcgcg    105660
     actgcgagcg agagagcttc acgcccagat ccgggcggcc atggcgagga accctacccg    105720
     caccgtctac ataggtgagc gtctgtctcc tcttccccct ccccgcggcg ctcgcggtgg    105780
     cttcagattt tggttttagt tcggattgga gtagattgat gtacacctcg gtgatttgat    105840
     tgatcaatta gttggttggt acttggtagg ttggttaagt tgtatgatgt ttccgtggtg    105900
     tcctcggtta gcgtggttac gcgtgatttg tggatttagc gtggttgctg ttcctctgat    105960
     ttctgatggg tgcaactgca aatgtatcgt tgaaaggatt cctgttgttc cccttgtatt    106020
     tcttttactg gctaaaacga tgagtgcatt tggaaataga gctgctagat gctagtatca    106080
     aagcttgaca agtgattgca ctgttgctgc tatgaacttt acttgataat aacgttggac    106140
     tgtgtttcac aagtagcatt tcaatttcta cacgtttctt aaacttacct ggcatggaga    106200
     tactgaactt ccacttttct ctcttttttt ttttggttgc gaggaacttt tagtctttta    106260
     ctgtttgttg cattagtgaa tctgtagcgg ctctagtcta ttgaactttt ctccagttgt    106320
     tagctttctt agcaattctc tgggctatgc taatttattc ggaaccttgt caatttattt    106380
     gcctgcaaat gcaatgtttt ttgtggacag tcctggtgtc atctggtatt gtttgtatgt    106440
     atattgtata tctagtgttt tatgtagtct aagcagcttc atttctctgt atcagagtat    106500
     tgtattaatt atattgcaat tttttcctac aataggtaac ttggatgaaa aggtaactga    106560
     aagaatattg tatgagattc ttattcagcc aggtcgtgta gtagacctat gcatacctcg    106620
     tgacaaggaa actagttgtc ccaaaggtta cgcttttgct gagtatgaaa cagaggaaat    106680
     cgcacagtat gctgttcaac ttttttcagg acttgttcgg ctttatggta aaacactcaa    106740
     atttgcggta ggtttccttt ttatctgttt tttttttgtt tggatgtgtt acttctatat    106800
     gatcatcagc ttcttatgat taaactgtac caatatgatt acagcttgcg aaattagagt    106860
     gctagtagtt gttcttgtgt tctgtgccat acaatttcgc aaaagattga taattctgat    106920
     ttcccaaaag attgataatt ctgatttcga atttcttcca catcctttag ataatgtttt    106980
     agttcatact tatctatatt tatgcggata tgaagagggt cagttttctg aatttatatc    107040
     attgtctttt gcagatctct ggacaagaca aaccctcatc aaatggcaat aatccagtaa    107100
     tgcctaaact caatcctgta ccattaccaa agcagcctca gtttgtgcat catagtgata    107160
     tgcatgtatt gcatacccca gcggatccaa tggtaaatgg tgggacaaga gattatggct    107220
     tttcaaacta ttatccttat agtgctaatc cccaaggtga gattatttcc tgggcctatc    107280
     tatatgtact gttgtacgct gcatatatgt cactcttaat ctaatcctac tattcttttg    107340
     ctaaccagca ttaccagttg gacccgtgca tagctacaga gggttcagca atggtacgta    107400
     tgattgcagt acatgcatat ttggttctat tgttaatggt aggtatggag attatgtttt    107460
     gaatgctgct ggccatggag ctccgaggca accaatgttg tatccgtcct actaggcacc    107520
     aaagaaggga atctggtatg ttgagttgtt gatagagtag gctggttggg attagctccc    107580
     tgaaattttc atctcttaat gcacatcatt gtcatacatg tacagaatat ggctctcttt    107640
     tatgaatggt aattagaaaa tcttagtaca acactcatcc ttctcttctt tggggacggg    107700
     agggctgcaa cagcgaaggc tgtactacgc ctcctccaac tctcgaaaca atgagctatg    107760
     cacgcttagg ctgtatttga ggagaggaga tagaggagat tgggaagata cgcaaaacga    107820
     ggtgagccat tagcacatga ttaattgact attaagtatt ttaaacttca aaaatggatt    107880
     aatatgattt tttaaagcaa ctttcctata gaattttttt acaaaaaacg taccgatgag    107940
     tagttcggga agcgtgcgtg tggactctta aagccttgaa agcaatcttt gtcgtgtact    108000
     tgaatgaccg ttactctgta atactagaag atgttgatgt ctcaacatca gctgtagatt    108060
     ttttatggaa ccgaatcaag tcaactgttc tttacttctt tgtccgtgca catcacagaa    108120
     atgagtctct gtcagtgtca gggacaggca agttgctgca atgtggcatt gccaactaac    108180
     cctattttgt gatggttaag tggtagtggc ttggctgatg tttcgctttg cagttctcta    108240
     ttcgtttgtc acctgtcatt gctagctagt aaattttagg cttatcttgg gcattgcatt    108300
     cctttttatg tgttaggtga ggtgatgcat acgttggagc taggcaaatt ttgatcattt    108360
     ctctactagt gcagttccat tgtgttccac ctataccaaa aaacacataa gacagacaca    108420
     caaaacttca caggtagaca ggatggcact aaaacactcc cattttgact cacctaaccc    108480
     aaaaggtatc ctatcctgaa acgaaaattc tactgaaaag atcatcactt tgggtcccct    108540
     cgattaacct tcttcaaggt gaaaaccaca cctcaagaca cgtatcagag gtgctgcttc    108600
     tcgttgcata tctcctctag tgtaagttac ttctgatgct ctactaaacc tagcctccag    108660
     gggttctttc cttcacttct tggagtagta gcatgtacaa gtcacatgcc atctctgcat    108720
     tgtgctattt ttccgttgca actagagcaa tatgaaaact gaaaccaatt gtgcataacc    108780
     aatgctagcg cggcatcttt cctctgcaaa aaaacgtttt ggatcttgtt gctccagttg    108840
     cagttgcaga ctttgcatct gccgtactgc tgcacttgct cgtttgacgc tgtctctcgg    108900
     cattgcaagc tgacaacatc gaagaccaag actacgcaac gcacgtacaa ggacttttct    108960
     gggtaagact cttattgaat ccattggagt gtgtatgatt tctcgccggt caaagccaag    109020
     agaggaggcg atgaagatgg agagcccggg ggtgcagccg gcggccgccg gtgaagaaga    109080
     aggcggcggc ggcgtcttct tctgcgtggc ggtgacgtcc aggggcagga cggaccggct    109140
     gtcctacttc caggcggaag gggacggcga cgacgcggag gaggtggccc gcgccaccgc    109200
     cgcgctctgc ctcgaccacg cgccggagca ccaccactgg caccaccaca ccgtcgtcgg    109260
     gcggcgcacg ttcgcgttcc tcgccgggga cgacggccgc acgtactttg ccgtggcgga    109320
     cccgacgcct ggcagcgccg agacggtccg gttcctgcag cgcgtccgcg acgcgttcgg    109380
     cagctgcggc ggcggcggcg gcggcggcgc gaccaggcgg cgcaaccagc gcgacgacgc    109440
     cgtggacgcc gtcgtgtggc agttcgtgcg ggcgctgcgg gcctccgcgg gaagagggac    109500
     ggcagcgctg ttccccggcg acgactcacg aggtggaggt gacgcgtcga gcgccgacgg    109560
     cgacaaggac gacgaggagg aggaggatga tcgtggcggc gaagcgatgg ccgtcgcggc    109620
