(data stored in SCRATCH zone)

EMBL: AP006520

ID   AP006520; SV 1; circular; genomic DNA; STD; PRO; 47890 BP.
XX
AC   AP006520;
XX
PR   Project:PRJNA13233;
XX
DT   04-DEC-2004 (Rel. 82, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 5)
XX
DE   Geobacillus kaustophilus HTA426 plasmid pHTA426 DNA, complete genome.
XX
KW   .
XX
OS   Geobacillus kaustophilus HTA426
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus;
OC   Geobacillus thermoleovorans group.
OG   Plasmid pHTA426
XX
RN   [1]
RP   1-47890
RA   Takami H., Takaki Y., Chee G.;
RT   ;
RL   Submitted (25-JUN-2003) to the INSDC.
RL   Contact:Hideto Takami Japan Marine Science and Technology Center, Microbial
RL   Genome Analysis Research Group; 2-15 Natsushima-cho, Yokosuka, Kanagawa
RL   237-0061, Japan URL    :http://www.jamstec.go.jp/jamstec-e/bio/exbase.html
XX
RN   [2]
RX   DOI; 10.1093/nar/gkh970.
RX   PUBMED; 15576355.
RA   Takami H., Takaki Y., Chee G.J., Nishi S., Shimamura S., Suzuki H.,
RA   Matsui S., Uchiyama I.;
RT   "Thermoadaptation trait revealed by the genome sequence of thermophilic
RT   Geobacillus kaustophilus";
RL   Nucleic Acids Res. 32(21):6292-6303(2004).
XX
DR   MD5; 3d8d510f14557a05445f368412b17277.
DR   BioSample; SAMD00061072.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..47890
FT                   /organism="Geobacillus kaustophilus HTA426"
FT                   /plasmid="pHTA426"
FT                   /strain="HTA426"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="isolated from the deepest Ocean"
FT                   /note="thermophile"
FT                   /db_xref="taxon:235909"
FT   CDS_pept        298..612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP01"
FT                   /locus_tag="GKP01"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP01"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74244"
FT                   /db_xref="GOA:Q5QL66"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL66"
FT                   /protein_id="BAD74244.1"
FT                   /translation="MYIERQPPFCCFYILLVFISFKSLYILGGGKILDLSRVSAIWTVH
FT                   FWCLSRTFLVVSAYIFGVQRTFLVFISYIFGCFGVHFWCPAYIFGVYLVHMFSCVRFNK
FT                   "
FT   CDS_pept        714..1865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP02"
FT                   /locus_tag="GKP02"
FT                   /product="replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP02"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74245"
FT                   /db_xref="GOA:Q5QL65"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL65"
FT                   /protein_id="BAD74245.1"
FT                   /translation="MQTPAVQPQYNSAVTKSNALIEANYKLSTIEQKIILYIISQIRKD
FT                   DADFKMYKLPIQEFSELLGYRGSPKYTELREITKNLMRKVLEIREGQKLKQLSWVSYVE
FT                   YDEHSGYVSLAFDPRLKPYLLQLKREFTTYRLKNVMELKSSYSIRMYELLKRWQYMGEV
FT                   VIRLDDLRMMVGAGDKYSEYHNFKKRVLNPAKKEIAEKTDIMFTYEEIREKRKVAAIRF
FT                   QIREKVVEPVVVALEEKKEAQADDRYLQFLAVVQAYDRYITEQQFTKIAVLAQKAFGGN
FT                   WMDELIQTARRIMQRNDIREPIAFLTYFLNEKVQRIQVGIDPNEVTIHSHGGARFVRRE
FT                   IVPDWLRGYEEQLAAESAKSKEVDEDIEQMRRELEERLKKYKD"
FT   CDS_pept        2021..2674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP03"
FT                   /locus_tag="GKP03"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP03"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74246"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL64"
FT                   /protein_id="BAD74246.1"
FT                   /translation="MHRCLKEQIIKRISDDKNNRVYIKIIKTINKRLFHLFFQQTKVSW
FT                   FEQRFHFRAGLPGWPPSGLWPSGWSLEKPGAQPLGEAACDPEPSAVHGRAKQNQGVAQS
FT                   TAAINNDVYCFIFLSDIKYWLIFDKKRQIGVAAPALPFPFGPGPRGGVMVGWQPERLSH
FT                   CKPKRRSPRLPARSSLSHRPSRPKRLRVAGVPRNAAKRAFLLIDFTIFEINGGF"
FT   CDS_pept        2876..4195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP04"
FT                   /locus_tag="GKP04"
FT                   /product="replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP04"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74247"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL63"
FT                   /protein_id="BAD74247.1"
FT                   /translation="MENLKLENMEISPLDRAKRHVWIQHRGASGWITLAKKEPDGGWRQ
FT                   YHYQPNELAVELPKWLGEDVYFSQNTFYKPQRRIENIRQLRALYVDVDCHTIGYEPEWV
FT                   VGKLDIEVFYDNILPEPNLIIFSGRGIVCVWLIEPVPYKALPLWKAVENYFYEQLSYVG
FT                   ADKRSLDPTRVFRIDGSVNSKSKREVVVEYRHGDRYVLRDLQYEYLPELTRAETGKKGR
FT                   KGKLVRLHNIQTLHYARLLDLIRLAELRNYDLKGYRELFCFLYRYWSCCLTDDPDEALR
FT                   QMIELNAGFKEPLSEKEVIRATKSAEKAWMAKNDAKANEEARKKGYPGAGYNLKNSTII
FT                   RWLDITPEEQRHLQTIIDANEKRRRKRERDRARTGELRRGQGAKTREEYLEEQRERTED
FT                   KAWQLQKAMERHPDATNKHLAMMLQISVRRVQQLKRLVKN"
FT   CDS_pept        5221..6066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP05"
FT                   /locus_tag="GKP05"
FT                   /product="late competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP05"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74248"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL62"
FT                   /protein_id="BAD74248.1"
FT                   /translation="MRKIKMLMVAVIVFMIAILPGIVTDAAPKNMYVHFINVGQGDSIY
FT                   IKAPNGEDILIDGGNKDGSDVVAYLKKQKVKDIEIMIATHPDADHIGGLDEVLKAFPVK
FT                   SVYAPKVGNTTQAYKDFLVAVKNKKLTIKVAKADVVLPIKGVTAKFVGPVKSYSTSDTN
FT                   DWSAVLKVTYGKKSFLFTGDAETRAEADMVKAKKDLRADVLKVGHHGAKTSTSATLLKA
FT                   AKPTYAVISVGKNAYGHPTSEVLNRLKSYKVKVFRTDKQGTIIATTNGTTLTFNVKPIY
FT                   "
FT   CDS_pept        6078..6293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP06"
FT                   /locus_tag="GKP06"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP06"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74249"
FT                   /db_xref="InterPro:IPR021377"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL61"
FT                   /protein_id="BAD74249.1"
FT                   /translation="MKYIIDRFEGKWAVCEAEDGKMIDIEKSKLPKNARAGDVIVQENG
FT                   NFRVDQKETEKRWKEIEELMNEVFEE"
FT   CDS_pept        complement(6498..6881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP07"
FT                   /locus_tag="GKP07"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP07"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74250"
FT                   /db_xref="GOA:Q5QL60"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL60"
FT                   /protein_id="BAD74250.1"
FT                   /translation="MCEPLSIPEDLLLGGDDNPIDRLNAEEGLVSFATPFVAHFHFLAH
FT                   TAKGAFPRHPMSPTRPLIESALHHPILQSLPFPKNVCMSALGRFLAVFFFYPVIRLSAI
FT                   GRMDTTGNRRPAVATIAATRFVP"
FT   CDS_pept        7943..9841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP08"
FT                   /locus_tag="GKP08"
FT                   /product="type IIs modification methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GKP08"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74251"
FT                   /db_xref="GOA:Q5QL59"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012186"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL59"
FT                   /protein_id="BAD74251.1"
FT                   /translation="MKPQASEEIRTMVKPKPILKWAGGKQQMLDVLLPQVPKQYNRYIE
FT                   PFFGGGALFFALTPKDAIIADSNPELINLYRVVADNVEELISILKEMKNDESFYYEVRG
FT                   LDPDLLSPVERAARTIYLNRTCYNGLYRVNRKGQFNVPYGKYKNPKICDEENLRAASNA
FT                   LQDVLIVEGDYKDVLREHARPGDFIFLDPPYLPVGKYSDFKRYTKEQFYEEDHIELAQE
FT                   VDRLHELGCYVILTNSNHPLVHELYGKYAISVHKTRRNINSDASKRTGEDVMVKVEPKQ
FT                   RIFIVPEPVKLPSQMDKYPPTRFMGSKQNLLEHIWSVASHFQFDSVLDLFSGSGVVSYM
FT                   FKTQGKQVFSNDYMAFSHYFTKAMVENSFVTLTDQDIELLFDKSTPRDNFVSETFKDLY
FT                   FNDEDNEFIDTIRANLDRLKNEYKRAIAISALVRACLKKRPRGIFTYTGYRYDDGRRDL
FT                   TLTLQQQFLEAVTQVNGAVFDNGKMSKSRYGDAMDCRQKADLVYIDPPYYSPLSDNDYV
FT                   RRYHFVEGIARNWKGVEMQWHTKTKKFKSYPTPFSSIKGAHDAFDLLFKRHQNSILIVS
FT                   YSSNSLPTKDEMLALMAKYKKRIEVVSIDHRYSFGNQGHKVGDNNNQVQEYLFVGF"
FT   CDS_pept        9863..11557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP09"
FT                   /locus_tag="GKP09"
FT                   /product="type IIs restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GKP09"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74252"
FT                   /db_xref="GOA:Q5QL58"
FT                   /db_xref="InterPro:IPR018573"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL58"
FT                   /protein_id="BAD74252.1"
FT                   /translation="MTQKAWYIGNTTVRNAKRLKDGLRVLLNSPLHGNLIGREKEQEFA
FT                   KLLHNEGIVFVKRLNDSPSSDASDVGRKWRAALMQLGFIKPFFADDPFTITPNGMRLVE
FT                   SRTMPSEQECFLRALLAYQIPSDIERSFHEPIFSPLRIVLEIIAALERRGLEAEISKHE
FT                   MASIVQLTTSLEEIDDVVNRIVRYREKLATATSARMRKELIREHLQSVVTASQSANTLM
FT                   DYADSNFRYLKLTGLFVEKGNKLRFASHKKTIIEQILEEPYTPIPESEYLETLWNGAKL
FT                   PTDNAPKAIEVIQTTAQLLTESGQTVELPNLEEMGVPDLSRLRLELEDDWLKVLEKQYA
FT                   QDQANQWQDILQYLQALTQPIRRNSIIPQGEGAAYFEWSIWRAFLAINSLCNEPWEARR
FT                   FKVDQDFLPLHPAPGNGPDMIFEFDDFVIVVEVTLTQSSRQEAAEGEPVRRHVAEIVDH
FT                   YEQHGKRVYGLFLANKIDTNTAETFRIGVWYRPDDSRMALRIVPLTLEQFIHLFETGFR
FT                   INGRLDYKLLEQVLRDCLVESNNDAPEWKRRIQQQIDRTVQRLNSIT"
FT   CDS_pept        complement(11647..13413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP10"
FT                   /locus_tag="GKP10"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP10"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74253"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL57"
FT                   /protein_id="BAD74253.1"
FT                   /translation="MITGKGIIDDFFNKKNPIDKKKILSNICKYTYIYYGIIPFASWFA
FT                   KDERGVSYEDLLWELFRSANAEETSIGAFLLLAEIKEKYPPVPIGFAQRALTIWCQRDF
FT                   KDDKVLAYVFNRFPQNRKEWIKILTDYGRFKGDIQLKWGDSSLETILHLCLTMIKGVQT
FT                   CKIEQIDYFLKPELDRSLNLLTKQIIGLVNNSEEISNHFINELLSAIPNNNLKLTTRML
FT                   AFQLLTMKKIKERVEPSHIARVFFSSSVDAPSPLGALLYNTAKEISDLAEDIPIPLKLV
FT                   ARSNRYMNEDYSQIKPEAWKEILHAFHTEIKSNHSIKKLQYPEGFTNDMIVRSLLRETK
FT                   VQSPIDPFELCDQLNILVKTVELPHNIEAFTIKSESADKGMIVLNCNFRETNRQKFTLA
FT                   HEIGHLLKHSFPNGTNVLVDERVEELLSNQYTPWNQYVNLQWERDANDFAHRLLLPTGS
FT                   IEEKQLKRIQSNFVSNISFFSKKWGISMSVLSSRLISVTDIEMILIISENGDIVFCQVS
FT                   PSWEGETVSLKNCTVPDNSLTYDFIYCEKFSYTSRPGQTNLNIWCKEADDIFLKEEVFA
FT                   TGYGKVYTFLYK"
FT   CDS_pept        complement(13433..13969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP11"
FT                   /locus_tag="GKP11"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP11"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74254"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL56"
FT                   /protein_id="BAD74254.1"
FT                   /translation="MAKQTKICACGHTVPIDFDQEQIELTGKVSDLNMLDPISYKAEAT
FT                   ELYKGIELYYYYEEDTLKFIDDGSAPKAKFKNLCESCLLETLQTDEPHYGDGVYLTQHK
FT                   QLFDNATHEEVKKSHGISYRKHRATYVCLDESVFRKIYKTGGVVRSCKHTVQTIGDKKM
FT                   VSVDDGVLFQLYLDW"
FT   CDS_pept        complement(14182..15639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP12"
FT                   /locus_tag="GKP12"
FT                   /product="transposase of ISBst12-like element"
FT                   /db_xref="EnsemblGenomes-Gn:GKP12"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74255"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL55"
FT                   /protein_id="BAD74255.1"
FT                   /translation="MANVAFGFQEAVFTLESMVANIERQAQTIEKLINENKQLRQENQQ
FT                   LKARIAELEARTKKNSTNSHLPPSSDRFGAKSPSRQPSEKRPGGQPGHQGTTLRQAPNP
FT                   DHRVLHRVTQCKGCGHSLEHVDPLQVDIRQVFDLPVVRMEVTQHEREIKRCPECRLVQQ
FT                   AEFPFYVTNHVQYGPVITSLLLYWNHAQLIPCERITEMVKTLFHHPISAGTVVNMTRRW
FT                   QPVLEAAIEEIEAALLTSSTLHVDETSLRVKGTKQWVHVASTSKETRYGIHRSRGKQAT
FT                   DDIGILPRYKGTMVHDAYSVYPMYTQASHALCHAHHLRELREYTELYQHSWSNKMAEAL
FT                   LEMKQAVEKAGGALPEEKVRYWEAVYDELLSNGRRELDERCRQGSHLGVRKAENFIRRL
FT                   EKRKQEALLFLRKKEVPFDNNQAERDLRMVKVKQKISGTFRQEDDAEAFCVIRSVVSTL
FT                   QKHGKPVWESLQRLLSGEPLQTILHSS"
FT   CDS_pept        complement(16089..17003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP13"
FT                   /locus_tag="GKP13"
FT                   /product="integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:GKP13"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74256"
FT                   /db_xref="GOA:Q5QL54"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL54"
FT                   /protein_id="BAD74256.1"
