(data stored in ACNUC7421 zone)

EMBL: AP007174

ID   AP007174; SV 1; linear; genomic DNA; STD; FUN; 1282697 BP.
XX
AC   AP007174;
XX
PR   Project:PRJNA20809;
XX
DT   21-DEC-2005 (Rel. 86, Created)
DT   17-DEC-2016 (Rel. 131, Last updated, Version 7)
XX
DE   Aspergillus oryzae RIB40 DNA, SC103.
XX
KW   .
XX
OS   Aspergillus oryzae RIB40
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-1282697
RA   Sawano T., Tanaka T., Machida M., Yamada O.;
RT   ;
RL   Submitted (03-JUN-2004) to the INSDC.
RL   Contact:Toshihiko Sawano National Institute of Technology and Evaluation,
RL   Genome Analysis Center, Department Of Biotechnology; 2-49-10 Nishihara,
RL   Shibuya-ku, Tokyo 151-0066, Japan
XX
RN   [2]
RX   DOI; 10.1038/nature04300.
RX   PUBMED; 16372010.
RA   Machida M., Asai K., Sano M., Tanaka T., Kumagai T., Terai G., Kusumoto K.,
RA   Arima T., Akita O., Kashiwagi Y., Abe K., Gomi K., Horiuchi H.,
RA   Kitamoto K., Kobayashi T., Takeuchi M., Denning D.W., Galagan J.E.,
RA   Nierman W.C., Yu J., Archer D.B., Bennett J.W., Bhatnagar D.,
RA   Cleveland T.E., Fedorova N.D., Gotoh O., Horikawa H., Hosoyama A.,
RA   Ichinomiya M., Igarashi R., Iwashita K., Juvvadi P.R., Kato M., Kato Y.,
RA   Kin T., Kokubun A., Maeda H., Maeyama N., Maruyama J., Nagasaki H.,
RA   Nakajima T., Oda K., Okada K., Paulsen I., Sakamoto K., Sawano T.,
RA   Takahashi M., Takase K., Terabayashi Y., Wortman J., Yamada O.,
RA   Yamagata Y., Anazawa H., Hata Y., Koide Y., Komori T., Koyama Y.,
RA   Minetoki T., Suharnan S., Tanaka A., Isono K., Kuhara S., Ogasawara N.,
RA   Kikuchi H.;
RT   "Genome sequencing and analysis of Aspergillus oryzae";
RL   Nature 438(7071):1157-1161(2005).
XX
DR   MD5; 61305fad74596497f39eeffd06733a27.
DR   ENA-CON; BA000056.
DR   BioSample; SAMD00067075.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00004; U2.
DR   RFAM; RF00005; tRNA.
DR   StrainInfo; 491981; 0.
XX
CC   URL:http://www.bio.nite.go.jp/dogan/Top
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1282697
FT                   /organism="Aspergillus oryzae RIB40"
FT                   /strain="RIB 40"
FT                   /mol_type="genomic DNA"
FT                   /note="SC103"
FT                   /note="phrap>=30:101-1282697"
FT                   /db_xref="taxon:510516"
FT   CDS_pept        join(5922..5928,6097..6246,6858..6916,7411..7446,
FT                   7513..9921,9997..10155)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000001"
FT                   /old_locus_tag="AO070242000001"
FT                   /note="Alanyl-tRNA synthetase"
FT                   /db_xref="GOA:Q2TZ34"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ34"
FT                   /protein_id="BAE65489.1"
FT                   /translation="MKEDQLIAYWLCFCDDESRDCSQVLPDPRQKRDRITGKLSFCYLT
FT                   FKVMNVNRQTPEHSTIFTLPLPLPHFEDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAI
FT                   NYSWELMTKIYGLDPQRLYVTYFEGSKEGGLSPDLEAKELWKAVGVPEDHILPGNMKDN
FT                   FWEMGDQGPCGPCSEIHYDRIGGRNASNLVNQDDPNVLEIWNNVFIQYNRESDRSLKPL
FT                   PNKHVDTGMGFERLVSVLQNKSSNYDTDVFSPLFQTIKDITGARPYQGRFGVEDADGID
FT                   TAYRVVADHVRTLTFAISDGVAPNNEGRGYVIRRVLRRGARYARKYFRVEIGNFFSKIV
FT                   PTLVDQMGDMFPEVKRKQQDVMEILDEEEISFAKTLDRGERQFEHYAQQAKAKGDDKLH
FT                   GADVWRLYDTFGFPVDLTRIMAEERGLRIDDTEFEEARSRAKEASKGQKKAAADTVKLD
FT                   VHDLGKLEKMNDVPKTNDSAKFDRGNITAQVKAIYHGKSFHLSTEQIPEGDQLGLILDR
FT                   TNFYAEQGGQENDTGRIVIDGQAELEVGDVQLYAGYVLHTGFMKYGSLSVGDEVICEYD
FT                   ELRRWPIRNNHTGTHILNFALKEVLGDGVEQKGSLVAAEKLRFDFSHKSPVTDKDLERI
FT                   EDISTEYIRQNCAVYSQEVPLATARQISGVRAVFGETYPDPVRVVSVGVELEEILKNVK
FT                   DPRWEKVSIEFCGGTHVQKTGDIKELVILEESGIAKGIRRIIAVTGEDAHEVQRVALGF
FT                   EKRLDRLEAMALGPEKEQDAKQIQVDLSQLLISAVQKSRFRERFAHINKQIIDSQKAQQ
FT                   KLESKKALEAITSYFENPENKDKSWLVARLPISANAKAVSESLNHVKSKLQDKTVYVLA
FT                   ADSNQGRVVHGCYMSKGASASDWAAIVSTAVGGKAGGKGPTSIGNGTNPDKTDEAIALA
FT                   SDYLSKFKL"
FT   exon            5922..5928
FT                   /number=1
FT   exon            6097..6246
FT                   /number=2
FT   exon            6858..6916
FT                   /number=3
FT   exon            7411..7446
FT                   /number=4
FT   exon            7513..9921
FT                   /number=5
FT   exon            9997..10155
FT                   /number=6
FT   CDS_pept        complement(join(10377..10568,10619..10756,10816..10961,
FT                   11142..11211))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000002"
FT                   /old_locus_tag="AO070242000002"
FT                   /note="U-snRNP-associated cyclophilin type peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="GOA:Q2TZ33"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2TZ33"
FT                   /protein_id="BAE65490.1"
FT                   /translation="MDSQVTSSAKTPNPVVFFDITLGGESLGRIKMELFTSITPRTAEN
FT                   FRQFCTGESKSPQGRPQGYKNSKFHRVIKDFMIQGGDFVNGDGTGSRTIYGTPRFQDEN
FT                   FILKHDQPGLLSMANSGPNTNGCQFFITTTATPFLNNKHVVFGQVVEGMDVVRMIENTR
FT                   TTRDKPNQDVTIIQCGEM"
FT   exon            complement(10377..10568)
FT                   /number=1
FT   exon            complement(10619..10756)
FT                   /number=2
FT   exon            complement(10816..10961)
FT                   /number=3
FT   exon            complement(11142..11211)
FT                   /number=4
FT   CDS_pept        12376..13551
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000003"
FT                   /old_locus_tag="AO070242000003"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ32"
FT                   /protein_id="BAE65491.1"
