(data stored in ACNUC7421 zone)

EMBL: AP003515

ID   AP003515; SV 1; circular; genomic DNA; STD; PRO; 54310 BP.
XX
AC   AP003515;
XX
PR   Project:PRJNA79;
XX
DT   02-AUG-2001 (Rel. 68, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 11)
XX
DE   Clostridium perfringens str. 13 plasmid pCP13 DNA, complete sequence.
XX
KW   .
XX
OS   Clostridium perfringens str. 13
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Clostridium.
OG   Plasmid pCP13
XX
RN   [1]
RP   1-54310
RA   Hattori M., Yamashita A., Oshima K., Shiba T.;
RT   ;
RL   Submitted (12-APR-2001) to the INSDC.
RL   Contact:Masahira Hattori Graduate School of Frontier Sciences, University
RL   of Tokyo; 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8561, Japan
XX
RN   [2]
RX   DOI; 10.1073/pnas.022493799.
RX   PUBMED; 11792842.
RA   Shimizu T., Ohtani K., Hirakawa H., Ohshima K., Yamashita A., Shiba T.,
RA   Ogasawara N., Hattori M., Kuhara S., Hayashi H.;
RT   "Complete genome sequence of Clostridium perfringens, an anaerobic
RT   flesh-eater";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(2):996-1001(2002).
XX
DR   MD5; f0f0a2ce6a42712b8f329bf0dc10ff8a.
DR   BioSample; SAMD00061119.
DR   EuropePMC; PMC117419; 11792842.
DR   EuropePMC; PMC135029; 11976286.
DR   EuropePMC; PMC4459074; 26055257.
DR   EuropePMC; PMC5770547; 29339424.
DR   EuropePMC; PMC6471305; 30699957.
DR   StrainInfo; 684799; 0.
XX
CC   This work was done in collaboration with Tohru Shimizu, Kaori
CC   Ohtani, Hideo Hayashi (University of Tsukuba), Hideki Hirakawa,
CC   Satoru Kuhara (Kyushu University), Naotake Ogasawara (Nara
CC   Institute of Science and Technology), and supported by the
CC   Research for the Future Program of the Japan Society for the
CC   Promotion of Science.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..54310
FT                   /organism="Clostridium perfringens str. 13"
FT                   /plasmid="pCP13"
FT                   /strain="13"
FT                   /mol_type="genomic DNA"
FT                   /note="anaerobic pathogen for gas gangrene"
FT                   /db_xref="taxon:195102"
FT   CDS_pept        940..1692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soj"
FT                   /product="Soj protein"
FT                   /note="250 aa, similar to pir:I40444 Spo0A activation
FT                   inhibitor soj from Bacillus subtilis (253 aa); 37% identity
FT                   in 250 aa overlap"
FT                   /note="PCP01"
FT                   /note="ParA family"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62438"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62438"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q93ME6"
FT                   /protein_id="BAB62438.1"
FT                   /translation="MKKISVFNIKGGVAKTTSTANFGACLEEKGDRVLLVDLDPQSNLT
FT                   KLFKAYSMEDVSIADVLLDKNLDIEKVIKKTDFENIDILPSNVTLAFAERKILLDVNRS
FT                   QQNRLAKALEEIEDKYDYCLIDCPPALNMITVNALCASDEVLVPIKIDKFALDGLEYLL
FT                   DSIEEIKDEFNPNLNFKGCFITMDSSTTVNKVIKQELKSVLGEKMFNTSIHQNIKVVES
FT                   TFEECPVVFSSKKARASLNYKDLSKEIF"
FT   CDS_pept        1751..3031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /product="ParB protein"
FT                   /note="426 aa, similar to gpu:AF300944_3 presumptive ParB
FT                   protein from Lactococcus lactis subsplactis (242 aa); 30%
FT                   identity in 266 aa overlap"
FT                   /note="PCP02"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62439"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62439"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q93ME5"
FT                   /protein_id="BAB62439.1"
FT                   /translation="MAKKFSISEGMLNGISKNTRKVEEFQAKENFKIEYINIDRIKRNE
FT                   KNFYEIVDIESLAEDIKLNGLNHNLVVRKLDNDMYELISGERRYTALSKLVNEGNKEFN
FT                   LVPCKVIESNDIDSEIILIQANAQSRELTEVEKLTQVERLQEFYKIKKENGEKVPGKIR
FT                   DIIANDLNLSATQVGRYERINNKLIPELKAVIEQGNLTIANASEFSSLSEENQRVILSI
FT                   IDDKTNMSKQEAVDLKNKLKKIEEEKELELKKAYEEKELELKRLEEEKKNQVSKLKSEN
FT                   ENLKKKLDSNNIEEERKEIEGQIKIEFEEKLKNEKVILEEELKSKYDKKIEDITKEAKE
FT                   NNLEKQRLKDELSKLKEKSNNEVDIKNTKENFVLVQNLKLIDNSFKNLKSQINKMKKEN
FT                   VKVAEETKAKEFLEKYQKEISDLLKKL"
FT   CDS_pept        3147..3509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP03"
FT                   /product="hypothetical protein"
FT                   /note="120 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62440"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62440"
FT                   /db_xref="UniProtKB/TrEMBL:Q93ME4"
FT                   /protein_id="BAB62440.1"
FT                   /translation="MEKILAEKRINISFYKRKNGALVTTLYLPPKWLEVIGITENEREC
FT                   FFYIEDKAIKISKEKQSEEAKEKTISFSKTSTKTYLNNKWLEYLGVSEDERSCIIELRK
FT                   KDITLVKDNGRDILDI"
FT   CDS_pept        3773..4024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP04"
FT                   /product="probable transposase"
FT                   /note="83 aa, similar to pir:T14710 probable transposase
FT                   from Yersinia pestis (402 aa); 44% identity in 50 aa
FT                   overlap"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62442"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62442"
FT                   /db_xref="GOA:Q93ME3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q93ME3"
FT                   /protein_id="BAB62442.1"
FT                   /translation="MSKDFLRNYIKEQNFNDSNNVLNSLKDLFNDVLQEVVSAELDDML
FT                   GYEKNLTNQFYNSRNGYSKKTIKSELGTITLNILRYRN"
FT   CDS_pept        4040..4222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP05"
FT                   /product="probable transposase"
FT                   /note="60 aa, similar to gp:AF143819_1 transposase-like
FT                   protein from Escherichia coli (402 aa); 38% identity in 60
FT                   aa overlap"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62443"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62443"
FT                   /db_xref="GOA:Q93ME2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q93ME2"
FT                   /protein_id="BAB62443.1"
FT                   /translation="MISKHQRNINRIEDKNLNLYASGITTRDVAGQIKALYDIEISAET
FT                   VSNITNRIMPLVSEW"
FT   CDS_pept        4588..4746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP06"
FT                   /product="probable transposase"
FT                   /note="52 aa, similar to pir:T43600 probable transposase
FT                   from Yersinia pestis (105 aa); 56% identity in 50 aa
FT                   overlap"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62444"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62444"
FT                   /protein_id="BAB62444.1"
FT                   /translation="MLYTTNVIESLNSQFRKFTKTKLIFPNDVSLIKMLYLATEKVNKK
FT                   WTRNYPN"
FT   CDS_pept        complement(5169..5804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP07"
FT                   /product="probable ABC transporter"
FT                   /function="ATP-binding protein"
FT                   /note="211 aa, similar to gp:AP001508_4 ABC transporter
FT                   (ATP-binding protein) from Bacillus halodurans (213 aa);
FT                   49% identity in 214 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62445"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62445"
FT                   /db_xref="GOA:Q93ME0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR019895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q93ME0"
FT                   /protein_id="BAB62445.1"
FT                   /translation="MNIIEISNLNKKYFDKVIFKDFSLSIKKGEMIAISGRSGCGKSTL
FT                   LNMIGLIEKFDSGEIIIDGVKNIKINSKLANKFLREKISYLFQNFALVDEETVEENLRL
FT                   AIKHTIKNTKKIEEEIIRCLKFVGLEGCQKNYIYELSGGEQQRVAIARLMLKPSEIILA
FT                   DEPTGSLDEENRDIIISLLKELNESGKTIIIVTHDNYVAKQADRIIFL"
FT   CDS_pept        complement(5804..7966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP08"
FT                   /product="conserved hypothetical protein"
FT                   /note="720 aa, similar to gp:AP001508_3 BH0280 gene product
FT                   from Bacillus halodurans (713 aa); 23% identity in 661 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62446"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62446"
FT                   /db_xref="GOA:Q93MD9"
FT                   /db_xref="InterPro:IPR006541"
FT                   /db_xref="InterPro:IPR016976"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MD9"
FT                   /protein_id="BAB62446.1"
FT                   /translation="MKKKVALIILFIIITILSFEGVYSVRNHTEFMKLKNLQGNLENFE
FT                   VTISIPDRENYNTAYESIIKSLDEYNGNIFFSEVDINEDVRKYINYGYFSNKETENHIP
FT                   IVSGRFFHEKDNIDSYLSTIDSEDTQQIGVINDFNGKNIHEIRTIKSKLDINTFENLFI
FT                   VQIENEQILDKLIEDLKSESIIVQKRVMGDSSQYNTETLKIILVVCFIGLIFMIFYQVL
FT                   GSYKKIGIQKLLGHSTFVMLKERLLEVLRIEVIVMLVVTVLLVFFNFKTFNSLFWKFML
FT                   ELICIYSIMIIFTIVSVIIPYIYVSKITLSNIIKNKRPVKSIIILNSIVKVILASIILI
FT                   FFSNALDDLSSIGKGYEKNYKVWEETKQYYILPELGFNDESIQSFSIEEMEKERAVYLY
FT                   FNKQGAILADFNRYEPTSMEEAKQMLPEEYMRETIIVNPNYLLKHKVYDVDGNIINISE
FT                   DEKDRILLVPEKYRNFEKEILEYYGYNSQEPCSSTTCSHKTADGKLNLVEQKQKIIWMK
FT                   SNQKYFSYLLDVNPEEGNYVTDPIVSVLTESNDKLVSYYKIIGYNNSPFKIRANSEEEV
FT                   INGLEKYYDMSVYLIDPYNLYDNVASTIINIKAKVKVIIFAIVILLAVISIIILQNTSL
FT                   YFNQNKNKIIVKKLHGYRLIYRYMNYFIMVLITWTCPLAIASLITKDINIIYFTLILVV
FT                   IELVFIIFNINSLEKKNLIKVIKGEY"
FT   CDS_pept        complement(8043..8354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP09"
FT                   /product="hypothetical protein"
FT                   /note="103 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62447"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62447"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MD8"
FT                   /protein_id="BAB62447.1"
FT                   /translation="MKRNKLIKTFIASLLLVGSLGTTALAYTHSSDKFEAASLPGLFSQ
FT                   AQSSKFYCGEQKHRATARVKVGTTLYEAKDIKDAKLTAHAQTKYYKGVTEWNSYYAHL"
FT   CDS_pept        8779..9012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP10"
FT                   /product="probable transposase"
FT                   /note="77 aa, similar to probable transposase from Yersinia
FT                   pestis plasmid pMT1 (402 aa); 25% identity in 158 aa
FT                   overlap"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62448"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62448"
FT                   /db_xref="GOA:Q93MD7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MD7"
FT                   /protein_id="BAB62448.1"
FT                   /translation="MKEVLSICMSTNEGSKFWLSPHKDKKEFAKDLKTIYGSVNETEGM
FT                   KNLIELREKWGSKYPNVVKSWKDNWDNLSTFF"
FT   CDS_pept        9127..9366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP11"
FT                   /product="probable transposase"
FT                   /note="79 aa, similar to probable transposase from Yersinia
FT                   pestis (99 aa); 46% identity in 73 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62449"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62449"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MD6"
FT                   /protein_id="BAB62449.1"
FT                   /translation="MKMLYLSREKVNKKWTRNYPNWDLVINELKILLNEYLSKECKKKR
FT                   ALRKCSKSSKIQTKCILLPIVGQNIHNKYFSRST"
FT   CDS_pept        complement(9488..9973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP12"
FT                   /product="conserved hypothetical protein"
FT                   /note="161 aa, similar to sp:YPI6_CLOPE HYPOTHETICAL 19.7
FT                   KDA PROTEIN (ORF6) from Clostridium perfringens plasmid
FT                   pIP404 (166 aa); 25% identity in 156 aa overlap"
FT                   /note="plasmid-related"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62450"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93MD5"
FT                   /protein_id="BAB62450.1"
FT                   /translation="MLVQDLAEELNVTRSEIYNILRRKRFAPLVKKNGSQIIIDNELSE
FT                   LLKEELEKKKQLTPKEIKKETTEIQHEVSVTVDEDFLYQNTINILQSQIENRDKQIEFK
FT                   DKQISILNTIIENNLKIIKQLEEKQSSYKNLHEEIELLKNTLLDLTKRKNKKRFSIF"
FT   CDS_pept        complement(10102..10281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP13"
FT                   /product="hypothetical protein"
FT                   /note="59 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62451"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62451"
FT                   /db_xref="GOA:Q93MD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MD4"
FT                   /protein_id="BAB62451.1"
FT                   /translation="MTLLCCIISLCCSSWMFIYLYGLSATSSSAYNSVLYIFPCLFLII
FT                   SLYLFYKIAIDDKN"
FT   CDS_pept        10439..11113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP14"
FT                   /product="hypothetical protein"
FT                   /note="224 aa, similar to gp:AP001517_204 BH3082 gene
FT                   product from Bacillus halodurans (211 aa); 25% identity in
FT                   196 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62452"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62452"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MD3"
FT                   /protein_id="BAB62452.1"
FT                   /translation="MKEGIYIKNKKILRKFSILALLTVFTSVGIQSIDVSAKTINNNEL
FT                   YENLNMEKAIPTSDLENYLPNLDSNFSVTEGENVIYFANQNDLDLYNSMKAGNNARYGE
FT                   GMKVEVLDSTYKSHLWIGYHSGTSSWAKASSYTLTKGKTYSTSGSYSYKGYTVNTGFSY
FT                   TNSVATTIPADSSRYSRLGTWGDFTFKYCKYIETSYGQPTGRVTYGVQKSMSNHYVQPT
FT                   YQ"
FT   CDS_pept        11317..11886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="resP"
FT                   /product="resolvase"
FT                   /note="189 aa, similar to sp:RESP_CLOPE RESOLVASE (ORF8)
FT                   from Clostridium perfringens plasmid pIP404 (189 aa); 92%
FT                   identity in 174 aa overlap"
FT                   /note="PCP15"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62453"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62453"
FT                   /db_xref="GOA:Q93MD2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93MD2"
FT                   /protein_id="BAB62453.1"
FT                   /translation="MLVGYARVSTEGQSLNRQIDMLVDYGLDKRNIYQEKISGTKLRRD
FT                   QLDKMIEELQEGDTVIITDLTRISRSTKDLLNIIDRIKEKGASIKSLKDTWLDTSGDNP
FT                   YNSFLLTVMSGLSQLERDLISQRTKEGLRSAKARGRNGGRPSKRNDKADTVGLLYREGY
FT                   KIVDIVKQTELSRATVYRILKDLNLK"
FT   CDS_pept        12101..13366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP16"
FT                   /product="hypothetical protein"
FT                   /note="421 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62454"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62454"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MD1"
FT                   /protein_id="BAB62454.1"
FT                   /translation="MRVFSNKLLSTNQLPLLTLANNEGWLDGFSDDNFLIKCLNNKLDY
FT                   FDEHSNLIGNSPYFNSNIQSCNTFLFNFSRMLGILISKFGKDDVKKFFKHSLIAGGKNY
FT                   SDEQFFRAYSEIVVIEFLLKYNQVEKCIYEPKLGVNGSNPEARLICEDGVIVDIEVKTP
FT                   GFKKEESTNTIIPAFILDDDIEHEFKEIAEKHNLNYVRPRVLKLKDFINSAGKKFEKPK
FT                   SSKHINLLYINWTYSDIKFSGFKEPYGLLYNNLNGILKNKDFALRLGIEEEALEKITAI
FT                   IIYQDSFDSLIFGDFRDVWNGYKFRLLPNQLIDSTLIDKELLFKITGMNPPVKGDHLAP
FT                   YLLSYSGSKENCFLIADMINSKIQEKISKLNIDGFEDNFIYFNKDFWEKTYNEQMLYFN
FT                   QFKDCFIPQDKNLNNVTAFISI"
FT   CDS_pept        13654..14451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpb2"
FT                   /product="beta2-toxin"
FT                   /note="265 aa, similar to pir:JC6515 beta 2 toxin from
FT                   Clostridium perfringens (265 aa); 91% identity in 265 aa
FT                   overlap"
FT                   /note="PCP17"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62455"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62455"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MD0"
FT                   /protein_id="BAB62455.1"