     ggacggcgcg cggcggcgaa cgcggcgctc gtggtggcgc tacagcaagg tcgtgatcgg    109680
     cgtggagttg gtgctgttcc tcgtcctgtt cgtcgtgtgg atgatcgtgt gcaaaggctt    109740
     caattgtgtc cagcgatgag cggcacatcg cttgtgcaac tgtaattaca tttacacgta    109800
     tagtttgttt tagtctacgt gctgtgctgt ccatgaaaaa ccttgcccgt cttgttaaat    109860
     cgtaattgtc ttagcaacat ggagtacaat ttacggagta tttgctgtga aaggctttgc    109920
     tggttgattt tgttttcatg taaaaaactt gggctcgctt gccagcgggt tttcttaacg    109980
     atggtaaggg ggttacctct tcctaccgcg gtagcaaaac tgagcaaact ttaacaaaaa    110040
     aaaattaaag ctttgtttaa ttgttgatgg ttgatatgct aggagctagg ttatttccgt    110100
     tactaaaccc tgacgataag cccattcacc gctgtaaccg aagatgagag acattgcttt    110160
     tgcttgctag ttaatcctgg ggtaatgcaa ttatgcccaa tgcagggttt gagaaacata    110220
     ccaatgccac tatgccagca tctgtcagtt accacgaact acggtacaga agaaacagta    110280
     ctcaacaggg tacaagaatt tgcagggtgg gagctgtttc aaacatggac tcgagctgat    110340
     catgtgtgtt cacaaacagg gcagccctgt aaaacactat tctaaaatct cgccgtcata    110400
     tgcatgccac gttgcccgta caattccttt tttttttcct aaacacggta ccgacgcatg    110460
     cgcccatata cacgacatct cgtagaataa tacgtcatct accataataa aataattagc    110520
     cgtaaataaa aaacatatgc taaatttaaa acttaaattc ggataaacat gtttcactgt    110580
     aagaaaccta atcggtcgtt cacgttgcca gtacaatttt gagcagctat agtccgactc    110640
     atactcatac ataaacactg ggaatttgta aatgaatttt ctgaataata aatggcattt    110700
     gatggatgaa tttgtaaatg aattttctgg ataataaatg gtatttgaag gataattgca    110760
     aaacaaactg acaaaatgta ccagtgtgaa gactgcacat tttgtttgat ttgggctatt    110820
     ggacttgcat catagtaaag ttttatttgg cccagatgta aatcaggccc ggattatgac    110880
     agcctccagg aggccatttt tctaaggcag tggttgggaa gcggtagttg atgaatggcg    110940
     atcagcctac ctatccttct ctccctaacc gaaagggagg aaaaaaaaca agtaaacaac    111000
     aattccttgg aataaaagac actatagtaa atagagtaat atataagagt tgattagtct    111060
     atgaaaatga gcctatatat cgcctatgat ttggacagaa tatcttgatc agctttgttg    111120
     cgctagcacc caaccatttc cctcataaaa agacagaagt acgaaaatga aaggagcaca    111180
     gctttggcag cctttctgtt gtaaaaccaa ttcatacgca tccacatctc taaattataa    111240
     aacttttctc cccacgacaa aaggaagtaa tgtgtgctac tcctatcacc gttctgaata    111300
     atctgcagtg gtttctttgg caagatcaga agaaccaaca tgaacttgca tttgctttgc    111360
     cagttgccag tttgccacca aaacacagaa cacggcatgc tctgtctctc gagcggtgca    111420
     atgcaatgca agcgacaccc tcgatttcct cctgcaaaag agggagagag agagtacagg    111480
     gcatggacac catgcgtgct ccagtttcag gctcgggttc agaaacgggc agtacgggac    111540
     acggccttta cccacacaac tctgcatcac atgcgacgat caataccaaa cagctgcgcc    111600
     tctgcatctg catcttcagc caggggcgga gctagagaaa aaccgagggg ttcctaactt    111660
     tctttacgta gtatcgacat gtacagctct ggaacgatat tatactaaat agttgtatac    111720
     tcaatacata taagcatcat cttcctaatt aatgacaata tatgagaaag tgcatgaaaa    111780
     aattaaaaaa aatacgtacc ataatgaaga aaccaactga taataatata tatgaagtta    111840
     ataatgtgtc atgagctcca tacccaaaac aaatgaatat atcatgtaaa atgcgatgtc    111900
     accatcttca ttcctccatg caacaaggca tagtttaatt atcaacaaac aataagtcat    111960
     gaaatgattt gacataaata aaaacagtta cctattaatc tttatcatat ttgcggtggt    112020
     tatattcatg aaccgataaa ccacttgttg taagtggtgg ctatcggatg tgatttttga    112080
     tagaagcact tgtggtcact aggcggattt gacgagtcaa tgagggcaag ccggcgagct    112140
     catggatcca gccattgccg gccagcttgc tgctgccgct gcccgccggc cgtcctaaac    112200
     ttctactccc agactgccct gaatggctgc gttcatcgca aaagcaagca agaaaattaa    112260
     gattaaatca atggtaaact agcaaaattg gaagagagaa gaagtaggag tacatgactt    112320
     acagagtggc agattggatg ataggattta ggggctgtca taggtcgcgg agtcgtcgga    112380
     gtgtgtggga aacgggcggc gtcggcaagc gagcgccggg cggtcgccgc gtcgagcacg    112440
     gctgtggcgg tccatgggcg aacggtgacg ggcgcacgac gggatggagt cggagacgtc    112500
     aggcgtggtc gccggtcgtg gagtcgcgtg gagcaggtgc tcagcggcga cggacgagga    112560
     gaaagaaata atcacgcgct tgattttggg agatgaaacg acgccgccgc tgcgccgtgt    112620
     ggatccaacc acgtgcgcga ctcctcctct cctctcagct gggctgtctc taacagatac    112680
     acatcgatgg gccttgtttt gggccagacg aaggaggggt tcctggtttt gggctgaggg    112740
     ggtgctgatg tggtgaattt atgggggtaa caaggtattt cagaaattgg gccgggttcc    112800
     tgggaacccc ccgggcctat tgggctccgc ccctgtctgc agctgttgcg ggcttgcagc    112860
     aacgtcatgg gttttgctac gctacgtgcc aggagaatgg tctcggatcc tctctctctg    112920
     ttgctgttac tgcggggctg gctttgctgc tgtgcgcgtg aaattgtgaa cagtgtagtg    112980
     agtgatgagt actaccagtg gtactggtac tggtactcca gtaactgaag aaccgaactg    113040
     ggcagcaagc aagcaaggaa ggagaggagt ctgctgtggt ggttgtgtcg ctgaaacttt    113100
     ttttaaccgc atgttcttct ctaccgctgt tgatgggtgg atggggcgat gggctgtcac    113160
     attcgccggt caaagaagcc tctctttcct tacagttgga gccagctgcc accgactatt    113220
     ttagcatacg tactcctact cctaatctgt tgctcttttg cattcttttg tgtataccgg    113280
     tgcagtactg gtactgccct gcagtgccgg tgggagaccg attccacagc acttgggacc    113340
     ggggttttcc ctctaggaaa ggaagaaaat ttcggtgggc atcaaaattc cggaatttcg    113400
     gatattccta acgatttttt aaaattttta acatatattt actgaattta aataaattat    113460
     gactaaattt acaaatattt gaaaaggtct gaaatttcga tcagaatatt tgcttgtcgg    113520
     aaagggatga aattcccaaa attttgaata ttcctgaaat ttcgaaccaa aatttatatt    113580