FT                   /translation="MFRIIVGVKYCFRYNQRNRQLRNEETGEPIDLVTMPRTHRRRREK
FT                   KLMSMDEVNERFPLVKYKVWRSSRANEGLPTAGGISAPNSRPQSLKGEHNVLSTTVGAP
FT                   SYTTNSAIKGHRRCDSTTSQLSIPAEHAQTALVQPQEKENAGQAFAVLADGTHGPDAKQ
FT                   LQNCNSLEDEDVNNPIRTAVPAELLPNPGDSCAICLDTIEDDDDIRGLTCGHAFHASCV
FT                   DPWLTSRRACCPLCKADYYVPKPRSDPGGLTTNPERSGRRNTTRLAVPTQPQSVFIGGR
FT                   VNPFRNPLAISDRQDPSRNGTQSSRLTAPRFWRIQAHHSQPANNPSSSAPEPSDRRDWR
FT                   TRFTPTRSLNLSFLSFSARNHYSRESMPHPTDTARSAADRTPSQLEAQSGA"
FT   exon            12376..13551
FT                   /number=1
FT   CDS_pept        complement(join(14185..14775,14828..14971,15031..15209,
FT                   15263..15587))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000004"
FT                   /old_locus_tag="AO070242000004"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TZ31"
FT                   /db_xref="InterPro:IPR024382"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ31"
FT                   /protein_id="BAE65492.1"
FT                   /translation="MHRLTSLLSLSLAIASGTKALDASIFTFGPSPPWQNMKTPVVTDD
FT                   VARHILELRMNVPTVSALGKWDQDIVELLDRYGGARHSLFGGDIDYKDVTRSLVILEGI
FT                   GAGLGSAIQQEYQGDLMIGSPSANYLIDGFLDSTSEANSDGYVTATKNYCKSDSGGGIS
FT                   FDVLQTIENCIPKGSAFEAVAHVFGKELLGIVKVAETWVDEQSLTAVLKISFQVPDEYV
FT                   GSGSVVDSLTSVLHGLRALSSEVSQVTAVLLPTINQGKGLKRKVDPREAVKEEASVRSS
FT                   SAAVMTTLQRQTHPVCFTSNSSCNLATDSCSGHGFCYKKSGSANDEAASDCYACKCKST
FT                   IVTKEDGTVQKIRWGGPACEKRDISSPFFLIAGISVLVVMAAGTAVGMLFHIGQNELPG
FT                   VISAGVGPAKAQK"
FT   exon            complement(14185..14775)
FT                   /number=1
FT   exon            complement(14828..14971)
FT                   /number=2
FT   exon            complement(15031..15209)
FT                   /number=3
FT   exon            complement(15263..15587)
FT                   /number=4
FT   CDS_pept        join(18183..18261,18322..18341,18401..18802,18860..18907,
FT                   18970..19047)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000005"
FT                   /old_locus_tag="AO070242000005"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TZ30"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ30"
FT                   /protein_id="BAE65493.1"
FT                   /translation="MALPPKFAGHRLRAGTDQLPQHTLELYLDYACPFSAKMFDTFYSS
FT                   VRPTLASQYRGQLQVIFRQHIQPWHPSSTLMHEAGAAVLRVAPEKFWEFSAALFKQQKD
FT                   FFDVSVVNETRNRTYERLAKVAGHIGVEEREVLKLLTVSDKASDNGELNTGNFVTDDIK
FT                   KMVKADRAVGVHVSPTVYFNGIEEPGISSSFTATQWGQWLAKNVI"
FT   exon            18183..18261
FT                   /number=1
FT   exon            18322..18341
FT                   /number=2
FT   exon            18401..18802
FT                   /number=3
FT   exon            18860..18907
FT                   /number=4
FT   exon            18970..19047
FT                   /number=5
FT   CDS_pept        complement(join(19176..19218,19424..19506,19550..19694,
FT                   19751..19854))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000006"
FT                   /old_locus_tag="AO070242000006"
FT                   /note="cyclin-dependent protein kinase CDC28, regulatory
FT                   subunit CKS1, and related proteins"
FT                   /db_xref="GOA:Q2TZ29"
FT                   /db_xref="InterPro:IPR000789"
FT                   /db_xref="InterPro:IPR036858"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ29"
FT                   /protein_id="BAE65494.1"
FT                   /translation="MDIDMSRRNKKPRLLLESERERLDEFIDSIHYSARYSDDQFEYRH
FT                   VQLPKNMLKKIPADYFDSSKGTLKLLWEEEWRALGITQSSNFTDGQSLGWEHYEVHEPE
FT                   PHILLFKQSGASCMKFRQGI"
FT   exon            complement(19176..19218)
FT                   /number=1
FT   exon            complement(19424..19506)
FT                   /number=2
FT   exon            complement(19550..19694)
FT                   /number=3
FT   exon            complement(19751..19854)
FT                   /number=4
FT   CDS_pept        join(21617..21659,21766..21816,21877..22003,22058..22223,
FT                   22278..22985,23067..23547,23606..23874)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000007"
FT                   /old_locus_tag="AO070242000007"
FT                   /note="molecular chaperones HSP70/HSC70, HSP70 superfamily"
FT                   /db_xref="GOA:Q2TZ28"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ28"
FT                   /protein_id="BAE65495.1"
FT                   /translation="MSDEVYEGAIGIDLGTTYSCVANYEGTNVEIIANEQGSYTTPSFV
FT                   SFTEKERLIGEAAKNQAAMNPKNTIFDIKRLIGRRYDDPIVKKDVESWPFKVVDQGGSP
FT                   AVEVEYLGETKTFTPQEISSMVLMKMKEVAETKLGKKVEKAVITVPAYFNDNQRQATKD
FT                   AGAISGLNVLRIINEPTAAAIAYGLGSGKSDKERNVLIYDLGGGTFDVSLLNIQGGVFT
FT                   VKATAGDTHLGGQDFDTNLLEHFKKEFQRKTGKDLSGDARALRRLRTACERAKRTLSNA
FT                   TQTTVEIDSLFDGEDFNSSITRARFEDLNAKSFSGTLEPVQQVLKDSGIEKSKVDEIVL
FT                   VGGSTRIPRIQKLLSDFFDGKKLEKSINPDEAVAYGAAVQAGILSGKATSAETQDLLLL
FT                   DVVPLSLGVAMEGNIFAPVVPRGQTVPTIKKRTFTTVVDNQTTVQFPVYQGERTNCADN
FT                   TSLGEFTLAPIPPMRAGEAALECVFEVDVNGILKVTATEKSSGRSANITISNAVGKLST
FT                   TEIEQMIDDAAKFKSSDEAFTKKFESRQQLESYISRVEEIISDPTMSMKLKRGNKEKIE
FT                   SALSDAMAQLEIEDSTPEDLKKKELALKRLITKAMATR"
FT   exon            21617..21659
FT                   /number=1
FT   exon            21766..21816
FT                   /number=2
FT   exon            21877..22003
FT                   /number=3
FT   exon            22058..22223
FT                   /number=4
FT   exon            22278..22985