FT                   /translation="MKKIISKFTVIFMFSYFLIVGAISPMKASAKEIDAYRKVMENYLN
FT                   AFKNYDINTIVNVSEDERVNSDEKYKEMLEEFKYDPNQQLKSFEILNSQKIDNKEIFNV
FT                   KTEFMNGAIYDMKFTVSSKDGELIVSDMERTKIENEGKYILTPSFRTQVCTWDDELSQS
FT                   IGGVDPKTYSTRFTYYADNILLNFRQYATSGSRDLKVEYSVVDHWLWGDDVKASQMVYG
FT                   QNPDSARQIRLYIEKGQSFYKYRIRIQNFTPASIRVFGEGYCA"
FT   CDS_pept        complement(14479..15123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP18"
FT                   /product="hypothetical protein"
FT                   /note="214 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62456"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62456"
FT                   /db_xref="GOA:Q93MC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MC9"
FT                   /protein_id="BAB62456.1"
FT                   /translation="MSLIKTLDRRLKNLDISQKELNELKLQLLDNAEEIKNDFLNEGFS
FT                   EEEAEKKAIDSMELDELVKSIKEGSIKKSLLPNRIISSVLIILYTLFVIKCVKNISVIS
FT                   SPLLHGSFIPFKFTFNFLSSIFTGNFSFIDDVYFLDQLLILLLFIPFGIFIPIIINKYN
FT                   NLKPNLIIFIVFNIVFSLLFYFPYFNFDITVLRILSCMLGFYIIKLIVKKI"
FT   CDS_pept        complement(15135..15449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP19"
FT                   /product="conserved hypothetical protein"
FT                   /note="104 aa, similar to pir:B75335 conserved hypothetical
FT                   protein from Deinococcus radiodurans (strain R1) (107 aa);
FT                   39% identity in 101 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62457"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62457"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MC8"
FT                   /protein_id="BAB62457.1"
FT                   /translation="MDREILKGSLEIILLSLLKNKPMYGYEISKTIKNLTENELTIGEG
FT                   TLYPALKRLEERQLIENYFVELETSKKKRKYYKITEKGLTELNLKLMDFSLITNLIKNC
FT                   "
FT   CDS_pept        16008..16232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP20"
FT                   /product="hypothetical protein"
FT                   /note="74 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62458"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62458"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MC7"
FT                   /protein_id="BAB62458.1"
FT                   /translation="MKDYIIYKQFGKEDIKEGDLLRVDLIDGFKIKDIKELKDFNLVYE
FT                   TKGHEDFCTKKGKKVKRSVRYIRVFKKKN"
FT   CDS_pept        16323..16760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /product="DNA repair protein RadC"
FT                   /note="145 aa, similar to prf:2605291A RadC protein from
FT                   Bacillus sp. (119 aa); 54% identity in 119 aa overlap"
FT                   /note="PCP21"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62459"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62459"
FT                   /db_xref="GOA:Q93MC6"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MC6"
FT                   /protein_id="BAB62459.1"
FT                   /translation="MKKIDVVKVYVKKEQSLQIEKDIIKKPEQVFEVVKNFLGEVDREY
FT                   LIVIVLDVKNKINSISVASVGTLNSSIVHPREVFKTAILANGASIILAHNHPSGDTSPS
FT                   KDDINITTRIKECGVLMGIELLDHVILGDEKFISLKNEGII"
FT   CDS_pept        16820..17137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP22"
FT                   /product="hypothetical protein"
FT                   /note="105 aa, partially similar to gp:AF225463_1 SpoIIGB
FT                   from Clostridium bifermentans (107 aa); 34% identity in 73
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62460"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62460"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MC5"
FT                   /protein_id="BAB62460.1"
FT                   /translation="MNMIDIFESGQKFKKILEEKNIDRAIIITKLEGEKNLLDTYIEIC
FT                   IENNINLNREIIEVLIYAKEYKTIVNIKKIFVLGLKGNEMIINKNDDLYRCIEEKVYLG
FT                   N"
FT   CDS_pept        17161..17484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP23"
FT                   /product="hypothetical protein"
FT                   /note="107 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62461"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62461"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MC4"
FT                   /protein_id="BAB62461.1"
FT                   /translation="MNNIKYNIEFEDTIDNLILFKKIKLEDINKALKQFGSNDWGVLDK
FT                   EEKEDQNLLIIEGKYKGENPKLKYCFNGIYEMNKYLINIRSKYETLTKTLLIKVNLIVR
FT                   LSN"
FT   CDS_pept        17739..17942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP24"
FT                   /product="hypothetical protein"
FT                   /note="67 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62462"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62462"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MC3"
FT                   /protein_id="BAB62462.1"
FT                   /translation="MEIKYIEKINLTIYKVKDSIYGMSSYLDVDFDENLVAIKGTTCKY
FT                   GYFRKLDKNELKNITELVNENN"
FT   CDS_pept        18016..18405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP25"
FT                   /product="hypothetical protein"
FT                   /note="129 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62463"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62463"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MC2"
FT                   /protein_id="BAB62463.1"
FT                   /translation="MILLRDYLSKKISELDEMKSGEKFSLNSILYAISIIESDDNLILI
FT                   DESLKGTLEIFKYSDDEISSISLNDLIVECKDLLENWLRENKSINENFNIIPYEILNSS
FT                   MDKLLELVEDSIFFDEAFKNMIEKE"
FT   CDS_pept        18575..19642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP26"
FT                   /product="hypothetical protein"
FT                   /note="355 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62464"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62464"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MC1"
FT                   /protein_id="BAB62464.1"
FT                   /translation="MKITFEDVLSEVNISKQDILDLKIELRNAKKGEELPIILKLIGLA
FT                   DEVGQYYYKKIFYEDFFISIEDIAKHLDVSIRFVMSDIIDKLDRIEFPSEEFIDIKSSM
FT                   KNVIFLNIGDSSKKGKNIYTSTKYSNEILKEKVKVLYRKKVLYSKESYIKFLKEHMKLL
FT                   ENNILINLSLEKEWIENIKVRLIKDKKVTNRTFINLLFNNFMKKNKREIEKYKANDIFD
FT                   FNALIENRFGDSQEKRELTDFKSMNSLKVFFDKVYETEVTRAIEKSDYSFEFNLDLGRK
FT                   KNIKRYILNSEFLLEKVKESFNFNIEEKSENEDDYEMNIPASFLLKKYDNNIKLLIGDF
FT                   KKYSESIKRLAIKDI"
FT   CDS_pept        19722..19919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP27"
FT                   /product="hypothetical protein"
FT                   /note="65 aa, similar to pir:S75025 hypothetical protein
FT                   slr1999 from Synechocystis sp. (strain PCC 6803) (136 aa);
FT                   45% identity in 53 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62465"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62465"
FT                   /db_xref="GOA:Q93MC0"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MC0"
FT                   /protein_id="BAB62465.1"
FT                   /translation="MKSYSSREIVKIITKDGWYEVNCVGDHHQYKHPTKKGRLTIPHPK
FT                   KDLPIGTVRSIFKQAGIKIL"
FT   CDS_pept        19969..20385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP28"
FT                   /product="conserved hypothetical protein"
FT                   /note="138 aa, similar to pir:T13557 hypothetical protein
FT                   17 from Bacillus phage phi-105 (138 aa); 48% identity in
FT                   134 aa overlap"
FT                   /note="phage-related"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62466"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62466"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MB9"
FT                   /protein_id="BAB62466.1"
FT                   /translation="MKKKDTYIFPAIVTTESDGITITFPDLEGCITCAYSDDEIMKVSK
FT                   EALGLHLYGLETDEEIEGKELIPVPSKLNDLKLEKNQATTLVEVYMPVIRQVLDNKAVK
FT                   KTVTIPNWLDVQAKKYEINFSQLLQESIRNLLQL"
FT   CDS_pept        20737..21495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP29"
FT                   /product="hypothetical protein"
FT                   /note="252 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62467"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62467"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MB8"
FT                   /protein_id="BAB62467.1"
FT                   /translation="MLAAVALISVLNISQVNVKANSVIDTTDTTEHVVGELSIEDELAN
FT                   EEKYNLAKEYVENKRQLYGYNSSKVLYFPYERQTAGNWCGPAAAYNAIIGANPSYKGKI
FT                   SQNSLAMTLKTGVPGDKGTDFPGEWKRTMNNYLGANNYEISKGSSYSYSDWRNRVKNSV
FT                   IWTVDKGYAVIADTKQSPYGTKLHPNYNYIDDRGPGGKPTYHYIAITGYDDTPGNDRML
FT                   YSDSHQDFNGRYWTYTTNVAKVTHGHGIVW"
FT   CDS_pept        21612..22625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP30"
FT                   /product="conserved hypothetical protein"
FT                   /note="337 aa, similar to gp:AP001508_32 BH0309 gene
FT                   product from Bacillus halodurans (338 aa); 23% identity in
FT                   343 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62468"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62468"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MB7"
FT                   /protein_id="BAB62468.1"
FT                   /translation="MKLNLKKSLLLVIIILGVLVTQIKFKYKEYNLPNNIRVLHADDNN
FT                   LYVQKKEDNNIYIYDLDKGNLNKYKKPIYGEKIINMVFSDDWIVWIEESNLEYKILYEN
FT                   IDTGNISEINNMTPSYIPTISIDNDYLVYSRLNESNFELVLLNLMDKDLVILETLNSES
FT                   NEKISIPSISENLIVWSKSNGNYSNLSSNIYMYDISKDSKILLSENNSIIKPQIKNNII
FT                   IATNIKDNSDFTESYLTKYDLKNSKWNEFISNKSKVYNDVKNLSVDDPLIGENYISWWD
FT                   NYSNKLILYDIKKEKTITLKKEKPNEIKQIYFLKDNIIVYRIENDNGSEHKCIKIK"
FT   CDS_pept        22653..23123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP31"
FT                   /product="hypothetical protein"
FT                   /note="156 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62469"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62469"
FT                   /db_xref="GOA:Q93MB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MB6"
FT                   /protein_id="BAB62469.1"
FT                   /translation="MVKFFKNRFVFIILVIIILLFSFYKIFYRNYPILKPTITIKYNNE
FT                   KILSTPGEHSWFNLKEGGNSYLVSKSSYESKEPIYVKKCDKIYIKFSSIPKEVTVKEIS
FT                   NSPYITYEHFESNSKKEYFFFSPDQIGKYIFEVRGSWDDTHTISEIFSVYVN"
FT   CDS_pept        23328..23513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP32"
FT                   /product="probable resolvase"
FT                   /note="61 aa, similar to gp:AF179847_5 putative resolvase
FT                   from Lactococcus lactis (199 aa); 38% identity in 65 aa
FT                   overlap"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62470"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62470"
FT                   /db_xref="GOA:Q93MB5"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MB5"
FT                   /protein_id="BAB62470.1"
FT                   /translation="MVDYDVNERFILSNKYRGKTLDRDGLNELLIIIRSEATLVVKEID
FT                   RLGENRKETKELKLFL"
FT   CDS_pept        23553..23795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP33"
FT                   /product="hypothetical protein"
FT                   /note="80 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62471"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62471"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MB4"
FT                   /protein_id="BAB62471.1"
FT                   /translation="MANAPLDVILEEVPRMTYKESIKYFLGVTNGDFYNSKADNIFELT
FT                   YEEVIRLSKDNNFYEDTKNKLKRLIKGNIKYNEIV"
FT   CDS_pept        complement(24051..24548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP34"
FT                   /product="hypothetical protein"
FT                   /note="165 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62472"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62472"
FT                   /db_xref="GOA:Q93MB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MB3"
FT                   /protein_id="BAB62472.1"
FT                   /translation="MFSELIEKIKRNKKTSIVIIILVLIIVFLQTSISLKNQKIDYLNS
FT                   SVSKLESELKSVNSTESKGSELNDSTKDKKAEDKIKDESSNKILENVKNRYIQFGKDEG
FT                   KIYDENLNGIEIATFEWMDDSIVSDSQIKNGINKITKEKFNIKASVKRVSGMNMYKIIV
FT                   IE"
FT   CDS_pept        complement(24604..25965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP35"
FT                   /product="conserved hypothetical protein"
FT                   /note="453 aa, partially similar to sp:PRIM_CLOAB DNA
FT                   PRIMASE (EC 2.7.7.-) from Clostridium acetobutyricum (596
FT                   aa); 21% identity in 402 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62473"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62473"
FT                   /db_xref="GOA:Q93MB2"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MB2"
FT                   /protein_id="BAB62473.1"
FT                   /translation="MTLKKPNERFKEAELKVRELKREAEQRDEYYPYAKTKLKLHYAPE
FT                   KVIPLHFDIGDGYVNDLKELINKELKSARYEDLRNSIDNTLDNKEKAFKKEVEPFYDIN
FT                   KLKEIPIGDIADKLGIDTVKRGNKLWCNLRGEKTASCCINIDKNYFYDFGGQPEGGDGI
FT                   KFVSKAEGISAKDSIYRLADMFGIEPENNIDNSFKPSFHISNSDYKEIGIEPNRAMLNV
FT                   DINLERQSLAEVMELEKSCAKTMNELANDDKSTFLNILNFKSMPIVYNNAKTYYSCIER
FT                   INEYVKEYNSPIDGFNSLEVLLYKDFTKSLEEKLNKQIDILYRAGINERIGFDLSEEKV
FT                   NLKKDLDDLFSASLSNGVEVYYNSNPDELKVIKSIEEFRDYAIDILVPELSGFEVSEEE
FT                   ITKMEKEVKSWTYTDLLEFCEGNDIEIVPLKKEKTIEIEKPVKEVRIKNKPMEL"
FT   CDS_pept        complement(25943..27403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP36"
FT                   /product="conserved hypothetical protein"
FT                   /note="486 aa, similar to gp:AF188935_80 pXO2-81 from
FT                   Bacillus anthracis (589 aa); 28% identity in 500 aa
FT                   overlap"
FT                   /note="plasmid-related"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62474"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62474"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MB1"
FT                   /protein_id="BAB62474.1"
FT                   /translation="MAFKKKSNEERKKEVDFLVEQANKKIDKVFNSPEDIKEYLSFMSK
FT                   FYNYSFKNSILIEEQFRGARAVGSFAFWKEKGYVVNKGEKGIKILVPTKLGDRFEAEDG
FT                   TIKLVSKATEREKVLIKEKKLEFIPGKTLFKQGYVFDVSQTNVPLEEIPKLFPNRWLEG
FT                   TVENYKGFFNSLENLADKIGIKIIEPKSELGQVKGISYTFTNEVALNPRNSELQNIKTL
FT                   IHELAHAKLHTSETFSNYTQAEKEFQAEMVAFSVSSYFNIDTEEYSLRYLKSWTKDRDF
FT                   KDKEKLLKEVKETTKEFIETIESSLLNIKEKEILIEDEAVKEFLGKDKVKINELSKKEL
FT                   EELIEKNNSYTWFKIDENKEIDSKNFTGKNHVMVVKEDDSYRDIYVGKTYNLENLIYVD
FT                   DNKNLYRLKKELEVEKTNNSFFYKKNESEVLSMEYEKDINLSSDKFISDENRELNEKGV
FT                   FKEPYITVDFCEENFFKKGEVIDLKEAK"
FT   CDS_pept        complement(27506..27670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP37"
FT                   /product="hypothetical protein"
FT                   /note="54 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62475"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62475"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MB0"
FT                   /protein_id="BAB62475.1"
FT                   /translation="MKKYYVYKNRNGFGGVSEIEQEGLEDNLIDVVDSEEKAKKVLLEY
FT                   IINANIEVK"
FT   CDS_pept        complement(27747..27965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP38"
FT                   /product="hypothetical protein"
FT                   /note="72 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62476"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62476"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MA9"
FT                   /protein_id="BAB62476.1"
FT                   /translation="MFENLAMVNEIVGENEVSVYLLEEKRDIVVKANKNYIKLLSDELN
FT                   QKEEDNTMILAVDINNKSIIEDYNYEV"
FT   CDS_pept        complement(27983..29116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP39"
FT                   /product="conserved hypothetical protein"
FT                   /note="377 aa, similar to gp:AF188935_83 pXO2-84 from