     cctgcttggg acgaggagcg agcgtccact ctccatggtc tgcatggacc atagcccata    113640
     tacccgtcag ccggtcagcc actcttggag aggcttttcc ctatttggta ggaaatactt    113700
     tcaagccatc gaaatagttg acagtaaaca gatcaaagtt cagtacaaat ggaatgaact    113760
     agtgtgaatt gcgggtttat gatattaaag ctaaaggtgt cgtcatctca tatattgctg    113820
     ggagtttcgt ttattttgtg ttcctattgt gttacccttt tcttatatgt aactataagg    113880
     cacatacacc tcaagattat aactctacaa cctattaatt ttacggaaag tatgtgtaca    113940
     acaaagtaca acaaactata ttttagacct ggtagagtag taacttgttg acgctctcga    114000
     tgaaggggtt tggtgaaaag tgattgttgg aatagtctct gggatctttc tttgcttgta    114060
     tctcgatggt atttatgctc gtaggctcca ttgtcttgag agactcatga ttttttgtca    114120
     tgtacccgtg ccattctagt tgagttcaaa tatgtcatga aatccttaca taattgggtg    114180
     cgtctccgac ccttatatgc tctaggcgat accttttgca gaattttttt ttatatgcaa    114240
     gttggtatgc attctttagg ccgtgtatcc gtagagtatc ctttggcttc gttcgagatg    114300
     gctgcttgga ctagattttc atcggcacgt gaaatcagac gagctattag caaattatta    114360
     tttgagcatt gagtattaca atttaaaaat agatttattt aattaaaaaa attctgtata    114420
     ggaagtattt gtaaaaaggc aaaattgttt tacactggaa attgttgtct ttggtttcat    114480
     agcatcgtaa gatattagta aaaatgtgct aatgataaac gagagaatag ctaatccgaa    114540
     aaacactctg aaactcagcc ttttaaccct agatctaaag gaagtattgc tagctctgtt    114600
     tcaggcttca cccaaacctg actaaaggag tatatctttg ccatttctgt tcatttacac    114660
     gcaccaacta ataaatccaa attaaagacc agattgttaa gctaatgaaa atgaccaggc    114720
     aaaaactaat ttatccatga aagtcacata gccgtatcgt ccttcatcgt ctccaactcc    114780
     aacatcgcca tgcagtacgt acggatgaga ggcaacgtgg ctgtttgacg agcccgtaac    114840
     gtacataatt tgtcacattc cggagaaaaa ggtcccagcc gttggctcat catattcata    114900
     tctttcacgg ttcaccgcta cggacgcaac gccaaaaggt gcccgaccga tgcactgttg    114960
     gcgacggcat atacatacat acatccacgc gaccatacgc tatgtcacga cggggatctt    115020
     cgagttgtcg ggttcgttcc gtttttataa tctcctgcat atatgcatgt ttatctttta    115080
     gcgtcaaatg atagagatca ggttagtcgt cttcacagac ggaatcatca atcatgtact    115140
     ccatgtgctt tgcatggctg tagattccag ctgctgtcgt ctagcatcac atagacggca    115200
     cttaaaataa acagccggta aaaaatctga aaaaaactta tttttatttt cagtttttaa    115260
     ctttttattt ttttttttca aattctacga ttacatatta taaaaatctg gattatttag    115320
     atagtttctg acagctgaat attctaaaag aaattgtagt actagcttag aagtttcccc    115380
     aaacatacac atattttctt catcctaaaa aacaaacctc ccgtattagt atgtgttata    115440
     ttctgtacta aggccgtgtt cgataccagc cgttcccaac tccccctctc gttttccgcg    115500
     tgtacacttt ttaaactact aaacggtgtg ctttttgtaa aaagtttata tatgaaagtt    115560
     gcttaaaaaa atcatattga ttcatttttg aaaaaaaaaa agctaatact taattaatca    115620
     cgcgataata gaccgctccg gttcccatca cccaccaccc accaccgaac acaacctaaa    115680
     atttgtcttg tacatgatga aagaaataaa ctcgtaccac agtcaccatg acacatactc    115740
     cctctggctc ataatataag gtcatgtaca aaggtagaga ctaatatgag ctctctatat    115800
     taattaatgt aattagagac tattctccta caatattaga gacaataaaa attctaaacc    115860
     attaatgcat aaataatgtt attattatac ttctttcctt ttctctaccc tcatgcaata    115920
     aactttctgt taataaatgt taagagttat ctctgagccg ttgtcatgcg tagcaataat    115980
     atttctcatt cctttccact ttttcttcca cgtcaccaaa tttacttgca taacaatgaa    116040
     gagagcccgt tattagacac cattgtacat gccctaaggg attttggagg gatgcgatat    116100
     atactaggac aaccaatctg gataggagta tgtccagatt tgttgtccta gtatatatca    116160
     tatctcttca aactctgttg taatatgtga cggagggagt atttatttat ggacttaact    116220
     acagcgcatg cagcgtgcat ttacctccag gatcgtcacg ttgacggtac ggtacggtac    116280
     gtagtcccat tttgaccatg tacttagatc ctgatttcct gtggaaaatg acacgtttct    116340
     acggcagaat catctaaaat gacgttgaca agaagccggc catctgccaa ctgcgatgtg    116400
     ccgctgcagg aatattttgg tcagttaatt ataactggct gtgcctctgt acggagtgga    116460
     agtgcaggcc ggaccgccgg agaaggggca gtctgagcca aagcgatgat gtctttcacc    116520
     ccccctcggc ttttccggtg agatcggcgg gcaagaacga tggatgcagc gtgcggcgca    116580
     gccgcgcagg cctacctacg ccgcgcggcg ccactgccgc tgccgctgcc ggctacggga    116640
     ggacgaggga gggagggagg gttggagggg cggcggcctc agaatctgcg acgcttgtca    116700
     caagtggcct ggggaccctc ctcctcaccc tcgagatctg caccagcaat gattcgccgc    116760
     gtggtagggc caacgccgca ctgcttgcca ttcgagcctg gaattgctgt gcatacgtcc    116820
     atacgtccat acgttagagc agtaggctat atgccggcta agagaagtgg gctataaact    116880
     tacagtcagc ttagacataa gaaccaaaaa gctctgtgag agagacaagt gggtcatgta    116940
     ttaattgtaa agagctaatt attactccct ccgtcctata atataaggga ttttgagttt    117000
     ttgcttgcac tgtttgacca ctcgtcttat tcaaaaaaaa ttagaattat tttttttgac    117060
     ttactttatt ttccaaagta ctttaagcct atttttttgt tttttatatt tgcacaattt    117120
     ttttaataag acgagtggtt aaacagtgca aacaaaaact caaaatccct tatattatgg    117180
     gacgaaggga gtatatgggt aggttgaaag aagactacaa agaaccttat aaccaacagg    117240
     tcggctgtat tattagcctt gctcttacgg gggatttttg gttctctccc aactggcgaa    117300
     gtagaaattt aactctgtgg ggtcaattac tagtttgtac ttaaacgagg tcatttattt    117360
     aattattttg gatttatata tgaaaatgaa agtctatagt ggtatttttc aaaaagctgt    117420
     gaggtcagct gaccccacag tttatgcata ggtccgccac tactctattc ttggtaagtt    117480
     ttggtactaa taatattttt ggtagataga tatgcatgta tcacacatat ttggaatgat    117540
     actagtataa agccaaatat tgatcatatg gagaggaagg ttttaaatta atgctaaact    117600