FT                   /number=5
FT   exon            23067..23547
FT                   /number=6
FT   exon            23606..23874
FT                   /number=7
FT   CDS_pept        complement(join(25264..25406,25669..26520,26579..26699))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000008"
FT                   /old_locus_tag="AO070242000008"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ27"
FT                   /protein_id="BAE65496.1"
FT                   /translation="MFQLRTKLIRHERVRLVEGCLYPIRQFSSIQGRAKDASQSGNDAP
FT                   KARSLPSGASSSRAPSRKSNLPPANLNSRKTDSDKPRPRRVFDARSLAAPSANGQSTNI
FT                   LRSTSLRSPRKGPSIRARRPRPPAKSSAPKLRKGGRPQRSKNTDMEESDSSQIENVYRE
FT                   LAEKSRPTPSRYEPQAPDFSNLKETWPSFPTGTTANTAEVVEKLSFLSDRFPNGYVTPY
FT                   ELGMRLFRGQFVQFLDEEEKAQAIAEAKKLSQQRADNYSQRKGDLVEPEDVGFIPLSVE
FT                   DRKSLVQSFIQGAYPKLSTEKAASPILSEVKKNLRNNESYQAAGYALSIAFFAASKRSL
FT                   TSLCPFSVTFSICSCAFRTSSGLAIFFFCIS"
FT   exon            complement(25264..25406)
FT                   /number=1
FT   exon            complement(25669..26520)
FT                   /number=2
FT   exon            complement(26579..26699)
FT                   /number=3
FT   CDS_pept        complement(join(27900..28212,28276..28739,28791..29344,
FT                   29390..29671,29763..30104,30159..30677,30736..30780,
FT                   30864..30918))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000009"
FT                   /old_locus_tag="AO070242000009"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TZ26"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ26"
FT                   /protein_id="BAE65497.1"
FT                   /translation="MQGYSFTPPTGPPREGHKNYVFVDEHNRHKRLKVMRACNGCRKRK
FT                   IKCDAATTNTWPCSACTRLKLVCVPPTVGQDSEFPTGQGVEANPTNAIGASNTTESFSS
FT                   FSMPQGYRDSGQATVGGIPPYSDGMGMFPQFTHSASHQTGMYEVGSPALAVSHQTYQQQ
FT                   QIFPSQTESLGTIESGVYGDHEQSTAEDLSEVLGELKIDETGIAPYIRQQKKEKGEPEI
FT                   PIQDEVEEPLPPLSTGAGSTIRIPPELMPSDEEVTNYFKIYFDDIHPYVPVVHRSHLYY
FT                   QWQYDRSSISPLLLEALFACAGRQSDDPAQGAQWLALANRHESSFMDVPRLSTIQAMLL
FT                   LLKARESVPKKGYYYRSWQTVKTIVSMAKDLEIDEHYNTHAEHRLCDLNPIECLVQTRV
FT                   WQALLVVEVMIGAPQGRSDYGVTPDTVCMDPALDIKDLDQFEIDRSRQYAYFVQNAHHI
FT                   RIITDTYHKIKRQKDWGANPKFVEKNPLFTDWLQGLPSDLQITYPPDGSPPWIPSHFVA
FT                   NMHSHCHLGIILLHRPQLLASKSFAAGGGWKMHMALCYSSAKYLCRLQEAILQRFGLPG
FT                   LLSMQRGINFAIYCIMTCTMLHLVAITSPDPNFHTDARDYFARHMRILERCSSAWPMPE
FT                   MQAQIDSLRLAFSADVNRPFELKPTFPYGSPSEPYHPSPPPLDSQYQPHVSQVSGGVRG
FT                   RVGYNPYPITPPISASTEDSKSDCSQLHSLGMMPPQPVSSQSLNAPLVDENSWDPTRII
FT                   TQWDMAFSMAPSTVNTNSPPMAMDHSVQAPLAGQYTVQYGQTTKVTPVTPPQAISPPQF
FT                   NGQQVLFTARDWQQSVASVYDPNGLKRRWNYSVDIGTEHTQKRAR"
FT   exon            complement(27900..28212)
FT                   /number=1
FT   exon            complement(28276..28739)
FT                   /number=2
FT   exon            complement(28791..29344)
FT                   /number=3
FT   exon            complement(29390..29671)
FT                   /number=4
FT   exon            complement(29763..30104)
FT                   /number=5
FT   exon            complement(30159..30677)
FT                   /number=6
FT   exon            complement(30736..30780)
FT                   /number=7
FT   exon            complement(30864..30918)
FT                   /number=8
FT   CDS_pept        join(33542..33779,33837..34210)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000010"
FT                   /old_locus_tag="AO070242000010"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="GOA:Q2TZ25"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR039796"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ25"
FT                   /protein_id="BAE65498.1"
FT                   /translation="MASEMQNSNPTILNAADLPKRLRPAPSRKPGIFGNGLFASALPFV
FT                   YASKLPPEGFTSSSESESDDDDLLEEPIDEQEIYDLVSTISDPEHPISLGALAVVSLPD
FT                   ISITPTLPYVPASPLRTVTVLITPTITHCSLATVIGLGVRVRLEQSLPPRFRVDVRIKE
FT                   GTHSTADEVNKQLADKERVAAALENGTLMGVIAKMLETCQ"
FT   exon            33542..33779
FT                   /number=1
FT   exon            33837..34210
FT                   /number=2
FT   CDS_pept        complement(join(34374..34936,35041..37269,37326..37471,
FT                   37529..37548))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000011"
FT                   /old_locus_tag="AO070242000011"
FT                   /note="U5 snRNP-specific protein"
FT                   /db_xref="GOA:Q2TZ24"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031950"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035655"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ24"
FT                   /protein_id="BAE65499.1"
FT                   /translation="MDDLYDEFGNYIGEAADSDEDGQHDEVKPRAFAFNEAFGEEEDEE
FT                   LYGQQSMEVDEAPSNAVILHEDKQYYPSAQQVYGTEVETLVQEEDAQPLSEPIVAPVQQ
FT                   KKFAIEETELPRVHFSREFMTDLLNFPEQIRNIALVGHLHHGKTAFMDMLVMQTHDLTE
FT                   RLEKRAGKRKEVQLRYTDIHFLERERGLSIKSAPMSLVLQGTKGKSHLFNILDTPGHVN
FT                   FVDEVAASSRLVDGVVIVVDIVEGVQSNTEQIIKHAVLEGLPLTMVVNKMDRLILELKI
FT                   PPNDAYFKLKHVIEEVNTVIESVLPGQGEKWRLSPEKGNVAFACASMGWCFTLQSFAGM
FT                   YAETYPQIETSDFALRLWGDIFFNPTSRKFTRKGVEENSKRTFVKFVLEPIYKLYSHAI
FT                   SESSEDLKRTLASVGIHLKPSQLKSDAKELLNLVCGQFFGPATGFVDMIVQHVPSPVEG
FT                   AQMKLDRYYTGPLDSKVAAAMTTCDADGPLVVHITKLFTSTDASSFNAFGRIMSGTAQP
FT                   GQQVRVLGEGYTPEDEEDMVTATISDTWIAETGYNIMTSGVPAGNLVLLGGVDNSIVKT
FT                   ATIVPLKLEDDEDAYIFKPIRHMTESVFKVAVEPVNPSELPKMLDGLRKVNKSYPLIST