FT                   /translation="MLNEYVAYLQEKGASRNTIISYTNDLNIFFHDLHIRPDDYVTPAD
FT                   IRKWIQHMLNPEEGKPLAISTINRRLNSLRSFYAWAVEHHYIEQNPMKDIQDLKTADED
FT                   HEKIMWLTEEEFEDLLQRMRKKPVQSRGVDPEEKYRRDRAVVYLLTYAGLRVEELSNLK
FT                   LTDLDLEMKRIRIVGKGMKVRTVPISNILLAELEDWLEFRAEMAKKKPHVAASPYVFYS
FT                   QRSPKFSVRGIQRMIESYSLPNKKLTPHMFRHTFCKWMLKATNNDIEKVRRLAGHSNIA
FT                   TTSRYLKDSYSDLADAVEALPKF"
FT   CDS_pept        complement(17469..18494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP14"
FT                   /locus_tag="GKP14"
FT                   /product="molybdopterin cofactor biosynthesis protein
FT                   (moaA/nifB/pqqE family)"
FT                   /db_xref="EnsemblGenomes-Gn:GKP14"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74257"
FT                   /db_xref="GOA:Q5QL53"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL53"
FT                   /protein_id="BAD74257.1"
FT                   /translation="MEERDRVKITDRLARPLRDLRLSVTDQCNFRCVYCMPAEVFGPNF
FT                   RFLDEGQLLTVEEMALLAECFVELGVEKIRLTGGEPLLRRDLDALIERLSAIPGLRDIG
FT                   LTTNGVHLVKWSKRLKAAGLKRVNVSLDALDDDIFRKMNGIGVGAAPVLKGIEAALAAG
FT                   LGVKVNMVVKKGWNDSQIVPMAAYFKDLGIPLRFIEFMDVGTTNGWDYSHVVTKKEIYE
FT                   QINAMHPLEPVEKEYFGEVANRYRYAGTNVEVGFIASVTETFCRSCTRARISADGKLYT
FT                   CLFAADGVSLKDKLRAGAEKEELKALIAAVWSKRADRYSEERTAETAKQRPKIEMSYIG
FT                   G"
FT   CDS_pept        complement(18550..19212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP15"
FT                   /locus_tag="GKP15"
FT                   /product="binding-protein-dependent transport system
FT                   (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GKP15"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74258"
FT                   /db_xref="GOA:Q5QL52"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL52"
FT                   /protein_id="BAD74258.1"
FT                   /translation="MTEFWSPVWLSIKVSLLAGLIVVVLGTTAARWMERRRFRGKTIVE
FT                   TVFMLPLVLPPSVVGFLLVVLFGRHSPIGQLMETWFHTTVLFTPGAAVMAAVVVSFPLM
FT                   YQAAKAGLEAVDPTIEGAARIDGANERQVFWHISLPLARNALLSGAVLSFARSLGEFGA
FT                   TLMFAGNIPGKTQTIPTAVYMAMESGRMELAWAWVAVTIGLSFSLLSCAAKLGRLQR"
FT   CDS_pept        complement(19958..20767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP16"
FT                   /locus_tag="GKP16"
FT                   /product="enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:GKP16"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74259"
FT                   /db_xref="GOA:Q5QL51"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL51"
FT                   /protein_id="BAD74259.1"
FT                   /translation="MEQMKSNVVVLEGDWDHIRVEKNLDRKTATIIFDRPGKFNTISFI
FT                   ARSHFNEIFQMLDKDDDVRVIIIRGEGGVFTSGGNIMQFMERHPEELSELHKNVAAPER
FT                   SPKPVIAQLEGYAFGVGLEIAMACDFRIAAENTLLALPELNLGMIPGSGGTQRIARIAG
FT                   LGRAKDMIMRARRITAQEAYQWGLVTEVVPADKLDVAVQKLVDELLRFSPLTLKVCKEV
FT                   LNASQEAPLSSGLEIEGRAYGMLRCTEDFAEGVQAFAEKRKPNFRGR"
FT   CDS_pept        complement(20797..22356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP17"
FT                   /locus_tag="GKP17"
FT                   /product="long-chain fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GKP17"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74260"
FT                   /db_xref="GOA:Q5QL50"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL50"
FT                   /protein_id="BAD74260.1"
FT                   /translation="MDLATMFEFAVKRYPDAIAIVQENVRFTYARFDEEINKLAAGLQT
FT                   LGIEKGDRVLLVTKNRWEMVALYWAIQKIGAVFTPINFRLMSHEIEYCLRDSEAKAIVY
FT                   EPASKDEVLKATKDVSVKKIGLLNVEGAEVSYKELLRLGEEKNLIRPQIDMDDICLILY
FT                   TSGTTGKPKGVPRSHKNEYGAAVAHILQNQYVTGESTLGVMPLYHTMGMRSLLSMAFLN
FT                   GKLVMTPDYSPKKLLEEIEREKITCAYLVPTIYHDLVNHPDFTKHDLSSLTKLGYAGAA
FT                   MTTSLTKEIFEKLNPKVFVNHYGCTEVYTFTTCNYLDKKPGCAGKPGFHQDIRVVKVDP
FT                   NKEVGPDDVVAPNVPGEIIANLSSIEAFRGYWKRPDANKKAIRQGWYFTGDLGYFDEDG
FT                   DLYVVGRVDDMIISGGENIHPLEVEDVLSKHPKVYEVAVAGLPDDHWGQIVTAFIVKAD
FT                   PTLTAQELDQYCRESGKLANFKRPKKYIFVKEIPKSPVGKILRRKLKNGEYDGILDFAL
FT                   EG"
FT   CDS_pept        complement(22395..22904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP18"
FT                   /locus_tag="GKP18"
FT                   /product="carbon monoxide dehydrogenase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:GKP18"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74261"
FT                   /db_xref="GOA:Q5QL49"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL49"
FT                   /protein_id="BAD74261.1"
FT                   /translation="MIKIEKGQKVLVKLKVNGKLYEEYTESRKLLSDFIREDLGLTGTH
FT                   VGCEHGVCGACTVLVNGRAVRSCLMLAIQADGTEVNTIEGLASEEGWHPLQEEFSKCHA
FT                   LQCGFCTPGILMSAVEFLETNRNPTEEEIKEMLSGHICRCTGYHGIVKAIRQAADRIKN
FT                   TVNKVN"
FT   CDS_pept        complement(22909..23784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP19"
FT                   /locus_tag="GKP19"
FT                   /product="nicotine dehydrogenase chain A"
FT                   /db_xref="EnsemblGenomes-Gn:GKP19"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74262"
FT                   /db_xref="GOA:Q5QL48"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL48"
FT                   /protein_id="BAD74262.1"
FT                   /translation="MKPPLFDYYKPETVDQALELLQEYGINGKIIAGGQSMMPILNMRL
FT                   STPELLIDISGLQELSYIRVEDGFLKIGALTRQRDVELSPLVREACPLLSEAIPYIGHM
FT                   QTRNRGTFGGSLAHADPTAEIPMTLLALDAQAVIRSASDQRLVKMEDFFLTYLTTDLMP
FT                   EEMLTEVQIPLNEMPKGYAFTEFSRRHGDFALVAAACLLDVDKDGHITSGRLVLGGVDS
FT                   VPLAVHEAVEAMIGSVLTEELLEHSVEEAIRFLEPESDLHASSEFRKHLAKVFAMKAIR
FT                   TAYQRAQNRE"
FT   CDS_pept        complement(23817..24275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP20"
FT                   /locus_tag="GKP20"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP20"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74263"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="PDB:2PCS"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL47"
FT                   /protein_id="BAD74263.1"
FT                   /translation="MNGNGSIELKGTVEEVWSKLMDPSILSKCIMGCKSLELIGEDKYK
FT                   ADLQIGIAAVKGKYDAIIEVTDIKPPYHYKLLVNGEGGPGFVNAEGVIDLTPINDECTQ
FT                   LTYTYSAEVGGKVAAIGQRMLGGVAKLLISDFFKKIQKEIAKSKQEAS"
FT   CDS_pept        complement(24275..26707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP21"
FT                   /locus_tag="GKP21"
FT                   /product="molybdopterin binding oxidoreductase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GKP21"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74264"
FT                   /db_xref="GOA:Q5QL46"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL46"
FT                   /protein_id="BAD74264.1"
FT                   /translation="MVDHGIGKPMYRLEDVRLLQGQGQFMDDLNPLPNIHHVAILRSPY
FT                   PHARIKAIRTDKAALVPGVKGVITGSMVASLSRPFPVGVTAPVKYYSLAVDKVRFVGEP
FT                   VAVVVAKNRYIAEDALEKIEVEYEPLPAVVDIERAMEEDAPLLHEEVGSNIANQRTFHY
FT                   GDVEKAFQEADYTISHKFLFPKYSATPMETYGVIANYEKSTNSYTVWANFHGPFTLHSV
FT                   MAAALQVPGNKLRIITPKDNGGSYGIKAGIYPYVVLMAIASRVAGVPVKWIEDRQEHLA
FT                   ASSSGTDRVTYIEAAFNKDGTVTALKMKMIDNVGGYIRAPEPACLYRNHSNAVGPYRIR
FT                   NLYMEAYAVMTNKCPTGLIRGYGGQEHYFPIERTMQMIAEKLGMDPAEVIRKNLIRADE
FT                   FPYKTPSGGIYDSGDYHKAFELLLQVGKYHELREYQKKAKADGKLFGIGLACIVEPSGS
FT                   NMGYITMALTPEERAKSLPKSGCAEAATVMIDPSGSISVRISTTPSGQGHETVAAQIVG
FT                   EVLGVNPRDVQVVAELDTLTSPWSVASGSYSSRFAPIGSSAIYQAAQKVRQKLLKIASG
FT                   ILSTSEEDLDLSQGKVVVKGNPEKSVSIKRLAGLSHWHPQGLSEGVEPGIFETAYYTVH
FT                   TANPPDKNEFVNSSVTYGFVADLVAVEVDPDTGEVKILDYYTVHDAGKLLNPLIVDGQI
FT                   YGGLVHGLGGALYEELSYDKNGQFLAGTFMDYLCPTATEIPPIHIHHIETPSPFTPLGA
FT                   KGLGEGNCMSTPAAIANAVADATDCIIDNLPLSPNRVWNLLQKKRQEQEKVYIRGDH"
FT   CDS_pept        complement(26726..27328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP22"
FT                   /locus_tag="GKP22"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP22"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74265"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL45"
FT                   /protein_id="BAD74265.1"
FT                   /translation="MKVWAVILAAGVSKRMGYPKTLLPFNGKSIIRHVIKKALSSNVDG
FT                   IIAVINPNVRGLEQEVKETGVKVVINQYAENGMSSSLWNGLKALPNEVEATLILLGDQP
FT                   GVDPWVINKIIKTYEETRSKIIQPTYQGIPGHPVLFDQSLFPYLYEVRGDQGGREVIQK
FT                   FLSERVLIETGQSLLKDIDTWEDYIQLIKSSNQKIGS"
FT   CDS_pept        complement(27372..28472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP23"
FT                   /locus_tag="GKP23"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP23"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74266"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL44"
FT                   /protein_id="BAD74266.1"
FT                   /translation="MLDILNFMEECWKQKKSAALATIVHVEGSSYRREGARAIVSLEGK
FT                   IIGSISGGCVESDLQERAARVLTSGQPEIVRYDFRGDNDSIWGMGVGCNGAVTVFIEPL
FT                   DPRNDPENMKRIMDDFRKLRDGNESVFLLQVIESEDHKHLKPGTRLRYLPKGISVQSLL
FT                   YEFKLKGKESGLIRLLYFDSNVMDREIPCTLYVEQMKPIPRLVIFGAGPDVAPLVKLAK
FT                   SLQWLVTVIDHRPAYANKSNFPEADRIILVPRGKFPDNLCFDQETYAVVMSHHFEQDQL
FT                   YLNELLKKPIPYIGMLGPLKRTAKLLNISESDVSKIERLHGPVGLDLGGETPEEIALAI
FT                   LAEIIAVRQKGSCRPLKQKKGPIHRK"
FT   CDS_pept        complement(28679..29455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP24"
FT                   /locus_tag="GKP24"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GKP24"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74267"
FT                   /db_xref="GOA:Q5QL43"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL43"
FT                   /protein_id="BAD74267.1"
FT                   /translation="MSDLLIIDSDDKARIDIRKKIEDSPFHYLNIHEASMAREGLQLIK
FT                   QIQPCVIIMDISLKDEDGISFGKSVIQLYPAIRILIVSHLQMFEIVQSAINAGFSGYYL
FT                   KPISRTELLSGLERILTPSLDTMKTKANQHYGKGMESIDLANPIESALRYIQDNYHLPL
FT                   TLNEVASMVYLSQSHFSRLFKSATGMTFVEYLTQVRIQKSKYLLKMSSLPIDVIAHKTG
FT                   FSNASYFATTFKRLEGKTPTEYRELLQKIYPKTGNK"
FT   CDS_pept        complement(29487..31013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP25"
FT                   /locus_tag="GKP25"
FT                   /product="4-chlorobenzoyl CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GKP25"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74268"
FT                   /db_xref="GOA:Q5QL42"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL42"
FT                   /protein_id="BAD74268.1"
FT                   /translation="MNLSIVFENAVSRCPKKVALIEGDRQYTYGELEEHVWRVASAFQR
FT                   LGIRQRDRVMVLLKNRIETVVIFFALQKIGAVFAPVNPYMSFEIIKYCANDLEAKVIIY
FT                   EGDGQNWIKKIMFNDRPILISLEDDSHSDLTYQELINYKREHFEEPIISDDDIALILYT
FT                   SGVTGTPKGVPRSHMNEYSSTIAHIFQTRLDMGEVCLGAVPFYHTMGMRVLLSTIMLAG
FT                   KLVILSDFDPIDALKSISKEKVTSLYLTPTMYHDIIHCSKLGDYELSSVNKLAYAGAKM
FT                   TKALTDKCFSTFNPKHFVNHYGSTEIYTYTTCSELNEKPESAGKPGIHQNIRVVRADPF
FT                   GNATIDDLVQPEEVGEIIVNMNSPEAFKGYWNRPDLTKKAIRNNWFFTGDLGFFDQAGD
FT                   LYVLGRIDDMIISAGENIYPMEVEEVLTQHPQVADCAVIGEPHERWGQIVVALIVPKEP
FT                   GLNAQELDRFCMQHEKLPNFKRPRKYIFVPEIKRTVTGKVLRNQTLQHEA"
FT   CDS_pept        complement(31350..32228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP26"
FT                   /locus_tag="GKP26"
FT                   /product="ribonucleotide reductase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GKP26"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74269"
FT                   /db_xref="GOA:Q5QL41"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL41"
FT                   /protein_id="BAD74269.1"
FT                   /translation="MSVNQNEVNIDQELEALQDLSHESEESPKALAWKLYQMAIRFGTW
FT                   NPQEIDLSEDKKHFKQLDEQRRAYLIHFCTGFWNAEENVALKFCPWIMIAPSIEQQAFL
FT                   STQLVDEFKHTEFFIRYFAEVLQTDREVKVLNLVHDTLDERARQLLSVLDKGPEEREIA
FT                   MLEGLVHYQGVIEGIQAMVGYEVFEAVYGQYGLFPGLKEGFKQIKRDEGRHVGYGLRMM
FT                   KYLSKNPSYAKRIKELFEEFLPKILVRYDQEIVVNGKRYDIPAEVNGKERLTRMYQRRL
FT                   KDIFGLEANLV"
FT   CDS_pept        complement(32360..33697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP27"
FT                   /locus_tag="GKP27"
FT                   /product="permease (proline/betaine)"