     gaccgttgga attatcaatt atttgggttt aatccaaata tacactaata ccattcaaac    117660
     atattttttg acaacaacct aaaaatggtc ctatcctaca tcgctgggca catttcccct    117720
     tttaaaatca cacgactttg gatgttttag actactttaa gatctgttca acacctctct    117780
     agccccaacc cgtcattata ttcttctcgt tcactcacga caccatcgcg acaggctctt    117840
     cttctcccga tcctcatgcc ctctccattg caaccgtctt cccataccag cgtgccgtcc    117900
     tcgaccttgc tagcgccagg agccactacc aacacgtgac gagatacatc cgatcaagct    117960
     cctccattcc cccagccatg ctttctccct gtttcgagac caccggagac accacggtca    118020
     cctaaccact ttggatccat gcttccatcg ccaatataga ccaatcacct tttttttttc    118080
     gtcgagacga caacaccact gtctcgccgc ccaaccatga ccgtgggtcc accatcagac    118140
     tatcaccgcc ttaaccattc ctcttagcta gggaacaatt ctcacttccc tgcctccaaa    118200
     ccccattttc tctctcaccc tcaactttga aaccattata gtatgtagtt cagggcttat    118260
     cagagacaga cgaagcacga atcttagagc atatctgaag gctcaaaatt cgagtgatct    118320
     tcaccctaag agcaagttta atagtatagc caactactag ctccaattca tctatagcta    118380
     atctaatagc tcattaatac aatggttaca tactacacta ttaatacttg gttccacctg    118440
     tcatacacac actgtgtttt ggaatccgtg ctacagctga ctataaatat atagcccgct    118500
     gttcttctct ctcctcactt atctccttaa aatatgttta cagctggctt atagcctgct    118560
     actgtacctg ctcaaaaatg tgtcaagtgg tatatatagc attcccgttg ggttgtgtgg    118620
     tttgtgcgcg tagcgggttt tctcgtggcg aagaggatcc gcgcggccag cacggtgcac    118680
     gcgggccgta cctgggccgc acgtgccggc gagcccgcgg ggggaggcag tgggcggtgg    118740
     ctttttgcgc gcaagtgacc tcgatagagg agggggcccc gctttacagc tggtttctcc    118800
     tccccggcag gggggcactc tgtccagtca cgtgggacag acagcctcag ctcttctctc    118860
     ccctcctctc tccctctctc tctctctgcc caattatttc ctgaattatt gcggctaaaa    118920
     acacgacgtg gcccacagac agagtgctca gaggtatagt tagcctattg tgcactccta    118980
     ctcctactac tagtaccgga gtcatgttca cgctgtgccc tgttggtttg aaccgtggac    119040
     cagtggtcaa aacgaaaaac ggatcagtcc cctgctcacg ttacgttaat ttggacagta    119100
     gtcaggtcca tgcaatcatg catgcatgca gcccaagttg tagagtactc cgcagtatag    119160
     taccactact ataactcatg aacttgagtt gtataaagat cttgtaagat attggtagat    119220
     gagatttttc aagaggccgt atgttaccga taaaaattct aatcctacga ggctttaatt    119280
     gggcatgttc tatgttcgac tagcagccaa aaattcattg caccaccaac caaaattcca    119340
     gacgattctc tctttacgtc aatcttttcc tacaagtgga aagacttagc gaggtcttcc    119400
     tacgtcagtg gcaccgccca atatctccta accagaataa tacaggttgg aagcttggac    119460
     agttgggtag tggaaatgtg gaatcctaat tgctgcgcag tatgggcaca gccgtttacg    119520
     tacccttctc aagtctcaac aaatattcat cgggcgaaag acgacacgct gacaacagat    119580
     atacgaagta ctactattct tttcaaagat aagcagcagt tgcgcttttc ttttcaaaga    119640
     ttctactgtt cctgaaaaaa aatggttgat ttgttagtga aaatccctcg aaatacatac    119700
     gtaccaaatg cggcatgatg gaaatcatgt aaaggaaggc agaaaaaccc tactacagta    119760
     tatcactggt gagtgattga gctagccgat aattccccca ttcaatccca taattcaaac    119820
     atcgtgcagt agaacttacc aattgtacta cgagatgtgc cagcagctta ccaagttttc    119880
     tggattctgg ttcagactag agagtatcca aagttccaaa ctttagtgcg ctggtggaag    119940
     agcagaattg gatgtgaaca gtgatcactt gcatacagga ccaggcacca atggactgac    120000
     gcctcagtgc ttcacatgtc caattagcca agaccccctt gctccagggt cagtccacct    120060
     cgaccagtca acaaggacag ccggcctggg gagaagttaa tctaggacgc agatactgta    120120
     gtctgataca aacgtcaggc tgtatactgg accaagctaa gattcctccc ttctccagag    120180
     agaaatactc ccctggttgt taaaaaagat tccccttgca atgaagcatg tagccaaatg    120240
     attagtagac aacatccatc ggaatgaaag agacaaaagt gataaaatat caaagcatat    120300
     gtaattcaat gattcataac atacatctta tttctagttc atgtgaatac tgcacttgca    120360
     gctagccagc tagtactacg agattataaa ttccacatta gacatccatt ttcagtcagc    120420
     taaagcgagg tgatagcccc ctcacactga tattcatata atttaagcga atgttctcgg    120480
     attatgcaca ttacactttt cttcatggat ttctgtaata tactaatctc tcctgcaggt    120540
     actcctaatc tcatgcaaga gtatctaaag ctaaggagag tctcctcgct tagacactat    120600
     tatatatgag aacccactct agcctacttt attatattag tatttacgct accatgtcag    120660
     attccaaagg tgcttcagac tgtttgaagt acttgtactc acaagtatga acgaacatat    120720
     gctttctatg ttaataaatc taaccttgca gttgcagaca catgttacat gatatacact    120780
     ttccgcatat tctttatttt cgtcttgaaa agaaagggac aactattagt cagcagcaag    120840
     atattgcatg gataggtaca tacacacggg gcgccaaaga ttgtattgtt gttgtctggg    120900
     acatgacaaa gtgatggagg aggctgttgt tatcagaggt ggcttacagg ccaagagaga    120960
     tctagagtta ggaggagcta gagagacagg caaaagcttt ggcacctgcg tccttgtcaa    121020
     gcctcgaaac agttcagtac tcccccaacc actccaattg gggtggcaac tccagccgtc    121080
     catctccaga tcagatctga tggcacatca tgcattccct cagtttgcca ggcagtgcac    121140
     atcatcaaat atctctccct ccattggtgg ggcatatttt tctacgtgct tgatgtacaa    121200
     ggaagaaagc ctccaccaca gctttgctcc aactcaaagc ggctagcagc ctaggatcac    121260
     gagtgagagt gatgctgata atctctaact atattgctct actgattagt tcatttaatg    121320
     tagcatatat ttattgagtg aagtaatata accttcacaa ttgttggcaa aacgtctcag    121380
     ataggaatta ggatatttaa catgggttgg aaatggggca tgagatataa ctcggataaa    121440
     caactagcct aagatttgca caaaggattt gttcaggtaa aaaaagccct gggctttata    121500
     aaatagaact tatctgcaat tgcagtccta tcaggcataa attattctca cctagaaata    121560