FT                   KVEESGEHVILGTGELYMDCVLHDLRRLFSEMEIKVSDPVTRFCETAVETSAIMCYSIT
FT                   PNKKNKITMIAEPLDDGIAEDIESGKVSIKDPIRKVARFFEDKYDWDKLAARSIWAFGP
FT                   DELGPNILQDDTLPSQVDKKLLGSVRDSITQGFSWGTREGPLCEEPIRNTKFRLTDVSL
FT                   ADQVIYRGGGQIIPTARRAIYSSFLMASPRLMEPIYSCTMTGPADAVASVYTVLARRRG
FT                   HVLSDGPIAGTPLYSVRGLIPVIDSFGFETDLRIHTQGQAAVSLVFDKWSVVPGDPLDR
FT                   DVKIKPLEMAPAMATARDFVLKTRRRKGLAEDVTVSKFLEPELWRGLKESGVLDS"
FT   exon            complement(34374..34936)
FT                   /number=1
FT   exon            complement(35041..37269)
FT                   /number=2
FT   exon            complement(37326..37471)
FT                   /number=3
FT   exon            complement(37529..37548)
FT                   /number=4
FT   CDS_pept        join(37968..38032,38100..38149,38207..38282,38356..38845,
FT                   38914..39432)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000012"
FT                   /old_locus_tag="AO070242000012"
FT                   /note="acetyl-CoA acetyltransferase"
FT                   /db_xref="GOA:Q2TZ23"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ23"
FT                   /protein_id="BAE65500.1"
FT                   /translation="MSSLPPVYIVSSARTPVGSFLGSLSSLTAPQLGSHAIKAALSKAD
FT                   GIKPSDIQEVFFGNVISANVGQNPARQCALGAGLNESTVCTTVNKVCASGLKAVILGAQ
FT                   TIMTGNADIVVAGGAESMSNAPHYLPNLRVGAKYGNQSLVDGIMKDGLTDAGKQELMGL
FT                   QAEECAQDHGFSREQQDDYAIRTYEKAQAAQKAGLFDEEIAPIELPGFRGKPGVTVSQD
FT                   EEPKNLNPDKLRAIKPAFIPGSGTVTAPNSSPLNDGAAAVILVSEAKLKELNLKPVAKI
FT                   LGWGDAAQQPSKFTTAPALAIPKALSHAGVAQDAVDAFEINEAFSVVALANMKLLGLAE
FT                   DKVNIHGGAVAIGHPIGASGARILTTLLGVLKARKGKIGCAGICNGGGGASAIVVESLV
FT                   "
FT   exon            37968..38032
FT                   /number=1
FT   exon            38100..38149
FT                   /number=2
FT   exon            38207..38282
FT                   /number=3
FT   exon            38356..38845
FT                   /number=4
FT   exon            38914..39432
FT                   /number=5
FT   CDS_pept        complement(join(40270..41420,41478..41666,41772..41817))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000013"
FT                   /old_locus_tag="AO070242000013"
FT                   /note="Fe2+/Zn2+ regulated transporter"
FT                   /db_xref="GOA:Q2TZ22"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ22"
FT                   /protein_id="BAE65501.1"
FT                   /translation="MDELTRWQRNDLEKFNIESAVELSAYIPEAVLRAELHRRSGIRDS
FT                   DNDKPSCGSKDRGVYNTPVHVMALFLILLLSTLACSFPVLARRFPRLPIPRRFLFLSRH
FT                   FGTGVLIATAFVHLLPTAFVSLTDPCLPRFWSESYRAMAGFVAMVSVFVVVVVEMFFAM
FT                   KGAGHVHGSEYDHLIGDVGGDTASVYRNEGPEYLQESTENIHLEGMPDGSCTSSLPQSS
FT                   GHLLSDFTDDGSQSQSANLVAHKEDVEVDLEGPDSYDGSRTNAHRNPYSQSELARPSPA
FT                   ISCEHPDTMLTIQNPQRQLLQCLLLEAGILFHSIFIGMALSVATGTSFIVLLVAICFHQ
FT                   TFEGFALGSRIASLIPDLFAPSSMKPWLMSLAYGTTTPIGQAIGLILHNLYDPTSTAGL
FT                   LMVGITNAISSGLLLFAGLVELLAEDFLSESSYATLHGRKRVEACIAVACGALLMALVG
FT                   AFA"
FT   exon            complement(40270..41420)
FT                   /number=1
FT   exon            complement(41478..41666)
FT                   /number=2
FT   exon            complement(41772..41817)
FT                   /number=3
FT   CDS_pept        complement(join(42360..43303,43340..43997))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000014"
FT                   /old_locus_tag="AO070242000014"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR018791"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ21"
FT                   /protein_id="BAE65502.1"
FT                   /translation="MSCHVCSRAPTSRLKYLCPSCARNQLYQLRIENARILLENESLGQ
FT                   QINETVSSTSILEALSERPDSGHLSLKNEGHIAWPIQIIANEKTRSSLRIKLLKSRTEN
FT                   LRLEIKNKKRNISEHKLTLAQRRSDAGSAKYQLAEREAAILSGIHNNAKRTDHLWHSLH
FT                   SKTAEARIFLCREAAYLYNLQQKVKKRDGEVKEAYTIGGIPIIDLRDMNGKLRSLFRAT
FT                   PSQISTSFSYIAQLLVLVSHYLSLRLPAEITLPHRNYPAPTIYAPSGSYLLREMLPASS
FT                   TLQPSPSSLTPSRTADPRSCFPRPRPLSIDRSLPKLAREDPGTYALFIEGATLLAWNIS
FT                   WLCRTQGLHITSDSWEEICSIGKHMWQLLVAPPAQTSTLVRAFAGRDVQSKVKITRDPP
FT                   KTIIQRTKSFPMLGHYSHGTVHSFLAASEGTEYTRTWRLPTPTKVADKLKSSLLGEMAS
FT                   AEWEVLEKKEWDNIPEAPLQSVHESSANREDEKDELNISNIEPSENNCAEPESPKEPVK
FT                   SNRLKGTSGWTKLRNR"
FT   exon            complement(42360..43303)
FT                   /number=1
FT   exon            complement(43340..43997)
FT                   /number=2
FT   CDS_pept        complement(join(45379..45572,45636..46643,46732..47281))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000016"
FT                   /old_locus_tag="AO070242000016"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TZ20"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2TZ20"
FT                   /protein_id="BAE65503.1"
FT                   /translation="MALLQTSLIWAVYAIVVAILAAVASVFIYTYQTPRDRCPSVILTC
FT                   IVAVTTLLATVLLVPVDVALVSSTINPALGRRQDWATQSEVDRILLCLKIVYYFLYSLD
FT                   ALLCLIVIPFIYFLYEEYDEVASETEQQSFGQRFWAAFKYTVSFLAIVVVLFLVGFFVP
FT                   VAKDGDGGGLDYFKHLLTENRGERALTFALGLLITIGLCLYVLYTSTGLALFPITLIKE
FT                   GPSVISPTLKATTAVQLCSNRERQRQLEGRCRGNPGLLSSKDRRELDTLVREERTLIRR
FT                   QRLADEAHGKHQNWLMQLWLKFGAIFRPFQLLSGVIFSLLALIIWISMLLTTIDKAKNS
FT                   FCKQRCGYILGHINVFNPINWVFVQSAKIFPVDYVIFTLLVLFLFSSSIVGISAVGIRF
FT                   LWIRIFQIRKGHTSPQALLLATAMLMLIILALNYSTSMILAPQYATYGPQTFCDRELSF