FT                   /db_xref="EnsemblGenomes-Gn:GKP27"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74270"
FT                   /db_xref="GOA:Q5QL40"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL40"
FT                   /protein_id="BAD74270.1"
FT                   /translation="MDNITKTNIERPVEVSIKNSQMVRATIASLIGWALDLYDLFLLLY
FT                   VATTIGNLFFPASNQTLSLAAVYASFAVTLLMRPLGSAIFGVYADKNGRKKAMTVAIIG
FT                   AGLSTTAFGLLPTIHQVGVAASIAFLILRLVQGIFVGGVVASTHTIGTESASPKYRGLM
FT                   SGLIGGGGAGLGALFASIAYSIVSAIFPGDAFDTLGWRIMFFTGIIGALFGLFIFRSLD
FT                   ESPLWKQLKEKQSKDKMVEQQKSPFKMFLTKYYKVLFVNLMIVIGGGSGYYLTAGFIPT
FT                   FLKVVNKVPAAVSSGVLIATSITTILAAIVVGHLSELIGRKKTFMIIGILCVFGLPYFY
FT                   LSLAHSTTTTSIYLNAIGLVFLGNASYAPVLIFLNERFPTEVRSTGTGLSWNVGFAIGG
FT                   MMPTFVNLASGTVEHIPYTLMYFTIVIYLVYILGSFIIPETKGNLK"
FT   CDS_pept        complement(34145..35551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP28"
FT                   /locus_tag="GKP28"
FT                   /product="4-hydroxybenzoate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GKP28"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74271"
FT                   /db_xref="GOA:Q5QL39"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL39"
FT                   /protein_id="BAD74271.1"
FT                   /translation="MRAKTFRTWLEYMQSTERLAVIDKRVKLKYEVASIAKKLDGKKAV
FT                   YFTQVEDYSIPVVSGICTTRQQFAEALETDQSGLIPKFIQAVSNPLPYRLVDKKDAPVK
FT                   ENVILKNIDLMEILPIPIHHEKDSGHYITAGLLIVRDPLTRKQNVSIHRLQVSSKDRLG
FT                   ILILPRHTFHLYRQAEEAGKPLECAIAIGVDPITLLASQASTPFGIDELEIASALRGEP
FT                   LEVVRCETVDIDVPAHAEIVLEGKILPRVREPEGPFGEFPKYYGSRSDKEVVQITGITH
FT                   RNHPIFHTIVPAGYEHLLLGGIPREASLFQSVKQTVPSVKSVHMSLGGTCRYHAIISIK
FT                   KRNEGEAKNAILAAFANSFDIKHVVVVDEEIDIFNMEEVEWAIATRFQADRDLIVIHGA
FT                   QGSKLDPSTNNGVGCKMGLDCTVPLDSEPMKYLRIEIPGYNDLDVDEYINQESTGLKPE
FT                   HLEKNNAASI"
FT   CDS_pept        35731..36264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP29"
FT                   /locus_tag="GKP29"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-terminal region of transposase (455 aa)
FT                   of Thermoanaerobacter tengcongensis (GKP29 divided by frame
FT                   shift is possibly continued to 37,165 bp)"
FT                   /db_xref="EnsemblGenomes-Gn:GKP29"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74272"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL38"
FT                   /protein_id="BAD74272.1"
FT                   /translation="MLPQLLAYLLQIIKTQYQIIVYLMGVIVGKSLNRKDLDEPVQKPY
FT                   RKLQVDDLPIIDVPETLDYRKLLADYEAQHGRPLRPIQRRANAKHRVPDSLTCPRCQAP
FT                   SSYLYANNGGKGQYQCKVCQCRFNHRNRFTNASGLSLPALQKDAGKDQRNAKNTTSISA
FT                   RTTIARFTRPTFAG"
FT   CDS_pept        complement(37453..38628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP30"
FT                   /locus_tag="GKP30"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GKP30"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74273"
FT                   /db_xref="GOA:Q5QL37"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL37"
FT                   /protein_id="BAD74273.1"
FT                   /translation="MVGHYIQKEVEFEFSFHLPTSIQFGYGKASQLGNQLVDMGIKSAF
FT                   LVTDRGVEATGLLAGIIQSLESSNIQYCVYADVEPDPSLETIDQGAAAFKEQPFDCIVA
FT                   IGGGSPIDTAKGIRVVATNGGSIGDYAGVNRIKKKSEIPLIALPTTSGTGSEVTIFGVY
FT                   SDWKNNVKVTVTSPYMAPEIALVDPKLTMSLPKKITAASGIDALAHGIETFFSLRSQPI
FT                   SDVLAIEAMTTVNRYLRRAVEDGTNKEARIGMSYGSLLAGMAFNNGFLGLAHAIGSALS
FT                   GHCHVSHGVAIGLLLPKVVEFNSVVQPEKAAKIAELLGRKGNQNTLVQQAALAVASLVK
FT                   EIGLPTRLRDVDVPKEKLPDIAKDSFKSGMMRFNPRQPSEAEVMTLLQQIY"
FT   CDS_pept        complement(38672..40138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP31"
FT                   /locus_tag="GKP31"
FT                   /product="glycine betaine aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GKP31"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74274"
FT                   /db_xref="GOA:Q5QL36"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL36"
FT                   /protein_id="BAD74274.1"
FT                   /translation="MEIITSKEVPVYYNYIGGEWIESLSKELIESYNPATGELISYAQN
FT                   STVEDVTQAIDATCQSFKESDWSVNPKKRYEALLSLAQKMSENMERLARLLTIEQGKTI
FT                   RESRVEISGCIDTLKYFAGAARAVFGRSIQLEPKNFGVIVKEPIGVVGIISPWNWPALL
FT                   MIRELAPALAAGNAVIVKPASLTPSIAVEIFKLIDEISYFPKGIVNIVTGPGSSIGAAL
FT                   ASSKKIDMISFTGDTSTGKKIMEMAASNIKKLALELGGKSPNIVFDDADLDKAIPIIGR
FT                   SIFISAGQICMAGSRVLIQESIKDEVIDRLKDYAESLRVENGLLETSDMGPLVSQNQLD
FT                   IVQEYCDIGRQEGTIITGGHRLTGGDYNKGFFFAPTIISDLESDCRILREEIFGPVLAV
FT                   QTFSNEDEALRIANDSDFGLSAGVWTTNLNRAMKMSQGIKAGTVWINTYNKNFPEAEFG
FT                   GYKQSGLGRTRGIDGLMEYCETKHVHLEID"
FT   CDS_pept        40548..41168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP32"
FT                   /locus_tag="GKP32"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-terminal region of hypotheical protein
FT                   (450 aa) of Streptococcus gallolyticus"
FT                   /db_xref="EnsemblGenomes-Gn:GKP32"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74275"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL35"
FT                   /protein_id="BAD74275.1"
FT                   /translation="MKHLTTEWPLLKELEEQLVRTLQKVFAVLLAALLEEIDQQLAEAR
FT                   DKRRYQLKDKRPTTIQTLFGEVTFRRNYYYDRQAGAYTFLLDAELGFDGAQSISPCLEE
FT                   TAVELAVECSSYRKAAHTLESIVGYAVMSHEAIRQLVLEAPVSLHHPVSQRHGRVLFVE
FT                   ADGLCFPPGERETGERRENPGDSRGMETKRFAARAREPAPLPP"
FT   CDS_pept        41041..41955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP33"
FT                   /locus_tag="GKP33"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP33"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74276"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL34"
FT                   /protein_id="BAD74276.1"
FT                   /translation="MDSVSRQGKGKRAKEEKILAIHEGWKRNGSQLELVNRRHYLHEGA
FT                   GDVWERFEEWLMNEYAYDPCRDLLIINGDAASWITACREYFGKRACFQLDRFHVARELR
FT                   QCLVRPSALAGGAEEAGETRRRGASRGAEQRGRHVGGRSEREADGCHDPPDRVDAGMHP
FT                   GLSGVAVGARGGDDRHASDGPRRERDEPVCASGEIPPQLERPRASGVSEGDGGPNRRDL
FT                   AEKWAVGGGRRDPNGGLGLNKVQADRTGQTEGRTVMGRCGASESTVSAAVIRDTDPSSV
FT                   VGAPGWWLGVKKWNIVSSPQDEG"
FT   CDS_pept        42197..42739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP34"
FT                   /locus_tag="GKP34"
FT                   /product="phenylacrylic acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GKP34"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74277"
FT                   /db_xref="GOA:Q5QL33"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL33"
FT                   /protein_id="BAD74277.1"
FT                   /translation="MGMSGATGAIFGIRLLESLKDIGVETHLILSKWAETTIKLETNYS
FT                   IEDVKKLASVVHSSTNQAASISSGSFRVDGMVIAPCSMKTLAAIRMGYSENLLSRAADV
FT                   VLKERKKLVLLTREMPLNDIHLENMLFLSRMGAVILPPVPAFYNLPSSIDDIVNHIVAR
FT                   TLDQFGINNELTKRWKT"
FT   CDS_pept        complement(43383..43670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP35"
FT                   /locus_tag="GKP35"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP35"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74278"
FT                   /db_xref="GOA:Q5QL32"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL32"
FT                   /protein_id="BAD74278.1"
FT                   /translation="MSKVDDIKNMKRQQKVITPTQVLTDPVGEENNTVLNEDDNQPRKE
FT                   GKKVERKRVSFDIRTDLHKELKMQSILQEKNIYLLIEEALEKYLNELKNN"
FT   CDS_pept        complement(43654..44451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP36"
FT                   /locus_tag="GKP36"
FT                   /product="chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP36"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74279"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL31"
FT                   /protein_id="BAD74279.1"
FT                   /translation="MAITITMGIQKGGCGKSTTTGVLAYLLSRDGYRVLAVDMDSQGNL
FT                   TELLSRKPSNEFTEKSVLEAMQERDPEPYIVKVNDRLDLLPANNFLATFPRWIYTGETY
FT                   LGKYIRYKGKPTLILDDTLDKIRHRYDFIVIDTPPSLSEQTTNALCASQYVIMMFECSN
FT                   WCYSAVPNFMESVEGARVHGRHNTRLLGILRTMNDVRRNDAKAFNEMIEEDYPNEVFKT
FT                   IITRKAPIGRLSLYGFEENNELNQALEQYENFYKEMMERVQSR"
FT   CDS_pept        complement(44556..44972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP37"
FT                   /locus_tag="GKP37"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP37"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74280"
FT                   /db_xref="GOA:Q5QL30"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL30"
FT                   /protein_id="BAD74280.1"
FT                   /translation="MMAMMEGRCYERHDFQVLVLQEFGKRRPRSPEETKRLQEEYLRLL
FT                   EEIPRMWEEFVEKHKNIYERFGYLDVVVHDDLRVERKKLQRGRPKEEKSKSYRITVRLD
FT                   DELYELLQKYCQTKNMSESEAVRQLISELKWKRF"
FT   CDS_pept        45260..45790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP38"
FT                   /locus_tag="GKP38"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP38"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74281"
FT                   /db_xref="GOA:Q5QL29"
FT                   /db_xref="InterPro:IPR010461"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL29"
FT                   /protein_id="BAD74281.1"
FT                   /translation="MDWKEVKRFAYAGQAFIPVNVENRGDSVKLFFRSGETKLLDVQSS
FT                   LFLKRLLTFFGTSISINRHRYGELVGKKQLVPIVLSYGFTIIPFNVREPVGRQSRVGWF
FT                   VSREIEQFRQRSPQCTTIHLLSGHQIPVFHSRKFCIDQLKNAKWIEMCYGEIHEPHRRQ
FT                   WINGSAVCETVVM"
FT   CDS_pept        complement(45941..46396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP39"
FT                   /locus_tag="GKP39"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP39"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74282"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL28"
FT                   /protein_id="BAD74282.1"
FT                   /translation="MTDALWQLDVLRFAFNDAGALRAHQLPVAGHKNICRYELVHHRFH
FT                   LHRINRLLGIADQNPRRPRLSVKRQFQRLHCSFPLSSCIDNMAGQRRAHVPQAAARQAG
FT                   DGGGGIIKRLDTCVALHSEGLRADDVLSVAVLSGVEVQNKSAARHHF"
FT   CDS_pept        46449..46595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP40"
FT                   /locus_tag="GKP40"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GKP40"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74283"
FT                   /db_xref="InterPro:IPR024419"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL27"
FT                   /protein_id="BAD74283.1"
FT                   /translation="MDLFSMISEVSFPILVSIYLLYRMETKLDQLTKSIQDLTIALSRG
FT                   PQN"
FT   CDS_pept        46615..47085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP41"
FT                   /locus_tag="GKP41"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-terminal region of phagelysin (287 aa)
FT                   of Listeria innocua"
FT                   /db_xref="EnsemblGenomes-Gn:GKP41"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74284"
FT                   /db_xref="GOA:Q5QL26"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL26"
FT                   /protein_id="BAD74284.1"
FT                   /translation="MELVELLFRAEKRLSGLHPLVADKARALIRKAYEEGIYIIITQGF
FT                   RTVEEQNRLYALGRTKPGRIVTNARGGYSYHNFGLAFDVCVCNVFKGTLIPSWSLDRRW
FT                   FRVGQIGKSLGLEWGGDWKSFKDYPHFQYTFGLSLAQLRAGKRPPAAVVAKK"
FT   CDS_pept        47267..47836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GKP42"
FT                   /locus_tag="GKP42"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:GKP42"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74285"
FT                   /db_xref="GOA:Q5QL25"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QL25"
FT                   /protein_id="BAD74285.1"
FT                   /translation="MHTVQPIKDREKIEAMKKILRASSLRDELLFTIGINTGLRISDIL
FT                   ALRVGDVRNQKGVVERIEIVEKKTKKTRVVALNRKTRRLIELYLAQERPHARGDEPLFR
FT                   SQKGGRAISRQHAHYILNRAAKAVGIVDRIGTHSLRKTFGYFAYKQGTDLAMIQKILNH
FT                   SSQAETLRYIGITQEQIDEVTAGLDL"
XX
SQ   Sequence 47890 BP; 13146 A; 10775 C; 10369 G; 13600 T; 0 other;
     ggccggagcc tagggaagcc cggcgctcag ccgctcgaag aagccgcttg cgatctagct        60
     ccttccgttg tccgcggtcg tgcgaagcaa gatcaagagg ccgatcaaag tggcgctgtg       120
     gaagaaaaaa tcaaaacttg ccgtaaaacg tcgttaaacg gcttattttg gcgttttgaa       180