     tagcacaaaa taacctatat tagtggtgca gtgattttac ctttaaactc tttctgccca    121620
     cttcctcaac ccatgcttat ctaccacttt gaagcaaaac agtactcaaa atgatctcta    121680
     cacatcatat tctgcttggt attagattgt accaagtatg accagaagat atgttgatgc    121740
     gcccataaac ccattctgtc caccataaac ctccaattac gcaagagagt acatccataa    121800
     atccattatg tcctctgttc tgctagaata taataatcaa actactatgt tataattgca    121860
     ttcagagcac gaacagcgct agactgatta cgcttgatta tctataatga cctacctcca    121920
     atctaaacaa acaaaatcgg gatacgctca caaggcctgc atcttacgaa attctgttaa    121980
     gttccctaat tcccgacgga atccctccct aactccgttc cgtttttgcc actatccaga    122040
     caaggacagc tcaacgccac cctgtaacta ctgttcatcc aataaggaca gttgagtcat    122100
     tctactgatg ctttggccgg ggtgggtgtg tctcccggtg tgtagtatta ttatacgagc    122160
     atggtttgga ccaaaaggac aagagtggtg cattatagca gacacttgta tatattgccc    122220
     ttctgtactc tcccttcccc tctctcctac ccccttttcc ttctaacctt tagcttttcc    122280
     tgcctccctc cttctttccc tcctctcttc tcttctcttc tcttctcttc catctcctaa    122340
     tcttccccta acaagtccta gctaaattca gatccttagt tgctggtttt tcttgttcct    122400
     tttctgagct agatttcttg ctgctgagtt gaagttagta tcatgagtcc accgagtgtg    122460
     atagggcaat ttggggacac aacctacacc aaggtgtttg taggagggct ggcatgggag    122520
     acccagaagg agaccatgag gaagtacttt gagcagtttg gggagatcct ggaggcagtt    122580
     gttatcactg acaagaacac tggcagatcc aagggctatg gatttgtatg atcatttaca    122640
     gttctatctt tcctttacgt gcacttaatt gcagcagttt actttgcaaa cctttcagtt    122700
     ctagtccacg agttttttct ttcctttttg gtttgctgca atatgcaaag aatgcttaat    122760
     ttttattaaa ttatgcacca caaattcgta ttgtaggtta ccttccggga cccggatgcg    122820
     gcgatgaggg cttgcgttga tcccgcgccg gtgatcgacg ggagaagggc taactgtaat    122880
     ctggcttccc ttggggttca gagatctagg cctccaaccc cacagcatgg ttagacattt    122940
     gccattatct caccagctaa caaaagcaac atagaacaca cagttagcta gcttgcttga    123000
     aagccttcga tgacaacttc ttatgagttg aaaacagccc aacaccaaaa gctcttgaaa    123060
     aagagaagtg ataatcatta tagatgcact aactctggca ttttctatga tttccacata    123120
     tagtttcatg atcgcaaact tagctgttat gattttatgc gcaaaaaagt tccttcctgc    123180
     caatagaata aataagagct taaagaacac gacatcaagt ttgcctaact ttgctaattg    123240
     gctaagcctt gttagatgag gaccttttaa atgcattggt ttagcttagt gctaactaat    123300
     ttttactaag tacagagcat acattttgac aggactgccc ttttacctag cagcaaaaaa    123360
     atccatagtc ttgacgatat tatcttggaa tttagttact ggaaaagtag ataaggagga    123420
     cgaacaacat tagcagtaca aagatgttag ttatccttga aataagtgcc ttgtttcgga    123480
     taatgcgcta tactaattat aaatcctagg ctcagataat aaactatagg atcaaacctt    123540
     aaccctaaat taatcgggac agattcagag aatcttttac ttctattatg tcgtcttgca    123600
     attcagcgac cgaagaatgg tttgaccatc tctgtgaata aactcattag tggtgcatca    123660
     gaacaagtgc aaggctgctt tcaagtgtct ttttgcagat aatgctagca aggcaatgtg    123720
     ggtaaatttg ctctaatttt cttgacgatg ttgctacagg aggggctagg agctttaggg    123780
     tgatgaagtc ctttagccag caggcaggga tccaaggtgg tctgggcgca gcttttcctt    123840
     ctcacgccac cttcccccat tatgctatcc cacaaggtct cccttaccat gtctatgggt    123900
     aagttctctc tctctctctc tcccccctta aagttcccaa ggaccaacta tgacgggggg    123960
     cttatcacat gcatgacatg tgcatcatga catgccgcct tggtcaatgg tgaatggcat    124020
     ggaagctttt tagcttgcac ccccaaggcc ccaacccctc ctctctcaca cacacacagt    124080
     ggcaggctgg cactggcagt gcatgctgat ccagtggcac atgaaagggc agtcttgtta    124140
     tctcccttag actgcaagca cgccctactc tccctctggc gcaagctatt agatgcttag    124200
     tcgagtagat gatttcataa ccatgattga tacaaaattg atattatttc ttctccttcc    124260
     cttaactact gcaggtactc tccctattct ccagactaca gttatcccac agtaagttcc    124320
     tcttgcaaat ccagcaagta ctattagttg gataaaaaat ataataggat gctgatgttc    124380
     ttattattta actgagatca gtttctgtgt gtgttggggg tgggtgcggg gacaaatatt    124440
     aagcatatca attttaagct aacataccat tgtgacaatg cttataggtg taccagaaat    124500
     tagttttgta gtatgcattt gcaatagcaa tcaagatatg atacatgctg catagaaaat    124560
     agtagcacat aaacatctaa tagcaaaaca agacattgca cgaaattaaa tgctgctaca    124620
     ggaacatata ctatactgct atagcaaaca gtaacccaaa gaaggtgaga aatgctaagc    124680
     atattagcct cttcaaccgc gagctttcaa gccaacctgg acggtttgtc tccatactct    124740
     agtgtactaa atgaaatctg tcttcatagc aaatcctaca caggttttac ttacaaactg    124800
     acatcctgca tgcaccgtca cttaaaaact ggcatagcat gcttgtcaaa cactcaaact    124860
     tgtaaatcat gtacagatcc cattaaaatg ttactaatgg aaagcacata actagctaat    124920
     acaagcccac agccccacac caaataaaca ttagtgtgta gcactacccc agtaccccta    124980
     tataaatata ataacatgaa tatacaaaaa gaaaagctat caaaataatc acttttgcta    125040
     ctagaaaacc aaaaatccta gcaatttcaa tacattgaac catttgaaat accacaggct    125100
     gataaagatt ttcctttacc agtagttttt acctgtcagt tggcatgagt tagcagctct    125160
     taagaatatc catcgcctgc ctagcttcct ccatgttcag tgacaatatt atgtgctatt    125220
     gtgctgaaag gccctaagcc atgcatcctt tcaaaaccat tcccttcacg tgtaacaggt    125280
     attataatgt tgaatttctg agtccagctt cgctaatgga tatgaggttg ttttccaacc    125340
     cccctcaaac agttgtccca tatgagatga gcccagtcca aacaatgtcc atgcctgcat    125400
     taaaaaaaat catcaattat ccatcctgag cctccatcaa gtatagtgcc ttatggtcct    125460
     agcagcttct atcttacctg gtacaggcgc acatgacatg ggccctagct tgtccagacc    125520