FT                   SEKQPDCSRDKHLIRPCSEVADSLAAKQVCTPSVVSTFLNRVTMNFPFFGAIFFWAQFA
FT                   FLGIYLLVMVTALLHSPKLDERQLDEDAEEAEEESLLANTRGRAETTWEDITSRLRRQN
FT                   EVDRAGA"
FT   exon            complement(45379..45572)
FT                   /number=1
FT   exon            complement(45636..46643)
FT                   /number=2
FT   exon            complement(46732..47281)
FT                   /number=3
FT   CDS_pept        join(47795..49760,49812..50125,50211..50378,50446..50875,
FT                   50907..51062,51111..51186,51269..51710,51778..51925,
FT                   51980..52461)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000017"
FT                   /old_locus_tag="AO070242000017"
FT                   /note="mRNA cleavage and polyadenylation factor II complex,
FT                   subunit CFT1 (CPSF subunit)"
FT                   /db_xref="GOA:Q2TZ19"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2TZ19"
FT                   /protein_id="BAE65504.1"
FT                   /translation="MQCYTELLPPTGVTHSLALPFISESANNLVVARTSRLQIFSLLDV
FT                   GPRPGGIEEQGVPKLVLEREYALPGTVTDLCRVKLLNTKSGGEAILLAFRNAKLALIEW
FT                   DPGRYGICTISIHYYERDDSTSSPWVPDLSSCGSILSVDPSSRCAVFNFGIRNLAILPF
FT                   HQPGDDLVMDDYGELDDERLGSHGLESGTDCDMTKESIAHRAPYSSSFVLPLAALDPSI
FT                   LHPISLAFLYEYREPTFGILYSQVATSNALLHERKDVVFYTVFTLDLEQRASTTLLSVS
FT                   RLPSDLFKVVALPPPVGGALLIGSNELVHVDQAGKTNAVGVNEFSRQVSSFSMTDQSDL
FT                   ALRLEGCIVERLSETNGDLLLVPTTGEIVLVKFRLDGRSVSGISVHPIPPHAGGDIVKS
FT                   AASSSAFLGDKRVFLGSEDADSILLGWSVPSSGTKKPRPQARHTEEDSGGFSDEDQSED
FT                   DVYEDDLYATVPEVVVDGRRPSAESFGSSLYNFREYDRLLNIGPLKDIAFGRSFTSLGG
FT                   EENAGNDSGLELVASQGWDRSGGLAVMKRGLELQVLNSMRTDLASCVWTASVAHMEEAV
FT                   SKTTTQAENRECHQYVVVSKATSAEREQSEVFRVEGQELRPFRAPEFNPNEDVTIDIGT
FT                   LIGKNRVVQILRSEVRSYDGDLGLAQIYPVWDEDTSEERMAISSSLVDPYVAILRDDST
FT                   LLLLQADDSGDLDEVELNEQIANSKWTSCCLYFDKTGIFSSISATSDELAQNSMTLFLM
FT                   TQDCRLFIYRLPDQKLLAIIEGVDCLPPVLSSEPPKRSTTREVLTEIVVADLGDSWSSF
FT                   PYLIIRSRHDDLAVYRPFISITKSVGEPHADLNFLKETNLVLPRITSGVEDQSSTEEVI
FT                   KSVPLRIVSNISGFSAIFRPGVSPGFIVRTSTSSPHFLGLKGGYAQSLSKFQTSECGEG
FT                   FILLDSKVLCFILLCLTYCILSFHTGCHSYYPWTIQQIPIGEQVDHLAYSSSSGMYVIG
FT                   TSHRTEFKLPEDDELHPEWRNEMTSFFPEVQRSSLKVVSPKTWTVIDSPAEHVMAVKNM
FT                   SLEISENTHERKDMIVVGTAFARGEDIASRGCVYVFEVIKVVPDPKRPEMDRKLRLVGK
FT                   EPVKGAVTALSEIGGQGFLIVAQGQKCIVRGLKEDGSLLPVAFMDVQCHVSVVKELKGT
FT                   GMCIIADAVKGLWFAGYSEEPYKMSLFAKDLDYLEVLAADFLPDGNKLFILVADSDCNL
FT                   HVLQYDPEDPKSSNGDRLLSRSKFHTGNFISTLTLLPRTSVSSEQMISDVDAMDVDIKI
FT                   PRHQMLITSQNGSVGLVTCVSEESYRRLSALQSQLTNTIEHPCGLNPRAFRAVESDGTA
FT                   GRGMLDGKLLFQWLDMSKQRKVEIASRVGANEWEIKADFEAISGEGLGYL"
FT   exon            47795..49760
FT                   /number=1
FT   exon            49812..50125
FT                   /number=2
FT   exon            50211..50378
FT                   /number=3
FT   exon            50446..50875
FT                   /number=4
FT   exon            50907..51062
FT                   /number=5
FT   exon            51111..51186
FT                   /number=6
FT   exon            51269..51710
FT                   /number=7
FT   exon            51778..51925
FT                   /number=8
FT   exon            51980..52461
FT                   /number=9
FT   CDS_pept        complement(join(53433..55062,55132..55277))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000018"
FT                   /old_locus_tag="AO070242000018"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TZ18"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR024061"
FT                   /db_xref="InterPro:IPR037141"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ18"
FT                   /protein_id="BAE65505.1"
FT                   /translation="MEGFDTMAMPYLASPLSLSNIQGADYLNSMPGMDLPDQRSNFESE
FT                   TFVSGDDIAFPQTGLSAPLKRFHSGYDDPFSDMVAPFDPAPAEQQHSDSSIDHNNKLLS
FT                   FSMPVYNFTLLDYSLRRTSLSLSAQLHGMFFLAESPWTTSPAENAPPQQGAELTCYRRN
FT                   LFQITGSVTLPRSLRYIMTEQGDRIPILAQELTVSATESVEGNSVKIISVPWKTPAANA
FT                   NPSTEDSGHPTATNNPNNPKVEKEPPAIPLDIMAGQDLDTDYATFPIAWKRLQFRVATA
FT                   NNGRRKELQQHFVVRLKVVATLSTGTKIPICEVHSGPVIVRGRSPRNFQSRKDLPLSGS
FT                   AAASRKNAQASHSASINRTPTSETAPRSGQPPSKFKTTGKSSSPETSASQTGVTAQRAS
FT                   PDWTQIPQSTGGALPSAALPRSSIYSQSSPEYSRTAETQQRRASAIAAPINLSLLDDDG
FT                   GGDPSRLNDSARPTSSYASETPQKIINTEGSAPPAKMRKLSHGIPQPPARSTSSSLPLL
FT                   NTTNMQQPFASTLPFPNESADLLYEYFPLGLDDWQAPVDAVYRPHVVHHTNMPEMKFVA
FT                   TRGRSKRYFAAEDVF"
FT   exon            complement(53433..55062)
FT                   /number=1
FT   exon            complement(55132..55277)
FT                   /number=2
FT   CDS_pept        complement(join(61519..61635,61694..64206,64307..64425,
FT                   64741..64823,65486..65539))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000019"
FT                   /old_locus_tag="AO070242000019"
FT                   /note="beta-glucosidase-related glycosidases"
FT                   /db_xref="GOA:Q2TZ17"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ17"
FT                   /protein_id="BAE65506.1"
FT                   /translation="MQPSLICCGVVSIDGTLWILSWHSLFRALMAPREDMLPPGWDDLD
FT                   RQMGQLFMMGFDGTSVDPQIRSLIENYHLGSILLTAKNLKSAEDATRLVLELQTIARDA
FT                   GHPVPLLIALDQENGGVNSLYDEIYIRQFPSAMGIAATGSKALAHDVAVATAQELKAVG
FT                   INWILGPVLDVLTNVRSQPLGVRTTGDDPQEVSQYGVEFMKGYKEAGLVTCGKHFPSYG