     gcttgggggg tagaaaacca ttaacccatc aaaaaaagcg tctcatacgg gccgtacaag       240
     gcctaggaga ccttgtttgt ttttcctctt cagcacagca agatatatta aacccttgtg       300
     tatattgagc ggcagccccc tttttgctgc ttttatatac ttttagtatt tatatctttt       360
     aaatctttat atattttagg agggggcaag atccttgatt tatcaagggt ttcagcgatt       420
     tggacagtac atttttggtg tttatctcgt acatttttgg ttgtttcggc gtacattttt       480
     ggtgtccagc gtacattttt ggtgtttatc tcgtacattt ttggttgttt cggcgtacat       540
     ttttggtgtc cagcgtacat ttttggtgtt tatctcgtac acatgttttc ttgtgtacgc       600
     tttaataaat aaagcgtaca tgtacgaaaa aatgtacttt ttaacgtgag tgttttcttg       660
     tagaatagga tcaaggagtt attttcctaa tttagtaggt ggaggatgag aggatgcaga       720
     ctccggctgt ccagccgcag tacaacagcg ccgtgacgaa gtccaatgcg ctgattgagg       780
     cgaactataa gctgtccact atcgaacaga agatcatctt gtatatcatc agccagattc       840
     gcaaagatga cgccgatttt aaaatgtata agctgccgat acaggagttc tctgaattgc       900
     tgggatatcg gggaagccct aaatacacgg agcttcggga gatcacgaaa aatttgatgc       960
     gcaaggtgct tgagatcaga gaaggccaga agctcaaaca gctgagttgg gtttcatacg      1020
     tggaatacga cgagcattcc ggctatgtca gcttggcctt tgatccccgc ttgaagccct      1080
     acctcctgca gctgaaaagg gaatttacga cctatcgcct gaagaatgtg atggaactga      1140
     aaagctctta ctccatccgt atgtacgagc ttttaaaacg ttggcagtat atgggcgagg      1200
     tcgtgattcg tctggatgat ttgcggatga tggttggagc aggggacaag tattcagaat      1260
     accacaattt caaaaaacga gtgcttaatc ccgccaagaa ggagattgcg gagaagacgg      1320
     acatcatgtt cacatacgag gagataaggg aaaaacgcaa agttgcggcg atccgctttc      1380
     aaatcagaga gaaagtcgtt gagccggttg tcgttgcctt ggaagagaaa aaggaagctc      1440
     aagcagatga tcggtatttg cagtttttgg ctgtagtgca ggcttatgac cggtacataa      1500
     cagaacagca attcacgaag atagcggtct tggctcaaaa agctttcggc ggaaactgga      1560
     tggatgagct cattcaaacg gcaaggcgca ttatgcaacg caatgacatc cgcgaaccaa      1620
     ttgcttttct gacctatttc ttgaatgaaa aagtgcaacg gattcaggtc gggatcgatc      1680
     caaatgaggt gaccattcac agccatggag gcgctagatt cgtccgccgc gagatcgtgc      1740
     cggactggct ccggggctac gaagagcagc ttgctgccga aagcgccaaa agcaaagagg      1800
     ttgatgaaga tatcgaacag atgcgacgtg agcttgagga gcggttaaag aaatacaaag      1860
     actaagtcca gcccgcgccg gtcttcccgg ctgaccgcct tctggccttt ggccatccgg      1920
     ctggagcctg gagaagcccg gcgctcggtt cattcgaaga agttgcctat gggcccattc      1980
     atccgcagcc gtgcgaagcg tgaccgaaga agccaatgca ttgcaccgct gcttgaagga      2040
     acaaatcatt aaacgaataa gtgatgataa aaataataga gtatacatta aaataattaa      2100
     aacaataaat aaacgtttat ttcatctttt cttccaacaa acaaaagttt cgtggttcga      2160
     acaaagattc catttccgcg ccggtcttcc cggctggccg ccttctggcc tttggccatc      2220
     cggctggagc ctggagaagc ccggcgctca gccgctcgga gaagctgctt gcgatccaga      2280
     accttccgct gtccacggcc gtgcgaagca gaatcaagga gttgctcaaa gcaccgccgc      2340
     gatcaataat gatgtttatt gttttatttt tttgtctgac attaaatatt ggttaatttt      2400
     cgacaaaaag cgacagatag gtgtagctgc accggcgctt ccgtttcctt ttggtccggg      2460
     tccccggggc ggtgtgatgg tcggctggca gccggaaagg ctcagccact gtaagcccaa      2520
     gcgccgaagc cctcgccttc cggctcggtc cagcctatca caccgccctt cccggcccaa      2580
     aagactacgg gtcgccggtg ttccaagaaa tgcagccaaa agagcatttt tgttaatcga      2640
     ttttacgatt tttgaaataa atggaggatt ttgaaataaa gtgtcgaaat tcaagaccgc      2700
     cagagtcctc tcctattcaa taggcctcga ttgatcctca tggcattctt attttccctt      2760
     tttctatttg aatggtgtgt aaattttgaa gaaacggccg ctgtctttct gcataatgat      2820
     cgtacctcgc acccgcgcga ctatgcggtt gtttcccatg tagggagggt gttttgtgga      2880
     gaatttgaag ctggagaata tggaaatttc ccctttggat cgcgcaaagc ggcatgtatg      2940
     gattcaacac cgcggcgcct caggatggat cacgctggcg aagaaggagc cggatggggg      3000
     atggaggcag tatcactacc agcccaacga attggctgta gaactgccta aatggcttgg      3060
     agaggacgtc tattttagcc agaatacctt ttataagcct caacgaagaa tcgagaatat      3120
     aaggcagctg agggctctgt acgtggatgt ggattgccat acgattggct atgagccgga      3180
     gtgggtggtc gggaagctgg acatcgaggt attctatgac aatatcttgc ctgaacctaa      3240
     tctcatcatt ttctcgggtc gcggaatcgt atgcgtttgg ttgatcgagc cggtcccgta      3300
     caaggccttg ccgctgtgga aggcggtgga gaactatttt tatgagcaac ttagctatgt      3360
     gggggcggac aagaggtcgc tggatccgac cagggtgttc cggatcgacg ggtcggtcaa      3420
     ctccaagagc aaaagggagg tcgtcgtcga gtaccggcac ggcgacaggt atgtcctccg      3480
     tgacttgcaa tatgagtact tgccggaatt gacaagggcg gagacaggga agaaaggaag      3540
     aaaagggaaa cttgtccggc tacataatat ccagacgctg cactatgcca ggctactgga      3600
     tttgattcgt cttgcggagc ttagaaatta tgatctgaag ggatacaggg agctgttttg      3660
     ttttttatat cgatactgga gttgttgcct cactgatgat cccgatgagg cgctgagaca      3720
     gatgatagag ctgaacgctg gatttaagga gccgctgtct gaaaaagagg tgatccgggc      3780
     gacaaaaagc gccgagaaag cgtggatggc taagaatgat gcgaaggcga atgaggaggc      3840
     gaggaaaaaa ggctatcccg gcgccggcta taatctgaag aactctacga tcattcgatg      3900
     gctggacatc acgccggagg aacagcgaca cttgcagacc attattgacg ccaatgagaa      3960
     gcgccggcgg aaacgggaac gcgacagggc gaggacaggg gagttgcgcc ggggacaagg      4020
     ggcgaagaca agggaggagt acctcgagga acaacgggag cgaacggagg acaaggcatg      4080
     gcaactgcag aaggcaatgg agcgacaccc tgacgcgaca aataagcatc tggccatgat      4140
     gcttcagata tcggtgcggc gtgtccagca gcttaagagg ttggtcaaga actgacgttc      4200
     ccgtgaaatg gttcgtcgcc cttatattat gggcgtcagc ctgcttgctc ccgcgaccat      4260
     aaagaaagaa taaaccaaat tggttttgtt ccaatacctc attagattgg tggggggagt      4320
     cccgagggtt ttaaacttca gattttcact tcgatgaagg gtgaaatgca agcggatcgt      4380
     cgcaaaaagg atggtaaaag ggattttaaa gattgatttt ggacgcatag ctgcaaggtg      4440
     aaaatgccag ttagtagtta ttataaaggg gataggttta ttgattagat tttgattggt      4500
     gatgatatga ttatttagaa catgattctc aatgcaaatt caccaataag ataaaaattc      4560
     tgcttagaat caggggagcg aatgaaggtg aggacaccag agtgacgcag aggacgctat      4620
     gatgaaatat tgcaaataaa agacgaggac aagggacgtg tctctgctcc tcgatcgatt      4680
     agaaatctat acaactaaga catgcaaccg cgtaaaggtg tcgcgacaga tgtcccgatg      4740
     gattagcggc cgccggagac gatggacaat gaatcgcgac agaccgaaat aataaacgtg      4800
     tctcccatga caatatggac agtgggtgtc cccggtcggg ggattctgag gacacagcat      4860
     atcatcgtgt cttgaaaaaa cgagcttaat ttattttttg tcagacaaaa aattaaacac      4920
     tttcattatc atgatcatca agtaaaaacg gatacttcag caacatatgt tgaaatgttc      4980
     ctttgtcttt gaatgggagg aatttacggg acaaattttg atagtagcat ctctggtgga      5040
     tgattgtatt gattatatcc aagaacactt tatcgctagg gcggacaatt tttgagcata      5100
     ccggacacct tagtcttccg ataatatcga acattttttc gcctcctgtt tgttttctat      5160
     actccctctt agctcaattg atggtataat cttcttgaaa agtaaaaggg ggagttttca      5220
     atgaggaaaa tcaagatgct gatggtagct gtaattgtat ttatgatagc aatactaccg      5280
     ggaattgtaa cagacgcagc cccaaaaaac atgtatgtac acttcatcaa tgttgggcaa      5340
     ggtgacagta tttacattaa agcgccaaat ggagaggaca ttctcattga tggaggaaat      5400
     aaagatggca gtgatgtcgt cgcctatctt aaaaagcaga aggtaaagga catcgaaatc      5460
     atgatcgcga ctcatccaga cgccgaccat attggcggtc ttgatgaggt tctcaaggct      5520
     ttccctgtga aaagtgtgta tgctccaaaa gtcggtaata caacgcaagc atataaagat      5580
     ttcttggtcg ctgtgaaaaa taagaaactt accatcaaag ttgctaaagc agatgttgtt      5640
     ctgccaatca aaggtgtgac tgcgaagttt gttggccctg taaaatcgta cagcactagc      5700
     gatacaaatg actggagcgc tgttttgaaa gtaacctacg gcaaaaagtc gtttctgttt      5760
     acaggcgacg ccgagactcg agcagaagcg gatatggtta aagcgaaaaa ggatttgcgc      5820
     gctgatgtgt tgaaagtagg tcatcacggt gcgaaaacat cgaccagcgc aacgctttta      5880
     aaagctgcaa aaccaacata tgcggtaatt tcggttggca agaatgccta tggccatcca      5940
     acatcggaag ttttaaatcg gttgaaatct tataaagtca aggtattccg taccgacaaa      6000
     caaggaacga ttatcgcaac aaccaacgga acaacgctta ccttcaacgt aaaaccaatt      6060
     tattaagagg tggttaaatg aaatatatca ttgatcgctt cgagggtaaa tgggcagttt      6120
     gtgaggcgga ggatggcaaa atgatcgata ttgagaaaag caagctaccc aaaaacgccc      6180
     gcgccggcga tgtgattgta caagagaacg gaaatttccg agtggatcaa aaagaaacag      6240
     agaagcggtg gaaagagatt gaagagttga tgaatgaggt gtttgaggag taacacctca      6300
     tttttttata taaacgattt tcccaaaaca agggagcgct gaggcgttct ttgtctctgg      6360
     catgggaaac ccctgtctgt tagagtcatc ttctgtcctt cagtgagagg cgtgtggcga      6420
     ctaatgatgg gtggttggcg gctcgtcatt gtaatgatgg agaagatcaa ccttcgtgga      6480
     ctcaatcgtg gactcaatca aggtacgaag cgagtggccg ctatcgtggc gactgctggg      6540
     cgtctgttgc ccgtggtatc cattcgtccg atggctgaaa gccggatcac tggataaaag      6600
     aagaacaccg ctaaaaaccg acctaatgcg ctcatacaga cgtttttggg gaaagggagg      6660
     ctttgtagga ttggatgatg cagggcagac tcaatcaagg gacgcgtcgg agacatagga      6720
     tgtcgcggaa atgccccctt ggctgtgtgg gcgaggaagt ggaagtgcgc tacaaacggt      6780
     gtggcgaagg ataccaagcc ttcttcagcg ttcagccggt caatcgggtt gtcatccccg      6840
     ccgagtagca aatcttccgg tatggacagc ggctcacaca agacttcatc gatgcccttg      6900
     acggacgaca tgtgtctcgg ttcagtgaga cgcgattgag cggcaacggc accgaatcat      6960
     cggataatgc cagcgcccct tgacgcaact gtccgtcttg ttcccacaaa acgagccgga      7020
     cggtaagcgt cgggattagg ggcgtgatgt cattgacgtc acgaaacgcc ggatgggggg      7080
     gagaacgaga caccatgggt atccttcgtg gcggcgtctg cctcctcctg aggacatccc      7140
     agagtcaaca caggacatcc acacgacccc cagagtgtgc ggtgacacgg ccagccagga      7200
     caaatcgacc tccggctttt tcggtggcgt cggagttaac cggggtcaaa ccagtaaacc      7260
     aacaatgtca ccctgatata ttgctgtttt ttctcccttt tccacataca acaatattaa      7320
     aactttagca acgcctccac cgcatccgcc aaatcactgt agctgtcctt taagtaccgc      7380
     gatgtggtag cgatatggct atgaccggct agccggcgca ccttttcgat atcgttgttc      7440
     gtcgctttta acatccactt acaaaacgta tgccggaaca tatggggcgt gagcttttta      7500
     ttcggcagga tgtagctttc aatcattctt cttcaacaca tagacacgcg tatgtacgaa      7560
     ggtaaatgat cacatggacg catcggtatt tatgtagtgg gattttgggg gataaatcca      7620
     gtgaaaaagt ggataactgg tttgtataat aggggtatca cttgatattt tgggggacgt      7680
     gttttatgcc tacctttcag tttggaacga cagcgattga gtacacattg caacaggtga      7740
     aagggaaaga agatatttct attgttgtag agtggatgga gggggttaca gtggtagctc      7800
     ccgatcatct agttctggaa gaaataaacc gagttttgcg taagaaggtt cttcgcacca      7860
     gaaccgcata attcaataca tcccatatat atgttattat ttttgataga aagattactg      7920
     atagttgata ggagaaaaca gaatgaaacc acaggcttca gaagaaatta gaactatggt      7980
     gaaaccaaaa ccaatattga agtgggctgg cggaaagcaa caaatgctag acgtgttgtt      8040
     gccacaagta ccaaaacaat ataaccgata tatagaaccg ttttttggtg gaggtgcttt      8100
     gttctttgca ctcaccccaa aagacgcaat tattgcggat tctaatcctg aactgataaa      8160
     cctgtatcgt gtcgttgctg acaatgtcga agaactgatt tcaattttga aagaaatgaa      8220
     aaatgacgaa tctttctatt atgaggttcg aggtcttgac ccagatttac tgtctccggt      8280
     tgaaagagca gctcgaacta tatatttgaa tcggacttgc tacaacggat tatatcgagt      8340
     gaatcgaaaa ggacaattca atgttcctta tgggaaatac aaaaatccaa aaatctgtga      8400
     tgaagaaaat cttcgtgcgg ctagtaacgc acttcaagac gtcctcattg ttgaaggcga      8460
     ttataaagac gttttgagag aacacgcgag accgggcgat tttatttttc tcgacccgcc      8520
     gtatctgccc gttggaaagt attctgactt caagagatat acgaaggaac agttttacga      8580
     agaagatcat attgaacttg cccaagaagt tgacaggctt catgagttag ggtgttatgt      8640
     catactgaca aactcgaatc accctttagt tcatgaactg tatggaaaat acgcaattag      8700
     cgttcataag actcggagaa acataaatag cgacgcttca aaaaggacag gagaggacgt      8760
     catggtaaag gtcgaaccaa aacaacgtat ttttatcgtt ccagaacccg tcaaactccc      8820
     aagccaaatg gacaaatatc ctccgactcg ttttatgggg agcaaacaga accttttaga      8880
     acatatctgg tctgttgctt ctcatttcca gttcgatagc gttctggatc tgttcagcgg      8940
     aagtggcgta gttagttata tgtttaaaac tcaaggaaag caggttttca gcaatgacta      9000
     tatggccttt tcgcattact ttacaaaagc gatggtcgag aatagttttg taaccttaac      9060
     cgatcaagat atagagcttt tgtttgataa gtcaactcca cgtgataact ttgtttccga      9120
     gacattcaag gacctgtatt tcaacgatga ggataatgag tttattgata ctattcgtgc      9180
     aaatttagac agattaaaaa acgaatataa acgagctatt gctatatcag cactagtcag      9240
     agcgtgtctt aaaaaacgtc ctcgaggtat ttttacttat acgggatatc gttacgacga      9300
     cggtagacgc gatttaactc tgactttaca gcaacaattt ctcgaggcgg taacacaagt      9360
     gaatggagca gtttttgata atgggaaaat gagtaaatct cgttatggtg atgcaatgga      9420
     ttgtcgacaa aaagcagatt tagtttatat tgatccacct tactacagtc cattgtcaga      9480
     taacgattat gttcgtcgct atcattttgt tgaaggaatc gctcggaact ggaaaggagt      9540
     agaaatgcaa tggcatacaa aaacaaagaa attcaagagc taccctactc catttagttc      9600
     catcaaaggt gctcatgatg cttttgatct tttgttcaaa cgccatcaaa acagcatctt      9660
     gatagtatcc tattcctcta actcgttacc tacaaaagac gaaatgcttg ctttgatggc      9720