     aaacctgtta aacactgggt ccatcctccc atcagctaga cccctttgtt agccaaataa    125580
     acttagtgac agcacatgcg tgggtccaca attctattca aagctatacc tctgtttggc    125640
     tccataaaga cctaagtcac ctattgggcc tttgatgcat ggacctaaat gtagtccaga    125700
     atacaggttt ttgcagttag tgcgccaatt tagctttgtc ccagattgat gcactgcata    125760
     tgacaggaac agtcaagtgt ctgtctaaca tgtaatctgt tgcagaggca catgattttc    125820
     atgaagtcaa ataggaagca cagaaacttg gtatttcaat actgtttgat agtttacatg    125880
     agctagaaaa aaaaaactat ttgaggtata ccactctaat aacgggacta tagcctgccc    125940
     ccttctcccc ctcctctctc tctcagttcc aatttccaaa ccatgcattt tgacaccatc    126000
     catttactag tgttggagcg aggaaaaaac aaaataagtt acttgtttgg atatagtagg    126060
     atattttcta gaataatgca acagaacacc ttttaaaagt aggtaaattg tacatctgca    126120
     tagtgactgt gatacccaga attagattat tggttatgta ctgtaaaagg catatccaaa    126180
     atattaaaat gacaattaaa ccaaattgtt gcctttactt taacagttgc taacggttat    126240
     gcacttacgc cttagccgcc ttaatatagt actatcagag tcactgattc aaattcatta    126300
     gtaaattttc aacaagaagc aagaaaactt aacagaatat gcaagcactt aattcaactt    126360
     tttacataaa gttacagatg ctaaaatgca tctcttgcaa acctaacaga ttcaagctgc    126420
     atataggtat gttttgaatg taatgtgaac tgaattataa cagagttcct aacatacatc    126480
     acagaattat atcagaaaga acaaacgtca tggaatcaag acttatcttc tccttgtgct    126540
     gttaattaga actactacaa catctacgga ggagctcaat acccatttta tggagcggcg    126600
     gcggcggcgg cagcagcagc agctggcatg gtgactggaa gcagcccctt ttatccatat    126660
     ttccagtttg ggcaatcagg aagcactaca accaactatg caagtggaca aggctacaac    126720
     ttgcaatacc cacagatgtt tcacttctca actgtggctt ctacagctgc tgctgtaaca    126780
     ggttttgcac agcaatatgg agggccattg tctcttgcag cgagtcctca agcccaagca    126840
     ggtattacta gctctcttgt atatgcacct ccatcataat tcaaatcctc tgtgtaggca    126900
     tgatcctagt ttcctaggta aaatatagag ctttcaaaag tacattagat ttttttttct    126960
     cttcacttga caaaaatgca attcagaggt tactttgcat gaatattaaa acaagaaaag    127020
     caatccagca gctgttacta ggttgcattt caaccctaac aaaaggttgc atttcaatat    127080
     ggaacttttc agtctgcccc agtacatttc taaggacaaa ttagctgtct tttacgcatt    127140
     tgtcaatcag tcagtgcata aagaatccta actagtggac atgtaatgag aatgatacaa    127200
     agtatggttt actttttcac gcttgtttgc taagaaagct atcattttct cataatatag    127260
     ttacattatt tctttcttgc tcagtagtga cactaataca ttcacagtgt gtgtccccat    127320
     taaacaggca tgactatggc tctcacagct cctactttgc cgactccaac tcaggctgct    127380
     catccttacc ggctcattcc ctcgcacttt gctgtgtctg ctgctccaga gcaacccttg    127440
     gcctaaccat ggtctccttt ctcatcgtca ctctcatttt tatttcccac atgttgagtc    127500
     catgcatcca tctctaacac cagaaggcac tattgttgac ctcatgctca tcagctaaaa    127560
     gtgcacactc catatcccac atggtcatgt ggtgattgga gataagcttc agccccagga    127620
     tgggctcaaa gcttaatgcc cccatggatg gggctgtact aacagagaag cacaaaccaa    127680
     ccaatttaac aacagtccaa ggaaggactt catggattaa tttcaaccct agcagagaag    127740
     gctatgggca aaagtaaccc taacaatcaa gcattaaccc agggagggtt catgctgata    127800
     caggccaatt ggacaaaagt gacatctaaa caactgatcg agcaagaatg ccacttcaaa    127860
     atttcgtcag tggaatctat attgtattta gcataggcca tgtgcttctg gatgaagcac    127920
     aaaccattta gcagacccta atcttctagt cttgctgtta cctagaggaa atcaatttga    127980
     catgtaacca gtctttaacc tcttcccatg caaattagcc cccagcaact tatctaacac    128040
     cacgtgttaa cttgtgtaac caacttttaa cctttagtaa gcaactatta ggtgctccaa    128100
     ctaacattcc ttttttatct tccagtttat agcttgcatc taggtggtta aggctctaag    128160
     gagagcctgt gccccttgtc agagacaggt tcagaggagt gctaatgttt gtttttggca    128220
     cttagtgcta cctcctgtca tttctaacat agtgatggta ccccaaagaa ggctttggaa    128280
     atgccagaca ctgcctatgt atttcattca ttaaccccaa tggacccata gatatatttt    128340
     attgtcttgg gtcggccact catctagatg tccattgctt ccccaatgtc actaccatgg    128400
     ttaggtccag gatcactcct ttctgctccc ttccctcctt ccccacctct cttccctctc    128460
     tctgtgtgta cagagagaag ccttaatgct ttttaatgta ctattatcgg acatggtgat    128520
     tgtaataata aagtagtact gtgacacttt taggacaagc agtcaagcag aactgtttac    128580
     tattcaatcc tgcatttctg ccacatccat tcctgatgtt gtagtttatt gtataatgtt    128640
     atgtaaaatc tacctaccgt gatgcaaatt tcttgctcgt ttatctttta cctagtttca    128700
     tctcagaaat cagaatttaa ataaacagga attactgatg tgaaaagtat gtgttaaaat    128760
     cactcagtta aggcagttca tttgaaccac catccagtaa tattttagct aaataaactc    128820
     aaattatcca gtgagatagt gatgcaccaa ttacaattaa agaaatcact tcagctgctg    128880
     ctattttcta caaagtacca agccactctc aaggcgtgct ttgcagtttc catgctgtgt    128940
     ggtgttgtgc ttattgttta aagttgttgt gggaatgaaa acttataatc gctacagttt    129000
     gttttaccta taaaattaag gttagaatga aatatgttat ttaacagtca tgtctctccc    129060
     atcagttcca tatttttggg aaacaataat aacattatct tttgcaacaa agatagagag    129120
     agagagagag agagagagag aagtcaagca taaaatgcgg aaatgtctaa aaagcagttg    129180
     caccaaatga tattatcata atccaacgca attccaaaag gagcctgagt taagaatcat    129240
     acctaagctg tggacaaata accaatttgc tcaaattatt acggtaaaac agcacatagg    129300
     tccaactaca atcgatataa accaacagtt tgcatgtcca gttctatacg aagatggcaa    129360
     taaccagatt gtttgtaata tacaaaatac tgatgaaggt tagtttagac tgttattttg    129420
     tcagaagtta ttgcctagta tagctagtta gctacatcag tcgtggaaat tttggaagtc    129480