FT                   NLEFLGSQSDVPIITESLEQLSLSALVPFRNAILHGIDSMMVGGVSMSSAGFHVMHACL
FT                   SEQVVDDLLRKKMKFDGVVVSECLEMEALTHNIGVGGGTVMAKKAGCDIILLCRSFPVQ
FT                   QEAITGLKLGVENGIIGRARIEQSLRRVLSLKAKCTSWEQALNPPGLSSLTQMQPSHTT
FT                   LSTRAYNSSITVVRDKKTLLPLSNIIEPSEELLLLTPLVKPLPASAVSRSVTEHPNLSI
FT                   EPMTWDRTSSVLSGESVFRELGRSLSRQRNGRVLHTSYTANGVRPIHENLIDRASAVIV
FT                   VTADANRNQYQYGFTKHVSMICRSQFTPSGESREKPVVVIAASSPYDFAMDPSIGTYIC
FT                   TYDFTETALEALVKILYGEIIPMGSLPGSINRSQKLHQARQHWLVENWNEERDSHALDS
FT                   LLDAVREDCTQTQRSELLGVTSCSFLLRREEIDEAHFVVRNSSTQALYGFCSTYFFRST
FT                   GTGVIGALIVDPARRKLSIGASLHNRAIRTLVQRKGVKRFQLGSRLPGIYLGIPSANPV
FT                   ERKRLRQWFANLGWNTALSRPVCSVVLRSLSSWKPPNGLIQGLQNADVVYDLVYGWDYA
FT                   DTILDHIKTNSRQGVIDIYKVALGGAPNCGIIRATRPGDGAILGSVVTYNGRATLAEHM
FT                   PALKAMHSSTGGISSPVISPSVGEYATVMQGLIFMGIKQHRKQGADSVIMDCVDGDSNF
FT                   DSLSGIMGFSTLHSFEEVNCDAATWTMMTAS"
FT   exon            complement(61519..61635)
FT                   /number=1
FT   exon            complement(61694..64206)
FT                   /number=2
FT   exon            complement(64307..64425)
FT                   /number=3
FT   exon            complement(64741..64823)
FT                   /number=4
FT   exon            complement(65486..65539)
FT                   /number=5
FT   CDS_pept        join(66425..66426,66503..66564,66622..66770,66843..67706)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000020"
FT                   /old_locus_tag="AO070242000020"
FT                   /note="glucosamine-6-phosphate isomerase"
FT                   /db_xref="GOA:Q2TZ16"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ16"
FT                   /protein_id="BAE65507.1"
FT                   /translation="MRVIIRETALEASEYIADYIISRIKAFKPTEDQPFVLGLPTGSSP
FT                   EVIYKTLVQRHRAGEISFRNVVTFNMDEYVGLPRDHPQSYHSFMYKHFFSHIDISPQNI
FT                   NILDGNASDLAAECASFEAKIARCGGIELFLGGVGPDGHIAFNEPGSSLSSRTRVKTLA
FT                   YDTILANSRFFGGDVDKVPRMSLTVGIQTIMEAREVVIVATGAHKALAVEKGLEGGVNH
FT                   MWTLSALQLHQHPLIVCDRDATLELKVKTVRYFEAIEQSGTDARTQGPPLVYRPRTYVP
FT                   APMGASKTNQQPTPASTPPRVPKDLRINTQLNQTLDDEELTPDSMSSRMVDSAISGLDS
FT                   TLKGDLMFDRMGTRVISH"
FT   exon            66425..66426
FT                   /number=1
FT   exon            66503..66564
FT                   /number=2
FT   exon            66622..66770
FT                   /number=3
FT   exon            66843..67706
FT                   /number=4
FT   CDS_pept        complement(join(68218..69232,69308..69792))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000021"
FT                   /old_locus_tag="AO070242000021"
FT                   /note="NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="GOA:Q2TZ15"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ15"
FT                   /protein_id="BAE65508.1"
FT                   /translation="MSYLPLPPRQLFYDGKVQSASSGKTFQSVNPSDATPLAEIQVASH
FT                   SDIDAAIAAADRVFPSWSQTPPIARARILQKASLILRERNDEIARVESLDSGKAFTETS
FT                   TVDVVTGADVLEYYANLVGGGGLNGETTQLREDAWVFTKKAPLGVCAGIGAWNYPIQIA
FT                   LWKSAPCIAAGNTMVYKPSEFTPLHAQTLAEIYKEAGLPDGVFNIVYGAGDVGAYLTSH
FT                   PTIAKVSFTGQVATGMKVAGSAAGNMKYVTMELGGKSPLVILPDAELENAVDGAMMANF
FT                   YSTGQVCTNGTRVFVPSSMKAAFENRLLEKMQYIRPGPLFDEATNFGPLSSAIHLEKVI
FT                   SYIRHGIETDKATLLYGGLGKPQVSKELENGFWVRPTIFTDCKDDMLIVKEEIFGPVMS
FT                   ILYYETIEEAVRRANTTELGLAAGVFTKDVNLAHRIIDQLQAGITWVNTWGESPAEMAV
FT                   GGWKKSGLGVENGRRGIEAWVKNKSTLVDMNGAVATVFAKL"
FT   exon            complement(68218..69232)
FT                   /number=1
FT   exon            complement(69308..69792)
FT                   /number=2
FT   CDS_pept        join(70983..71229,71359..72740)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000022"
FT                   /old_locus_tag="AO070242000022"
FT                   /note="choline dehydrogenase and related flavoproteins"
FT                   /db_xref="GOA:Q2TZ14"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ14"
FT                   /protein_id="BAE65509.1"
FT                   /translation="MATTNDFPASDVNSYDYIIVGGGTAGCVIASRLAQYLPNKRVLVI
FT                   EGGPSDFNDDRVLNLREWLNLLGGELDYDYPTTEQPMGNSHIRHSRAKVLGGCSSHNTL
FT                   ISFRPFEYDCQRWEQQGCKGWSFETFTRVLDNLRNTVQPVHARHRNQLCKDWVEACSTA
FT                   MNIPIIPDFNKEIRQNGKLTEGVGFFNVSYNPDDGRRSSASVAYIHPILRGEEKRPNLT
FT                   ILTNAWVSRVNVEGDAVTGVNLTLQSGVKHTLRAKKETILCAGAVDTPRLMLLSGLGPQ
FT                   NQLSSLGIEVVKDIPGVGENLLDHPESIIMWELNRPVPPNQTTMDSDAGIFLRREIPNA
FT                   AGSDGRSADIMMHCYQIPFDLNTSRLGYDAPINAFCMTPNIPRPRSRGRIYLTSADPNV
FT                   KPALDFRYFTDPEGYDAATIVAGLKAAREIAQQAPFKDWIKREVAPGPKIQTDEELSEY
FT                   GRRVAHTVYHPAGTTKMGDVYRDPLAVVDPQLKVRGLKNVRIADAGVFPEMPSINPMLT
FT                   VLAIGERAAELIAEEAGWKREQPRL"
FT   exon            70983..71229
FT                   /number=1
FT   exon            71359..72740
FT                   /number=2
FT   CDS_pept        complement(join(73509..74429,74534..74905))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000023"
FT                   /old_locus_tag="AO070242000023"
FT                   /note="N-acetyl-glucosamine-6-phosphate deacetylase"
FT                   /db_xref="GOA:Q2TZ13"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ13"
FT                   /protein_id="BAE65510.1"
FT                   /translation="MPGKTATPPRITKFTNCRIIRGNQLVEQDVWIDSLSGKILRDQEA
FT                   FYELHMSPDEVLDLGGRILAPGLIDVQLNGAQGFDFSVPKSSKEEYDEGLRMVNKGLAK
FT                   TGVTSYLPTVVSSTPEVYWKVLPSLGPSGAKHRAEDGAESLGAHVEGPFISPGRNGIHK