FT                   Bacillus anthracis (490 aa); 31% identity in 421 aa
FT                   overlap"
FT                   /note="plasmid-related"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62477"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62477"
FT                   /db_xref="InterPro:IPR041073"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MA8"
FT                   /protein_id="BAB62477.1"
FT                   /translation="MVGVINKVKFIRNGSSKFKNFIDYIDRSEATRKKNFDKYSAYNNY
FT                   MGNPEKIGSLFTKDKHSLTEKEVKKLKKDFDKAQLNGSNMWQEVFSFDNEFLEANGLYD
FT                   SENGALDEEKIQEATRRAMEELSKREGFKDLTWSASLHYNTDNIHVHIASVEINPSRER
FT                   GKFKPRTLYNMKSSFVNSLLDKQKDLDKINLLIRDNLIQGKKEMSFKEDIEMRKMVKEI
FT                   VKKLPSDKRQWHYNYNSMQEVRPLIDNLTKYYIETYKKDEFKELVDRLEKEDKFYKEVY
FT                   GKRKVETTTYKDNKIQDLYTRMGNTILKEIKEYVKEEDLKSQKKFENLQEKWEINRNII
FT                   ITKQSISMMKKSLNDDINSMKNQREYEKLQNSIEYDM"
FT   CDS_pept        complement(29119..29526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP40"
FT                   /product="hypothetical protein"
FT                   /note="135 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62478"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62478"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MA7"
FT                   /protein_id="BAB62478.1"
FT                   /translation="MKRQEKHYRLSNASIEHIEDIKTKHSCRSNSEALELIIREHEKNL
FT                   NIPMENMIEILGDRVAEKIKASILVLKRVSNNSDRNIQVLLELMNGLFIAEDLPDIFPS
FT                   KEKEHEAYITAKKEVDKRIESQRVKKLDKEY"
FT   CDS_pept        complement(29533..29799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP41"
FT                   /product="hypothetical protein"
FT                   /note="88 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62479"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62479"
FT                   /db_xref="GOA:Q93MA6"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MA6"
FT                   /protein_id="BAB62479.1"
FT                   /translation="MSDLLVRDLSKEAITRIDSFAKAKGVSRNEFLKEHLETLSHSDEM
FT                   RKFEANYRITMEKVLRVLDLNTKVMKKFCDENYIDLTEIFKEE"
FT   CDS_pept        complement(29800..30003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP42"
FT                   /product="hypothetical protein"
FT                   /note="67 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62480"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62480"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MA5"
FT                   /protein_id="BAB62480.1"
FT                   /translation="MPSLAPCVIAISPYALKVSISSSYQFTIKYTITINVFENFFEKVN
FT                   LLFSIGALKKFQYFHFLKGVVI"
FT   CDS_pept        complement(30127..31041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP43"
FT                   /product="conserved hypothetical protein"
FT                   /note="304 aa, similar to gp:AF188935_5 pXO2-05 from
FT                   Bacillus anthracis (282 aa); 25% identity in 227 aa
FT                   overlap"
FT                   /note="plasmid-related"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62481"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62481"
FT                   /db_xref="GOA:Q93MA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MA4"
FT                   /protein_id="BAB62481.1"
FT                   /translation="MIFKSFINFIKLFFPINMKGAIGMDRESLQLKVDDLKYKFQKNGA
FT                   ITYYLISGVIVIILIFFLSSNALFNREANLISSDLNKPFLVDSINVDVTNREYNPENHL
FT                   IQFNLKIDNLDINTDSNLSVELREKNNPNEIIPTKLVKVSDQDYIIYATLPEKKWSAVS
FT                   LTFINKNNKTNEIKKVKFYSDSRDISIDNNLKEQNKEGLTIELVNEEIEKVKKEIKDND
FT                   IKIENKNKEIDNANSKITSLEKDKEYQTETEIATTDSTITSLKGQVDSLNKDVEKIKKD
FT                   NKELNDKIDKLNKKKEDLEKMVK"
FT   CDS_pept        complement(31168..32331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP44"
FT                   /product="probable cell wall-binding protein"
FT                   /note="387 aa, similar to pir:F70031 cell wall-binding
FT                   protein homolog yvcE from Bacillus subtilis (473 aa); 47%
FT                   identity in 168 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62482"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62482"
FT                   /db_xref="GOA:Q93MA3"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MA3"
FT                   /protein_id="BAB62482.1"
FT                   /translation="MEKEKELIKKIIKYSIMFFSSSFLILTLLIGSLAMAIFQINSSKN
FT                   NNSHADIGAGGVPAEFVQYFNEASDLTGIPNWVLAGIAKQESNFNPNDSYGGAYGIMQQ
FT                   QRYDFDGSDIYKYYLDLGLGDIYKQLGYSFSSVDEIWNVFLKDVRLQIITGAYETRHYA
FT                   NYVLYRKKLVPTLEYNSTENLKVINWNADENDSNFSEILRRIFACYNGGPGYGMSVNLD
FT                   TAQNNYPNNVFKYAMEFRSKGLVNSGGIKGNNETIEKAIEAGMKWVGKSPYVWGGGRTE
FT                   ADVIAGRFDCSSLVHYCYASAGIQLGDRSSVTTWSLLTLGKSVPKEQMKRGDLIFFDTA
FT                   GRNGHVGIYLGNGKFLNDSSTKGVSIGDLNSPYWSRYFNGNVRRIIE"
FT   CDS_pept        complement(32417..33106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP45"
FT                   /product="hypothetical protein"
FT                   /note="229 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62483"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62483"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MA2"
FT                   /protein_id="BAB62483.1"
FT                   /translation="MKKKTIAIIIGGVLFISSLAYIGYKKYQVDNVSKSNVATQISPKN
FT                   EAKSDKENTVENNNNETSDSYYSLPEGFVTSVKTKEQVGDKNFYQANYIPRDGKFSDED
FT                   LLNAKRVVENFMQGIMNFDKSNPLKYRDMVGKYLTPEALGNFDLESQGIKADAGKYPYK
FT                   KSIVNKIYSDCEDNSNNNYLEFTSYVKKDNIDNYDQKVDNDLSPTYIFKLLKIDGKWKI
FT                   TEYYMKN"
FT   CDS_pept        complement(33111..35009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP46"
FT                   /product="conserved hypothetical protein"
FT                   /note="632 aa, similar to gp:AF188935_9 pXO2.09 from
FT                   Bacillus anthracis (643 aa); 33% identity in 640 aa
FT                   overlap"
FT                   /note="plasmid-related"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62484"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MA1"
FT                   /protein_id="BAB62484.1"
FT                   /translation="MGIFKRDYNYNPYFFNKIQPVGGIKFNPRSIVKGDGYEACLRIYD
FT                   FPTSVDEFWLGKLIDIKDVTVTIDVETEDRSKALQSLNSAISENVDRANSLKNNIDIIE
FT                   ANNATSILMGLVNDITSRDEVIKLVTIRYYLSAKTEIELEEKIKQVLTKLEGLGYRGAV
FT                   FLNEQEYEWKSLFLSAGEQKYLRNKRSGHPVPSISLGAGYPFHYVELNDPTGMFMGTSI
FT                   TGGNVIFDLFTKNEQRKSYNALAIGVMGSGKSTLLKKLSNNNAIVNNTLRILDITGEFK
FT                   DLVNELEGKIVALDGSNGMINPLQIFATMINENTNEVQVEQSYMQHMSKVSMIYNFLSP
FT                   EATQEEIREFERLLHDFYIIYGIEREKATSYKAEEYPTLSEFLNYIKGVFYEDEEKASI
FT                   RKNLSDFRKKRLESIMLTIDNAIRNYGKLFDGHSSIEDLTKEQIVSFEIRTLTGVDKRI
FT                   FNAQIFNVLSMLWNNALTQGLPEKKAFDEGKKTVEESKKYLLLLDESHRIINSNNILAV
FT                   DYLINFEREARKYFGGLIFATQSIRDVVPDVSNSEVFEKIRTLFELTQYKFIMQQDNNT
FT                   KGLLSEIFSGQLTDTEINAIPNFSTGDCILVINGDKNIRFNIEISDREKYLFKGGA"
FT   CDS_pept        complement(35027..37138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /product="type I topoisomease"
FT                   /note="703 aa, similar to gp:AF007787_9 type I
FT                   topoisomerase from Enterococcus faecalis (714 aa); 31%
FT                   identity in 742 aa overlap"
FT                   /note="PCP47"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62485"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62485"
FT                   /db_xref="GOA:Q93MA0"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:Q93MA0"
FT                   /protein_id="BAB62485.1"
FT                   /translation="MKKLVIAEKPSLAMNIVKALNSSESFERKDGYFESENYIISFAFG
FT                   HLFKLYNIEEYTGEDKGAKWRNDILPFIPKEFKFSIKDDVGVKKQYKILEELIKSNRVD
FT                   EIVACGDADREGEVIIRLIINNVFNNNSINKKVTRLWLPEQTTQSILYGLNNLKDIDTY
FT                   NNLANEGFTRTFLDWLVGVNLTRYVTVKSKHLFPVGRVLVPIVQAIYERDKSIENFVPE
FT                   TYYQIESNEKTNDEIIKLVVKELAFTKSEFIKAKSFADELNTYEAIVISKDTKKVKKQP
FT                   SKLFSLSKLQSLLSKKYKMTFKESLELIQKLYEKGFVTYPRTNTEYLAEAEKGKVKEII
FT                   DILCSEGYNLEFKDKKTIFDDSKIESHSAITPTVKIPKEDELKGKMLDVYNTIKNRFIS
FT                   NFLIEETLIDRTIIRIEVGDLEFSLKGDVIVQKGFLEYEPIKKDENTLPNLNVGDKINT
FT                   NFKAIEKVTQAPGKMTTEMLSNYLKNPFKNYEIENEEEDYKAILDGLEIGTEATRTGII
FT                   ENAKKYKYISENKSVLSIEPLGRKLIETLDKLNVNLSKEKTVEFSRILKKVYKNELNID
FT                   RAVDLISNELKSILEDSKNIEIEAIKEEKEVIGKCPRCGKNIYETSKSFSCEGYKDEPK
FT                   CQFNIWKEDKFFKDKGKKVTKSIAKNLLAGKKVKMTGLKKKDGNGTYDAFVSLNDTGKY
FT                   VNYKLDFSK"
FT   CDS_pept        complement(37182..37826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP48"
FT                   /product="conserved hypothetical protein"
FT                   /note="214 aa, similar to gp:AF188935_10 pXO2-10 from
FT                   Bacillus anthracis (222 aa); 23% identity in 222 aa
FT                   overlap"
FT                   /note="plasmid-related"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62486"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62486"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M99"
FT                   /protein_id="BAB62486.1"
FT                   /translation="MKKFENIKIVNKKEKVKLSKEEKVKLKEEKTKEKKELKEKKKESK
FT                   NTLISNREVLPFLDVDEDNFFVTKQGFLNLYQVKTRDVSNLSEYETMLYIYNFIHFLRN
FT                   YIDDFKIIAMNFPVNTVKQQEYLNKKLEETDNQKYIGFLEEKLNELKFLETHRNNKEFF
FT                   LMVFMKNEVDKENLLNKLNHMQNISITLKNINLEKKMKILFKLNNMNTKLM"
FT   CDS_pept        complement(37937..38218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP49"
FT                   /product="hypothetical protein"
FT                   /note="93 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62487"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62487"
FT                   /db_xref="GOA:Q93M98"
FT                   /db_xref="InterPro:IPR020275"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M98"
FT                   /protein_id="BAB62487.1"
FT                   /translation="MQYNIPKEISTEMKFTSKIYLFDFAMLLVALIFATIFSGLVYPSL
FT                   RVLFYIFVAISTIFLVNKSIINPKKRNFQTVYLALVRDKKVYVAEKVE"
FT   CDS_pept        complement(38221..40350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP50"
FT                   /product="conserved hypothetical protein"
FT                   /note="709 aa, similar to gp:AF188935_14 pXO2-14 from
FT                   Bacillus anthracis (952 aa); 21% identity in 798 aa
FT                   overlap"
FT                   /note="plasmid-related"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62488"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62488"
FT                   /db_xref="GOA:Q93M97"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M97"
FT                   /protein_id="BAB62488.1"
FT                   /translation="MTLIELTEMGILSITGIISHAFRWLGWQIIWLLASLVDGVEGAVN
FT                   KIYTLNSFFSSSEVNNFIDRYKPIIWSILAISLAVLGYKIIMNRKMDKQSIPTNLIFSL
FT                   IVVIALPMLMVKMGDLTNLVVKDVKAGYTSSAKQIVKDNLYDLYALDQNDFNFKEKNNI
FT                   TIDNIFDIHIDEAFKVDSKTKHEEIFKKKLDTLANGDMKETDLEKNWIMMDEDYYRYNI
FT                   DFVSVIIGLATTGITLLCVGFKIARLIFELAFNKLFAMLFAFADIEDNKKIKAILKNIF
FT                   STFAVIMATAVLLKLYIIFVAWLNFTASSVDTGIGFTVTSLAKLILQIGASFAVIDGPN
FT                   IIERILGIDAGLKSGLNTMLGTYGAMKALGSGTKSMISGTKGFAKATGGTVDSAIKGGA
FT                   VGAGAMNGLFKNKTSSSGTNDNETENKSSSLQNEMKNANANSNANIDKNINSSDKNNNK
FT                   QDLQSEMNNDKKSNEKDFNNSNIENSAKLHDDMKNLSVETTETLQDEMNGLNNKNNDNP
FT                   KLNEEMNKETSKSNSPNLQEEMSKEANRNIIPNLQEEMKGADNIKNDNSSLQDEMKNGS
FT                   LNNDLRSQVNNSPNENLQSEMSGKEELSSGGKLNDEMNRNINGNSDFRSTNPKSNPVNE
FT                   SMDNRENSNVNTGNNAFNQGSFRQVNTKENFATRKSREIKQAYKLGQSATERFNIPKNY
FT                   KNLKDKKNNKMKGDN"
FT   CDS_pept        complement(40347..43088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP51"
FT                   /product="conserved hypothetical protein"
FT                   /note="913 aa, similar to gp:AF188935_16 pXO2-16 from
FT                   Bacillus anthracis (611 aa); 35% identity in 650 aa
FT                   overlap"
FT                   /note="plasmid-related"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62489"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62489"
FT                   /db_xref="GOA:Q93M96"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M96"
FT                   /protein_id="BAB62489.1"
FT                   /translation="MSFFSNLKNTISNELRSNEKYKNEKFNLGRFVSSNKTLVTLTLSI
FT                   LLAVTIIVNIIVGAFTTLTSFNSDTISSFSVLKSMFNITLIFKYPLFYLLIYIVLCIPI
FT                   LKLVFDLKKSFISLEDGQKGTSRFTTLEEIKAQYKEVPEKKEGFKGGGGVPISRHKDKI
FT                   YIDTSPVNNLIIGTTRSGKGEMFVVPLIDIYSRAEEQASMVLNDPKGELVAMSKDTLEK
FT                   RGYRVEVLNLLNPLNSISYNPLQLIIDAYEKGELDEAQNLCKTLTYALYYNPSAKDPFW
FT                   QNSAMTLVNGLILAIIDECLNKCKILDVKIKDFENKINELRNKINEVENTEEIKIINNK
FT                   IEAHKEAIKELEKRKKEENSKITLYTVANMLSELGGDTDDDGNKLDNYFQSLPANSVAK
FT                   MQYATSKFADGSARGSIFAVAMAELSRFTMSSIAKMTAKNSINLKEVGFSRYIEKVVKV
FT                   EVKEKLEDDKKINFIKTNISECIGAFSGLEKVEIMKGYEPNEDRFIEEIRAFGSKGNEI
FT                   IKGIEVDTSDLDVNEVGEYIIKFRVLDTDYDNKPIALFMVTPDYDGSNHVLASIFIRQL
FT                   YYVLSKEASLFDTAKCEREVIFILDEFGNMPPIEGMGTLTTVCLGRRIRFNMIIQAYSQ
FT                   LKKLYGEDEKTIVGNCGNVIYILTNDNDTAEEISKSLGDKTIVNQSRSGEILDITKNRT
FT                   ESVDSRRLLLPEELKKFKEGETVVLRVIKRQDLKRSKIVPNPIYNHGETAFKYRYEYLS
FT                   EDFNNENVFKNIKIKSKHRNLDLDSLLIDFNESKDEYISKIDKQLNNIISAYDRNLNVN
FT                   EDINTIKEDCIENFEEKANETEIYCSEKDITLGEFLDYSFIMKLNTYNNRFRELRDIKF
FT                   NKDTPFSEFEKLYNFEGSKHLEEYNKILNILKAKKVTGGEEK"
FT   CDS_pept        complement(43075..43287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP52"
FT                   /product="hypothetical protein"
FT                   /note="70 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62490"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62490"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M95"
FT                   /protein_id="BAB62490.1"
FT                   /translation="MDSIFSFLDEFLRKSIMNIMEFKSDKELRVLNELYNDKRLCVRFW
FT                   YRFYKKQRIIKTLKFKKRRIINELF"
FT   CDS_pept        complement(43355..43591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP53"
FT                   /product="hypothetical protein"
FT                   /note="78 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62491"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62491"
FT                   /db_xref="GOA:Q93M94"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M94"
FT                   /protein_id="BAB62491.1"
FT                   /translation="MDVIDQIKNLLNEAVKWLQILGTPAAALAFGIGGFFQIFGGNEGG
FT                   RKARPWYIGAGIGLIIILGASAIASFLQSKITF"
FT   CDS_pept        complement(43655..43849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP54"
FT                   /product="hypothetical protein"
FT                   /note="64 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62492"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62492"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M93"
FT                   /protein_id="BAB62492.1"
FT                   /translation="MARGNNRNNVKNPIKETVSMILESKGISYDTWLEEAHMKLIFENL
FT                   ELLNEGLALKKELEGNSGE"
FT   CDS_pept        complement(43842..44300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP55"
FT                   /product="Spo0A homolog"
FT                   /note="152 aa, partially similar to gp:CBE288947_2 Spo0A
FT                   protein from Clostridium beijerinckii (273 aa); 28%
FT                   identity in 112 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62493"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62493"
FT                   /db_xref="GOA:Q93M92"
FT                   /db_xref="InterPro:IPR014879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M92"
FT                   /protein_id="BAB62493.1"
FT                   /translation="MNVDKGQDKVIKFYIENSIEIGEFSLEKEVNELLSEFITPYKRSF
FT                   EAIKIGVILLVNNIEYRNKATKLYEKIAEILDSTYSSIYRSIRYSLDVAYWQGRLKNKS