     taaatacaaa aaaagaatcg aagttgtgtc catagatcat agatactcgt ttggcaacca      9780
     aggacataaa gttggagaca acaacaacca agttcaagag tatctatttg tcggatttta      9840
     ggttttatcg ggggaacaat tcatgacgca aaaagcatgg tacatcggca atacaactgt      9900
     gcgcaacgct aaacgtttga aagatggatt gagagtcctc ttgaactctc cactgcatgg      9960
     gaacctaatc ggaagagaaa aagagcagga gtttgccaaa ctccttcata atgaaggtat     10020
     cgtttttgtt aaaagactca atgattcacc aagtagtgat gccagcgacg taggaagaaa     10080
     atggcgtgct gctttaatgc agcttggatt tatcaaaccc ttttttgcag atgatccatt     10140
     tacgatcact ccaaatggaa tgagactcgt ggaatcaagg actatgccta gtgaacagga     10200
     atgttttttg cgagcattac tagcctatca aattccttca gacatcgaaa gatcttttca     10260
     cgaacctatt tttagcccgc ttcgcatagt cctggaaata atagctgcgt tagaacgtcg     10320
     ggggttagaa gctgaaatta gcaagcacga gatggcctca attgttcaac taacaacgtc     10380
     tttagaagaa attgatgatg tggtcaatcg cattgttaga tatcgtgaga aacttgctac     10440
     agctactagt gcaaggatga gaaaagagtt aattcgagaa catctacaat cagttgtaac     10500
     tgcgagtcaa agcgcaaata cgcttatgga ttatgctgac tcgaacttcc gatatttgaa     10560
     gttaaccggt ctttttgtag aaaagggaaa caaacttcgt tttgcaagcc ataaaaaaac     10620
     catcattgag caaattcttg aagaaccata cactccgata ccagaaagtg agtatcttga     10680
     gacactttgg aatggagcaa agctacctac cgacaatgct cctaaggcta tcgaggtgat     10740
     tcagacaaca gctcagcttc tcacagaaag tggccaaaca gtagaacttc ctaaccttga     10800
     agagatggga gtacctgatc tctctcgttt gcgccttgaa ttggaagatg attggttgaa     10860
     agttcttgaa aagcagtatg cgcaagatca ggctaatcaa tggcaggata tattgcagta     10920
     tcttcaagcc ttaactcaac caattcgacg taatagtata attccacaag gagaaggtgc     10980
     tgcatatttc gaatggtcaa tttggcgagc ctttttagca ataaattcgc tttgtaatga     11040
     gccgtgggaa gcaaggagat ttaaagttga ccaagacttt ctgccattac atccagcccc     11100
     tggtaatgga ccagatatga tttttgaatt cgatgatttc gttatagtag ttgaggtcac     11160
     tctaacgcag tcttcacgtc aagaggctgc ggaaggggaa ccagtacgta ggcatgttgc     11220
     ggaaatagta gatcactatg aacaacatgg gaagcgagtt tatggactat tccttgcaaa     11280
     taaaatcgat acaaatactg ccgaaacctt ccgaatcggt gtgtggtatc gaccagacga     11340
     ttcgcgaatg gccttaagaa ttgttccttt aaccttagaa cagtttatcc atttatttga     11400
     aactggattc cgaataaacg gacgattgga ttataaattg ttagaacaag tgcttcgtga     11460
     ctgtctcgtt gaaagcaata atgacgctcc agaatggaaa cggagaatac aacaacaaat     11520
     cgatcggacc gtacaacgct taaactccat tacttaacaa attgatcaaa tcacaaagaa     11580
     atgagagcag caagaattga cgttagctct catttcttct tttaatatta caactttatt     11640
     taaactttac ttatacaaaa atgtatacac ttttccataa ccagtggcaa atacttcttc     11700
     ttttagaaag atatcatctg cttccttaca ccaaatattt aaattcgttt gacctggccg     11760
     cgatgtataa ctaaattttt cacagtagat gaaatcatac gtaagagaat tatcagggac     11820
     agtacaattc tttaatgaca ctgtctctcc ttcccaggaa ggtgaaactt gacaaaatac     11880
     aatatcccca ttttctgaga taataagtat catctctata tctgtaacag aaattagtct     11940
     cgatgataag acactcatag aaattcccca tttttttgaa aaaaacgata tattacttac     12000
     aaaattggat tgaatccttt ttaactgctt ttcttcaatc gatcccgtag gtaataacaa     12060
     acgatgcgca aaatcgtttg catccctttc ccattgcaga ttaacatatt gattccacgg     12120
     tgtatattga ttagaaagca actcttctac acgttcatcc actaaaacat tagttccatt     12180
     tggaaaggag tgttttagaa gatgaccgat ctcatgtgct aacgtaaact tttgcctatt     12240
     tgtttctcga aaattacaat tcagtacaat cattccctta tcagccgatt cacttttgat     12300
     agtaaatgct tctatgttat gaggtaattc tactgtctta accaatatat ttaattgatc     12360
     gcataattca aacggatcaa taggtgattg tacttttgtt tctcttaaca gtgatctgac     12420
     aatcatatca tttgtaaatc cttctggata ttgaagtttc tttatactgt gattactttt     12480
     tatttcagta tgaaaggcat gaagaatttc cttccatgcc tcaggcttga tttggctgta     12540
     gtcttcattc atataacggt ttgatcgtgc taccaacttt aaaggaattg gaatatcctc     12600
     tgccaaatca cttatttctt ttgctgtatt atataataaa gctccaaggg gagacggagc     12660
     atctacagaa gaactaaaaa aaactctggc aatgtgtgat ggttcaactc gttcttttat     12720
     ttttttcatt gtcaatagtt gaaaagctaa catacgtgta gttaatttca aattattgtt     12780
     tggaattgct gacagcaatt cattgataaa atgattacta atttcctcgc tattgttcac     12840
     taaaccgatt atctgtttgg taagaaggtt caaagatcga tccagttcag gtttgagaaa     12900
     gtaatctatc tgctctattt tacatgtctg tactcctttt atcatggtca aacaaagatg     12960
     taagatagtt tctaaagatg aatctcccca ttttaattgt atatcacctt tgaatcgtcc     13020
     ataatcagtt aatattttta tccattcttt acgattttga gggaaacgat taaatacata     13080
     agccagtact ttatcgtcct taaaatctcg ttgacaccag atagtcaatg cccgttgagc     13140
     gaatccaatt ggtacaggag gatatttttc ttttatttct gccaataata aaaaagcccc     13200
     aattgaagtt tcttctgcat ttgctgatcg gaaaagttcc cacaacaaat cctcataaga     13260
     tactcctctt tcatcttttg caaaccagct tgcaaatggg attattccat aatatatata     13320
     tgtatattta catatattgg ataatatctt ctttttatca ataggattct ttttattaaa     13380
     gaaatcatca ataattcctt ttcctgttat cattattttc tcccctcctt tcttaccagt     13440
     ctaagtaaag ctgaaacaaa accccatcat ctacacttac cattttttta tcacctattg     13500
     tttgtactgt atgcttgcaa gaacgcacaa cccctccggt tttatatatt tttcgaaata     13560
     cactttcatc aagacaaaca tatgtagcgc ggtgttttct ataagaaatt ccgtgacttt     13620
     ttttcacctc ttcatgggta gcattatcaa acaattgctt gtgttgggtc aaatatacac     13680
     catcgccata atgtggttca tcagtttgta aagtttccaa caaacatgat tcacataagt     13740
     tcttgaattt tgctttaggt gcgctcccgt catctataaa ttttaaagta tcttcttcgt     13800
     aatagtagta cagctctata cccttataca actctgttgc ttctgcttta tagcttatag     13860
     gatcaagcat attcagatca cttactttac ctgttaattc tatttgttct tgatcaaaat     13920
     ctataggtac tgtatgtcca catgcacaaa tttttgtttg ctttgccaat cttactcccc     13980
     tctctatcta acaagttaat ttctttataa ttattacatt atttcatcga cttctcccct     14040
     atctccttca cagaaaggag aaaaatctat tgaggcgtcg gcttatgatt cagtaaatga     14100
     cgagttgtat ctattcagcc cagtactagc gagattttca gaatccagca ccaatagggc     14160
     attcccagta tcgaaaatgc cctaggagga atggagaatc gtttgaagag gctctccgct     14220
     tagaagtctt tgcaacgatt cccacaccgg ctttccgtgt ttttgcaggg tggaaacgac     14280
     gctgcggatg acacagaaag cctcggcatc gtcttcctga cgaaacgttc cagagatttt     14340
     ttgtttgact ttcaccatcc gtaaatcgcg ttcggcttgg ttattgtcaa acggcacttc     14400
     tttctttcgc aggaagagaa gcgcttcttg cttgcgcttt tctaggcgcc ggatgaaatt     14460
     ttccgctttg cggacaccta gatggctgcc ttgtcggcaa cgttcatcga gttcccggcg     14520
     tccattcgaa agaagctcgt cgtacaccgc ttcccaatac cggactttct cttccggcaa     14580
     ggctccgccc gctttctcca ctgcctgttt catctccaac agtgcttcgg ccatcttgtt     14640
     cgaccaagag tgctggtaaa gttcggtata ttcccgaagc tcccggagat gatgggcgtg     14700
     gcaaagggca tggctcgcct gcgtatacat cgggtatacg gaatacgcat catgtaccat     14760
     cgttcctttg taccgtggca aaatcccgat gtcatccgtc gcttgtttgc cacgcgagcg     14820
     atgaatcccg tatcgggttt ccttggaagt ggaagcgacg tgcacccatt gtttcgttcc     14880
     cttcacacgc aggctcgttt catcgacgtg cagcgtgctc gaggtgagca gcgcggcttc     14940
     gatttcttcg atcgctgctt ctaacacagg ctgccaccgt ctcgtcatgt tcacgaccgt     15000
     tccggcacta atgggatgat gaaataatgt tttcaccatc tccgtaatcc gttcgcacgg     15060
     aatcaactgc gcgtgattcc agtataacag gagtgaagtg atgaccggtc catattgtac     15120
     atgattggtg acatagaaag ggaactccgc ctgctggaca agtcggcatt ccggacaacg     15180
     cttgatttcc cgctcatgtt gagtgacttc catgcgaacc actgggaggt cgaacacttg     15240
     gcgaatgtct acttgaagtg gatcgacatg ttctaaagag tgaccacatc ctttgcattg     15300
     ggtcacacgg tgaaggactc gatggtcagg attcggtgct tggcggagcg tcgttccttg     15360
     gtgccctggc tgtcctcccg gccgtttctc cgacggttgg cgagaaggag atttcgcccc     15420
     aaaccggtca gaggacggcg gtaaatgact attcgtactg ttttttttcg tacgggcttc     15480
     taattctgca atacgtgctt tcaattgctg gttttcttgt cttaactgtt tattttcgtt     15540
     gatgagtttt tcgatggtct gtgcttgacg ttcgatgttt gccaccatgc tttcgagtgt     15600
     gaagaccgct tcttggaagc caaaagcaac atttgccatt gtgttcacct cccatgtcta     15660
     tgatggtaat tagtatagac aaggaaggta cgaacaaacc ggctctcgta aattttttct     15720
     atgtacgggc tgaatagtta cgacgagttt gggtcattca ccagattccc taaatgaaac     15780
     accgtttttc gctgtttatt ccttttcatc aagcttctcc gcaatcatga atagctcttt     15840
     tttcagctgc cgattgagct ccacaggaac gtggagcacg gtgttgggac ctagcgtgaa     15900
     agaaaaaggc tcgttttcat cgatcaatcg tgccaaggaa cgcaagccgg cggccttgaa     15960
     gcgaccttct aacggaaatc cagccacgct gcgcatataa aactccttat tgctaaaata     16020
     cccgtcaatg atttgcaatg aatccatcat cgattggttt tctcccttct gaaacaaatt     16080
     tgcttaggtt agaacttcgg cagcgcctcg actgcatcag ccaaatcact atagctgtct     16140
     tttaagtatc gtgatgtcgt ggcgatattg ctgtgaccag caagcctccg cactttctcg     16200
     atatcgttgt tcgtcgcctt taacatccac ttacaaaacg tatgccggaa catatggggc     16260
     gtaagctttt tgttcggaag gctgtagctt tcaatcattc gctggatgcc acgtactgaa     16320
     aactttggtg agcgctggct gtaaaagaca tatggcgatg cggccacatg cggtttcttt     16380
     ttcgccattt ccgcgcgaaa ctccagccaa tcctccagtt ccgccagtaa aatattcgag     16440
     atcggcactg tccgcacctt catccctttt cctacaatcc gaattcgttt catttctaaa     16500
     tctaagtccg ttagttttaa atttgataac tcttccaccc gcaatcctgc ataggtaagc     16560
     aagtacacca ccgcacggtc ccggcgatat ttctcttcag gatcgacacc tcggctttgt     16620
     accggctttt tccgcatccg ttgcaacaag tcctcaaatt cttcttcggt gagccacatg     16680
     attttttcgt gatcttcatc ggccgttttc aaatcttgaa tatccttcat cggattttgt     16740
     tcgatgtaat ggtgctcaac cgcccacgcg taaaagctgc gcagcgaatt gaggcggcgg     16800
     ttgatcgtgg agatcgccaa cggcttccct tcttctggat ttaacatgtg ctggatccat     16860
     ttgcggatgt cagccggcgt gacataatca tctggacgga tatgtaaatc atgaaaaaat     16920
     atgtttaaat cgtttgtata ggaaataatg gtatttctgg aagctccttt ttcctgaaga     16980
     taagcgacat actcattgag catctttttc caccctttca cttatacggc gagtttaaaa     17040
     ggattcgaag agcaaataat cggtttaaaa aataacatta tatgacgagt atatcataaa     17100
     aaagaatcaa ttgttagtca tataatgtat attatatgat tagtttgaat tgaaatcaat     17160
     caagactttg tgaagaactt ttttcggttc actaggagtg tatatataaa ttacaggttc     17220
     atcaccacaa catgtacttg acaagcgggg gattttcttg agccgccgtg tacgaaaaat     17280
     ctgatttact gatttttcct tataagtaca gagaaggcgt gttctgaaat agtcaagtac     17340
     aactttcggt gaagagccaa aaaataaaat ttaatacata tattgtaaaa taattaattt     17400
     ttattcagcg atatcagact tatgttaaat ttttattcaa ggtacgaaat gtgagttaaa     17460
     gaaaaatttt atcctccaat atacgacatt tcaattttcg ggcgctgttt cgctgtctct     17520
     gccgtccgtt cctcggaata gcgatctgcc cgtttgctcc agactgcggc gatcagcgct     17580
     ttgagttcct ctttttccgc tccggcgcgc agtttgtctt tcaacgacac gccatcggcg     17640
     gcaaacaaac acgtatacag cttgccatcg gcggaaatgc gcgcccttgt gcagctccgg     17700
     caaaacgttt ccgtcaccga ggcgataaag ccgacttcga cgttcgtgcc cgcgtaccgg     17760
     tagcggttcg ccacctcgcc gaaatactct ttctcgaccg gctcgagcgg atgcatcgcg     17820
     ttgatttgtt catagatctc ttttttcgtc acgacatggg agtaatccca gccgttcgtg     17880
     gtgccgacat ccataaattc aataaagcgg agcggaatgc ccaagtcttt aaagtaagcc     17940
     gccatcggca cgatttgcga gtcgttccat ccttttttga cgaccatgtt cactttgact     18000
     ccaagccccg ccgccagggc ggcttcaatg cctttcaaca ccggagcggc gccgacgcca     18060
     atgccgttca ttttgcggaa aatgtcatcg tccaacgcat cgaggctgac gttgacgcgt     18120
     ttcaacccgg ctgctttcaa ccgtttcgac catttcacta aatggacgcc gttggtcgtc     18180
     aatccaatat cgcgcaggcc agggatcgcg gacagccgct caatgagcgc atcgaggtcg     18240
     cgccgaagca acggctcgcc gccggtcagg cggatttttt cgaccccaag ttcgacaaaa     18300
     cattccgcta aaagcgccat ttcctcaacc gtcagcaact gcccttcatc caaaaagcga     18360
     aaattcggcc cgaacacttc cgcaggcatg caatagacgc agcgaaaatt gcattggtcg     18420
     gtgaccgaca accgcaaatc gcgaagcggg cgggcgaggc ggtcggtgat cttcacccgg     18480
     tcgcgctctt ccatggcgct ccctcctttc cctttcatgg gccgcgtgat gttcaaacgg     18540
     cctgctcctc tatcgttgca aacgacctag tttcgccgca caggacaaca aactaaatga     18600
     caatccaatg gtgaccgcca cccatgccca cgccaactcc atccgccccg attccatggc     18660
     catatagaca gcggtgggga tcgtttgcgt ttttcccgga atattcccgg caaacatgag     18720
     cgttgcgcca aactccccca ggctgcgggc aaacgacagc accgccccgg acaacaaggc     18780
     gtttctggcc agcggcagtg aaatatgcca aaacacttgg cgctcattcg ccccgtcgat     18840
     gcgcgccgct ccttcaatgg ttggatcaac ggcttccaga cccgctttgg ccgcctggta     18900
     catgagcgga aacgacacaa caaccgccgc catcaccgcc gcgccgggtg taaacagcac     18960
     cgttgtgtga aaccacgttt ccatcaactg tccgatcggg ctatgccgcc caaacagcac     19020
     aacaagcaaa aaaccgacaa ccgacggcgg cagcaccaac ggcagcataa acaccgtctc     19080
     aacgatcgtc ttcccacgaa accggcggcg ctccatccat cttgctgctg tggtccctaa     19140
     gactacaaca atcaggccgg cgagaagcga cacttttatc gataaccata ccggtgacca     19200
     aaactccgtc atggatcaac ctcgctttgt tgcatatcca tctcactatt cctaccgtga     19260
     tcgaactgca ttcgaaagcg tggtgtccca aattcctcat ccttattaac tccagggata     19320