     agaatgactc agcatccctt agaacaaact caagtaagta catataaatc atttgaccta    129540
     acaagagaaa agaaggtgct ataaatattg aagaacagtt gcgtcatcaa aaaattctat    129600
     tggattgaaa ttcaaatagt aaacataact gtacaaaaaa acttgcctga tcaccctgca    129660
     aaaccattaa tacgggaaca accgctaaca tgcaatatgt ttccttccag cgagcatgca    129720
     aatgaaatat atagtaaaag aatgttatag atcagaaaga atagaagtcc gattcccata    129780
     agaatcagtg gaataaatag catatgcata ttttcaatcg caggaatttc atatgaaata    129840
     atttaattcc agcagtaacc aggaatttct tgatacgaaa aagggacata tatcttggaa    129900
     cagcaggctg gttcataata aggtaatagt tcaacagtag ttgcattagt agcttacatt    129960
     tagcgatcta cgcaaccacc taaagtacct agcttcatat gctggacgtt cataacatgc    130020
     acaagaaaag tgtatccagc acaaaagggg gtctgtgcac catgagacat gcaagagttt    130080
     aataccgcag acaattgaca ttaagcattt atgacatatc ttcatgatag agatgaagtc    130140
     caagaccaag acgggtacaa gctcggcgaa aagccattgc ttcagccttc tgcacaggat    130200
     ctccatagcc tgtatcatca gcagaagaag ttccagtggc ttctctgtag atctgaaaga    130260
     aatatatccc aaataggtca gttctaccat atgttaatta aacagaacta tgtaatgtta    130320
     gtatgttaaa gcctagcatt tcaacgcttc gagttgagat gagtttgtat ttaacaaagg    130380
     aatgctgagt gatctccagg atcctcgcct taccatttgg aatagaattt cattagtata    130440
     tttatatgca tcagcatgtg cactccatga ttgaagaact agtaacatac tggaagatta    130500
     caaatgggag aatagtagaa aatgcagtat atgaatctaa ataacctaaa ccatacataa    130560
     cagtacgaca caaagcatgc ctagtaaatt ttgatgaact atggcatgaa atcctagttc    130620
     agcatcaaaa gaaatcctgc atcaaaaagg gggcagccat acttagtttg aaatttatca    130680
     gcagattgtc aatagtacca tactagaagg cctgggattc aataattcat ccatatcttc    130740
     tagtttcgga atgacattta gtaatttagt tgcagagagc ttgtcatcta tacaaaatat    130800
     gatttcctgg ggaaaatagg tacctctgca tcagttccat ggagagtcac gcgataaata    130860
     acagatacag attttccatc agatgaataa acaatgctgc gaacctcgcc agaccattct    130920
     gcaatggata caaaaatcta aaattaaaac agcaaatatg atcactcaac ttctggccca    130980
     ctttgaaact aatccctcta caagagtata agtaaacagc caatgtagta gtgaccagaa    131040
     aaaaactcac ctggagcatg tatattcaga attttgttaa caatgtgcct gcaaaagtca    131100
     tcagaagtga aaacacaaat acaactatat gagcgtcatt tacccaactc aaacaatggt    131160
     atggttgctg aagctcatgg cattaccgat tgtaaagtta gctaggtgga tatggttgtt    131220
     taaggaagat cgtatgtttt atcccttctt attggagaag ttgttagtga atacatgtat    131280
     ataaaggaga ccataatgct accattgaga attaaaaaga agatgaattg ctctcaagaa    131340
     tcaagacctt caagtttttt atatttaatc tagctcctct caaagcagca ggtggccaaa    131400
     ttttttcctc tccatcaatc aatcccaaat ttttacacga acgaaccaac aattacatgt    131460
     agttcacact tcgcagaaca gtgtagtgtg ttaggtccaa gcatcattca gctgctaagc    131520
     acgattctac aagtataatc taggacatta atgtaaacca catcaaaaat ccgcaaatac    131580
     gcgcaacgcg ttaaaaacta acagggaaat ctcccaaaat aagccgatcc ctgtgttggt    131640
     gtgtaggaag ggaggatttc gataggccat cgaaagtgat cgagcgggct caccatggga    131700
     tgtacttcag ggagaagcca tcttcgacgc gcgtcttgac gagggcctcg gggaccctct    131760
     taccgagctc cctgaggacc tcggcgagcg gcttgctgat gccttcggtg ggcgcgggcg    131820
     cggccacctc gccgccggcg aagtcgtcct cgtcctccga cgggaaggcc ggctcctgcg    131880
     gccggcgcga cgcgcgggcc ttcgcggcga aggggcgcgc gaggagaggg gtggcggccg    131940
     cgcggcggcc gaggaggagg cgggctaggg caccggaagc catggcgggg gaatcggggg    132000
     atgcggaggg ggcggggaga gcgagagggg tttggttggg gttttggagt ggagaatcgg    132060
     aaggtcgcct tttattgcga acagaaaatc tatcgcacgg catcccgtgg cggtgcgggc    132120
     ggtcacggga cagctttagg gtccctttga atcgtatgaa tgaaaaaaca gagtaatagg    132180
     aaaaacacag gattctgaca ggaatacaat tgtaaaacag aggattacaa aacacaggaa    132240
     aaacacagga atggccgttt gattggacca caggaaaaac gcaagaatca gatgagagag    132300
     atagactcag aggaaatgtt ccaagaagtt agacatcttg ctaactttcc tccaaaatgt    132360
     gcataggatt acccattcca taggaatttt aaaggattgg ataggattca atcctttgtc    132420
     tcaaaggcct tcataggatt tttttccata ggattgaaat cctccaaaat tcctacattt    132480
     ttcctacaaa tcaaatgggc ccttaatgtg tccgaaacgc cacggcttac agcttgcagc    132540
     tactcacagc tcccttcctc tctctgtgtt tttcccctct attcacagcg ctcgccggcg    132600
     tgcgcagccg ctcccctccc tccctccgcc tccccacgcc ggcgagcctg cgccgccgct    132660
     cctcttcctc cctccgtccc ccacgccggc ggtgctgcgg cgccactccc atcacatcct    132720
     tccttcgatc ggaatcggct cctccactcg gcgcactcca ctccggccga ttcctccatc    132780
     ctccacgtcg gcagtgctgc atcttctttt ggctcccttc gtttctttcc actggtacct    132840
     gtcgtgctcc ggccataggt tgatttacca tcgcttcaac gacctacatc cacatcgcgt    132900
     catctaaagt tagtgatggt gtttgtttta aaatgtaaag gcaactccat agtgcttttg    132960
     aaccatgtac tgacctcccc cccccccaac aaccaggcca actatctggt ggtaccacca    133020
     ttttttttgt tttaaatcat gtgaatatgt gaacaaatgt caccatgtaa tggctactgc    133080
     agtgtcacca tgtgaaatac atccaaactt atctttcatt tgcagcactc aacttttttt    133140
     atgcttgttg tgtgatattt ttttaaaaaa atatataccg cgaatttaaa ccatgaaatc    133200
     aaaatgtcaa taagtatatg ggggttggta cctaaaatat tttttccctg tatttgaaag    133260
     gtatcagggt cttggtacct cacaaaatgg ggttggtacc tacaagcatc ggaggctttg    133320
     attggtacct tccagtgaag gtaccatgat atggtacctt ggtacctcac acaatgggat    133380
     ttggtaccta gtaccaggta ccacacctga acctagggtt actgtgaggc acacggtacc    133440
     tgctaccacc accttgtcta aactaggtac cagaccttgt acctcaatga aaacccaggt    133500