FT                   IGEYKFIEPQTKPTPFEFMNMIREQISTKMNRCFVAKSKALKGGDVIG"
FT   CDS_pept        complement(44413..45009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP56"
FT                   /product="conserved hypothetical protein"
FT                   /note="198 aa, similar to gp:AP001514_133 BH2127 gene
FT                   product from Bacillus halodurans (194 aa); 29% identity in
FT                   174 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62494"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62494"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042000"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M91"
FT                   /protein_id="BAB62494.1"
FT                   /translation="MKKILVILILIGISLISVASYIDYKDNNIKNDLISNYENNSSIDN
FT                   SIEKENDNIENKISNEFEYKEETINSKRTNVIGILEIKSIGLKAPIVDGEENLDYVVAK
FT                   YRNSANFGQVGNVILAGHNNMKGSIFKNLYKVKIGDIIEIKTDNNIYKYKLTERVIVNP
FT                   SDSSLLTQDISKKEITVITCINRAKERLILKGKII"
FT   CDS_pept        complement(45255..49361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cna"
FT                   /product="probable collagen adhesin"
FT                   /note="1368 aa, similar to gp:AP001514_20 BH2014 gene
FT                   product from Bacillus halodurans (1816 aa); 30% identity in
FT                   718 aa overlap. Also similar to pir:A42404 collagen adhesin
FT                   from Staphylococcus aureus (1185 aa); 23% identity in 813
FT                   aa overlap"
FT                   /note="PCP57"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62495"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62495"
FT                   /db_xref="GOA:Q93M90"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M90"
FT                   /protein_id="BAB62495.1"
FT                   /translation="MSKAKRFKLITTITLIFTFLFTNIKVFAVEITSTDAESYLNYDSP
FT                   TWGKVLPIGNHRYYVPGDLTTCYCLNTGALNPTGQDYTKEMQVDAGIETILYWGYPAKD
FT                   GSDWGISADEYRYCTQLAIWAYQKEAGLSRGLVRERLQSGTVPLSKLKPVIDFLVDKAH
FT                   NKEMPTFFEVSPNDIIAHQEGDYFVSEPIKIKSNYTLSGVKVTIKSASNPELTKDIVIK
FT                   DMDGNVKDSGYKANESFRVYIPSNAETGDLKVSVKAKVDIPAMLGYMTPEQGIQDMAVS
FT                   SLDTHSMDKDNIKVSWTGLNGAVQVIKKGDDGKLLTGAKFVLKNANDENVAEATSQDGK
FT                   AVFNDIKPAEYTIHEVEAPQGYLVTNPVNVTVKPNKVSIAEMTDTQIKGKIQVLKVDEE
FT                   TNTPLQGAEFEITQDGKHIETITTGENGIATSSLLPFGNYLVKEIKAPSKYVLNGEEHP
FT                   VTISENGKTIEITHTNKIIKGKVAVKKTDSEISDLNLEGAEFTIYDNNKNIVATITTNK
FT                   DGYAESEPLNYGTYTMQETKAPKGYLLSNKVWDININENDKTYTFDVSNDVIKGKLQIV
FT                   KVDSENEEKPVEGAGFDVIAVNVNGIKEGTVVDHVVTDKNGFAYTKDLRYGDYKFHETD
FT                   TPKGYWKSDKEYSFNIAENGKTYVKYIKNSPIQAKVRVIKVDSKDGKPLKGVKFQIRNA
FT                   DTKKLVEFTNFIGIIPMKTTTLETNKNGELVTPQNLAYGNYLLEEVEPLEGYIKVNPIP
FT                   FKIDENSVLEEIKDLGTIYTQKVSNDRITANMELLKLDKETNKPLENIEFKVTALDGFM
FT                   KGKTWNLKSDDKGLVSLKGLEYGDYRVDEVKTLWNYVLNKEPIFFSVKENGKTIKLQMT
FT                   NKKIRGSVELFKFDKDTNRPLEGVKFDLLNGDKKVGTYTTDNTGKITVNNLEAGNYTWV
FT                   EVEAIDHYNKVDKKYDFNIYKDGQLEKIDVANTVKTGELDFSKTDVTTGDSIDGAKVKI
FT                   TGLEPQNKHINIEFTSSKEGNKFTLPEGKYTFEETLAPEGYRINKEVGTFEIKDGQITK
FT                   ANLKDERKQGDLIFTKTDVTTGKVIEGAKIKITCTEGLSKGKVIDFTSSKDGNKFTLDE
FT                   GKYTFEETSAPNGYRINKEVGTFEIKDGEITKANLKDERKQGDLEFTKTDVTDGRIIEG
FT                   AKIKIICVEGLSKGKVIEFTSFKDGNKFTLDEGKYTFEEISAPNGYEINKEVGTFEIKD
FT                   GEITKANLKDERTTGVLEFTKTDVATGEVLEGAKIKIECLEGLDQGKVIEFTSSKEGNK
FT                   FTLAKGKYRISETKAPEGYELTTETGEFEITNQGDIITCNLTNKKIEIVKTGSRFDINS
FT                   LIPLGILLVAGGIGGLFFTKKRKLS"
FT   CDS_pept        complement(49506..49856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP58"
FT                   /product="conserved hypothetical protein"
FT                   /note="116 aa, similar to gp:SASIGFACB_1 ORF1 gene product
FT                   from Staphylococcus aureus (120 aa); 41% identity in 112 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62496"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62496"
FT                   /db_xref="GOA:Q93M89"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M89"
FT                   /protein_id="BAB62496.1"
FT                   /translation="MKFKRNFYKGKVYKGDIFYANLGKRKQGSEQQGIRPVAILQNFGS
FT                   SFVVAPMTSQVKNKMKVHTEIENSCLEKPSTILLEQITTIYRHQLSEKKGTLTNNEIKR
FT                   LNRALVISLGLI"
FT   CDS_pept        complement(49980..51053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP59"
FT                   /product="conserved hypothetical protein"
FT                   /note="357 aa, similar to pir:A81049 TonB protein NMB1730
FT                   from Neisseria meningitidis (280 aa); 38% identity in 120
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62497"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62497"
FT                   /db_xref="GOA:Q93M88"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M88"
FT                   /protein_id="BAB62497.1"
FT                   /translation="MSKKLKELMRVIKEHKKTSIGVAVALAIAITGGVSYSILSNTYNK
FT                   TNNTALSEKINDTKEANKDNIKTDESTKTDEAEATNDEATNESEANKSTPEDGIEVEQT
FT                   KDGNVIVKDQKTGNIIADSSKGDDVKKVINSKKDAGSSITIKNDKTGKVEKVEDIKDVT
FT                   ATGEGTITIVKPENKPENTENNKPDSSSENKPESKPENNEKEEQPAEQPEETPQPSKPV
FT                   EKPVEKPTEKPVEQPKNVQYMADMSQQLWSDFNAYRQSKGLNALSWSGKYATWTKNHVE
FT                   EMAKKNTGSYHVDYPEGGQVTGSNSNKNLTASEILQQFKNSPAHNKNILDDELTEGACA
FT                   VYKSADGGYYFAIGFDY"
FT   CDS_pept        complement(51099..51584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP60"
FT                   /product="hypothetical protein"
FT                   /note="161 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62498"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62498"
FT                   /db_xref="GOA:Q93M87"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M87"
FT                   /protein_id="BAB62498.1"
FT                   /translation="MRILDELSEHEKRQLEIMDLYNAGYTYKDIGRIMFMSENTIKGIV
FT                   KNWIDSLPAPNRERIRKIHRQASFSRRDTRKAIDYEAKKEIGDKAFILKNRSIYNTKRN
FT                   GDIVLKDESEIGCSVSFDTPRKLINENKEIEYKNLKDEEIKLEVLSFYSRKNRDKLN"
FT   CDS_pept        51897..53000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP61"
FT                   /product="probable transcription regulator phage-related"
FT                   /note="367 aa, similar to pir:D69944 transcription
FT                   regulator phage-related homolog yqaE from Bacillus subtilis
FT                   (116 aa); 37% identity in 109 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62499"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62499"
FT                   /db_xref="GOA:Q93M86"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M86"
FT                   /protein_id="BAB62499.1"
FT                   /translation="MITIDWSKFSENLKEYRKKQKLTQEDLAKKIGVARSTLSYYEHGS
FT                   IEPNIFVLITLSKLMNCSIDSLIGLSNEKIIPIPSTDIKNNYDTKESEKTNEENNLEIQ
FT                   KIKQESKKILEKAKRSFSELEMAKKRTDKMYEDFIMAKKRADRMYNEFEISKRQVERII
FT                   NQFEVSKKRTDKMFEDLEMSKKRTDRMYEELFRTLNREKIINDSILKIKNLSKENKLEL
FT                   LKEKAKENNYEEFTKLKILGKISAGIPHYACEDLIDTIYLPNQFFKPNFEYFGLRIFGD
FT                   SMNKMFDNDFTIIVRKTNSFINGDIVVAIIGDEATCKEIKQVENYIYLIPHSTNPEHQI
FT                   QKYKADQVMILGVVEQTIKSILDKIDI"
FT   CDS_pept        complement(53114..53560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP62"
FT                   /product="hypothetical protein"
FT                   /note="148 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62500"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62500"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M85"
FT                   /protein_id="BAB62500.1"
FT                   /translation="MKEFIINYNNMPLSEFTTIIVKANSVKEAINKFHNEKINSKEMLY
FT                   DFSDCLDFALEEDYFSFLSKNEGAEYDWYTAMKVYLESNNGFKNKNKFKNLNLDKFIEE
FT                   CWNNIMFNRNIDPNSISLESKEAIYRYLYECVEALNIKKLRVIE"
FT   CDS_pept        complement(53589..54239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PCP63"
FT                   /product="hypothetical protein"
FT                   /note="216 aa, no significant homology"
FT                   /db_xref="EnsemblGenomes-Gn:BAB62501"
FT                   /db_xref="EnsemblGenomes-Tr:BAB62501"
FT                   /db_xref="UniProtKB/TrEMBL:Q93M84"
FT                   /protein_id="BAB62501.1"
FT                   /translation="MTIKQTRTKLESGKVVNDKNIYTLEQFPTPKPKEEIQKDKIKTNN
FT                   KNNISENSQNDSAEKNSMNTSFSENSQNDSSQNDSVQNVGSNSISINSNSINNNNNISS
FT                   SSKEVDEEDKKQIIQLLQICQNNKFKLKKNDIKDLLTIYDFNKIAKAILTASATDTKIK
FT                   NFKGYILATLNDMDKIKKVEFNINNKKTSPHANFTQRDQDYKKLEEQLLGWTE"
XX
SQ   Sequence 54310 BP; 19177 A; 7651 C; 6196 G; 21286 T; 0 other;
     taattttaca ctaggaaaag agtttaatcc tgcaccagcg aatgaagaca tatatgcata        60
     aatagcttta gcttctattg taagacgagt atctctcatt acggctttgg gactgaatcc       120
     atatccttga gacatgattc catttatttg aataaaatta ttagcattat tatttgttga       180
     cataaaaaaa tacctcctaa tggaaattaa agaacacctt agagtaaaat ccatatgaaa       240
     gtactatctt aatctatctt taatattgac ttttcaatat taattttata tactatagat       300
     aaattaagcc gattcatata ggcaatataa gtaaattcat ttatataaat taagtctaat       360
     tatatagata aattttcggc ttattacttt caggtgtccc attgatttct ttaacggttt       420
     ggcgattgtc taagaaatta atgggttttt gcttttattc cgttcttttt aaatttgtta       480
     ttattatacc aatttttcat ataactttca atattattta tattttatgg aaaaacgagt       540
     gtttttgata aaaatttatc taaaaattta aattaatgac agaagagcta atgctcttct       600
     tttttatttt atttgttttt ttgaaactcc agcctatcat atctacgcta aaattgtaaa       660
     gccattccac aattttttat cggccattca ttatattcat agcagctaaa aaatttgctc       720
     cattttcctt tacaattcac ttcgatatga agtcttaggc tcaacaaaaa aacaacaaca       780
     tgagagtgtt aaacgaaagt tgttggtgga agggggagag cttattcaat gaaaatttga       840
     catgtataaa ttgaagttta gttattgaca tgtataatta tacatgttac tataagagta       900
     tagttaagag aataaaaaat atgaaatgag gttgtaatta tgaagaaaat atcagttttt       960
     aatattaaag gtggagttgc taaaacaacg tctactgcta actttggagc ttgtttagaa      1020
     gaaaaaggag acagagtatt attagtagac ctagatcctc aatcaaatct tactaagtta      1080
     tttaaagcat atagtatgga agatgtttca attgcagatg tacttttaga taaaaattta      1140
     gatattgaaa aggtaataaa gaaaacagat ttcgagaata tcgatatttt accatctaat      1200
     gttactttag catttgctga aagaaagata cttttagatg ttaatcgtag tcaacaaaat      1260
     agattagcta aagctcttga agagatagaa gataaatatg attattgttt aatagattgt      1320
     ccaccagcac ttaatatgat aacagtaaat gctctttgtg cttcagatga agtattagta      1380
     cctattaaga tagacaagtt tgctttagat ggcttggaat atcttttaga tagtatagaa      1440
     gaaataaaag atgagtttaa tccaaacctt aattttaaag ggtgttttat aacaatggat      1500
     tcttctacta cagttaataa ggttataaaa caagaactta aatcagtttt aggagaaaaa      1560
     atgttcaata catcaataca tcaaaatata aaggtagtag aaagtacatt tgaagaatgt      1620
     ccagttgtat tttcttctaa gaaagcaaga gcaagtttaa actataagga tttaagtaaa      1680
     gaaatatttt aatttaaaag gtgtccccgg gggacaccta atataaatta gttaaggtgg      1740
     ttagaataaa atggctaaaa agttttcaat aagtgaagga atgttaaatg gaatttcaaa      1800
     aaatactaga aaagttgagg agtttcaagc taaagaaaat tttaaaattg agtatataaa      1860
     tatagataga ataaaaagaa atgagaaaaa tttctatgaa atagtggata ttgaatctct      1920
     tgcagaagat ataaaattaa atgggttaaa tcataattta gtagttagaa aattggataa      1980
     tgatatgtat gagttaataa gtggtgaaag aagatatact gctttaagta agcttgttaa      2040
     tgaaggaaat aaagagttta atttagttcc atgtaaagtt atagaaagta atgatataga      2100
     ttcagaaata atacttattc aagctaatgc acaatcaaga gagcttacag aagttgaaaa      2160
     attaacccaa gttgaaagat tgcaagagtt ttataagata aaaaaggaaa atggagaaaa      2220
     agttccaggt aaaataagag atattattgc aaatgattta aatttatcag ctacacaggt      2280
     tggtagatat gagagaataa ataataagct tattccagag ttaaaagcag ttatagaaca      2340
     aggtaattta acaatagcaa atgcttcaga attttctagt ttaagtgaag aaaatcaaag      2400
     agtgatatta agcataatag atgataaaac taatatgtct aaacaagaag cagtagattt      2460
     aaagaataag cttaaaaaga ttgaggaaga aaaagaatta gaattgaaaa aagcttatga      2520
     agaaaaagaa ttagaactta aaaggttaga agaagaaaag aaaaatcaag tttcaaaatt      2580
     aaaaagtgaa aatgaaaatt tgaaaaaaaa gcttgatagt aataatattg aggaagaaag      2640
     aaaagagata gaaggtcaaa ttaaaattga atttgaagaa aaacttaaaa atgaaaaagt      2700
     tatattagaa gaagagttaa agagtaaata tgataaaaag atagaagata taactaagga      2760
     agctaaagaa aataacttag aaaaacaaag attaaaggat gaactttcaa aattaaaaga      2820
     aaaatctaat aatgaagttg atattaaaaa tacaaaagaa aactttgtgt tagttcaaaa      2880
     tctaaaatta attgacaact catttaagaa tttaaaaagt caaattaata agatgaaaaa      2940
     agaaaatgtt aaagttgcag aagaaaccaa agctaaagag tttttagaaa aatatcaaaa      3000
     agaaatttct gacttattaa aaaagttata atatgaaata tagatgatag ggagaaaaat      3060
     ttctccctat atagttttat ataaatttaa tgatctgtac cttaatgatt cttacaaaat      3120
     ataatttgta ttttatggag gcataaatgg aaaaaatatt agctgaaaag agaataaata      3180
     tatcttttta taaaagaaaa aatggagcat tggtaacaac tctatattta ccaccaaaat      3240
     ggttagaagt tattggtatt acagagaatg aaagagaatg ttttttctac atagaagata      3300
     aagcaataaa aatatctaaa gaaaaacagt cagaagaagc taaagagaag actatatctt      3360
     ttagtaaaac ttcaactaaa acatatttaa ataataaatg gctagaatat ttaggtgtat      3420
     ctgaagatga gagaagctgt ataatagaat taagaaagaa agacataaca ttagtaaaag      3480
     ataatggaag agatatatta gatatttaat aaaaggtgtc cccgggggac acctttttat      3540
     tatcgataat agaattaaaa aaattaaaag caatgatatt atcattgctt ttaataaatt      3600
     attagatata ctaaaaagat taattataca gtttgatttt agcataaaaa aataaaaaat      3660
     catattcttg aatcctttaa ataattttgt gtaaattgaa taaacaactt cttcttggaa      3720
     ataatttgat ataccaataa attataagaa gaagttgttt ttttagagta atatgtcgaa      3780
     agatttttta agaaattata taaaggaaca aaattttaat gatagcaata atgttttaaa      3840
     ttcattgaaa gatttattta atgatgttct tcaagaagtg gtttcagcgg agcttgacga      3900
     tatgcttggt tatgaaaaga atttaactaa tcaattttat aatagtagaa atggttattc      3960
     taaaaagact atcaaatcag aattaggtac aataactttg aatattctaa gatatagaaa      4020
     ttaggagttt gagcctaaaa taatttcaaa acatcaaagg aatattaata gaattgagga      4080
     taaaaattta aacctatatg catcaggtat aactactaga gacgtagcag ggcaaataaa      4140
     agctctatac gatattgaaa taagtgctga aacagtatct aatataacaa acagaataat      4200
     gccacttgta agtgaatggt aaaatagaca attggaaaaa acttacttat ttgtatttat      4260
     ggatgctatt aattataaag ttagaaaaga taagcatatt gttgttaagg atgcctatgt      4320
     agttattagt gtaaatatgg atggaatgaa gtcctgggta tttgtatagg tgttaatgaa      4380
     agcagtaagt tgtggttatc agttcttaat aatcttaaat aggggctact tgtgttttgt      4440
     gttgacggac ttaagggttt taaagaagcc ataggagccg tatatccatt ttcaaaaatt      4500
     caaaggtgta taattcatca taaaagttag gaggataatt gggataatct tagaacttta      4560
     tttgagtttt cccctagcat aagaaaaatg ttatatacaa ccaatgttat agaaagctta      4620
     aatagtcaat tcagaaaatt tactaaaact aaattaatat ttccgaatga tgttagttta      4680
     ataaaaatgt tgtatttagc tacagagaag gttaataaaa aatggactcg taattacccg      4740
     aactaggatt tggtaatcaa tgaattaaca attttattca atgaatattt aagtaaagaa      4800
     tgttaaaaaa agagccttga gaaagcgttc taaaagctct aaaatccaaa tcaaatgtat      4860
     attattgcct attattgggt aaaatataca taacaaatat tttagtagat caacttaatt      4920
     tgtcgaaaga ctttatttat tttattatac ctaccaatta agttctaaat atatgtacta      4980
     atggttatac atactttatt catatttagt tgatttttat tattattaat agttatatat      5040
     taataataaa aatgcttagt ttataataat cgttacttta aataattaaa tcgataaagc      5100
     tcaagagcag cattactatg aaatcttctg attcattagc aatactgctc tattatttta      5160
     tctttttatt ataaaaagat tatcctatct gcttgttttg caacataatt atcatgagtc      5220
     acgataatta ttgtttttcc actttcatta agttctttta ataaagatat tataatatct      5280
     ctattttctt catctaatga gcctgttggt tcatctgcta aaataatttc acttggtttt      5340
     aacattaatc tagcgatagc tactctctgt tgctcaccac cacttaactc atatatatag      5400
     tttttttgac atccctctaa tccaacaaat tttaaacatc ttattatttc ttcttcaatc      5460
     tttttcgtat ttttaattgt gtgcttaatc gcaagtctta aattctcctc tacagtttct      5520
     tcatctacca aggcaaaatt ttgaaataag taacttatct tttcccttaa aaacttattt      5580