FT                   TDVLRAAKSFEDVVGCYGKENMFGPSKTVRMITAAPEVGSMVNNIPNLTAQDIIYSIGH
FT                   SDATYEQAMSATKQGATMITHLFNAMRPFYHRNPGVFGLLGQNEHRRPFYGVIADGIHL
FT                   HPTSIRIAYNAHPNGLILVTDAMKLCGLPDGVYDWTNGERIVKTGARLTLEGSDKIAGS
FT                   SATLIECVNNFRRWSGASTAEALNAATATPARLLGLEGVKGTLDCDADADLVVLTDAPD
FT                   PYSGPTLTIDQVWKRGVKIYDAEKEATNSRV"
FT   exon            complement(73509..74429)
FT                   /number=1
FT   exon            complement(74534..74905)
FT                   /number=2
FT   CDS_pept        join(77895..78482,78561..79168,79267..79362,79433..79664)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000025"
FT                   /old_locus_tag="AO070242000025"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="GOA:Q2TZ12"
FT                   /db_xref="InterPro:IPR010291"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ12"
FT                   /protein_id="BAE65511.1"
FT                   /translation="MGNSTVGDDNPAEKEFAAATSDPEAGQDSVTGKPWMYKPWKIGPL
FT                   TLPWFAHPMTQLVLVSFVCFLCPGMFNAVSGLGGGGQVDATDVNKANTALYSTFAVVGF
FT                   FAGSIANRIGLRLTLSLGGFGYFLYVASLLSYNHNSNAGFLVFSGALLGVCAGLLWCAQ
FT                   GAVMMSYPREHEKGKYICIFWVIFNLGGVIGSLVPLGQNLHSTAGRVNDGTYIAFMVLM
FT                   AVGFVLAWGLSDSKYIMRSDRSRVIVMKNPSWKSEFKGLLDTLRSDYYIVLMFPLFLSS
FT                   NWFYGYHFNSVNGAYFNVRTRSLNSCLYWLMQMVGAFVFGFTLDMKFFSRSMRAKINFV
FT                   LLFLLTLGVWGGGYAFQRQYTRADAPLDTDWSDSGYVGPMFLYMFYGFYDAAFQTCAYW
FT                   FMGSLTNNARKLANFAGFYKGIQSAGAAGMWALDLDKAPFMTELASCWGLLLGSLLVAS
FT                   PIIFFKIKDHVDIEEDLKFSDETAHDVMGNIPMEEQTSGKKEEKRESVA"
FT   exon            77895..78482
FT                   /number=1
FT   exon            78561..79168
FT                   /number=2
FT   exon            79267..79362
FT                   /number=3
FT   exon            79433..79664
FT                   /number=4
FT   CDS_pept        complement(join(80156..80731,80821..80879,80952..81105,
FT                   81164..81214,81277..81393,81445..81460,81535..81658,
FT                   81709..81825,81888..81992,82052..82400))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000026"
FT                   /old_locus_tag="AO070242000026"
FT                   /note="carboxypeptidase C (cathepsin A)"
FT                   /db_xref="GOA:Q2TZ11"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ11"
FT                   /protein_id="BAE65512.1"
FT                   /translation="MRGYEFLSVLPLVAASWALPGSTPASVGRRQLPKNPTGVKTLTTA
FT                   NNVTIRYKEPGAEGVCETTPGVKSYSGYVDTSPESHTFFWFFEARHNPETAPITLWLNG
FT                   GPGSDSLIGLFEELGPCHVNSTFDDYINPHSWNEVSNLLFLSQPLGVGFSYSDTVDGSI
FT                   NPVTGVVENSSFAGVQGRYPTIDATLIDTTNLAAEAAWEILQGFLSGLPSLDSRVQSKD
FT                   FSLWTESYGGHYGPAFFNHFYEQNERIANGSVNGVQLNFNSLGIINGIIDEAIQAPYYP
FT                   EFAVNNTYGIKAVNETVYNYMKFANQMPNGCQDLISTCKQTNRTALADYALCAEATNMC
FT                   RDNVEGPYYAFAGRGVYDIRHPYDDPTPPSYYNKFLAKDSVMDAIGVNINYTQSNNDVY
FT                   YAFQQTGDFVWPNFIEDLEEILALPVRVSLIYGDADYICNWFGGQAVSLAANYSQAAQF
FT                   RSAGYTPLKVNGVEYGETREYGNFSFTRVYEAGHEVPYYQPIASLQLFNRTIFGWDIAE
FT                   GQKKIWPSYKTNGTATATHTQSSVPLPTATSMSSVGMA"
FT   exon            complement(80156..80731)
FT                   /number=1
FT   exon            complement(80821..80879)
FT                   /number=2
FT   exon            complement(80952..81105)
FT                   /number=3
FT   exon            complement(81164..81214)
FT                   /number=4
FT   exon            complement(81277..81393)
FT                   /number=5
FT   exon            complement(81445..81460)
FT                   /number=6
FT   exon            complement(81535..81658)
FT                   /number=7
FT   exon            complement(81709..81825)
FT                   /number=8
FT   exon            complement(81888..81992)
FT                   /number=9
FT   exon            complement(82052..82400)
FT                   /number=10
FT   CDS_pept        complement(join(84021..86212,86298..86482,86572..86816))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000027"
FT                   /old_locus_tag="AO070242000027"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TZ10"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ10"
FT                   /protein_id="BAE65513.1"
FT                   /translation="MTNLTASPSSSNMAENEAKGKRKASTAGLPANARPVKRRASKACC
FT                   CCRARKVRCDVVENGSPCTNCRLDQVDCIVTESKRRKKSRVEVDNPNHQLSQSPAEAPE
FT                   DGSLLRRLSECHGLSDVAPASPSQRSVDLDQGQHMPHLLYQSQVSRIGAGPERYRRRMA
FT                   PNPAVPATMPLHHVTSQIQQLLDPSFANARSGGIILPDYIRGLPPRLQKEDIDYLAMKG
FT                   ALTVPDVGLRNELLKAYIHYVHTYMPLLDLEDFLQTIAQNDGIRRMSLLLFQAVMFAGT
FT                   AFVDLKHLQAAGYSSRKAARKSFFQRARLLYDFDYEVDRISLVQSLLLMTYWYETPDDQ
FT                   KDTWHWMGVSLSLAHTIGLHRDPGNSRMDVRRQRMWKRIWWSTYTRDRLIALGMRRPMR
FT                   VKDDDCDVPMLTLDDFEFHPFSPEIVSMVGNSEVLQNVSHQKELALMFIEKAKLCLCVS
FT                   HVLSAQYSVLSHKFGGTMETTMMLVPKKSAAETFEVRRCDQELEDWLAHLPSEIQYAPM
FT                   APAKLTEAQEVLHSHRALLKMVYLTTSSALHRPQVLPAMPFPSTDAELQDISRNKVRFA
FT                   AVEITNIAQDLHALDLTRYFPTTGVTVLLPAVIIHLLDIKSSDPNVRMVSLQRFYQCMR
FT                   ILQRLREIYASADFATSFLEAAIRKAGIQLTVAPQDVQSRNNCTFDSVRLNTLTPPPDS
FT                   LAQKIPDLTYPKTSGTRLAGEAAEASGFASTPPPSDGSENGSTNNINPHYHQDAFAIPN
FT                   LDSDLSISELMDLANDAEVTQNDFDALINFDDTGAELFAADDGLDLNGNPKGQGYGFNI
FT                   GTMDNVPDLFGTESKGVGLTGLGNGQLHEDRTSTTLGANEAPRATELDGIADLEAELGL
FT                   NL"
FT   exon            complement(84021..86212)
FT                   /number=1
FT   exon            complement(86298..86482)