     aaggatatat cggccattac ctaaaaaatt tatacaaaga gtaccaaata gcgctttgga     19380
     caccatcccg caaaaattag aaacaccgat cgtccaaaat gcgggaggag cggcattaag     19440
     aagaagcaca aagtcaagtc agtgaaacgg tatttttcat catagtcgat cagtatcatg     19500
     tcaatgggat tctagtcaat tcaagtgatg aattgaagta gctatcgatt gttgacgtat     19560
     ttgcttatag cgtttgtact aattgaacag taatgcttaa ctatatagat gcaatttgaa     19620
     actttaacat tggtagcttt tgcagagcta tttgatcgac tgtcgggcga ccgaacaacg     19680
     ccgcttccag acccatgtat gggtctgtga agcgagtggt tgttcggtct tccgtcacgc     19740
     cttggcgtgg cgaaggcaag ccacaggctt gcctccgtca gtcgaaaaaa tagacaagcg     19800
     actttttcgt caaggatatg gtaaactttt tcgttgcatc tatatagaac aacagattaa     19860
     agtattgaaa atagttcgtt agtttggtat caaaaagccc tgagttaact gaataatgat     19920
     actcagggct ttttgatata gtattgggaa agatttatta gcgtcctcta aaattcggtt     19980
     tgcgtttttc tgcaaatgcc tgtacacctt ctgcaaaatc ttctgtgcaa cgtaacatac     20040
     catatgcacg accttcaatt tccaaaccag aggaaagagg agcttcttgg gaagcattca     20100
     atacttcctt acacactttc aaagtaagag gtgaaaaacg aagaagttca tcaaccaatt     20160
     tttgtactgc aacatctaat ttgtccgccg gtactacttc ggtaacaagt ccccattggt     20220
     atgcctcttg cgctgtaatt cgtcgcgcac gcataatcat atctttagct cgccctaagc     20280
     cagcgattct agcaattcgt tgggttcctc cactccctgg aatcatacca agatttagct     20340
     caggcaaagc tagtaatgta ttctctgcag caattcggaa atcgcaagcc atggcgatct     20400
     caagcccgac tccaaacgca tacccctcga gttgggcaat tacaggttta ggcgaacgtt     20460
     caggggcagc aacattttta tgcagttcag atagttcttc agggtgacgt tccatgaact     20520
     gcatgatgtt tccgccggat gtgaagactc caccttcccc acgaataatg atgactctca     20580
     catcgtcatc tttgtctaac atttggaaaa tttcattaaa atgtgatcta gcgataaaac     20640
     tgattgtatt aaactttcct ggacgatcaa aaataatggt cgctgtttta cgatccaaat     20700
     ttttttctac acggatatga tcccagtctc cttctagtac tacaacattt gatttcatct     20760
     gttccatgat ttatcctcct tttataatta taaaatttaa ccttcgagcg caaagtctaa     20820
     aatgccatca tattcaccat tttttagctt acgtcgcaat attttaccaa ctggactttt     20880
     tgggatttct ttgacgaaga tatatttctt aggccgttta aaattcgcaa gtttgccgct     20940
     ttcacggcaa tattgatcca gctcctgagc ggtaagtgta ggatcagcct ttacgataaa     21000
     agcggttaca atttgacccc agtgatcgtc aggcagtcca gcaacagcta cctcatagac     21060
     tttagggtgt ttggataata catcctcaac ttcaagagga tgaatgtttt cgccgccgga     21120
     aatgatcata tcatctaccc ggccaacaac gtaaagatct ccatcttcat caaaataccc     21180
     aagatcgcca gtaaaatacc agccctgacg aattgccttt ttgttagcat caggacgttt     21240
     ccagtatcct ctaaaggctt caatgctgga aagattagca attatttccc ctgggacatt     21300
     gggagccact acatcgtcag gtcctacttc tttattagga tcaaccttaa cgacgcgaat     21360
     atcctgatga aaaccaggct taccggcaca ccctggcttt ttgtcaaggt aattgcatgt     21420
     tgtaaatgtg taaacctccg tacaaccgta gtgattgaca aacactttcg gatttaactt     21480
     ttcaaatatt tccttggtta atgaagttgt catagctgct cctgcatatc ctaacttagt     21540
     taacgaagac aaatcgtgct tcgtgaaatc aggatgatta actaaatcat ggtaaatagt     21600
     tggcactaaa taagcgcaag tgattttttc tctttcaatt tcctcaagca gcttctttgg     21660
     tgaataatcc ggtgtcatga ctaacttgcc gtttaaaaaa gccatagata ataaggatcg     21720
     catccccata gtgtgataca aaggcataac ccctagcgtg gattcgccgg ttacatattg     21780
     attttgtaag atatgggcaa cagctgctcc gtattcattt ttatgtgatc tcggtactcc     21840
     cttgggtttt cctgtcgtgc ctgatgtata aagaatcaaa caaatatcat ccatgtctat     21900
     ttgggggcgt ataagatttt tctcctcgcc taatctcagt aattccttat agctgacctc     21960
     tgcaccctca acgtttagca atccaatttt tttgacactg acgtctttgg tcgcctttag     22020
     aacctcgtct ttacttgctg gttcatagac gatcgctttc gcctctgaat ctctcaaaca     22080
     atactcgatc tcatgtgaca tcaatcggaa gttaatagga gtgaaaacag ccccaatttt     22140
     ttgtatagcc cagtagagag ccaccatttc ccagcgattt ttagttacta aaaggacacg     22200
     atcccctttt tcaattccta atgtttgcaa tcccgctgca agtttattta tttcctcatc     22260
     aaaacgggca taagtgaaac gtacattttc ctgcacaatt gcaatggcgt caggatatcg     22320
     ttttacggca aactcaaaca ttgtagccag atccacatct catccccctc tcaccataaa     22380
     atatcccttt ttctctaatt caccttgtta actgtattct ttatacggtc agcggcctgt     22440
     cgaatagcct ttacgattcc atgatacccc gtacatctgc atatgtgccc agacaacatt     22500
     tctttgattt cttcttccgt agggtttctg tttgtttcta aaaactctac agctgacatt     22560
     aaaattccag gggtacagaa gccacactgt aaggcatgac atttagaaaa ctcctcttgg     22620
     agaggatgcc atccttcttc tgaagctaat ccttcaatgg tattgacctc tgtaccatca     22680
     gcctgaatgg ctaacatcag acaactgcgg acagccctac catttactag tacagtacaa     22740
     gccccgcata ccccgtgttc acaaccaacg tgtgttccag ttaaaccaag gtcttcccga     22800
     ataaaatcac ttaataattt ccgtgactct gtatattcct cgtataattt accgttaact     22860
     ttcaatttga ctaacacttt ttgacccttc tctatcttaa tcatttgctc actccctatt     22920
     ttgtgctctt tgataggctg ttcgaatagc cttcatcgca aaaactttgg ccaaatgttt     22980
     acggaattca ctactagcgt gaagatcgct ctcaggttct aaaaagcgaa tggcttcctc     23040
     tacggagtgt tcaagtaatt cttcagttaa aacggaacca atcatcgctt caactgcctc     23100
     atgaacagcc aacggtactg aatcaacccc tcctaatacc aatcggccag aagtgatatg     23160
     cccgtcttta tcgacgtcga gcagacacgc tgcagcaact aaggcaaaat caccgtgacg     23220
     gcggctaaat tctgtgaaag catatccttt aggcatctca ttgagtggaa tctgtacttc     23280
     agttagcatt tcttccggca tcaaatcggt tgtcaagtag gttagaaaaa aatcctccat     23340
     tttcactaat cgctgatctg atgcagagcg aatgacagcc tgtgcatcaa gcgctagtag     23400
     agtcatagga atctcagctg tcggatctgc atgtgccaag cttccaccga aggttccacg     23460
     attccgtgtc tgcatatgcc cgatataggg gattgcttcc gaaagtaaag gacaagcttc     23520
     acgtactaat ggagaaagtt ccacatcacg ctgccgagta agagctccga tcttgagaaa     23580
     accatcttcc acacgaatat agctaagttc ttgtaatcca ctgatatcaa tcaacagttc     23640
     cggagtggaa agacgcatat ttagtattgg catcatactt tgcccaccag cgataatttt     23700
     tccgtttatt ccgtattctt gaaggagttc aagtgcctga tctacggtct ccggtttata     23760
     atagtcaaac aatggtggct tcacaaagta atcccccttc tagcttatcg taatatttag     23820
     gaggcctctt gtttggattt ggcgatctcc ttttgtattt tcttgaagaa atcacttatt     23880
     aatagttttg ctaccccacc aagcatacgt tgtccaatgg cagctacttt ccccccaacc     23940
     tctgcactat aggtataggt tagttgagta cattcatcat taatgggggt taggtcaatt     24000
     acaccttccg cgttgacaaa tcccggtcca ccttctccat taactaacag tttgtaatga     24060
     taagggggct ttatatctgt gacctcaatt attgcatcat atttcccttt cacagctgca     24120
     atgccgattt ggaggtcagc tttgtatttg tcctcaccga tcagttcaag ggatttacat     24180
     cccataatgc atttacttaa gatactcgga tccatcagtt tgctccatac ttcttcgaca     24240
     gttcctttta attcaatgct tccgttaccg ttcatcaatg atcacctcga atgtaaactt     24300
     tttcttgctc ttgtcttttc ttttgaagta gattccaaac acggtttgga gaaagtggta     24360
     ggttgtcaat gatacaatcg gtagcatcag ctaccgcatt ggcgatagca gccggggtac     24420
     tcatacagtt accctcacca agccctttgg caccaagcgg tgtaaagggg gatggtgttt     24480
     caatgtgatg gatatgaata ggtggaatct ccgttgctgt tggacataga taatccataa     24540
     atgttccagc aagaaattga ccatttttat cataggaaag ttcctcatat aatgccccac     24600
     ctaatccatg aaccaatcca ccgtagattt ggccgtctac gatcaatgga ttgagcagct     24660
     tacctgcatc gtgtactgta tagtaatcta aaatttttac ctcccccgta tctggatcta     24720
     cttctactgc taccaaatca gccacaaacc cataggtgac agatgaattt acaaattcat     24780
     ttttatccgg tggatttgca gtatgaacag tataataagc tgtttcaaaa attccaggtt     24840
     ctacgccttc actaagccct tgaggatgcc aatgtgataa tcctgctaaa cgtttaattg     24900
     acacactttt ttctgggttc ccttttacaa caactttccc ctgagataga tccaaatctt     24960
     cctcagatgt acttaggatc cccgaagcaa tttttaacag tttttggcgt actttttgag     25020
     ccgcttgata aatagcacta gaaccaatgg gagcaaaacg gcttgagtag cttcctgatg     25080
     ctactgacca tggactagtc aatgtatcaa gttctgccac tacctgaacg tccctaggat     25140
     tgacaccaag tacttcacca acaatttggg ccgctactgt ttcgtgccct tgccccgatg     25200
     gtgtagtact gatgcgtacg ctgatacttc ctgacggatc aatcataact gttgctgctt     25260
     cggcacaacc ggatttagga agagattttg ctctttcctc aggagttaag gccatcgtaa     25320
     tgtatcccat attcgaaccg gatggttcaa cgatacaggc tagaccgatg ccaaatagct     25380
     tcccgtcagc ctttgctttt ttctgatatt cacggagttc gtggtatttt ccaacctgta     25440
     gcaaaagttc aaatgccttg tggtaatctc cgctatcgta gatcccgcca gagggagttt     25500
     tatatgggaa ctcatcagct cggattagat tttttcgtat gacctcagct ggatccatcc     25560
     caagcttttc agcaatcatt tgcattgttc tctctattgg aaagtaatgt tcctgtccac     25620
     cgtatccccg aatcagcccc gtaggacact tattggtcat caccgcataa gcttccatgt     25680
     aaagatttct gattctgtat ggtccaacag cattagaatg gttgcggtac aaacaagccg     25740
     gttcaggagc cctaatatac ccgccaacgt tatcaatcat tttcattttt agagctgtga     25800
     cggttccgtc tttgttaaaa gcggcttcta tatacgttac acgatcggtt ccactcgaac     25860
     tcgctgctag atgctcttga cggtcctcga tccactttac tggaacccca gcgacgcggc     25920
     tagcaatagc cataagtacg acatatggat aaataccggc tttgatccca taactgccac     25980
     cattgtcttt cggtgttatg atgcgcaact tgtttcctgg tacttgtaat gcagctgcca     26040
     ttactgaatg taatgtaaaa ggtccatgaa agttagccca aacggtatag ctattggtgc     26100
     ttttctcata gtttgcaatt acaccatatg tctccattgg tgtagcactg tatttaggaa     26160
     acaaaaattt atggctaatt gtataatcag cttcttgaaa agctttttct acatccccat     26220
     aatgaaaggt acgttggttt gcaatattgg atccgacctc ttcatgtagt aatggagcat     26280
     cttcttccat cgctcgttca atgtctacaa ccgctggtag cggttcatat tccacttcga     26340
     ttttttctaa ggcatcttcg gcaatatagc gattctttgc gacaacaaca gctaccggtt     26400
     caccaacaaa ccgaactttg tctacagcca aggaataata ttttaccggt gcggtgacac     26460
     caacgggaaa aggccgcgac aaactagcaa ccatagaacc agtaattact cccttgactc     26520
     ccggcaccaa agctgccttg tcagttcgaa tcgctttaat gcgcgcatgg ggatacgggc     26580
     tacgcagaat ggcaacatgg tgaatattcg gaagtggatt taaatcatcc ataaattggc     26640
     cctgaccttg taagagacgt acatcttcca agcgatacat cggtttacca attccatggt     26700
     caaccattgg aactccccct tgttttcacg atccaatctt ttggttactt gactttatta     26760
     gttgtatata atcctcccat gtatcaatat ctttcaaaag cgattgaccg gtttcgatta     26820
     agactcgttc acttaaaaat ttttgaataa cttcccgtcc cccttgatcg cctcgtactt     26880
     catataaata tgggaacagg ctttgatcaa aaagaaccgg atggccaggt attccttgat     26940
     aggttggctg aataattttt gatcttgtct cctcatatgt tttgatgatc ttattgatta     27000
     cccaaggatc gaccccaggt tgatctccta gtaagataag ggtagcctct acttcattag     27060
     gaagcgcttt caatccattc cataatgatg aactcattcc attttctgca tattgattta     27120
     tgaccacttt cactcccgtc tcttttacct cttgttccaa tcctcgaacg tttgggttta     27180
     tcacagcaat aatcccatca acattagaag acagcgcttt cttaatgaca tggcgaataa     27240
     tgcttttccc attaaaaggc aaaagcgttt tggggtatcc cattcttttg gaaacaccag     27300
     ccgcaagaat aacagcccaa actttcatga tcagtaatca cctaatttga actaaaaaac     27360
     cgttattatt ctcattttct atggatagga cccttttttt gttttagtgg acgacaactc     27420
     cctttttgcc ttaccgcaat gatctctgcc aaaatggcca gtgcaatttc ctcaggcgtt     27480
     tcccctccaa ggtctaggcc gaccggacca tggagtcttt ctattttact gacatctgac     27540
     tcgctgatat ttaatagctt ggccgttctt tttaatggac caagcatacc aatgtaaggg     27600
     atgggctttt ttaataattc attaagataa agttgatctt gctcaaaatg atggctcatc     27660
     acgactgcat atgtttcttg atcaaaacaa agattatctg gaaactttcc tcgcggtact     27720
     aaaataattc gatctgcctc tggaaagttg gatttattgg cataagctgg ccgatgatca     27780
     atgacagtca ccaaccattg aagggattta gctagtttga caagcggagc tacatcaggc     27840
     cctgctccaa aaatcactaa tctagggatt ggcttcattt gttcgacata aagtgtgcat     27900
     ggaatttccc gatccatgac gtttgagtcg aaatacagca agcggattaa accactttct     27960
     tttcccttta atttgaattc gtaaaggagt gactggacgg atatcccttt aggcaaatat     28020
     cgcagacgag taccgggctt caaatgcttg tgatcttctg actcgatgac ttgaagaaga     28080
     aagacgcttt catttccatc tcttaacttt cgaaagtcgt ccataatcct cttcatattt     28140
     tccggatcat ttcgagggtc aagaggttct ataaacacgg taacagcacc gttacaacct     28200
     acacccattc cccatatgga atcgttatcc cctcgaaaat cgtaacgtac aatttccggt     28260
     tggccggaag ttaacacacg ggcggctcgt tcctgtaaat cactttcaac acacccccca     28320
     ctaatcgatc cgataatttt tccctctaac gaaacaattg ctctagctcc ttcccttcgg     28380
     taagaagatc cctccacgtg tactatagtt gcgagtgcgg ccgacttttt ttgtttccag     28440
     cattcctcca taaagttcaa tatatccagc atataagtcc ctcattctga atctgagtag     28500
     aaaattgttt ttatctatat catacaaatg tgagctgata atggtttgaa tatttactca     28560
     tctgagtttt tgttattttc tctataataa taaaaacaac caagagtcag ttcgatcatt     28620
     attccaagta ttgaacgtac ccattaataa tttaaggaga tttttgtaga atatgaaatt     28680
     acttatttcc tgtttttgga tatatctttt gcaatagttc gcgatattcg gttggggttt     28740
     tcccttctaa acgtttaaat gtagtggcaa aataactcgc attcgaaaaa ccggtcttat     28800
     gtgcaatgac atcaatagga agggaactca tttttagcag atactttgat ttttgaattc     28860