     gctaatttgc tatttatttt tatatttttt acaccgtcaa taattatttc tcctgaatca      5640
     aatttttcta tcaagcctat catatttaaa agggtactct ttccacaacc acttcttcca      5700
     ctaatagcaa tcatctcacc tttttttata ctcaaagaaa aatccttaaa tattacctta      5760
     tcaaaatact ttttatttaa atttgaaatt tctataatat tcattaatat tctcccttta      5820
     tcactttaat aagattcttt ttctctaatg aattaatatt aaatataata aaaactaact      5880
     ctattactac taatattaga gtgaagtata ttatattaat atccttagta attaaacttg      5940
     ctatagcgag tggacatgtc caagttatta aaaccattat aaagtaattc atgtatctat      6000
     aaatcaatct atatccatga agttttttca caattatttt attcttattt tgattaaaat      6060
     ataaagatgt attctgtaaa ataatgatgc taattacagc gagtaatatt actatagcaa      6120
     atataataac tttcactttt gcttttatat taattattgt acttgctaca ttatcatata      6180
     gattataagg atctattaaa taaacactca tatcataata tttttcaagt ccattaataa      6240
     cttcctcttc tgaattagct cgaatcttaa agggactatt attgtaccca attatcttat      6300
     agtaacttac caatttatca ttactttctg ttaaaacact gacaattgga tcagttacat      6360
     aatttccctc ttcaggattc acatctaata gatatgaaaa atatttttga tttgatttca      6420
     tccaaataat tttttgtttt tgttctacca aattaagctt tccatctgct gttttatgtg      6480
     aacaagtggt acttgaacaa ggttcttgcg aattgtaacc ataatactcc aaaatttctt      6540
     tttcaaaatt cctatatttt tcaggaacta acaaaattct atctttttca tcttcactta      6600
     tattaattat attaccatct acatcgtata ctttatgttt taataaataa ttaggattta      6660
     caattatagt ctctctcata tattcttctg gcaacatctg ctttgcttct tccattgatg      6720
     ttggctcata cctattaaaa tctgctaata tagctccttg tttattaaag tataaatata      6780
     ctgctctttc tttttccatc tcctcaattg aaaatgattg tatactctca tcgttaaatc      6840
     ctagttctgg tagaatataa tattgttttg tttcttccca tactttataa tttttttcat      6900
     atccctttcc tatgctcgat aaatcatcta atgcattact aaaaaaaatc aaaattatac      6960
     tagctaatat aactttcaca atgctattta atataattat actttttaca ggtcttttat      7020
     tttttataat gttagataga gttattttac ttacatagat atatggaatt atcacactta      7080
     caatagtaaa aattatcatt atactatata tacatataag ttctagcata aatttccaaa      7140
     ataaactatt aaatgtcttg aaattaaaaa aaactagcaa tactgttact actaacatca      7200
     caattacttc tatccgtagt acctctaata atctttcttt taacattaca aatgtactat      7260
     gtcctaataa cttttgtata cctattttct tatatgatcc aagtacttga taaaagatca      7320
     taaaaattaa cccaataaaa caaactacta aaataatttt taaagtttca gtgttatatt      7380
     gacttgaatc tcccattacc cttttttgta caataattga ttcacttttt aaatcttcta      7440
     ttagcttatc taaaatttgc tcattctcta tctgtactat aaataaattt tcaaatgtat      7500
     ttatatctaa cttacttttt attgtgcgaa tttcatggat attcttgcca ttaaaatcat      7560
     taataactcc tatttgttgt gtatcttctg aatcaattgt tgataaatat gaatctatat      7620
     tatctttttc atggaaaaat cttcctgata ctattggaat atggttctca gtttctttat      7680
     ttgaaaaata accataattt atatactttc tcacatcttc atttatatca acttctgaaa      7740
     agaaaatatt cccattatat tcatccaaac tttttattat actttcatag gcggtattat      7800
     agttttctct atctggtata gaaattgtca cttcaaaatt ttccaaattt ccttgtaaat      7860
     tttttagctt cataaattca gtatgatttc ttactgaata tactccttca aaagataaaa      7920
     tagtaataat aataaataaa ataattaaag ctactttttt tttcaaaata ctctcctttt      7980
     catattaata taaaagatat ctttaaatta ttatttaaag atacctttta aacattaaat      8040
     tactataaat gtgcgtaata tgaattccac tctgttaccc ctttataata cttagtttgt      8100
     gcatgtgcag ttaatttagc atctttgata tctttagctt cataaagagt agtacctacc      8160
     ttaacacgtg ctgtagccct atgcttttgc tctccacaat aaaactttga actttgtgcc      8220
     tgtgaaaata aacctggtaa tgaagctgcc tcaaatttgt ctgaactatg agtataagct      8280
     aaggcggttg tacctaaact accaactagc aaaagacttg cgataaaagt ttttattaat      8340
     ttatttcttt tcatattctc accccctaca ttacatatta taacaaaata accattttat      8400
     gtaaacgaga aattgcattt ttcttttaaa tttgcatgga aattttttta gctagtaaac      8460
     ttaaatactc tcctctttca ataatttatt aagagttttt tctactcttc acttaataac      8520
     tttttgtcta ggctcttcac tctggtatct caaactccga taacactttt aaaaaaaatc      8580
     tagttaatat ttttaaagtg ctggaacaat atctaatata acaaacagaa catgccactt      8640
     gtaagttaat ggcaaaatag accattagaa aaaacttact tatttgtatt tatgaatgct      8700
     attcattata aagttagaga agataatcat attgttgtta agggtggcta tgtatttatt      8760
     ggtgtaaata tggatggaat gaaggaagtc ctgagtattt gtatgagtac taatgaaggc      8820
     agtaagttct ggttatctcc acataaagat aaaaaggaat ttgcaaaaga cttgaaaact      8880
     atttacggtt cagtaaacga aacagaaggt atgaaaaact taattgaatt acgtgaaaaa      8940
     tggggttcta agtatccaaa tgtcgttaaa agttggaaag ataattggga taatcttagc      9000
     actttctttt agttttcccc tagcataaga aaaatagtat atacaaccaa tgttatagaa      9060
     agcttagata gtcaattcag aaaatttact aaaactaaat taatatttcc taatgatgat      9120
     agtttaatga aaatgttgta tttatctaga gagaaagtta ataaaaaatg gactcgtaat      9180
     tacccgaatt gggatttagt aatcaatgaa ttaaaaattt tattgaatga atatttaagt      9240
     aaagaatgta aaaaaaaaag agccttgaga aagtgttcta aaagctctaa aatccaaact      9300
     aaatgtatat tattgcctat tgttgggcaa aatatacata acaaatattt tagtcgatca      9360
     acttaatttg tcgaaagact ttaaaaaata ttaacttaaa aattaaaaaa tcttatatta      9420
     tttctaagaa gaaataataa tttacacaaa gtactttaca ggctctatta ttgagttttg      9480
     atatagatta aaatatagaa aatctttttt tattttttct tttagttaaa tctaataatg      9540
     tattttttaa aagttctatt tcttcatgta aatttttata ggaagattgc ttttcttcta      9600
     attgttttat tattttcaag ttattttcga taatagtatt taaaatactt atttgcttat      9660
     ctttaaattc aatttgttta tctctatttt caatttgtga ttgtaatatg tttatagtat      9720
     tttgatataa gaaatcttca tcaacagtaa ctgaaacctc atgttgtatt tcagtagttt      9780
     ctttttttat ttctttagga gttaattgtt ttttcttttc taattcttct tttagtaatt      9840
     ctgaaagttc attatctata ataatttgag aaccattttt tttaacaagt ggagcaaatc      9900
     tttttcttct aagtatatta taaatttcac ttcttgtaac atttaattct tcagctaaat      9960
     cttgtactaa cattttaaaa gctcctaatt cattcttgat aataaattct atattactca     10020
     tattctttaa aattatgtaa aatcctttta tctaattaaa gaaaaaatat cttcatattt     10080
     tatatgaaga tatttttttc tttaattttt atcgtcgatg gctattttat aaaataagta     10140
     aagagatatg attaaaaata aacaagggaa aatataaagt actgagttat aagcggaaga     10200
     acttgtagca cttaatccat aaagataaat aaacatccat gaagagcaac atagagaaat     10260
     aatacaacat agtaaagtca tataagacct ccttttttca ttttaaaata ttatataaac     10320
     attatataag aattatacat taaaatttaa gacaacaaat ggaaaaaatg tgtgaattaa     10380
     tatgctaggt attctaattt aattgaatga ataataaatt ttatagtgta taaatttaat     10440
     gaaagaaggt atatatataa aaaataaaaa aatactaaga aaattttcaa ttttagcttt     10500
     acttacagtt tttacttcag taggaataca atcaattgat gtcagtgcaa aaactataaa     10560
     taataatgaa ttatatgaaa atttaaatat ggagaaagct ataccaacat cagatttaga     10620
     aaattatttg ccaaatttag attcaaattt tagtgttact gaaggggaaa atgttattta     10680
     ctttgcaaat caaaatgatc ttgacctata taatagtatg aaagctggaa ataatgctcg     10740
     ttatggagaa ggcatgaaag tagaagtttt agatagtact tataaaagtc atctttggat     10800
     tggatatcat agtggaacat cttcatgggc taaggcatct tcttacacat taacaaaggg     10860
     aaaaacatat tctacttcag gaagttattc ttacaagggt tatactgtaa atacaggatt     10920
     ttcttatact aatagtgtag caacaacaat tccagcagat agttcaaggt atagtagatt     10980
     aggaacttgg ggtgatttta catttaaata ttgtaaatat atagaaacat cttatggtca     11040
     accgacagga agagtaacat atggagtaca aaaatcaatg tctaatcatt atgtacaacc     11100
     aacttatcag tagaaatcaa taaagtggcg attaaaaatc gtcactttat tttatatcaa     11160
     aaacggttgt ttttgatacg tttttttgaa ttatgaaaac aagccatttt ttttgtataa     11220
     aaatgtatca aaaaaggtac cataatctat tgagattatg ataccttttt gatacaatat     11280
     tgttaagaaa tttagaaagt ggagatagaa ataattatgt tagttggata tgcaagagtt     11340
     agtaccgaag gtcaaagctt aaatagacaa atagatatgt tagttgatta tggtttagat     11400
     aagagaaata tatatcaaga aaaaataagt ggtactaagc tgagaaggga tcagctagat     11460
     aagatgattg aagagcttca ggaaggagat acagttataa ttactgattt gaccagaata     11520
     tcaagaagta caaaggattt gttaaatatt atagatagaa taaaggaaaa aggagctagt     11580
     attaaaagtc tgaaagatac atggttagac acatcaggcg ataatccata taatagcttt     11640
     ttattaactg ttatgagtgg attaagtcaa ttagaaaggg acttaataag ccaaaggact     11700
     aaagaagggt tgagaagtgc taaagctagg gggagaaatg gaggaagacc ttctaagaga     11760
     aatgataaag ctgatacggt agggttatta tatagggaag gttataaaat agttgatata     11820
     gtaaaacaaa cagagttaag tagagcaact gtatatagaa ttttaaaaga cttaaactta     11880
     aaataataat ataaatatga tttagaattt ggagaatgga ttataaaaag gtatattaat     11940
     tatatatctg aaaatttatt attatattat aaggataatt aataaattta aggtgtcctc     12000
     aggggacatc tattagtata gaatagtaga tgaattaaag atttaggatt aaaataatag     12060
     tattgtaaaa tattaattat aataaaaaag aggggatttt atgagagttt tttcaaataa     12120
     attacttagc acaaatcaac tacctttgct tactttagct aataacgaag gatggttaga     12180
     cggtttttca gatgataatt tccttattaa atgtttaaac aataaattag attattttga     12240
     tgaacattca aatttaatag gaaatagtcc atatttcaat agtaatattc aaagttgtaa     12300
     tacattttta tttaactttt ctagaatgtt aggtattcta atctctaaat ttggaaaaga     12360
     tgatgttaag aagtttttta aacattctct aattgctggt ggaaaaaact atagtgatga     12420
     acagtttttt agagcttatt ctgaaattgt tgtaattgaa tttttattaa aatataatca     12480
     agtagaaaag tgtatttatg agcctaaact tggcgttaat ggttcaaatc ctgaagcaag     12540
     attaatatgt gaagatggag ttattgtaga tattgaggtt aaaacaccag gttttaagaa     12600
     agaagaaagt acaaatacaa ttattccagc ttttatttta gatgatgata ttgaacatga     12660
     atttaaagaa atagctgaaa agcataattt gaattatgtt agacctagag ttttgaaatt     12720
     aaaagatttt ataaatagtg ctgggaaaaa gtttgaaaaa cctaaaagtt caaaacatat     12780
     aaatttatta tatataaatt ggacatattc tgatattaaa ttttcaggat ttaaagaacc     12840
     ttatggatta ttatacaata atttaaatgg aattttaaaa aataaagatt ttgcattacg     12900
     tttaggaata gaagaagaag cattagaaaa aataactgca ataattatat atcaagattc     12960
     atttgattct ttaatatttg gtgattttag agatgtttgg aatggatata aatttagatt     13020
     attaccaaat cagttaatag attcaacttt gatagataaa gaacttttgt ttaaaataac     13080
     aggaatgaat ccacctgtta agggagatca tttagcacca tatttattaa gttattctgg     13140
     tagtaaagaa aattgtttct taattgcaga tatgataaat agtaaaattc aagaaaaaat     13200
     ttcaaagtta aatatagatg gatttgaaga taatttcatt tattttaata aggatttttg     13260
     ggaaaaaact tataatgaac aaatgcttta ttttaatcag tttaaagatt gttttattcc     13320
     acaagataaa aatttaaata atgttactgc atttataagt atataaatat ttattattga     13380
     tttaattttc cattatagtg ctagttattt ttactattat aaagtttaat aatttacatt     13440
     gtttaaacta attgctaaat agaattttaa ctcatgtttt aaaagttaaa tatatatttt     13500
     aaatttaagg tgtcccacgg ggacatcttt ttgtttttaa aaggtaaata tgaataaaat     13560
     ttagataaaa gtgtaaaaga attattttta ttttaaattt gttaaaattt tgatataatt     13620
     gaattgtaaa aaaaatttca ggggggaata taaatgaaaa aaattatttc aaagtttact     13680
     gtaattttta tgttttcata ttttcttatt gttggagcaa taagtccaat gaaagcaagt     13740
     gcaaaggaaa tcgacgctta tagaaaggta atggagaatt atcttaatgc ttttaaaaac     13800
     tacgatatta atacgattgt aaacgtatca gaagatgaaa gagtgaatag tgatgaaaag     13860
     tataaagaga tgttagaaga gtttaaatat gatcctaacc aacaactaaa atcttttgaa     13920
     atacttaatt cacaaaagat tgataataaa gaaatattta atgtaaaaac tgaatttatg     13980
     aatggtgcaa tttatgatat gaaatttact gtatcatcta aagatgggga attaatagta     14040
     tctgacatgg aaagaacaaa aattgagaat gagggaaaat atattttaac accatcattt     14100
     agaactcaag tttgtacatg ggatgatgaa ttatcacaat caattggggg agttgatcca     14160
     aaaacatatt ctactagatt tacatattat gcagacaata tattattaaa ctttagacaa     14220
     tatgcaactt caggttcaag agatttaaaa gtagaatata gtgttgtaga tcattggtta     14280
     tggggagatg atgttaaagc ttctcaaatg gtgtatggtc aaaaccctga ttctgctaga     14340
     caaataagat tatatataga aaaaggacaa tctttctata aatatagaat aagaatacaa     14400
     aactttacac ctgcatcaat tagagtattt ggtgaaggat attgtgcata gaaaaaaata     14460
     tgaagtgact aagtcacttc atattttttt tactattaat tttattatat aaaaacctaa     14520
     catacatgaa agtattctta atacagttat atcaaaatta aagtatggga aataaaataa     14580
     aaggctaaaa actatattaa aaactataaa aattattaaa ttaggtttta agttgttata     14640
     tttatttatg attataggaa taaatattcc aaagggaata aataaaagta atattagtaa     14700
     ttggtctaaa aaatatacat catcgataaa agaaaaatta ccagtaaaaa ttgaacttaa     14760
     aaaattaaat gtaaatttaa aggggataaa gctcccatgt aaaagtggac tagatattac     14820
     ggaaatattt ttcacacatt ttattacgaa caatgtatat aagattatta atactgaaga     14880
     tattatccta ttaggtaaaa gagatttctt tatagaacct tctttaatag atttaacaag     14940
     ctcatctaat tccattgaat caatagcttt cttttctgct tcttcttctg aaaaaccctc     15000
     gtttaaaaag tcatttttta tttcttcagc attatcaagt aattgtaatt ttagttcatt     15060
     taattctttt tgtgatatat ctaagttttt tagtctacga tctaaagttt taattaaact     15120
     cataatatcc tcctttagca attcttaatt aaattagtga ttaatgaaaa atccattagc     15180
     tttaggttaa gttcagttaa tcctttttca gtaattttat aatactttct tttctttttt     15240
     gatgtttcaa gttcaacaaa ataattttca attagctgtc gttcttctaa tctttttaag     15300
     gctgggtata aagttccttc acctattgtt aattcatttt ctgtcagatt ttttatggtt     15360
     tttgaaattt catatccata cataggctta ttttttaata aagatagcaa aattatttct     15420
     aatgaacctt ttaatatctc tctatccaat aaatcaactc ccttcaagtt aatttaatat     15480
     tttatagttt aattttacac aaatatacat cgctttacaa ggtataatta tataaaaaaa     15540
     ctaaaatttc aaaatattac atggaaaaat ttatatgact ttactattag aaagtttagt     15600
     gacttacatt ggttcaacta attgctaaat agaacaaaaa ataataagcc taagagcatt     15660
     taatactaac tgctcttagg cttttatttt aaaattctat ttaacaatgg attttcactc     15720
     aatgttttaa aagattatgc ttattacttg aaatgaataa ggagagaaga gctaaggctc     15780
     ttctttttat tttatttgtt tttttgaagc ttcagcctat catatctacg ctaaaattgt     15840
     aaagccattt cacaagtttt tttatcggcc attcattata ttcatagcag ctaaaaaaaa     15900
     ttgctccatt ttcctttaca attcgctccg atatgaagtc ttaggctcaa caaaaaaaca     15960
     acacgagagt aattaacgaa agtgttgaac taaaggagga ttttgagatg aaagattata     16020
     ttatctataa acaatttggt aaagaagata taaaggaggg agatttatta agagttgatt     16080
     taatagatgg atttaaaatt aaagatatca aagaattaaa agattttaac ttagtttatg     16140
     aaactaaagg acatgaagac ttttgtacaa agaaaggaaa aaaggtaaaa cgaagcgtta     16200
     gatatattag agtttttaag aaaaaaaatt aaaataaaag gcattaccca aaaaggcaac     16260
     acctaacaca caattagatt atagcctttt tgggaatgaa tttcaagaag gagttaataa     16320
     agatgaaaaa aattgatgtt gtgaaagttt atgttaagaa agaacaaagc ttacaaatag     16380
     agaaggatat tataaaaaaa ccagagcaag tttttgaagt agttaagaac tttttaggtg     16440
     aagttgatag agagtattta atagttatag tgcttgatgt aaaaaataaa ataaactcaa     16500
     tttcagttgc ttcagttggt acacttaatt cttcaatagt acatccaaga gaagtgttta     16560
     aaactgcaat attagcaaat ggagcaagta ttattttggc tcataatcat ccttcaggtg     16620
     atacatcacc aagcaaagat gatataaaca taactacaag aataaaagaa tgtggagtgt     16680
     taatgggaat tgaactttta gatcatgtca ttttaggtga tgaaaaattt attagtttaa     16740
     aaaatgaagg aataatttaa ttttaataat agtgcattgc ttgtaagcaa tgtgctattt     16800
     aaaaaggagt gaaaaataaa tgaatatgat agatatattt gaatcaggac aaaaattcaa     16860
     gaaaatatta gaagaaaaaa atatagatag agctattatt ataactaagt tagaaggaga     16920
     aaaaaatcta ttagatacat atatagaaat atgtatagag aataatatta atcttaacag     16980
     agaaataata gaagttctta tttatgcaaa agagtataaa acgattgtaa atattaaaaa     17040
     aatttttgtc ctaggattaa aaggtaatga aatgattata aataaaaatg atgatttata     17100
     taggtgtatt gaagaaaaag tttatttagg aaattaatat agttaagggt ggtttttata     17160
     gtgaataata taaaatataa tatagagttt gaagatacta ttgataattt gattttattc     17220
     aaaaaaataa aattagaaga tataaataaa gctttaaagc aatttggtag taatgattgg     17280
     ggagttttag ataaagaaga aaaagaagac caaaatttat tgattataga aggaaaatat     17340
     aaaggtgaaa atccaaaatt aaaatattgt tttaatggta tatatgaaat gaataaatac     17400
     ttaataaaca ttcgtagtaa atatgaaact ttaacgaaaa ctttattaat aaaggttaat     17460
     ttaattgtta ggttaagtaa ttaaatgaaa aaggagagaa gagctaaggc tcttcttttt     17520
     aaatttactt gtttttttga agctccagcc tatcatatct acgctaaaat tgtaaagcca     17580
     ttccacaaat tttttatcgg ctattcatta tattcatagc agctaaaaaa tttgctccat     17640
     tttcctttac aattcgctcc gatatgaagt cttaggctca acaaaaaaac aacacgagag     17700
     tgattaacga aagtgttgag ttaaaggagg aatttaaagt ggaaataaag tacattgaaa     17760