     atcaggtcta aacctaggaa ccaaacatgg cacctcacag gataggggta ccaacctcac    133560
     aaatacaggt accagggtct ggtgcctagc aacaaccaag gtaccggtac ctcacataaa    133620
     acccaggtac caggtctaaa cctaggaacc agacatggtt cctcacagga taggggtacc    133680
     agcctcacac aatacaatac aggtaccagg gtctggtgtc tagaaacaac caaggtacca    133740
     gacctggtac ctcaaaaaaa aacccaggta ccatgtctta acctaggaac cagacatgat    133800
     tcctcacagg ataggggtac cagcctcaca aaatacaagt accagggtct ggtgcttaga    133860
     aacaacctag gtatcaggtc tggtacctca caaaaaacca aggcaccaga cctgatacct    133920
     tacagcacat ggtcactata ggtatcatga ctggtactac acagtcatga ctagcttagt    133980
     acatgtatta ggcatgacca actcagtact tctcacaaca aggtaccaag atcacctcac    134040
     agtacaagta tcagataaaa ttcaagtatc aagtgcaaca aaatttgaca ttctctgacc    134100
     atacatcaca attgttcaga agctttccat tcagtatcag gcatcatcat catgacttga    134160
     tacttgttcc attgctcttt caacagagac atcttccttg ccactctact gttctttgat    134220
     acttctttca ccaaggaaat cactcccttc atttgctatc ttttctatca ttcttccagc    134280
     ggatccaacc gaggagtcca ttttttaact gaaactacaa cagcatgaat aattcacaca    134340
     ttttttcagt cattttttgg ccccacacat aacaagcaga acacaaacca ttatagcttg    134400
     aaaaaaatag acatgctgat acctacacta gagacaagct gatacctaaa ctagagaaaa    134460
     acactgatac ccaaaaacta gagaagatga tacctgtctg ggcagaagaa ggagcactcc    134520
     tgctcggagt gaggcgtgcc gggttctggc tggggctgct cggagtagtt gcggcgtcgc    134580
     ggagcgtcgc cggcgaggta tcgcacgcct ccgcgcgcga taccgagcca ggttctggct    134640
     tgggggagtc cctacttgga gtagttgcag gcggtgccgg cgaggtatcg aggattcggg    134700
     gcgaaggaag gagcgctctt gctcagagta gttgcggcgt cgcggagcgt cgccggcgag    134760
     gtatcgagcg cgataccgag ctgggttctg gctggggtcg ctcagagtag ttgcggcggc    134820
     gctccgcgcc gccggcgagg tatcgcacgc agctgggttc tggttggggt tgctatgagt    134880
     agttgcatat cagccgggtt ctggataggg aatcgagcag agttggcctt ggtcggaaaa    134940
     atgacgaagt gtggtattaa atctgtcggg gtggttttgt taattatccc gtgactactg    135000
     cgttgcaatg gaatcccgta cggtagctgc cctctattgc gaagtattgg aatggtttgg    135060
     gtttttctac ggaagctttg cattattatt tttccagagt atttcggccg tatggtttcg    135120
     cttttgcatg ctactccctc cgtttcataa tgtaaatcat tctaacattt ttcacgttca    135180
     tatcgatatt aatgaatcta aaaatatata tctatctaga tttattaaca tcattataaa    135240
     tgtataaaat gttaaaatga cttacattgt gaaacggagg aagtagtata tttcctgtaa    135300
     ttcactgtaa ctattcttcg gaaccttgct atacgtacga ctactccatt caaccggtgt    135360
     ccgactgaaa tggcacaaca ccataccacg taacggcgta aggcttcgta tgatgttctg    135420
     catgttaccg acgccgtgta cttcgcagtc gttggaaagt tggacgctca ggtcgcgtgt    135480
     gtagcatttt cattttcttt gttactggta gatttggtcc tgcagctcat tttattaata    135540
     ttttttaggc aactaaaaag tcataatacc ttattaagtc acctagcaca ctagtagcta    135600
     ggagagttaa cttctgcccc attatcacat gaagctctta agtcctactg ttagcgcgga    135660
     caatgttgtt atggtttcta ccgctataaa atcgaattaa tttgcaagca tatataattc    135720
     atagctatcc ctagaaattc atcttgcttg aatcaattca tattgttcct actagtttcc    135780
     atgattgcta caggagagga gattatacgg gagagaagac ggtggcacaa ctcataacac    135840
     aagtgaggca gcttgggtcc taaaaaatgt tgagagattt taaaagttaa gatggctacc    135900
     atgataatct agagataacc gcgtggtttt atccgcgtgg ttttataaac cctgttagaa    135960
     acttcagagc cattatgata ggtgtggata ctgaggcagc tcaatttgtt atgctaaaag    136020
     caagctcatg aaccgagtcg gaaaacctta gcgagctaaa agcctgattc aactcgactc    136080
     gcaagttggc ttgttaggtt tattaatata tctattatta ttcttttttt gccgagaaag    136140
     accgaatgag gccatccgag tatattaata ataaataaag ttacaaacaa aacacgataa    136200
     aaactatcga ggtcggaagt gcaccaaggt acatgaccag atagccacgt gctaaccaca    136260
     caaacacaac caaccgaagg tggaatctag caccgaaata acccctgcta agtgtgaccg    136320
     aacgcggtca ggcttacgac aacaccacca aaacgagact ctaaaaacaa tgctcccacg    136380
     aaggtcacaa catcaaggat gtcaccatca tccatctaag aagatgtggt tttcacctag    136440
     agaaacatca agggagaggg gtatcataat ttcaaatcta taattttatc atatgcataa    136500
     acataaataa tagatattaa ctaataaaga attcattata tacaaaatag tctagatgta    136560
     attaaatgat caagcactat ttaagaattt cgagcagctc gctagattaa ggttagttat    136620
     ttttctcaac ttcaaacttt aattttatcg ttttccgtta gtatgctttt caaactgtta    136680
     aatgatatgt tatttaaaaa aaaatctata taaaagttat tttaaaaaat caaataaata    136740
     tatttttcaa gtttataatt attaatactt aattaattat gtgctaataa gttttctcgt    136800
     tttgcgtgag ttaaaaatct ctctctaaaa aggagatata atgcaaccaa gtatagtttg    136860
     acttgacgta ttaagacttc gacttcaaat tcgaggtgaa ccaaatcaga ttagaatcct    136920
     ctacagttga agtcacgtga ctttcttact ctaatgatct atgggctcac atgtcggtga    136980
     taaagacatc gtgcatttaa ctgaagagta tcttaatcta atcagccccg ttcgttagtc    137040
     caacaaaagt tggataaact tttgaatact cgtggcacgt ttttcaaact aataaacggt    137100
     gtgtttcgtg taaaaacttt ctatataaaa gctgctctaa aatataagat taaattattt    137160
     ttcaagtttc taataatcaa aacttaatta atcacacgtt agtgccacct cattttacgt    137220
     gaaacactta atatttattt tcatcttcag gagattcaaa caccaccaca tgagtttcgt    137280
     atttttgttc acatgtcaca agtttgcact cgctcgaacg tttcgacggt ataaacaggg    137340
     gttaattg                                                             137348
//

If you have problems or comments...

PBIL Back to PBIL home page