     gtacttgtgt taaatattca acaaatgtca ttccggttgc acttttaaat agccggctaa     28920
     aatgtgattg gcttaggtat accatgctgg caacttcatt taatgttaaa ggaagatgat     28980
     agttgtcttg aatgtatcgc aaagcgcttt caatcggatt tgctaaatca atggactcca     29040
     ttccctttcc gtagtgctga tttgcttttg ttttcatcgt atcgagcgag ggcgtgagta     29100
     tacgttctaa accagacaag agctctgttc gagaaatagg ttttaggtaa tagccagaaa     29160
     accctgcatt gatggccgac tgtacaatct cgaacatctg cagatgtgag acgattaaaa     29220
     ttcgaattgc cggatatagc tgaataacgg acttcccgaa ggaaattcca tcctcgtcct     29280
     ttaacgaaat gtccataatg ataacacaag gttgaatttg tttgatcaat tgtagtcctt     29340
     cccttgccat cgatgcttca tgaatattta agtagtgaaa aggactatct tcaatttttt     29400
     ttcgaatatc aatccgtgcc ttatcatcgc tatctatgat taagagatct gacatacggc     29460
     gctccctcct tttttcgccg accaaactat gcttcatgtt gaagagtctg attacggagc     29520
     acctttcctg taacggttcg cttaatttca ggaacaaaaa tatattttcg tggtcgttta     29580
     aaattcggaa gtttttcgtg ttgcatacaa aaacgatcca gttcttgtgc attcaatcca     29640
     ggttcctttg gaactatgag agcgaccaca atttgccccc aacgttcatg aggttcacca     29700
     ataactgcgc aatcagctac ttgtggatgt tgggtcaaca cctcctcgac ttccattgga     29760
     taaatatttt ctccagcgga gataatcata tcatcgattc tccccaaaac atacagatca     29820
     cctgcttgat cgaaaaatcc aaggtcaccc gtgaaaaacc aattattacg aatggctttc     29880
     tttgttaaat ccggtcggtt ccagtaccct ttaaacgctt caggtgaatt catgttcaca     29940
     ataatttctc ctacttcttc tggttggact agatcatcta ttgttgcgtt gccaaaagga     30000
     tccgcacgga caactcgtat attttgatga attcctggtt ttcccgcact ttctggtttt     30060
     tcattcaact cgctgcaagt agtgtaggta taaatttctg tgcttccata atgattcacg     30120
     aagtgtttcg gattaaacgt actaaaacat ttatctgtta atgcctttgt cattttcgct     30180
     ccagcatagg ccaatttatt aacggaagat aattcatagt cacccagctt agagcagtga     30240
     atgatatcat gatacattgt tggtgttaga tagagagaag tgactttttc ttttgaaata     30300
     gacttaaggg catctatagg atcaaagtca gacaatatca caagcttgcc ggctaacatt     30360
     atggtcgata acaatactct catgcccatt gtatgataaa aaggcacggc tccgagacaa     30420
     acctccccca tatccaacct tgtctggaat atatgggcta tggtagagga gtattcattc     30480
     atatgggaac gaggaacccc ttttggtgtc ccggtaacac cagacgtata gagaataaga     30540
     gcaatatcgt catcagaaat tattggttcc tcgaaatgtt cccgcttgta gttgatcaat     30600
     tcttgataag tgagatcaga atgcgaatca tcctccagac taattaagat aggtcgatca     30660
     ttaaacatga tctttttaat ccaattctgc ccatcccctt cataaatgat caccttggct     30720
     tctaaatcgt tagcacagta tttgattatc tcaaatgaca tatacggatt gacgggagcg     30780
     aaaacagccc ctatcttttg taaggcgaaa aaaataacaa cggtttcaat cctgtttttt     30840
     aataatacca tcactctatc acgttgtctg atgccaagac gctgaaatgc agaagccact     30900
     cgccagacat gttcctcgag ctcaccgtac gtatattgtc gatccccctc tattaaggca     30960
     actttttttg gacagcgaga aacagcgttt tcaaaaacta ttgaaagatt catataacaa     31020
     acccactctc cgtgttgaaa tttagtttat tatgtttaaa tattaacacg caatcctatt     31080
     taggaatttt ttaatttttt agccaactat ataaaaattt tatcattccc aaaggctgtc     31140
     agaaatctga ttataaggag ttttgtacat gatgtatggt gagaaataaa gaccttccca     31200
     gcatcgccta tcggtgaaca cagagagaag acgccaataa acttttctta tatcttaaga     31260
     aagatatttg ctgtaccgtt cgccctattt gataaaaaat aaagtgccac caaatcacag     31320
     gggacacttt ctcaagtcgc catcggtttt taaaccagat tggcttccaa accaaaaatg     31380
     tcttttagcc gacgttgata catacgagta agacgctctt tcccattcac ctcagcagga     31440
     atatcgtacc ttttaccatt aactacaatt tcttgatcat aacgtactag aatttttgga     31500
     agaaactctt caaaaagctc cttgattctt tttgcatagc ttggattttt ggataaatac     31560
     ttcatcattc gtaatccgta gccaacatga cgcccttcat ctcgtttaat ttgtttaaaa     31620
     ccttctttaa gccctggaaa aagtccatat tgtccataaa ctgcttcaaa gacttcgtat     31680
     ccaaccattg cttggatgcc ttcaataact ccttggtaat gaactaaccc ctctaacatt     31740
     gctatctccc tttcttcggg gcctttatcc agtacagaaa gaagttgcct cgcccgttca     31800
     tccaatgtat catgaacaag atttaacact ttgacttctc gatccgtttg taacacttct     31860
     gcaaaatacc ttataaagaa ctcagtatgt ttaaattcgt ctactaactg ggtactgagg     31920
     aaagcttgtt gttcgatcga gggagcaatc ataatccaag ggcaaaattt taatgcaacg     31980
     ttttcttccg cattccaaaa cccagtacaa aaatggatga gataagctct tctttgttca     32040
     tccaattgtt tgaaatgctt tttatcttca gacaaatcga tctcctgggg attccacgtt     32100
     ccaaaacgaa tagccatttg atacagtttc caagccagtg cctttggtga ttcttcactt     32160
     tcatgactta agtcttgcag tgcctccaac tcttgatcga tgttcacctc attttggttc     32220
     acagacattt ctttgaactc cttcctaata agtatttgag aagtagggtc taactccttt     32280
     gaacaaagat tttataccaa tattcggaag gataagaccc tacaaaaaac attatcgttc     32340
     tatatctaga caacaataat cacttgagat ttcctttagt ttctgggata ataaaacttc     32400
     ctaagatata aactaagtaa atgacaatag taaagtacat caacgtataa ggaatatgtt     32460
     ctactgtgcc gcttgctaag ttaacaaacg ttggcatcat tcccccaata gcaaaaccga     32520
     cgttccacga taatccagtt cctgtagaac gaacctctgt cgggaaacgt tcatttaaaa     32580
     agattagtac gggcgcgtat gaagcgttac ctaagaagac aagaccaata gcatttaaat     32640
     atatgcttgt ggttgtggta gagtgagcca atgacagata gaagtaagga agaccgaaaa     32700
     cacaaagaat cccaatgatc atgaacgttt tctttctgcc gataagttca cttaaatgtc     32760
     ccacaacaat ggcagccaga atagttgtaa tacttgttgc aataagtacg cccgatgaaa     32820
     cagcagcagg taccttgttg accactttga ggaaggtcgg gataaaccca gcagtcaaat     32880
     agtaaccgga tccccctcca ataacgatca ttaaattaac aaataatact ttgtaatatt     32940
     tggttaagaa catcttgaat ggtgattttt gttgttcaac cattttatct ttgctttgtt     33000
     tctctttaag ttgtttccaa agcggagatt cgtcaaggga gcgaaatata aaaagaccga     33060
     atagagcacc gatgatacct gtaaagaaca taatgcgcca tcccaaagta tcgaaggcgt     33120
     ctccaggaaa aatcgctgat acaattgaat aggcaatgga agcaaacaat gcgcctagac     33180
     ctgcccctcc accaccgatc aatcctgaca taagtccccg atattttggt gatgctgatt     33240
     ctgttcctat cgtgtgagtt gaagccacca ctccacctac aaatattcct tgaacaagac     33300
     gcaagatcag gaaggcaatt gaggcagcaa ccccaacttg atgaatggta ggtaataaac     33360
     caaatgccgt tgtggacaaa cctgcaccga taatggctac ggtcattgct ttctttctcc     33420
     cgtttttgtc cgcataaact ccaaaaatgg cggaccccaa tggacgcatc aaaagagtaa     33480
     cagcaaagga agcatagaca gcagctaagg aaagagtctg attactagca ggaaagaaca     33540
     aatttcctat agttgttgcg acataaagaa gtaggaatag atcatacagg tcaagagccc     33600
     accctatgag agaggcaatt gtagctcgta ccatttgact atttttgata gatacctcta     33660
     caggcctctc aatgttcgtc ttggtgatgt tatccataaa tcatacacct ccaaataaaa     33720
     agtgtttgtg aacaggagaa ttaattatac atggatgatc agtgcttatt gtaagcgatt     33780
     acatataact taagtttgat tatattgcac tgagcaaaag tgagttataa aatcaacaca     33840
     ttcatatttt tgttttttta tcatttttca tttttttctg aatatataga ctaaaaataa     33900
     tagtagataa cggaagatga agtgatttct cctccgccat ccatatgatg aacaacccat     33960
     cttacgatct atattaatag atgcaatttg aagctttaac atttgcaact tttatagagc     34020
     tattggattc gagtgtcggg caaccgaaca acgccgcttc cgggtggttg ttcggtcttc     34080
     cgtcagtcga aaaaatagac aagcgacttt ttcgtcaagg atatgttaaa ctttttcgtt     34140
     gcatctatat agaggcggca ttgtttttct caagatgttc tggcttcaaa ccagttgatt     34200
     cttgattgat atattcatct acatccaaat cgttgtaacc tgggatctct atacgtaaat     34260
     atttcatggg ttcactatcc aatggaacag tacagtctag ccccatttta caaccaaccc     34320
     cattattagt tgacggatca agtttcgagc cttgggcacc atgaatcacg attaaatccc     34380
     gatccgcttg gaaacgtgta gcaatagccc attcaacctc ttccatgttg aaaatatcaa     34440
     tttcctcgtc tacaacaact acatgtttga tatcaaaact attggcgaat gcagccaata     34500
     ttgcgttttt ggcctctcct tcatttcgct tcttaataga gatgattgca tggtaacggc     34560
     aagtgcctcc aagactcata tgaaccgatt tcactgatgg caccgtttgt ttaacacttt     34620
     gaaaaagact ggcttctcga gggataccgc caagtaacaa atgttcatat ccagcaggta     34680
     cgatcgtatg aaaaatagga tggtttcggt gggtaattcc tgtaatttgt actacctcct     34740
     tgtcactacg agatccataa tatttcggaa attccccaaa aggaccttct ggttcacgaa     34800
     ctcgaggaag aatctttccc tctagtacga tttccgcgtg agctggaacg tcaatgtcta     34860
     ctgtctcaca tcgtacgact tcaagcggtt cgccacgtaa ggcactagcg atctctaatt     34920
     catctatccc aaagggggtg cttgcctgtg atgctagtag ggtaataggg tcaactccta     34980
     tggctattgc acattctaat ggttttcctg cttcttccgc ctgtctatat aagtgaaatg     35040
     tatgacgcgg gaggataaga atcccaagtc tgtctttact ggatacttgc aaacgatgga     35100
     tagaaacgtt ctgttttcgt gttaatggat cccgaacgat tagtaatccc gccgtaatat     35160
     aatgacctga atccttttca tgatgaatcg gtataggtaa aatctccatg agatcgatat     35220
     ttttcaaaat aacattttct ttcacaggag catctttttt atctacaaga cgataaggaa     35280
     gaggattaga aacagcttgg ataaatttag gtatcagccc agactgatct gtttctaaag     35340
     cctctgcaaa ttgctgtcgt gtggtacaaa ttccagatac aactgggatc gaataatcct     35400
     ctacttgtgt aaaatacact gctttctttc cgtctaattt tttcgcaatg gaagctactt     35460
     catactttag tttaaccctt ttatcgataa ccgctagacg ttcagttgat tgcatatatt     35520
     ctaaccatgt acgaaatgtt tttgccctca tgataatatc caagccccct gtcactgaaa     35580
     cggtattgtc aaaagtttat cctccacact cacggttttc tcctgagttt caaccgttgg     35640
     aagaaaaaaa gcttgccacc cccgttgttt tcggccatca ttgaggtaac cacacactca     35700
     acagcccaaa caaagaagga gtgacaagct ttgttacctc aattattagc ctatttgctt     35760
     caaatcatca agacccaata tcaaatcatt gtgtatctca tgggtgtgat cgtgggaaaa     35820
     tccctgaatc gtaaggactt ggacgaacct gtccaaaagc cgtaccgaaa acttcaggtc     35880
     gatgaccttc cgatcatcga tgtgccggaa acccttgatt accggaagtt gttggcggac     35940
     tacgaagccc agcacggacg tcctttgcgg cccatccagc gccgcgcgaa tgcgaaacac     36000
     cgtgttccgg attcgttgac ctgccctcgc tgccaggctc cctcttctta cctgtacgcc     36060
     aataacggcg gaaaagggca ataccaatgc aaagtgtgcc agtgccggtt caaccaccga     36120
     aatcggttca ccaatgcaag cggtctttcg ctgcccgcac tgcaaaaaga cgctggaaaa     36180
     gatcaaagga acgcaaagaa taccacatct ataagtgcaa gaacaacgat tgcccgtttt     36240
     accaggccaa ccttcgccgg atgaccaaga aggagcgcca acagtttcaa caggatcctc     36300
     aagccttcaa ggtgcggtat ttgtttcgag agttcttgtt tgactttctc ccgttggctt     36360
     cctcgtcgcc catccaaccg aaggtcgatt tgtcccggct ggctgcgtcg ccgcacgtat     36420
     tggggctcgt gttgacgtac tacgtcaact ttgggatgtc ctcgagggag accgcgcgca     36480
     tgaaggacat ccatggcgtc tcgatctccc atcagacggt gctcaactac gccaacagcg     36540
     ccgcgctttg gatcaagccc tttgtcgacc ggttcccgta tgagctgtcc ggttcgtttt     36600
     gcggggacga gacgtatatt cgcgtcaaag ggcgctggca ttacctgttc tttatgtttg     36660
     atgccgtcaa aaagatcgtg ctgtcgtatc gcgtctcgcc caagcgggac acgctctcgg     36720
     ccatccaggc catcgatgat gtcctggaaa gctgccgtcc ctcccagacg acttgtcgtt     36780
     tgtcgtggat ggcaacccga tttaccggct ggcgcaacac ttcttcgccc agcacgggat     36840
     ttcgtttgac gtccgccagg tgatcggcct aaccaacgaa gatccggtct cggaagagtt     36900
     tcgccctctc aaacagatca tcgagcgatt caaccggacc tttaaaggca actaccgccc     36960
     gacccatggg tttggtgcgg aagaaggctc ggtgtccttt gtgacgctgt ttgtggcgta     37020
     tttcaacttc ctgcgcccgc atagcgcact cgaaggccgg gtcccggtcg tcatcccgga     37080
     actggcggat cttccgcata tgccggcccg gtggacgaag ctcatcgcca tggcacaagc     37140
     gtttctccaa caagaggcgg cctgactttt ttgtccgccg gagcccgttg aacagaactc     37200
     ctgccggatt cggcgaagcg aacccttgac caaccgaaca ccgccaaagg taaaattcgg     37260
     tcatggcaag ggcggctttc ctattgcctt ctttttgtcc ccgtcgccct tgacgactct     37320
     ttcccacctt tggcgggtgt tggtcaaggg cgaatccggc cctccgcatg ccccacgatg     37380
     ctcaatggga tgatctgtgt ggagttttca tagaactttt gacgctacca ctgaaacatg     37440
     gctcttctgt aatcaataaa tctgttgtaa gagtgtcata acctctgctt cactcggttg     37500
     acgtgggtta aatcgcatca ttccgctttt gaatgaatct tttgcgatat cggggagttt     37560
     ttctttggga acgtcgacgt cgcgcaaacg tgtcggaagc ccaatctctt taactaacga     37620
     agcgaccgcc aaagccgctt gttgcacaag ggtattctgg tttcctttcc tccctaacaa     37680
     ttcggctatc ttggccgctt tttcaggctg aacaacggag ttaaattcca caacctttgg     37740
     aagtagcaac ccgattgcga caccatgaga tacatgacag tgacctgata aagcacttcc     37800
     aatcgcatgg gctaaaccta gaaatccgtt attaaaagcc attcccgcca ataagctccc     37860
     gtaggacata ccgatccttg cctctttatt agtaccatct tcaactgcac gacgcagata     37920
     gcgatttacc gttgtcattg cttcgatcgc tagaacatcc gatataggct gagaacgcaa     37980
     ggagaagaaa gtttcgattc catgggctag cgcatcaata cctgatgcag ccgttatttt     38040
     tttgggtaaa ctcatagtaa gcttagggtc taccaaagca atctcaggcg ccatatatgg     38100
     gcttgtaacc gtaaccttaa cattattctt ccaatcagag tagacaccaa agattgtaac     38160
     ctcactacct gtaccagatg ttgtaggcaa ggctattaaa gggatttcag actttttctt     38220
     gatgcgatta acaccagcgt aatcaccaat ggatcccccg tttgttgcga cgacacgtat     38280
     tcctttggcc gtatcgatcg gacttccacc acctatggcg acaatgcagt caaaaggctg     38340
     ttccttaaaa gcagctgccc cttgatcaat agtctccaag cttggatcag gttctacatc     38400