     agattaattt aactatatac aaagttaagg atagtatata tggtatgagt agttatttag     17820
     atgtagattt tgatgaaaat ttagtagcga ttaaaggaac aacatgtaaa tatggttatt     17880
     tcagaaaatt agataaaaat gaattaaaaa atataactga acttgttaat gagaataatt     17940
     aaaaaaggca ttacctaaga aggcaaccta acacacattt gccttcttag aattaaatat     18000
     taaggaggaa tacatatgat attattaaga gattatttaa gtaaaaaaat tagtgagctt     18060
     gatgaaatga aaagtggaga aaaattttct ttaaactcaa ttttatatgc tatcagtatt     18120
     atagaaagtg atgataattt aatattaatt gatgaaagtt taaaagggac tttggagatt     18180
     tttaagtatt cagatgatga aatttcaagt atatctttaa atgatttaat agttgaatgt     18240
     aaagatttat tagaaaattg gttgagagaa aataagagta tcaatgaaaa ttttaatata     18300
     ataccatatg agatattaaa ttcttctatg gataagttgt tagaattagt tgaagatagt     18360
     attttttttg atgaagcttt caaaaatatg attgaaaaag aatagattta ttaaaaaaac     18420
     aaatatagtt atgattattc ataactatat ttgttatgta agagaataga atttttaaat     18480
     aaatttcaaa ggtgtccccg ggggacactt ttagttaata ttaatcaagt gatataatat     18540
     agttaagatt attcataact atatgaggtg taagatgaaa ataacatttg aagatgtatt     18600
     aagtgaggta aatatatcaa agcaagatat attagattta aaaattgaat tacgtaatgc     18660
     taaaaaggga gaagagcttc caattattct taaattaata gggttagcag atgaagttgg     18720
     tcaatattat tataaaaaaa tattttatga ggattttttt ataagtattg aagatattgc     18780
     taaacattta gatgtatcta ttagatttgt aatgagtgat attattgata aattagatag     18840
     aatagaattt ccatcagaag aatttattga tataaaaagt tcaatgaaaa atgtcatatt     18900
     tttaaatata ggagatagta gtaagaaggg aaaaaacata tatacatcaa ctaagtattc     18960
     aaatgaaata ttaaaagaaa aagttaaagt gttgtataga aaaaaggttt tatatagtaa     19020
     agaaagttat ataaaatttt taaaagaaca tatgaagctt ttagaaaata atattttaat     19080
     taatttgtca ttagaaaaag aatggattga aaatataaag gtaagactta taaaagataa     19140
     gaaagttact aatagaacat ttattaattt gcttttcaat aattttatga aaaaaaataa     19200
     aagagaaata gagaaatata aggctaatga tattttcgat ttcaatgctt taatagagaa     19260
     tagatttgga gatagccaag aaaaaagaga acttacagac tttaaatcaa tgaactcttt     19320
     aaaagtattt tttgataaag tttatgaaac agaagtaact agagctattg aaaagtcaga     19380
     ttatagtttt gaatttaatt tagatttggg aagaaaaaag aatataaaaa gatatatatt     19440
     aaattcagaa tttttacttg aaaaggttaa agaaagtttt aattttaata ttgaagaaaa     19500
     gtccgagaat gaagatgatt atgaaatgaa tataccagct agttttttat tgaagaaata     19560
     tgataataat ataaagcttt taattgggga ttttaaaaaa tactcagaaa gtataaaaag     19620
     attagcaata aaagatatat aatattatga atattcataa caaaataact tgatacgtat     19680
     aatgatacgt gttataatat atatgtaagg agggtgaggt aatgaaatct tattcttcaa     19740
     gagaaatagt gaaaatcatt actaaggatg gttggtatga agttaattgt gttggtgacc     19800
     atcaccaata taaacatcct actaagaagg ggagattaac aattccacat cctaagaagg     19860
     atttaccaat aggtactgta agaagtatct ttaaacaagc tggaattaag attttataat     19920
     cttaattctg cctccttacc aaatttaaaa ttaaaaggaa gtgtttctat gaagaaaaaa     19980
     gatacttata tctttccagc tatagttaca acagaaagtg atggtataac aataactttt     20040
     cccgatttag aagggtgtat aacttgtgct tatagtgatg atgaaattat gaaagtatca     20100
     aaggaagctt tggggctaca cttatacggt ttagaaacag atgaagaaat tgaaggaaaa     20160
     gaattaattc cagttccatc aaagttgaat gatctaaaac ttgaaaaaaa tcaagcaact     20220
     acattagttg aagtttatat gccagttatt agacaggtgt tagataataa agctgttaaa     20280
     aagactgtaa ctatacctaa ttggttagat gttcaagcta aaaaatatga aataaatttt     20340
     tcacagttat tgcaagaatc aattagaaat ttacttcagt tataatatga aaataaatag     20400
     tgtactttct ttttatattt atagaaagtg tgtaacgaat gggaaatgat aaaataatag     20460
     atattaagga aatcatataa aattgataca tccttttgta ttactagctt aaaacaaact     20520
     tttgtgcaat tttgtagtga aaatgaatgt tggcctatag taaaaataaa atgaaataat     20580
     tagattaact atatataatt tttaagaatt tatgattaaa agaataatat ttaatttaca     20640
     caaaattaaa attgaacaaa tagtaaaaaa atataaaata tggtaaaata aatcgaatat     20700
     tataaataga agggggattt ttatgaaaaa aaattagtgt tagctgctgt tgctttaata     20760
     agtgtattaa atatatcaca agttaatgta aaagcgaata gtgttataga tacaacggat     20820
     acaacagagc atgttgttgg tgagttatct atagaagatg aattagctaa tgaagaaaag     20880
     tataatttag ctaaagaata tgttgaaaat aaaaggcagt tatacggata taactcatcg     20940
     aaagttttat attttccata tgaaaggcaa actgctggaa attggtgtgg acctgcagct     21000
     gcttataatg caattatagg ggctaatcca tcatacaaag ggaaaataag ccaaaatagt     21060
     ttggcgatga cactaaaaac tggagtacct ggagataagg gtacagattt tccaggagag     21120
     tggaaaagaa caatgaataa ctatttaggt gctaataatt atgaaattag taaaggaagt     21180
     agttattctt attcagactg gagaaataga gtgaaaaatt ctgttatatg gactgtagat     21240
     aaaggctatg ctgtaatagc tgatacaaaa caaagcccat atgggacaaa attacatcct     21300
     aattataatt atatagatga tagaggtcct ggaggaaagc caacatatca ttatatagca     21360
     attactggct atgatgatac tcctggaaat gatagaatgc tatatagtga ctcgcatcaa     21420
     gatttcaacg gaagatattg gacttataca actaatgttg caaaagttac acatggacat     21480
     ggaatagtat ggtaaattat ttaatgtaat tttaaggtat aaaagaagaa atttttaaat     21540
     attctttttt tataccttaa ttatataaat tttaacagat gatataattt aataccaagg     21600
     agatttaaat tatgaaatta aatctaaaaa aaagtctttt gctagtaatt ataattttgg     21660
     gtgtgttagt aactcaaata aaatttaaat ataaagaata taatttgcct aataatatta     21720
     gagtattaca tgcagatgat aataatttat atgtacaaaa aaaagaagat aataatatat     21780
     atatatatga tttagataaa ggcaatctaa ataaatataa aaaacctatt tatggtgaaa     21840
     aaataataaa tatggttttt tctgatgatt ggattgtttg gattgaagaa agtaatttgg     21900
     aatataaaat attatatgag aatattgata ctggaaatat tagtgaaata aataatatga     21960
     ctccaagtta tattcctaca ataagcattg ataatgatta tttagtatat tcaaggttaa     22020
     atgaaagtaa ttttgaatta gtgttattaa atttgatgga taaagattta gttatattag     22080
     aaactttaaa tagtgaaagc aatgaaaaaa tttctattcc ttctattagt gaaaatttaa     22140
     ttgtatggtc taaaagcaat ggtaattatt caaacttatc tagtaatata tatatgtatg     22200
     atataagcaa agatagtaaa attttattgt cagaaaataa ttcaataata aagccacaaa     22260
     ttaaaaataa tattattata gcaactaaca taaaagataa tagtgatttt acagaaagtt     22320
     atttaacaaa atatgatttg aaaaattcaa aatggaatga attcataagt aataaaagta     22380
     aagtttataa tgatgtgaag aatttatcag tagatgatcc attaataggg gaaaattata     22440
     tttcttggtg ggataattat tctaataaac ttattttata tgatataaaa aaagaaaaaa     22500
     caataacttt aaaaaaagag aagcctaacg aaattaagca aatatacttt ttaaaagata     22560
     atattattgt atataggatt gaaaatgata atggtagtga gcataaatgt attaaaatta     22620
     aataaatttt aaaataggag tattgtagta ttatggtgaa attttttaaa aataggtttg     22680
     tttttataat attagtaata attattttat tatttagttt ttataaaatt ttttatagaa     22740
     attatccaat attaaaacct acaattacta taaaatataa taatgaaaaa attttaagta     22800
     cacctggaga gcattcttgg tttaatctta aagaaggtgg aaatagttat ttagtaagca     22860
     aatcatcgta tgaatcaaaa gagcctatat atgtaaaaaa atgtgataaa atatatataa     22920
     aattttcatc tattcctaaa gaggtgacag taaaagagat atcaaattca ccatatataa     22980
     cttatgaaca ttttgaaagt aactctaaaa aagaatattt tttctttagt ccagatcaaa     23040
     taggaaaata tatttttgaa gtaagaggaa gttgggatga tacacataca atttcagaaa     23100
     tatttagtgt atatgtaaat tagatatctc tgaaaaaatt taattatcac aataagatgg     23160
     tttaacttat tgatcagata ggaagattta ggtcaatggt tttaatgatt ttcaacatac     23220
     aattcttata ttatggctat tggcttacta atggaaaggt tttatatgtg ttttgttaaa     23280
     taaatcaaat aatattcaag gtcaatcttc atggacaaat agatgcattg gtcgattatg     23340
     atgtaaatga aagatttatt ctttctaata aatatagagg taaaacctta gatagagatg     23400
     gattaaatga gcttttaatt ataatcagat ctgaagccac tttagtagta aaagaaatag     23460
     atagattagg tgaaaatcga aaagaaacta aagagcttaa actatttttg taaaagaggt     23520
     attgtcatga aaatgagaga tttctagaaa taatggctaa tgctccttta gatgttattt     23580
     tagaagaagt tccaagaatg acatacaaag agagtataaa gtattttttg ggagttacaa     23640
     atggagattt ttataattca aaagcagata atatttttga attaacttat gaagaagtga     23700
     taaggttatc taaagacaat aatttttatg aagataccaa aaacaaactt aaaagattaa     23760
     ttaaaggaaa tataaagtat aatgaaatag tataatttaa atggggagca atataattat     23820
     gttgttcctt tttatttttt ataatttacg ctcatttacg atatactcgt aaatgagcgt     23880
     aaattataaa aagaataaac ttaatattca tgcaattctt agcctactat cgttggccaa     23940
     gaatcctatt ttcaaaatta aaaaccaatt atttataagc tttatataaa tttaaaagtc     24000
     caggataatt ttattaaaca ccaggttaac actcctggac tttttctctt ttattcaatt     24060
     actattatct tatacatatt catacctgat actcttttta ctgaagcttt tatattaaat     24120
     ttctctttag ttattttatt tattccattt tttatttgac tatcacttac tatactatca     24180
     tccatccatt caaatgtagc tatctctata ccatttaaat tttcatcata tattttccct     24240
     tcatcttttc caaattgaat gtatctgttt tttacatttt ctaatatttt atttgaactt     24300
     tcatctttta ttttatcttc agctttttta tcttttgttg aatcatttaa ttcacttcct     24360
     ttgctttctg ttgaatttac agatttcaat tcactttcca acttagaaac acttgaatta     24420
     agatagtcta ttttttgatt tttaagagaa atgcttgttt gtaaaaacac aattattaat     24480
     actaaaataa ttatcactat acttgttttt ttatttcttt taattttttc aattaattca     24540
     ctaaacatat tactttcctt tcaaaaaaga agaactatta aaaatagttc ttctataata     24600
     tccttatagt tccataggtt tattttttat tctaacttct tttacaggct tttcaatttc     24660
     aatagttttt tcttttttta aaggcacaat ttctatatca ttgccctcac aaaattctaa     24720
     aagatctgta tatgtccaac ttttaacttc cttttccatt ttagttattt cttcttcaga     24780
     aacttcaaaa ccacttaatt caggtactaa tatatcaata gcataatctc taaattcttc     24840
     tatagatttt ataactttta attcatcagg attagaatta tagtaaacct caaccccatt     24900
     agatagcgaa gctgaaaata aatcatctaa atctttcttt aagtttactt tttcttcact     24960
     taaatcaaat ccaatccttt cattgatacc agctctatat aaaatatcta tttgtttatt     25020
     taatttttcc tctaaactct ttgtaaaatc tttatataat aaaacttcta atgaattaaa     25080
     tccatcaata ggtgaattat attcctttac atattcattt attctctcta tacaactgta     25140
     ataagttttt gcattgttat atactattgg cattgattta aagttcaata tgtttaaaaa     25200
     tgtactttta tcatcattag caagttcatt catagtcttt gcacatgatt tttctaattc     25260
     cattacttct gctaaacttt gtctttctaa attaatatca acatttaaca tagctctatt     25320
     aggttctatt cctatttctt tatagtcaga atttgatata tgaaaactag gcttaaaact     25380
     attatcaatg ttattttcag gttcaattcc aaacatatct gctaacctat atatagaatc     25440
     cttagcactt ataccttctg ctttagatac aaacttaatt ccatctccac cttcaggttg     25500
     tcctccaaaa tcataaaagt aatttttatc tatatttata caacaagaag ctgttttttc     25560
     tcctcttaaa ttgcaccata gtttattacc tcttttaact gtatctattc caagtttatc     25620
     agcaatatct cctattggaa tctcttttaa tttatttata tcataaaaag gctctacttc     25680
     ctttttaaac gctttttctt tgttatccaa tgtattatct atactattac gtaaatcttc     25740
     atatcgagcc gattttagct ctttattaat caattctttc agatcattta catatccatc     25800
     tcctatatca aaatgtaaag gtattacttt ctctggtgca tagtgtagtt ttaatttagt     25860
     tttagcatat ggataatact catccctttg ctctgcttct ctttttaatt ctctaacttt     25920
     taactctgct tccttaaatc tttcatttgg cttctttaag gtcaattact tcaccttttt     25980
     taaaaaaatt ctcttcgcaa aaatcaactg ttatatatgg ctctttaaat actcctttct     26040
     cattcaactc tctgttttca tcacttataa atttatctga agataaattt atatcttttt     26100
     catattccat acttaaaacc tcactctcat tttttttata aaaaaaagag ttattagtct     26160
     tttcaacttc taactctttt ttaagtctat ataaattttt attatcatca acatatatta     26220
     aattttctaa attataagtt tttcctacgt aaatatctct atatgaatca tcttctttta     26280
     ctaccataac atgattttta ccagtaaaat ttttagaatc tatttcttta ttttcatcaa     26340
     ttttaaacca agtataagaa ttgtttttct ctattagttc ctccaattct tttttactta     26400
     attcatttat tttcacttta tctttaccta aaaactcttt tactgcttca tcttcaatta     26460
     atatttcttt ctcttttata tttaaaagag aactttcaat agtttctata aactcttttg     26520
     tagtttcttt tacttctttc aaaagttttt ctttatcttt aaaatctcta tccttagtcc     26580
     aagattttaa atatctaaga gaatattctt cagtatctat attaaaataa ctacttactg     26640
     aaaaagcgac catttctgct tgaaactctt tttcagcctg agtataattt gagaaagttt     26700
     cacttgtatg caatttagca tgagctaact catggattaa tgtttttata ttttgtagct     26760
     ctgaatttct aggatttaat gctacttcat tagtaaatgt ataacttatt ccttttactt     26820
     gacctaattc acttttaggc tcaataatct taattccaat tttatctgct aaattttcta     26880
     aagaattaaa aaagccttta taattctcaa ctgttccttc taaccatcta ttcggaaaca     26940
     atttaggtat ttcttctaaa ggtacattag tttgacttac atcaaaaaca tatccttgtt     27000
     taaataaagt ttttccggga ataaactcta atttcttttc ctttattaag actttctctc     27060
     tttcagttgc tttacttaca agtttaattg ttccatcttc tgcttcaaat ctgtcaccta     27120
     attttgttgg tactaaaatt tttattccct tttctccttt attaaccaca taccctttct     27180
     ctttccaaaa tgcaaaactc cctactgctc tagctcctct aaactgttct tctataagta     27240
     ttgaattctt aaaagaataa ttgtaaaact tagacataaa agaaagatat tcttttatat     27300
     cttcaggtga attaaaaacc ttatctattt ttttatttgc ttgttctacg agaaaatcta     27360
     cttctttttt cctttcctca ttacttttct ttttaaaagc catacttatt tcctccttaa     27420
     acattcatac ttttataaaa ttaaagagtg cagccatgta aaaaaacatg gaagcactct     27480
     ttaatttaaa tttaccaagt ctaaattatt taacctcaat attagcgtta attatatatt     27540
     ctaataatac ctttttagct ttttcttctg aatcaaccac atctattaaa ttatcttcta     27600
     aaccttcttg ttctatttct gaaacccctc caaatccatt tctattttta taaacataat     27660
     attttttcat atatattcac tcctataata atttttcacc tttagttctt tttaaaaaaa     27720
     taaaagagta ttttaaaaat actcttttaa acttcataat tataatcttc tataatactt     27780
     ttattattta tatcaactgc aaggatcatt gtgttatctt cttctttttg atttaattca     27840
     tcacttaata gcttaatata atttttattt gctttaacaa caatatctct tttttcttca     27900
     agaagataaa ctgaaacttc attttctcct acaatctcat taaccattgc taaattttca     27960
     aacataaaat attcctcctt aattacatat catattcaat agaattttgt aatttttcat     28020
     attctctttg gtttttcatg ctattaatat catcatttaa actttttttc atcatagaaa     28080
     tactttgttt agttattata atatttctat ttatttccca tttttcctgt aaattttcaa     28140
     actttttttg actttttaag tcttcttctt ttacatattc tttaatttct ttaagaatag     28200
     tgtttcccat tcttgtatat aggtcttgaa ttttattgtc tttatacgtt gtagtttcta     28260
     cttttctttt gccataaacc tccttataaa acttgtcttc cttttctaat ctatcaacta     28320
     attctttaaa ttcatctttt ttatatgttt ctatatagta tttagttaag ttatcaatta     28380
     atggtcttac ttcttgcata gaattataat tataatgcca ttggcgttta tctgaaggaa     28440
     gttttttaac tatttcttta accatttttc gcatttcaat atcttcttta aaactcattt     28500
     ccttctttcc ttgaatcaaa ttatctctta taagtaaatt tattttatct aaatctttct     28560
     gcttatctaa caaagaatta acaaaagaac ttttcatatt atataaagtt ctaggtttaa     28620
     attttcctct ttctctacta ggatttattt caacactagc aatatgaaca tgaatattat     28680
     ctgtattgta gtgtagactt gctgaccatg ttagatcttt aaatccttct cttttactta     28740
     attcttccat agctcttcta gttgcttctt gtattttttc ttcatccaat gctccatttt     28800
     cagaatcata taatccattt gcttctaaga attcattatc aaaactaaaa acttcttgcc     28860
     acatattact accattcaat tgagctttat caaaatcttt ttttagcttt ttaacttcct     28920
     tttcagttaa agaatgtttg tctttagtaa ataaagaacc tattttttca ggattaccca     28980
     tatagttgtt atacgctgaa tatttatcaa aattcttttt tctagttgct tcacttctat     29040
     ctatatagtc aataaagttc ttaaatttac tgcttccatt tctaataaat ttaactttat     29100
     ttattacacc aaccataact aatattcctt atcaagtttc ttaactcttt gactttcaat     29160
     tctcttatca acttcttttt tagcagttat gtaagcttca tgttcttttt cttttgatgg     29220
     aaatatatca ggtaaatctt ctgcaataaa caatccattc attaactcta atagcacttg     29280
     aatattacga tctgaattat tacttactct ttttaaaact aaaatacttg cttttatttt     29340
     ttcagcaact ctatctccta atatttcaat catattctcc ataggaatat ttaaattttt     29400
     ttcatgctct ctaattatta attcaagagc ttcactattt gacctacaag aatgttttgt     29460
     ttttatatct tctatatgct ctatagaagc atttgataat ctataatgtt tttcttgtct     29520
     tttcatattc tattattcct ccttaaaaat ttcagttaaa tcaatataat tttcatcaca     29580
     aaactttttc attacctttg tatttaaatc taaaactctt aatacttttt ccatagttat     29640
     tctataattt gcttcaaact ttctcatttc atctgaatgt gatagagttt ctaaatgttc     29700
     ttttaaaaac tcatttctac tcactccttt tgctttcgca aaagaatcta ttcttgttat     29760
     cgcttcttta ctcaaatctc gcactaataa atctgacatt tatatcacta ctccctttaa     29820
     aaaatgaaag tattggaact tttttaaagc tccaatacta aataaaagat taactttttc     29880
     aaaaaagttc tcaaaaacat ttattgtaat tgtgtacttt atggtgaatt ggtaactact     29940
     tgatatactt actttaagag cataaggaga aattgctatc acacaaggtg ctagactagg     30000
     caaagcctag tatttcaatg atatcaaaac aatttccaat tatcccactt taagccacaa     30060
     atacgccctg ttaaatccct tttttatccc actttaagcc acataaaatc cataaaagat     30120
     accattttat ttaaccattt tctctaaatc ttctttcttt ttattaagtt tatctatttt     30180
     atcattaagc tctttattat cttttttaat tttttctacg tctttattta atgaatcaac     30240
     ttgtcctttt aaacttgtta ttgttgaatc agtagttgca atttctgttt ctgtttgata     30300
     ttctttatcc ttttctagtg aagttatttt tgaatttgca ttatctattt ctttgttttt     30360
     attttcaatt tttatatcat tatcttttat ttctttttta actttttcta tttcttcatt     30420
     aactaattct attgttaatc cttctttatt ttgttctttt aagttattat caatagaaat     30480
     atctcttgaa tcagaataaa atttcacctt tttaatttca tttgttttat tgtttttatt     30540
     tataaaagtt aatgaaactg cactccattt tttctctggt aatgttgcat atataatata     30600
     atcttgatct gaaactttaa ctaatttagt aggtattatt tcatttggat tattcttttc     30660
     tctaagctct acagacaaat ttgaatctgt attaatatct aaattgtcta tttttaagtt     30720
     aaattgtatt aaatgatttt cagggttata ctctctattt gttacatcta catttatact     30780
     atctactaaa aaaggtttat ttaaatcact actaatcaga ttagcttctc tattaaataa     30840
     agcattagaa gacaagaaaa atatcaatat tattacaata actccactta ttaagtaata     30900
     tgttattgca ccattctttt gaaatttata ttttaaatca tctactttta actgcaaact     30960
     ttctctatcc atacctattg ctcccttcat atttatagga aaaaagagct ttataaaatt     31020
     tataaagctc ttaaaaatca ctttacctat taaaacttct ctaaaaataa aaccattttt     31080
     aaatacaaaa aaggtaataa aacaaaaact aaaataaata ttgaaattaa tataattgtt     31140
     aaatttaaat tcaaattagc cacctcatta ttctattatt cttcttacat ttccattaaa     31200
     atatctgctc caataagggc tatttaaatc tcctatactt acacctttcg ttgaactatc     31260
     atttaaaaac ttcccatttc ctaagtaaat tccaacgtgt ccatttctac cagcagtatc     31320
     aaagaaaatc aaatctccac gcttcatttg ttctttcgga acagactttc ctaaagttaa     31380
     taaactccat gttgtaacac tagaacgatc acctaattgt attccagcac tagcataaca     31440
     atagtgaact aacgaactac aatcgaatct tcctgcaata acatcagctt ctgttcttcc     31500
     accaccccat acataaggtg actttcctac ccatttcata ccagcttcaa ttgccttttc     31560
     tatagtttca ttatttcctt taatacctcc actattaact aatcctttgc ttctaaattc     31620
     catagcatac ttgaatacat tgttaggata attattttgt gcagtatcta aatttacact     31680
     cataccataa cccggacccc cattataaca agcaaatatt cgtcttaata tttcactaaa     31740
     atttgaatca ttttcatcag cgttccagtt gattactttc aagttttctg tactattata     31800
     ctctaaggtt ggtacaagtt tttttctgta taatacataa tttgcataat gtctagtttc     31860
     ataagcacca gttattattt gcaatctaac atcttttaaa aacacattcc aaatttcatc     31920
     tacactacta aacgagtaac ctaactgttt ataaatatca cctaacccta aatctaagta     31980
     atatttataa atatcacttc catcaaaatc atatctttgt tgttgcatta ttccatatgc     32040
     tccaccataa gaatcattag gattaaaatt actttcttgc tttgcaattc cagccaaaac     32100
     ccagttaggt attccagtta aatcagaagc ttcattaaaa tattgaacaa attctgctgg     32160
     tactccacca gctccaatat ctgcatgact attattattt ttcgagctat taatttgaaa     32220
     tatagccatt gctaaacttc caattagaag tgttaggatt aagaaagagc ttgaaaaaaa     32280
     cattattgaa tactttatta ttttctttat caactccttt tctttctcca aaattacacc     32340
     tccttctaaa aaaatgtata aaaaaaagaa actaaatcgc taaaaaactt agtttctttt     32400
     tttattaatt ttaaatttaa tttttcatat aatattcagt tatcttccac tttccatcaa     32460
     tttttaataa cttaaaaata tatgttggtg ataaatcatt gtctactttt tggtcatagt     32520
     tatctatatt atctttttta acatagcttg taaattctaa gtaattatta tttgaattat     32580
     cttcacaatc tgaataaatt ttatttacta tacttttttt atatggatat ttaccagcat     32640
     cagcttttat tccttgagat tctaaatcaa aatttccaag agcttcaggt gttaaatatt     32700
     tcccaaccat gtccctatat tttaacggat tacttttatc aaaattcata ataccttgca     32760
     taaaattttc aacaactctt tttgcattta acaagtcttc atctgaaaac tttccatctc     32820
     taggtatata atttgcttga taaaagtttt tatctccaac ttgttcttta gtttttactg     32880
     aggttacaaa tccttcaggt aaactataat agctatctga tgtttcattg ttgttatttt     32940
     ctacggtgtt ttctttatca cttttagctt catttttagg tgagatttga gttgcaacat     33000
     tacttttaga tacattatca acttgatatt ttttatatcc tatatacgct aatgaactaa     33060
     tgaaaagtac ccctccaata attattgcta ttgttttttt cttcattatt ttaagctcct     33120
     cccttaaata agtatttctc tctatcagaa atctctatat taaatctgat atttttatcc     33180
     ccatttatta ctaaaataca atctcctgta gaaaaattag gtatcgcatt tatttcagta     33240
     tctgttaatt gaccactaaa aatttctgac aataatcctt ttgtattatt atcttgttgc     33300
     attataaatt tatattgtgt taactcaaaa agtgttctta ttttttcaaa aacttctgaa     33360
     tttgaaacat ccggaacaac atctcttatg ctttgtgtag caaatattaa accaccaaaa     33420
     tactttctag cttctctttc aaagttaatt aaataatcaa ctgctagtat gttattgcta     33480
     tttataattc tatgtgattc atctaataat agtaaatact tcttggattc ttctactgtt     33540
     ttctttcctt catcaaatgc tttcttttct ggtaatcctt gagttaaagc attattccaa     33600
     agcatactta atacattaaa tatctgagca ttaaatattc ttttatcaac tccagttaat     33660
     gttctaatct caaaacttac tatttgctct tttgttaagt cttcaataga agaatgtcca     33720
     tcaaatagtt taccataatt tctgatagca ttgtcaattg ttaacattat actttctaat     33780
     cttttctttc taaaatcact tagatttttt cttatacttg ctttttcttc atcttcatag     33840
     aatacacctt taatataatt aagaaactca cttaatgttg ggtattcttc agccttataa     33900
     cttgtcgctt tttctctttc tattccatat ataatataaa aatcatgtag aagtctttca     33960
     aattctctta tttcttcttg tgttgcttca ggtgatagaa aattataaat catagaaact     34020
     ttagacatat gttgcatata actttgttct acttgtacct catttgtatt ttcattaatc     34080
     atagttgcaa agatttgtaa tggatttatc attccattac taccatctaa tgctactatt     34140
     tttccttcta gctcattaac taagtcttta aactctcctg ttatatctag tattcttaat     34200
     gtgttattta ctattgcatt gttattgctt aattttttta ataaagttga tttacctgat     34260
     cccataaccc ctattgctaa cgcattataa gattttcttt gttcattctt agtaaacaaa     34320
     tcaaagataa catttcctcc tgtaatactt gttcccatga acattccagt tggatcattt     34380
     agttctacgt agtgaaatgg gtaaccagct cctaagctta tactaggcac aggatgtcca     34440
     cttcttttgt ttcttaaata tttttgttca ccagcactta aaaataaaga tttccactca     34500
     tattcttgtt catttagaaa aactgctccc ctataaccta acccttcaag tttagttaat     34560
     acttgtttaa ttttttcttc taactctatt tcagttttag cagataaata atatctaata     34620
     gttactaact ttattacttc atcccttgat gtaatatcat ttactaaccc cattagaata     34680
     cttgttgcat tatttgcttc tataatatca atgttattct tcaaactatt agccctatct     34740
     acattctcgc ttatagcact atttaaactt tgtaaagcct tacttctatc ttcagtttca     34800
     acatcaatag ttactgttac atcttttata tcgatcaact tacctaacca aaattcatca     34860
     acagatgttg ggaaatcata aattcttaaa cacgcttcat agccatcacc cttaacaata     34920
     cttctaggat taaactttat tccacctact ggctgaattt tattgaaaaa atagggatta     34980
     taattataat cccttttaaa tatacccata ttaaattcct cactttctac ttactaaaat     35040
     ctaatttata gttaacatac ttcccagtat catttaaact aacaaaagca tcataagtac     35100
     cgttaccatc tttctttttt aaacctgtca ttttcacttt ctttccagct aaaagatttt     35160
     tagcaattga ctttgtaacc ttcttccctt tatccttaaa aaacttatct tctttccaaa     35220
     tattaaactg acactttggt tcatctttat aaccttcaca tgaaaatgat tttgatgttt     35280
     catatatatt cttgccacaa cgaggacatt tccctataac ttctttttct tcctttattg     35340
     cttcaatctc tatattttta ctatcttcta aaattgattt taattcatta gaaattaagt     35400
     caactgctct atctatattt aattcatttt tatatacctt tttaagtatt cgtgaaaatt     35460
     ctactgtttt ttctttagat aaatttacat tcaatttatc taatgtttct attaattttc     35520
     ttcctaatgg ttctatagat agaactgatt tattttcaga tatatattta tactttttag     35580
     cattttcaat aattccagtt ctagttgctt ctgtacctat ttctaatcca tctaaaatag     35640
     ctttatagtc ttcttcttca ttttctatct cataattctt aaaaggattt ttaaggtaat     35700
     tactaagcat ttctgttgtc attttacctg gtgcttgtgt cactttttct attgctttaa     35760
     aattagtatt tatcttatct ccgacattaa gattaggaag tgtattttca tctttcttaa     35820
     taggctcata ttctaaaaat cctttttgaa ctatgacatc tccttttaat gaaaattcta     35880
     aatctccaac ttctattctt attattgttc tatcaatcaa tgtttcttct attaaaaaat     35940
     ttgaaataaa tctattttta atagtattat aaacatctaa catcttaccc tttaattcat     36000
     cttctttagg tatctttaca gtaggggtaa tggcactatg actttctatc ttactatcat     36060
     caaatatggt tttcttatct ttaaactcta aattataccc ttctgaacat aaaatatcta     36120
     ttatttcttt taccttacct ttttctgctt cagctagata ttctgtatta gttctaggat     36180
     atgttacaaa ccctttttca tatagttttt gaattaactc taaactttct ttaaaagtca     36240
     ttttatattt tttacttaaa agactttgaa gtttacttaa agaaaataac ttactaggtt     36300
     gtttcttaac ttttttagta tctttactta taactatagc ttcataagta ttcagttcat     36360
     ctgcaaagct cttagcttta ataaattcac ttttagtaaa agcaagttct ttaactacta     36420
     atttaattat ttcatcatta gttttctcat tactttcaat ttgataatat gtttcaggaa     36480
     caaagttctc tatgctttta tctctctcat atatagcttg tactataggt actaataccc     36540
     ttcctacagg aaataaatgc ttagatttta cagtaacata tcttgtaaga ttaactccta     36600
     caagccagtc taaaaatgtc cttgtaaatc cttcatttgc aagattatta taagtgtcta     36660
     tatcttttaa gttatttaat ccatataata tagattgtgt tgtttgctct ggcaaccata     36720
     atctagttac ttttttattt atactattat tattaaaaac attatttatt ataagcctaa     36780
     taataacctc accttctcga tctgcatcac cacaagccac tatttcatct actctattac     36840
     tttttattaa ttcttctaaa atcttatatt gttttttaac tccgacatca tcttttatac     36900
     taaatttaaa ctctttagga ataaaaggaa gtatatcatt tctccacttt gctcccttat     36960
     cctcacctgt gtactcttct atattataaa gcttaaatag atgaccaaaa gcaaaactta     37020
     taatataatt ctcactttca aaataaccat ctttcctctc aaaactctcg cttgaattta     37080
     aagcttttac tatattcatt gctaaacttg gtttttcagc tattactaat tttttcacaa     37140
     ttccaccctc cttatttgtt atgaatattc ttaactattt tttacataag ctttgtattc     37200
     atattattaa gtttaaaaag tatcttcatt tttttctcta aatttatatt tttcaaagtg     37260
     attgatatat tctgcatatg atttaactta ttaagtagat tttctttatc aacttcattt     37320
     ttcataaata ccattaagaa aaattcttta ttgtttctat gagtttctaa aaatttaagt     37380
     tcatttaact tttcttccaa aaatccaata tatttttgat tatcggtttc ttctaatttc     37440
     ttattcaaat attcttgttg cttaactgta tttactggaa aattcatagc tataatctta     37500
     aaatcatcaa tataatttct tagaaaatgt ataaaattat atatatataa catagtttca     37560
     tattcagata aatttgatac atctctagtc tttacttgat ataaatttaa aaaaccttgt     37620
     tttgtcacaa aaaaattatc ttcatcaaca tctaagaacg gtaaaacttc cctattgctt     37680
     attaatgtat ttttactttc tttcttcttt tctttaagct cttttttttc tttagtcttt     37740
     tcttctttta atttaacctt ttcttcttta ctaagtttaa ctttttcttt tttatttaca     37800
     attttaatat tttcaaactt tttcaaaata tcacctcatt tgaatataaa aaagtgtccc     37860
     ccggggacac ttttaaaatt aagttaaata aaacatctta tctgctattc agtaacttca     37920
     tagctgctaa aatattttat tcaacttttt ctgctacata aactttttta tctctcacca     37980
     aagcaagata aactgtttgg aaattccttt ttttagggtt tataatactc ttattaacta     38040
     aaaatatagt tgatatcgca acaaatatat aaaaaagaac tcttaaacta ggataaacca     38100
     atccactaaa tatagtagca aaaattaatg ctactaagag cattgcaaaa tcaaacagat     38160
     aaatctttga tgtaaacttc atttctgtag aaatttcttt tggaatatta tattgcattt     38220
     ctaattatct cccttcattt tattattttt cttatctttt aaatttttat aattcttagg     38280
     tatattaaat ctttccgttg cactttgacc tagtttataa gcttgtttta tttccctact     38340
     cttgcgagtt gcaaaatttt cttttgtatt tacttgtcta aatgatcctt gattaaaagc     38400
     attattccca gtattaacat tactgttttc tctattgtcc atactttcat ttacaggatt     38460
     actcttagga tttgtacttc taaaatcact atttccgttt atatttctat tcatttcatc     38520
     atttaatttt ccacctgagc ttaattcttc tttaccactc atctctgatt gtaaattctc     38580
     atttggtgag ttatttacct gacttctcaa atcattatta aggcttccat ttttcatttc     38640
     atcctgaagt gaagagttat catttttaat gttatctgca cctttcattt cttcttgtaa     38700
     attcggaatt atatttctat ttgcttcttt actcatttct tcttgtaaat ttggactatt     38760
     acttttactt gtttctttat tcatttcttc atttaatttc ggattatcat tatttttatt     38820
     atttaatcca ttcatttcat cttgaagtgt ttcagtagtt tctacgctta aatttttcat     38880
     atcatcatgt aatttagcac tattttcaat attagaatta ttaaagtctt tttcatttga     38940
     ctttttatca ttattcattt ctgattgtaa atcctgctta ttgttattct tatctgaaga     39000
     atttatattt ttatcaatat ttgcattaga attagcattt gcatttttca tttcattttg     39060
     taagctactt gatttatttt cagtttcatt atcattagtt cctgaagagc tagttttgtt     39120
     tttaaacaat ccattcatag caccagctcc aactgctcca ccttttattg ctgaatctac     39180
     tgttccacca gttgcttttg caaatccttt agttcctgaa atcatactct tagttccaga     39240
     gcctaaagct ttcatagctc catatgttcc aagcattgta tttaatccac tctttaatcc     39300
     agcatctatt cctaatattc tttctattat atttggacca tctataactg caaaagaagc     39360
     tcctatttga agaattaatt ttgctaaact tgttactgtg aatccaattc ctgtatcaac     39420
     tgaagaagcg gtaaagttaa gccatgccac aaatataata tataatttaa gcaatactgc     39480
     cgttgccatt ataactgcaa aagttgaaaa aatatttttt aatatagcct ttattttttt     39540
     attatcttct atatctgcaa aagcaaaaag catagcaaat aatttattaa aagctaactc     39600
     aaaaatcagt cttgctattt taaatcccac acaaagtagt gttattcctg tagttgctaa     39660
     cccaataata acactaacaa aatctatatt atatctgtaa tagtcttcat ccatcataat     39720
     ccaatttttc tcaagatctg tttccttcat atctccatta gctaatgtat ctaatttttt     39780
     cttaaaaatt tcttcatgct ttgttttact atcaacttta aatgcttcgt ctatatgaat     39840
     atcaaaaata ttatctattg taatattatt tttttcttta aaattaaaat cattttggtc     39900
     taatgcgtaa agatcatata gattatcttt tactatttgt ttagctgaag aagtatatcc     39960
     agctttaaca tcttttacta ccaaatttgt taaatctccc attttaacca taagcattgg     40020
     aagagctata acaacaatta atgaaaagat taaattggta ggaatacttt gtttgtccat     40080
     ttttctattc attattattt tatagcctaa tactgctaat gaaatagcta atatagacca     40140
     gataataggt ttatatctat ctataaaatt atttacttct gaactcgaaa aaaatgaatt     40200
     aagagtatat attttattta ctgctccttc tacgccatca actaaagaag ctaataacca     40260
     tataatttgc catcctaacc atctaaatgc gtgactaatt atacctgtta tactcaaaat     40320
     acccatttca gttaattcta ttaaagtcac ttttcttcac ctcctgtaac ttttttagct     40380
     tttagaatat ttaaaatttt attatattct tctaaatgtt tacttccttc aaagttatat     40440
     aacttttcaa attcactaaa aggagtatct ttattaaatt ttatatctct taattcccta     40500
     aacctattat tataagtatt taacttcata ataaatgagt agtctaagaa ctcacctaaa     40560
     gtaatatctt tttcactaca ataaatttca gtttcattag ccttttcttc aaaattttca     40620
     atgcaatctt ctttaatagt atttatatct tcatttacat ttaaatttct atcataagca     40680
     cttataatat tattcaactg cttatctatt ttacttatat attcatcttt actttcatta     40740
     aaatctatta ataagctatc taagtctaaa tttctatgtt tactttttat ttttatattt     40800
     ttaaatacat tttcattatt aaaatcttca cttaaatatt catatctata tttaaatgca     40860
     gtttcaccat gattataaat tggatttgga actattttac ttcttttcaa atcttgtctt     40920
     tttataaccc ttaatacaac tgtttctcct tctttaaatt tctttaattc ttcaggaagt     40980
     aaaagtcttc tactatcaac actttctgtt ctatttttag ttatatccag tatctctcct     41040
     gatcttgatt gattaactat tgttttatct cctaaagatt ttgatatttc ttcagcagta     41100
     tcattatcat ttgtcaaaat ataaataaca tttccacagt taccaacaat tgttttttca     41160
     tcttcaccat ataatttttt taattgagaa taagcttgaa ttatcatatt aaatcttatt     41220
     cttctaccta aacaaacagt agttaatgtt cccattcctt ctattggtgg catatttcca     41280
     aattcatcta atataaaaat aacttctctt tcacattttg cagtatcgaa tagagaagcc     41340
     tcctttgata aaacataata aagttgcctt ataaaaatac tagctaatac atgattagaa     41400
     ccatcataat caggagttac cataaataga gctattggtt tattgtcata atcagtatca     41460
     agaaccctaa acttaattat atattctcct acttcattta catctaaatc agaagtatca     41520
     acttctatac cctttataat ttcattacct ttacttccaa aagctctaat ctcttctata     41580
     aatctatctt cattgggttc ataacctttc attatttcta ctttttctaa cccactaaaa     41640
     gctcctatac attcacttat attagtttta ataaaattta tttttttatc atcttctaat     41700
     ttttctttaa cttctacttt tactactttt tcaatatatc tactaaatcc aacttctttt     41760
     aaattaatag aatttttagc agtcatttta gctatactgc tcattgtaaa acgtgaaagc     41820
     tctgccatag cgacagcaaa aatacttcct ctagcacttc catcggcaaa tttacttgta     41880
     gcatattgca ttttagctac cgaattagct ggtaagcttt gaaaataatt gtctaactta     41940
     ttaccatcat catctgtatc tcctccaagt tcagaaagca tattagctac tgtatataga     42000
     gttatctttg aattttcttc tttttttctc ttttctaatt ctttaatagc ttctttatgt     42060
     gcttcaattt tattatttat aatttttatt tcttcagtat tttcaacttc attaatctta     42120
     tttcttaatt catttatctt attttcaaaa tcttttattt tcacatctaa tattttgcat     42180