     ggcataaaca cagtactgta tattagacga ctctagagat tgaatgattc ctgccagtaa     38460
     gccagttgct tccactcctc tgtcagtaac taaaaaagca ctttttatcc ccatgtctac     38520
     cagctgattt ccgagttgag atgctttacc gtatccaaac tggattgatg taggaagatg     38580
     gaaagagaac tcaaattcaa cttccttttg gatataatgt ccgaccatct ttggttttct     38640
     ctcccctcat gctttttgca tttgctagtt tttaatctat ttctaaatgg acatgttttg     38700
     tttcgcagta ctccatcaag ccatctatac cccgagtacg tccaagccca ctctgtttgt     38760
     atccaccaaa ctctgcttca ggaaaattct tattgtaagt gtttatccat acagttccag     38820
     cctttatccc ttgagacatt ttcatggcgc gattcaaatt tgttgtccat acaccagcag     38880
     ataatccaaa atcactgtcg tttgcgatcc ttaatgcttc atcttcattt gaaaaagtct     38940
     gtaccgctag aactggtcca aatatttctt ctcgtaagat acgacaatcg ctttcgaggt     39000
     cagagataat tgtaggtgca aaaaagaatc ccttgttata atcaccgccc gtcaatctat     39060
     gtcccccagt gataattgtt ccttcctggc gcccgatatc gcaatactct tgtacaatat     39120
     ccagctgatt ttgtgataca agcgggccca tatctgacgt ttccaacaag ccattttcta     39180
     cacgcaaact ttctgcataa tctttcaatc ggtcaataac ttcgtcttta atagattcct     39240
     ggatcagtac tcttgaacct gccatacaaa tttgtcccgc agatataaag atggaccgac     39300
     cgatgatagg gatcgcttta tccaaatctg catcatcaaa gactatattc ggtgatttac     39360
     cgccaagctc gagcgctaat tttttaatat tactagctgc catttccatg attttttttc     39420
     ccgttgaagt atctccagta aaactaatca tatcgatctt cttactgcta gctagagcag     39480
     caccaatgga acttccaggt ccggtaacga tgttaacaat tccttttgga aagtatgaaa     39540
     tttcgtcgat gagcttgaat atttcaactg caatggaagg cgttaggcta gcaggtttta     39600
     caattacggc attacctgca gcaagagctg gggcaagttc acggatcatg agcaacgctg     39660
     gccaattcca aggggatata ataccgacaa cccctattgg ttctttcacg atcacaccga     39720
     aatttttagg ctctaactgg atcgagcgtc caaacacagc acgtgctgct ccagcaaaat     39780
     attttaacgt atcgatacat ccgctaatct cgacgcgtga ttcacgaatg gtctttcctt     39840
     gctcgattgt taataaacgc gccaaacgtt ccatattctc agacattttt tgagctaaag     39900
     acaacaaggc ttcataacgt ttcttcggat taacagacca gtcactttcc ttaaaagatt     39960
     ggcaagttgc gtcaatcgct tgtgttacat cttctactgt ggaattttgg gcgtaactga     40020
     tgagttcccc cgtagctgga ttgtatgatt caattagctc tttggataga gattcgatcc     40080
     attccccacc tatatagttg taatacacag gcacctcttt gcttgttata atttccattt     40140
     tgaacacctt ccccctttaa tacataaaat ttaatattgt caacatgtta ctaaatgatt     40200
     aggtgatatt atgaaagcga tttcaaaaca aattgataga aagtatatta aaactattct     40260
     taattttaaa ccaaatttat tatatagaac tttatctaaa attaagttac agtatctaag     40320
     catcttgttt tacattttct tatcaactta ttgtttagtg tgagtaaaat atttgtgggt     40380
     gacattcagg aatgattccc cgacgagggt tgcgaacttt tgttcgcgac gctcgtcggg     40440
     gccaccaagc gaagcgcggt agaaaaaagc aaatgtcatg caaaaaggac tctctccctg     40500
     ctatgatggt gatgaccaac atccataaaa caggagggag agagtccatg aaacatctta     40560
     ccacagaatg gcctttatta aaagagctgg aggaacaatt agtcagaact cttcaaaagg     40620
     tgttcgctgt cttgttggcg gcccttttgg aggagatcga tcaacaactg gcggaagcgc     40680
     gggacaagcg ccggtatcag ctgaaagaca aacggccgac cacgatccaa acgctgtttg     40740
     gagaagtgac gtttcgacgg aactactact atgatcggca ggcgggggcg tataccttct     40800
     tgctggatgc cgaactgggc tttgatggag cgcagtcgat cagcccttgc ctcgaggaaa     40860
     cggcggtcga gttggccgta gagtgctctt cctaccgcaa agcggcccat acgttggagt     40920
     cgatcgtggg gtatgcggtc atgagccacg aggcgattcg ccaactggtg ctggaggccc     40980
     ctgtctcgct gcaccaccct gtttcccaac ggcacggccg agtgctgttt gtggaggcgg     41040
     atggactctg tttcccgcca ggggaaaggg aaacgggcga aagaagagaa aatcctggcg     41100
     attcacgagg gatggaaacg aaacggttcg cagctcgagc tcgtgaaccg gcgccactac     41160
     ctccatgaag gggcgggaga cgtgtgggaa cggtttgaag agtggctgat gaacgaatat     41220
     gcctatgatc cgtgtcggga ccttttgatc atcaacggcg acgcggcgtc gtggatcacg     41280
     gcctgccggg agtattttgg gaagcgggcg tgctttcagc tggatcgatt tcatgtggcg     41340
     cgggagctgc gtcagtgtct tgtccggcca tccgcgttgg cgggaggtgc ggaagaagct     41400
     ggcgaaacaa gacgaagagg ggcttctcgt ggagctgaac agcgcggtcg gcacgttgga     41460
     ggacgaagcg aaagagaagc agatggctgc catgatccgc cggatcgagt cgatgccggg     41520
     atgcatccgg gactatcggg agtggctgtc ggagcaaggg gtggagacga ccggcatgcg     41580
     tccgatgggc cacgccgaga gcgtgatgag ccggtttgcg catcgggtga aatcccgccg     41640
     cagctggaaa gaccaagggc ttcgggcgtt tctgagggcg atggcggccc gaatcgacgg     41700
     gatttggcgg agaaatgggc agttggtgga ggaagaagag acccgaacgg cggcctcggc     41760
     ctcaacaaag tccaagcgga tcgaacaggc caaacggaag gccggacggt tatgggcaga     41820
     tgtggtgcgt cagaatctac cgtgtctgca gcggtcatcc gggacaccga tccatcaagc     41880
     gttgtcggcg ctccgggatg gtggttgggt gtaaaaaaat ggaatatcgt atcatcgcct     41940
     caagatgagg gatgagagtc cgaaagcgct tacgatatga attcctgaaa atggttcgct     42000
     aactagtgat tgacaacgcc cgtagtgaac cgaaaaaatg ttctccacaa agtcttgact     42060
     gactccttct gccaggtaga gttgaaaaag aagtaaataa tagtggatgt gtttacacat     42120
     cttaacataa tagattaata tcgaaatatg acaatgtaag aataacaatt aggtggtgga     42180
     aaagttgcgg attattgtgg gaatgtctgg agcaacaggt gctatctttg gaataagatt     42240
     attagaatct ttaaaggata taggggttga aactcattta attctatcaa aatgggcaga     42300
     aacaacgata aaattagaaa caaattattc tattgaggat gtcaaaaaat tggcgtcagt     42360
     tgtccactcc tcaaccaatc aagccgcatc tatctcaagc ggctcatttc gggtggatgg     42420
     catggttatt gcgccgtgta gtatgaaaac attagcagcc attcggatgg ggtactccga     42480
     aaatttgcta agtcgcgcag ctgatgttgt gttgaaagaa cgaaaaaagc tggtcctttt     42540
     aacacgtgaa atgccattaa atgatattca tctcgaaaat atgctttttt tgtcacgtat     42600
     gggcgcagtt atccttcctc ctgttccggc cttttataat cttccttcct ctattgatga     42660
     cattgttaac cacattgtag caagaacact agaccaattt ggtataaata atgaattaac     42720
     taagagatgg aagacttgat ttaaaagcaa taaaagccgc atattttaaa gttaaataag     42780
     tgcaggagtg ttcctaaaaa ttaccttaga ataggactta tttgtgctcc tcacaatttg     42840
     agaagcgaac gccatccgcc ccttctgctg ggaaaaaagg gttcgacggt caggatgatg     42900
     gaaagttccc gtctcaaaaa aactgggaat atccaaatga tttaaaaacc aaagaaaaga     42960
     ggttggcctt aaaaggtcgt tttacagcct tttgggacag accacaactt gggcattcat     43020
     ttccatgttt gggtagagaa aaaaagtttg ctcatggacg ttttctacaa tgattcctta     43080
     atcgataaaa tttacggcct ctatgttctc cctgatagtg agggtatctt gttttgctag     43140
     gtcaaaagtt gatcgatcga atattctttt aagtgaaagg tcaacctcgg tatatcatat     43200
     taaccgtgac ggtgctttga ttttgctttt tgtctctcct ttgcacggcc gcggacagca     43260
     gcaggaactg tgttgcaagc tgcttctttg agccgccgag cgccgggctt ccccaggctc     43320
     cagccggatg gccaagggcc agaaggcggc cagccgggaa gaccggcgcg gacttttaat     43380
     gattaattat tttttaactc atttaaatac ttctctaaag cttcttcaat aagcaaataa     43440
     atattcttct cctgcaaaat cgactgcatc ttcaactctt tgtgcaggtc cgtccgaata     43500
     tcgaaggaaa cacgctttct ttccactttc tttccttcct ttcttggttg gttgtcatct     43560
     tcgtttaaaa ctgtattgtt ttcttcccct acaggatcgg tcagcacttg cgtaggcgtg     43620
     atgacttttt gctggcgctt catgtttttg atgtcatcta ctttggacac gttccatcat     43680
     ctccttgtag aagttttcat actgctccaa cgcctggttc aactcattgt tttcctcaaa     43740
     gccgtatagc gacaggcgtc cgatcggcgc cttgcgggtg atgatcgttt tgaacacctc     43800
     gttcggataa tcttcctcga tcatttcatt gaacgccttc gcgtcgttgc ggcggacgtc     43860
     gttcatggtt ctgagaatgc ccagcagcct ggtattgtgc cgcccatgca ccctcgctcc     43920
     ctcaacggat tccataaaat tcgggaccgc cgagtagcac caattggagc actcgaacat     43980
     catgatgaca tactggcttg cgcacaaggc gtttgtcgtc tgctcgctca acgaaggcgg     44040
     cgtgtcgata acaatgaaat cgtaacgatg ccggatcttg tccaacgtat cgtccagtat     44100
     caaggtcggc tttcccttat acctaatata ttttccaagg tacgtctccc ctgtgtaaat     44160
     ccaacggggg aacgtggcca ggaagttgtt ggccggaagc agatccaacc tgtcgttgac     44220
     cttgactatg tacggctccg gatccctctc ctgcatcgct tcgagaacgg atttctccgt     44280
     gaattcgttg gatggctttc gcgaaaggag ctctgtcaaa ttcccctgcg agtccatgtc     44340
     gacggccaaa accctgtatc cgtccctgct caacaaatag gcgaggactc ctgttgtcgt     44400
     ggactttccg catccgcctt tctggatgcc catggtgatg gtgatggcca cttatatcac     44460
     cttcctttct tccaaggttt gtttcttctt ttgtttatat gatttattct acgttatttt     44520
     atagattcct tcaatgattg caaaaaataa gagcgttaga aacgcttcca cttcaattcc     44580
     gatatgagtt gccgcaccgc ctccgactcc gacatgtttt ttgtctgaca gtatttctgg     44640
     agaagttcgt aaagctcgtc gtccaagcgc acggtaatgc gatatgactt ggacttttct     44700
     tcttttgggc gtccacgttg gagctttttg cgttcgacgc gcagatcatc atggacgaca     44760
     acatcgaggt atccgaaccg ctcataaatg tttttatgtt tctctacgaa ttcttcccac     44820
     attcggggaa tttcttcaag aagccggagg tactcttcct gcagcctctt tgtttcctct     44880
     ggggaccgag ggcgccgctt gccgaattcc tgaaggacga gaacctgaaa atcgtgccgc     44940
     tcatagcatc ttccttccat catcgccatc acctctattt tttgtccgac actatttgtg     45000
     tttattatac ctccagactt tcactaattc aacatttttc gtctgacata aaattaagat     45060
     accagtgcca attttgcctt tcaaagcaca aattaatcga atcggcgttt ttcagaacaa     45120
     aaatcgctgt tttcgagctg aaagataagg ttttgtcatt ttgatttttt tgccaaatag     45180
     gggtatattg tacttaaaaa tgtgatattt tcgacaaatt tcaccccgag cgttaagggg     45240
     aagaagggga tgaagaaagt tggactggaa agaggtaaag cggttcgcct atgccggcca     45300
     ggcgtttatc cctgtcaacg tggaaaacag aggggattcg gtcaaacttt ttttcaggag     45360
     cggggaaact aagctgcttg acgtgcaatc gagtctgttt ttgaagcggc ttctgacctt     45420
     ctttggcaca agcatttcga tcaaccgcca tcggtatggg gagttggtgg ggaaaaagca     45480
     gctcgttccc atcgtattgt cgtatggctt taccatcatt ccgtttaacg ttcgcgagcc     45540
     ggtcggccga caaagccgtg tagggtggtt tgtgtcaaga gagattgagc agttccggca     45600
     aagatctccc cagtgcacca cgatccatct tctttccgga catcagattc ctgtgtttca     45660
     ttcccgcaag ttctgcattg accaactcaa aaatgcaaaa tggattgaga tgtgctacgg     45720
     ggagattcat gaaccgcatc gcaggcaatg gataaacggc agcgcagttt gtgaaacggt     45780
     ggttatgtag tgaaatgaat gatttatcgc aataaaccgg aaggatcggc ggcattggag     45840
     gccgcttttt tcttttttcg ctttgaaatc gtctttgtct atgggtgttc tcggttgata     45900
     tgatgttggc aaatcgaaag gaggtaggaa aatggccgct tcagaaatgg tgtcgggccg     45960
     cactcttgtt ttggacttct acgccggaaa ggacagcgac ggaaaggaca tcatccgctc     46020
     gcaaaccttc agagtgaaga gcgacgcaag tgtccaatcg ctttatgatg ccgccgccgc     46080
     catcgccagc ttgtcgagcg gcagcttgcg gtacgtgcgc acgacgttga ccagccatat     46140
     tatcaatgca tgatgagagg gggaatgaac aatgaagacg ttggaactga cgtttaacgc     46200
     tcaagcgggg ccggcgcgga ttttgatccg ctatcccaag gagccggttg atccggtgca     46260
     agtgaaaacg gtgatgaacc agctcgtagc ggcaaatgtt tttatgaccg gcaacgggga     46320
     gctggtgagc ccgaagagcg cccgcatcat tgaacgcgaa acgcaagaca tccagctgcc     46380
     ataacgcatc tgtcatgaac ggaaggtttc tcgccttccg tttttgagca ttgaaagggg     46440
     gaaaagcaat ggatttgttt tcgatgatca gtgaagtttc cttcccgatc cttgtttcta     46500
     tctatcttct gtatcggatg gagacgaagc tggatcagtt gaccaaatcc attcaagatc     46560
     taactatcgc attgagccga ggtccgcaga attgatgatg ggagggaatt cgaagtggaa     46620
     ttggtggagc tgcttttccg ggcggagaaa aggctgtccg ggctgcatcc gttggtggcg     46680
     gataaagcta gagcgttgat tcgaaaggct tatgaggaag gcatttatat catcattacg     46740
     caagggtttc gaaccgtcga ggagcagaac cgcctgtatg cgctggggcg gacaaaacct     46800
     ggacggattg ttacgaacgc ccgtggagga tacagttatc ataattttgg attggcgttt     46860
     gacgtttgtg tctgcaatgt tttcaagggg acgctgatcc ccagctggag cctcgaccgt     46920
     cggtggtttc gcgtcggtca gatcggaaag tcgcttggcc ttgaatgggg cggggattgg     46980
     aagagcttta aagattatcc ccattttcaa tatacatttg gcctttcgct tgcacagctg     47040
     cgggcgggaa aaaggccgcc ggccgctgtc gtggctaaaa aatagactgt ctcgcccctt     47100
     ccggaagtgg aggggatttt tttaaatctg acaaaagcac gttatgtcag atttttgtct     47160
     gacgttaaat acgttgaagg aagcaacacg aagccgcttt gccgctctcc cactttttgt     47220
     ccaaaaatct tactcatctc cctcatggac aagggggtgt catattttgc ataccgtcca     47280
     gcccatcaaa gatagggaaa aaatcgaagc gatgaaaaag attttgcgtg cttcgtcgtt     47340
     gagagacgag cttcttttta cgatcgggat caatacgggg ctgcggatca gcgatatttt     47400
     ggctctgaga gttggggatg tgaggaatca aaaaggcgtt gtcgaacgca ttgagatcgt     47460
     ggaaaagaag acaaaaaaga ctcgggttgt cgcactgaac agaaaaactc gccgcctgat     47520
     cgagctgtat ttagcgcagg agcggccgca cgcccgcggc gacgagccgc tgtttcggag     47580
     ccaaaaagga ggccgggcga tcagccgtca gcatgcccac tacatcctga accgggccgc     47640
     caaagcagtt gggattgtgg atcgcatcgg cacccactcc ctgcgcaaaa cgttcggcta     47700
     tttcgcatac aaacaaggaa cggacttggc catgatccaa aaaatcctca atcactccag     47760
     ccaggccgaa acgcttcgct acatcggcat tacgcaggag caaatcgatg aagtcactgc     47820
     agggcttgat ctgtgaacga agcccgcgcc ggtcttcccg gctgaccgcc ttctggccct     47880
     ttggccatcc                                                            47890
//

If you have problems or comments...

PBIL Back to PBIL home page