     ttattaagac attcatctat tatcgctaaa atcaacccat tgacaagtgt cattgctgaa     42240
     ttttgccaaa atgggtcttt agcagaagga ttataataca aagcatatgt taatgtttta     42300
     cacaaatttt gagcttcgtc taattcacct ttttcataag catctattat aagttgtaac     42360
     ggattataac ttattgaatt taaaggattt aataagttta acacttcaac tctgtatcct     42420
     cgtttttcta gtgtatcttt agacatagct actaattcac cctttggatc attcaaaacc     42480
     atagaagctt gttcttcagc cctagaataa atatctatta atggaactac aaacatttct     42540
     cctttaccac ttctagtagt acctataatt aaattattta ctggacttgt atcaatataa     42600
     attttatctt tatgtctaga aattggaact ccacctcccc ctttaaaccc ttcttttttt     42660
     tctggaactt ctttgtattg tgcttttatt tcttctagtg tagtaaaacg gctagtccct     42720
     ttttgaccat cttctaagct aataaaagat tttttcaaat caaatacaag ctttaaaatt     42780
     ggtatacata aaacaatata aattaataaa taaaaaagtg gatatttaaa aatcaaagtt     42840
     atattaaaca tactttttaa aacactaaaa ctagaaatag tatctgaatt aaaagatgtt     42900
     aaagtagtaa aagctcctac aattatattt actattatag ttacagctaa taaaatgctt     42960
     aatgttaatg taacaagtgt tttattacta gaaacaaatc tacctaaatt aaatttttca     43020
     tttttgtatt tttcattgct tctaagttca ttagatattg tattttttaa gttactaaaa     43080
     aagctcatta attatcctcc ttttcttaaa ttttaaagtc tttataatcc tttgtttttt     43140
     atagaatcta taccaaaacc ttacacataa gcgtttatca ttatatagtt catttaatac     43200
     tctaagttct ttatcactct taaattccat aatattcata attgattttc ttaaaaattc     43260
     atctaaaaat gaaaatatac tatccataaa ctcactcttt catttttttt aattaagtaa     43320
     agaccttata ttaaaggtct ttacttttta aatcttaaaa tgttatttta ctttgtaaga     43380
     aactagctat agctgaagct cctagaatta ttattaatcc tataccagct cctatatacc     43440
     acggtcttgc ctttctacct ccttcattcc ctccaaatat ttgaaagaat ccacctatac     43500
     caaaagctaa ggctgctgcc ggagttccta aaatttgtag ccattttact gcttcattaa     43560
     gtaaattttt tatttggtca attacatcca tatttaattc tccttttcac taaaaaattt     43620
     aaaataaaaa aagcgttttt aataaaaacg ctttttattc tccactatta ccttctaatt     43680
     ctttttttaa agctaacccc tcatttaaaa gctctaaatt ttcaaatata agcttcatat     43740
     gagcttcttc taaccatgtg tcataactta tacctttact ctctaaaatc atgcttacag     43800
     tttctttaat tggattttta acattatttc tattatttcc tctagccaat tacatcaccc     43860
     cctttcaaag ctttactttt agcaacaaag catctattca tttttgtact tatttgctct     43920
     ctaatcatat tcataaattc aaaaggagtt ggttttgttt gtggttcgat aaacttatat     43980
     tcacctatgc ttttattttt taaccttcct tgccaatatg caacatccaa tgaatatcta     44040
     atagacctat atattgaact atatgtacta tctaatattt cagcaatttt ttcatataat     44100
     tttgttgctt tgtttctata ttcaatatta ttaactaata aaattactcc tatctttata     44160
     gcttcaaagc tccttttata tggagtaata aattcagaaa ggagttcatt aacttctttt     44220
     tctaaactaa actctccaat ttctatacta ttttcaatat aaaatttaat aactttatct     44280
     tgtcctttat ccacattcaa aacctcactt tatcaattta aattcttttc tttaattatg     44340
     tatctgttaa tcaatttaac tcacaccttt atttaagcta aaatatatct attttcgata     44400
     ttctcaaaat cattaaataa ttttaccttt aagtatcaat ctctctttag ctctgtttat     44460
     acaagttatt actgttattt cttttttaga tatatcttga gttaatagac tagaatcact     44520
     tggatttact ataactcttt ctgttaattt atacttgtaa atattattgt cagttttaat     44580
     ttctataata tcaccaattt ttactttata taaattttta aatatagaac ctttcatatt     44640
     attatgtcca gctagaataa catttcctac ttgtccaaaa ttagcactat ttctatactt     44700
     tgctacaaca taatctaagt tttcttctcc atctacaata ggagctttaa gtcctatact     44760
     ttttatttct aaaattccaa ttacatttgt tcttttacta tttatagttt cttctttata     44820
     ttcaaattca ttagatatct tattttcgat attatcattt tctttttcaa tagaattatc     44880
     tatactagaa ttattttcat aattacttat aagatcattt ttaatattat tatctttata     44940
     atctatataa gaagcaactg atattaaact tattcctatt agtattaata ttactaagat     45000
     ttttttcatt ttattttctt aattcttcct ttgctaattt tgccataata atatctgctc     45060
     tctttgctcc tttaaataat tctatataaa tacaatcaag taaaaataat atcaaaataa     45120
     tcatagttac taacactata atctcacttc cttttcaaat aacctaaaaa aaagtgtccc     45180
     ccggggacac ttttaattac tttgtaattt aaatcatatt ttaaaaggtg tcccccgggg     45240
     acacctttat cttattatga taattttctc ttcttagtga aaaataatcc accaatacct     45300
     ccagcaacta aaagaatacc taaaggaatt aatgaattta tatcaaatct acttccagtt     45360
     ttaacaattt caatcttttt atttgtaaga ttgcatgtaa ttatatctcc ttgattagtt     45420
     atttcaaact caccagtttc agttgttaat tcatatcctt caggagcttt agtttcagaa     45480
     attctatact taccttttgc aagagtaaat ttattacctt ctttgctaga agtaaactct     45540
     attactttcc cttgatccaa tccttcaagg cactctattt ttatcttagc tccttctaaa     45600
     acttctccag tagcaacatc tgttttagta aactctaaaa ctccagttgt tctttcatct     45660
     ttaagattag cttttgtgat ttctccgtct tttatttcaa atgttccaac ttctttattt     45720
     atttcatatc cattaggagc tgaaatttct tcaaatgtgt attttccttc gtctaaagta     45780
     aatttatttc catctttgaa agaagtaaac tctattactt ttccttttga taagccttct     45840
     acacaaatta tttttatctt agccccctca attattctac catcagtaac atctgtctta     45900
     gtgaactcta aatcaccttg ttttctttca tctttaagat tagcctttgt gatttctccg     45960
     tcttttattt caaatgttcc aacttcttta tttattctat atccattagg agctgaagtt     46020
     tcttcaaatg tgtactttcc ttcatctaaa gtaaatttat ttccatcttt tgaagaagta     46080
     aaatctatta cttttccttt tgataaacct tcggtgcaag ttatttttat cttagcacct     46140
     tcaataactt taccagttgt aacatctgtc ttagtaaaga ttaaatcacc ttgctttctt     46200
     tcatctttaa gattagcctt tgtgatttgt ccatctttta tttcaaatgt tccaacttct     46260
     ttatttattc tatatccttc aggagctaat gtttcttcaa atgtgtattt cccttcagga     46320
     agtgtgaatt tgttaccttc tttagaagaa gtaaactcta tgtttatatg cttgttttgt     46380
     ggttctaatc ctgtaatttt aaccttagca ccatctatag aatctccagt agtaacatct     46440
     gtcttactaa agtctaattc tccagttttt actgtattgg caacatctat tttttctaat     46500
     tgtccatctt tataaatatt aaagtcatat tttttatcaa ctttgttgta atgatctatt     46560
     gcttctactt ctacccaagt gtagttacca gcttctaaat tattaactgt tatcttacca     46620
     gtattatctg tagtataagt tcctactttt ttatcaccat ttaataagtc aaacttaact     46680
     ccttctagtg gtctattagt atctttatcg aacttaaata actctacaga accccttatc     46740
     tttttattgg tcatttgaag tttaatagtt tttccatttt ctttaacact aaagaatata     46800
     ggctctttat ttagtacgta attccataaa gttttaactt cgtctacacg gtaatcacca     46860
     tattctaagc cttttaaact aactaatcct ttatcatcac tctttaagtt ccaagttttc     46920
     cccttcataa agccatctaa tgcagtaact ttaaattcaa tgttttctaa aggtttatta     46980
     gtttctttat ctaactttaa aagctccata ttcgctgtta tacggtcatt agataccttt     47040
     tgagtataaa tagtacctaa atcttttatt tcttctaaaa ctgagttttc atctatttta     47100
     aaaggtatag gattaacttt aatatatcct tctaatggtt caacttcttc aagaagataa     47160
     tttccataag ctaaattttg tggagttact aattcaccgt ttttattagt ttctaaagtt     47220
     gtagttttca ttggaattat acctatgaag tttgtaaact ctaccaactt tttagtgtca     47280
     gcatttctta tttgaaactt aactcctttt aatggctttc catctttaga atcaaccttt     47340
     ataactctaa ctttggcttg tataggagag ttcttaatgt atttaacata agtttttcca     47400
     ttttcagcta tattgaatga atactcttta tcagacttcc agtatccttt tggagtatct     47460
     gtttcatgga acttataatc tccatatcta aggtctttag tataagcaaa tccattttta     47520
     tctgtaacaa catgatctac aacagttcct tctttgatac cattaacatt aactgctata     47580
     acatcaaatc cagcaccttc aactggtttt tcttcatttt cactatcaac cttaactatt     47640
     tgtaattttc cctttataac atcattacta acatcaaaag tataagtttt atcattttca     47700
     tttatattta tatcccatac tttattactt aataaatatc ctttaggggc tttagtttct     47760
     tgcatagtgt aagttccata atttaaaggt tcgctttcag catagccgtc tttatttgta     47820
     gttatagttg ctactatatt tttgttatta tcataaatag taaattcagc accttctaaa     47880
     tttaaatcag atatttcact atctgttttc ttaactgcta ctttaccttt tataattttg     47940
     tttgtatgag ttatttcaat agtcttacca ttttctgaaa tagtaactgg atgttcttct     48000
     ccgtttaaaa catatttaga tggagcttta atttccttaa ctaaatagtt tccaaaagga     48060
     agtaagctac ttgtagcaat accattttct ccagtagtta tagtttcaat atgcttacca     48120
     tcttgagtta tttcaaattc agctccttgt aatggagtat ttgtttcttc atcaacttta     48180
     agaacttgaa ttttaccttt aatttgagta tcagtcattt cagctataga aaccttattc     48240
     ggttttacag taacattaac tggattagta actaaatagc cttgtggagc ttcaacttca     48300
     tgtatagtgt attctgctgg tttaatatca ttaaatactg ctttaccatc ttgtgaagtt     48360
     gcttctgcaa cattttcatc attagcattt ttaagaacaa atttagcacc tgttaaaagt     48420
     ttaccatcat cacctttttt aataacttgt actgctccat ttaatccagt ccaagaaact     48480
     tttatattat ctttatccat agaatgagta tctaaagatg aaacagccat atcttgtata     48540
     ccttgttcag gagtcatata tcctaacatt gctggtatat caacctttgc ttttacactt     48600
     acctttaaat ctcctgtttc tgcatttgaa ggaatatata ctctaaaact ttcatttgcc     48660
     ttatatcctg aatctttaac atttccatcc atatctttta tgactatatc ttttgttaac     48720
     tcaggattac ttgcactttt tatagtaacc tttacaccac ttaaagtata gttagacttt     48780
     atttttattg gttcactaac aaaatagtca ccttcttgat gtgcaattat atcatttggt     48840
     gacacttcaa aaaaagtagg catttcttta ttatgagctt tatcaactaa aaaatctatt     48900
     actggtttta atttacttaa tggtacagta ccactttgaa gtctttctct aactaatccc     48960
     ctacttaaac cagcttcctt ctgataagcc catatagcta attgagtaca atatctatat     49020
     tcatctgctg atattcccca atctgatcca tcctttgctg gatatcccca ataaagaatt     49080
     gtttctatac cagcatcaac ttgcatttct tttgtatagt cttgaccagt tggatttaat     49140
     gcacctgtat ttaaacaata acaagttgtt aaatctccag gaacataata cctatgattt     49200
     cctattggaa gaaccttccc ccaagttgga gaatcataat ttaaatagct ctctgcatca     49260
     gtagaagtta tttctactgc aaataccttt atgttagtaa ataaaaaagt aaaaattagt     49320
     gtgattgttg tgattaattt aaatcttttt gctttgctca cctttttccc tccatttttt     49380
     tgttttcatt tttttatttt tgataaaaaa ttttaggatg tatcaaagta atccacttaa     49440
     tcttctcctt cctaaaaaat tgtatttaaa aagagtgctg cctaattgca acactcttaa     49500
     atatcctaaa ttaaacctaa gcttattact aaagctctat tcaatctttt tatttcatta     49560
     ttagttagag ttcctttctt ctcactcaac tgatgtctat atatagtagt aatttgttct     49620
     aataaaattg tagaaggctt ttctagacaa gaattttcaa tttctgtatg aaccttcatc     49680
     ttatttttaa cttgagaagt cataggtgct actacaaaag agcttccaaa gttttgaaga     49740
     atagctactg gtctaatacc ttgttgttct gaaccctgtt ttctttttcc taaattagcg     49800
     taaaaaatat cacctttata aactttacct ttataaaaat ttcttttaaa cttcaatata     49860
     atctccaccc taaaaactat attaaaaaag acttagataa atctaagcct tttatatata     49920
     acctttttaa aaagtgtccc ccggggacac tttcaattac tttataattt taatgacatt     49980
     taataatcaa atcctattgc aaaataatat ccaccatcag cactcttata tactgcacaa     50040
     gctccttctg taagctcatc atctaaaata ttcttattat gtgcaggaga atttttaaat     50100
     tgttgtaata tttcacttgc agttaaattt ttatttgaat tacttccagt aacttgtccc     50160
     ccttcaggat aatcaacatg ataacttcca gtattctttt tagccatttc ttctacatgg     50220
     ttctttgtcc atgtagcata tttaccactc caactcaaag catttaatcc tttagattgt     50280
     ctataagcat taaaatcact ccataactgt tgactcatat ctgccatgta ttgaacattt     50340
     ttaggttgtt ctactggttt ttcagtaggc ttttctactg gtttttcaac aggtttggaa     50400
     ggttgtggag tttcttcagg ttgctctgct ggttgttctt ctttttcgtt attttcaggt     50460
     ttactttcag gcttattctc agaagaactg tctggcttat tattttcagt attctcaggc     50520
     ttattttcag gttttacaat tgttattgtt ccttctccag tagcagtaac atccttaata     50580
     tcctccactt tttcaacctt tcctgtttta tcatttttta ttgtaatact gcttccagca     50640
     tcttttttag agttaatgac ttttttcaca tcatcaccct tactactatc agcaataata     50700
     ttacctgttt tttgatcctt aacaattaca tttccatctt ttgtttgttc aacttcaatc     50760
     ccatcttcag gtgttgattt attagcttca ctttcattag tagcttcatc attagtagct     50820
     tcagcttcat ctgttttagt tgattcatct gttttaatat tatctttatt agcttcttta     50880
     gtatcattaa ttttctctga taatgcagta ttattagttt tattatatgt atttgataaa     50940
     attgagtaac ttacgccacc tgtaattgct attgctaaag caactgcaac tccaatgctt     51000
     gtttttttat gctcttttat aactctcatt aattctttta attttttact cattttacac     51060
     tctcccataa attatttctt caaaattaaa ttttcttact aatttaattt atccctattt     51120
     tttctactat aaaaacttaa tacttctaat ttaatctctt catcttttaa gtttttatat     51180
     tctatttctt tattttcatt tattagtttt ctaggagtat caaaagaaac tgaacaccct     51240
     atttcacttt catcttttaa aactatatca ccatttcttt tagtgttata aatacttcta     51300
     ttttttagaa taaaagcttt atctccaatc tcttttttag cttcatagtc tattgctttc     51360
     ctcgtatccc ttctactaaa agaagcttgt ctatgtattt tcctaattct ttctctatta     51420
     ggagctggta aactatcaat ccaattttta actattccct taattgtatt ttcactcata     51480
     aacataattc ttcctatgtc tttataagta taaccagcat tatataagtc cattatctct     51540
     aattgtcttt tttcatgttc acttaattca tctaaaattc tcaataaaag acccccttat     51600
     ataattttta aaaaagtata tagttcaacc taaccaaaaa aggttgtcca actttttaaa     51660
     ttttatcaat ttatgtactt ctaaagaaat tatgtacttt agaagaaatt tatgtaaatg     51720
     tactttatgc ttttataata catttttcaa aaagttttgt caataaaaac aacatttata     51780
     tattgatata ttttattttt attttatata tctatataaa aatattttta aatattctta     51840
     tataatcaca tccaggtgta ttttctctct atttatgcta aaaatgtttg taggaggtga     51900
     ttactataga ttggagcaaa ttttctgaaa atctaaaaga atatagaaaa aaacaaaaat     51960
     tgactcaaga agatttagct aaaaaaatag gtgttgctcg tagtacatta agttattatg     52020
     aacatggtag tatagaacct aatatatttg ttctaataac tctttcaaaa ttaatgaact     52080
     gctctattga tagtttaatt ggattatcta atgaaaaaat aatccctatt ccttctacag     52140
     atattaaaaa taattatgat acaaaagaaa gtgagaaaac taatgaagaa aataatttag     52200
     aaattcaaaa aataaaacaa gaatcaaaaa aaatattaga aaaagctaaa agaagttttt     52260
     ctgaattaga aatggcaaaa aaacgtactg ataagatgta tgaagatttt ataatggcaa     52320
     aaaaacgtgc tgatagaatg tataatgaat ttgaaatatc caaaagacaa gtagaacgaa     52380
     ttattaatca atttgaagtt tcaaaaaaaa gaactgataa aatgttcgaa gacctagaaa     52440
     tgtccaaaaa aaggacagat agaatgtatg aagagttatt tagaactctt aacagagaaa     52500
     aaattataaa tgattcaatt ttgaagatta aaaacttatc aaaagaaaat aaattagaac     52560
     tattaaaaga aaaagctaaa gaaaataact acgaagaatt taccaaatta aaaattttag     52620
     gcaaaatctc agctggaata cctcattatg cctgtgaaga tttaattgat actatttatt     52680
     taccaaatca attctttaaa cctaattttg aatactttgg attaagaata tttggcgata     52740
     gtatgaataa aatgtttgat aacgatttta caataatagt tagaaaaact aatagtttca     52800
     taaatggcga tatagttgta gctataattg gtgatgaagc tacttgtaag gaaataaagc     52860
     aagtagaaaa ttacatatat ttaataccac atagtacgaa tcctgaacat caaatacaaa     52920
     aatataaagc agatcaggtt atgattttag gtgtggttga acaaacaata aaaagtatac     52980
     tagataaaat agatatttag ttttaaaaat ttatattaat atttacataa ttacatgtaa     53040
     ttatagttat atgattacat gtaattataa ttatataaag actaaaaatt taaaatagat     53100
     aaatatattc aatctattca ataaccctta atttttttat gtttaacgcc tcaacacatt     53160
     catataaata tctatatatt gcttctttac tttctaaact tatgctattt gggtctatat     53220
     tcctattaaa cattatatta ttccaacact cttctataaa tttatctaaa ttcaaatttt     53280
     taaatttatt tttattttta aatccattat tactttctaa atatactttc attgcagtgt     53340
     accaatcata ctcagcacct tcatttttag ataaaaaaga aaaataatct tcttctaaag     53400
     caaaatctaa acaatctgaa aaatcataga gcatttcttt actattaatt ttttcattat     53460
     gaaatttatt tattgcttct tttactgaat tagctttaac tataatagtc gtaaattcac     53520
     ttaaaggcat attattataa ttaattatga attctttcat caaaacacct cttcattaaa     53580
     aactattttt attctgtcca ccctaataac tgctcctcta attttttata atcttgatct     53640
     ctttgtgtga agttagcatg aggacttgtc tttttattat ttatgttaaa ttcaactttt     53700
     ttaattttat ccatatcatt taaagttgct aaaatatacc ccttaaaatt tttaatttta     53760
     gtatcagtag cactagctgt tagtattgct ttagctattt tattaaaatc atatatagtt     53820
     aataaatctt taatatcatt tttctttaat ttaaacttat tattctggca tatttgtaat     53880
     aactgaataa tttgtttttt atcttcttca tcaacttctt tagaagaaga agaaatatta     53940
     ttgttattat taatactgtt actattaata ctgatactat tacttcccac attttgaacg     54000
     ctgtcatttt gagagctgtc attttgactg ttctcagaaa aactagtatt catgctattt     54060
     ttctcagcac tgtcattttg actgttctca gaaatattat ttttattatt agtttttatc     54120
     ttatcttttt gaatttcttc tttaggtttt ggtgttggga attgttctaa agtatagata     54180
     tttttatcat ttacaacttt acctgattct aatttagttc tagtttgttt tattgtgata     54240
     taaccaagat cttctaaaag ttttctatgt ttataatatc tttttcacta atacataact     54300
     cacttaattg                                                            54310
//

If you have problems or comments...

PBIL Back to PBIL home page