FT                   /number=2
FT   exon            complement(86572..86816)
FT                   /number=3
FT   CDS_pept        complement(join(92613..92668,93616..95869))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000029"
FT                   /old_locus_tag="AO070232000020"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TZ09"
FT                   /db_xref="InterPro:IPR024312"
FT                   /db_xref="InterPro:IPR039915"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ09"
FT                   /protein_id="BAE65514.1"
FT                   /translation="MSTPLSPLTSSRQNSQPFSPGISGLVAQEDVVDHIVAPKDSLENG
FT                   FSSPRKLVDDLSADTERRQSYTATQQPNEQDLDYDNTDPILPPSSPFQYEARDDTVDFQ
FT                   MLRSQQLSATPRKRSYEHVPEDDAFDDRYRKGTARRDMPDISVYADEDVSINNEQSSRE
FT                   SAGQEIGNSLMEEKHNEGMSTVIHENNSNDTSNDKEDTSLHEEDDDMIDDTNDSMDETC
FT                   LSTFSAVTNVDMTTFAHLRGDSPFKAGQPSKLHGDLDGKDEPGTPTTTRKSPRISGLVD
FT                   FGSPTPRKRDARVSINPSETPNLLDLSDQPSFFPRKRYSMQNERYSPSRRSPLRTVREP
FT                   TRSPAKVSLLDFDLPAAPTPRSIPSVTPRELESLKSGFLSEISSLKATLSGKEAEVASL
FT                   KQAVADAERRVGETSEELRNEAARRETLEIEQAEWQRRGQEMEDVLQSVKAEMMEGERE
FT                   REKLMRRAEEMEKSKEKLESRVVELETQLSSARKPASNDMGSSKSAQYGKTAEETAKEV
FT                   QDAVEKVARELHTLYKSKHETKVAALKKSYEARWDKRLREAENKLKAAYKDNERLKAER
FT                   DAALSEVSQPDISMITREKDEHEAEKRVLEAQIKGLQQELGALKDDSERLHHELKIERA
FT                   EKGELVAAVDEWLAIQQNQPSIQDGPQSPRPQEDNSPEPTPIEVAPEDFRQSISRSSSS
FT                   SIRPPSTGSSNGEKKIPRIPAPGSRQARGNSGGKSGIAVFTPGRSGIMGSIERMGRGEC
FT                   WDEGLKGAPARTCAKN"
FT   exon            complement(92613..92668)
FT                   /number=1
FT   exon            complement(93616..95869)
FT                   /number=2
FT   CDS_pept        complement(join(97220..98322,98544..98909,99007..99079))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000030"
FT                   /old_locus_tag="AO070232000019"
FT                   /note="permease of the major facilitator superfamily"
FT                   /db_xref="GOA:Q2TZ08"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ08"
FT                   /protein_id="BAE65515.1"
FT                   /translation="MVLTQQRRQPASDDQFPTTQLFLLAICRVAEPIALTSIFPYSWVM
FT                   VKDFNVANGSDASFFAGILVSAFSLAEALTGMFWGSLSDRVGRKPVLLSGCVGTMASLL
FT                   IVGFATNFWVALFGRALGGILNGNIGVIQTMVGELVKRPEHERFPSLFYREGLFGRFPY
FT                   LLPNLVCSVLLLLSIFFSWLFLQETHPDMQPCTATENLDGRSAERPLLATAGATANAGA
FT                   DLRAESYGTFNQVHLYDEEDWLVRADGSRPEKIPQRQTIFTKRVTMLIVALAIFTYHSM
FT                   TYDHLLPIFLQDKTLRDVPTVGNSILKFPGGVGLSTRTVGLIMSTDGIIALFIQSVIFP
FT                   ALAHYLGVWRLFVIVTILHPVAYFMVPFLIFLPRSLLFFGIYGCLVVRNILAIIDYPVL
FT                   LILIKQASPSDSVLGKINGLAASAGAASRTIAPPIAGYLYSTGAELDCTALAWWGSTLA
FT                   AIVGAVQLWFMERKKHSSATIQPAAPCHYLPNEAHPRRDAVHIIVTGTDVGTPDA"
FT   exon            complement(97220..98322)
FT                   /number=1
FT   exon            complement(98544..98909)
FT                   /number=2
FT   exon            complement(99007..99079)
FT                   /number=3
FT   CDS_pept        complement(101797..103422)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000032"
FT                   /old_locus_tag="AO070232000017"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TZ07"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ07"
FT                   /protein_id="BAE65516.1"
FT                   /translation="MTTDPSANKRLHITPFTAELLPSVLPSSVRPLATEISFHSIPTFP
FT                   ENNYGYVTLPAMEADKIKKKLNGSILKGRKFKVDVARPQKRQRDENEDESDKAVFNKVS
FT                   PSSKKTKKQKDIGNVLEGYELQTDRQVKRGWTESTSSLKERRKEEKRNKKKDDRTGKSQ
FT                   AKSKYTEKAECLFRTKIPPNRASSAEVEQDKQSKKKKKKSLQESVVHEFSKTVTQPSFL
FT                   RTDSDGAAPTFTFEEGKGWIDGSGNIKEQASDRIRSDQYTPGKIAGAKERPKSKSSLKA
FT                   KASSQSLDDACAVRGGVDLKESDESDESEDWTSSSGATSSDDSATDSESEASVTSGSSD
FT                   TSDISNDQHEQGAQSTPQGVEKVPGPEAKADQDVAQAEKSDEPHSQEVHPLEALFKKPT
FT                   PGTTDVKPDPDASAQFSFLGQGDMESEEEPQEVTEPQTPFTKKDIQSRELRSAAPTPDT
FT                   ALAGRNKKWNSLEQHDSMDVDDEPYINTPVPKFGSALKDESEFTKWFWEHRGDNNRAWK
FT                   KRRRDAAKEQRQRENRRKGMKGKS"
FT   exon            complement(101797..103422)
FT                   /number=1
FT   CDS_pept        join(104782..105156,105214..107298)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000033"
FT                   /old_locus_tag="AO070232000016"
FT                   /note="putative Zn-finger protein"
FT                   /db_xref="GOA:Q2TZ06"
FT                   /db_xref="InterPro:IPR039301"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2TZ06"
FT                   /protein_id="BAE65517.1"
FT                   /translation="MGNSQTKEARPPFTPNRRSHGGGHGRSPYGDRHHSEGSRSTRGSR
FT                   PDLSILGIGGSSERDVATLEHRRETKQEREARRLERERVARIKERERSMREEHVDGGYL
FT                   VTQGVYTGTEDFNKAVVRQLMIERRLAPFWRGLNDFSDSWTEHQLMAAARGLPIPPPDE
FT                   IPSELEYKNPPKITEGAKESTDTKGIQHLTVPITSRSQSYGSDASQSSTPAHSLPSPTS
FT                   PLASGTSSSPLFRTRAKTLASLTTSKHGTQADPAPREIQLPRDPFVNGQPIEAYLYKDA
FT                   AECPICFLYYPPYLNRTRCCDQPICSECFVQIKRPDPHPPEHGDSDPNAPAAAAEGDAA
FT                   DNQDSQLVSEPAACPFCVQPEFGVTYAPPPFRRGLTYASDPSARPNFTSPVSSTSSLSS
FT                   GNVTAVTGRRRAASLSANDPTVITTDKVRPDWAQKLANARAHAARRSAAATALHTAAYL
FT                   MNSNGNGGDSRTFNIGRRGVMRRAGGSDPHSSSSRTGSPALQALAFLTDRRSATNDMDS
FT                   AEEGSGNIAPPRNTSRRNRIDDLEEMMMMEAIRLSLASEEERRKREEKEAKKEAKKREK
FT                   EAKKAEKTARKTGLYSTNASGSALDVPTGLGRVASSSSSVIGEESTPAGKGKEVDRASP
FT                   EAPIDATSTCSVTAPASMNAVYPPMNSADQHQSMQSSVPQTSPRELSKPSHLRHVSSAS
FT                   SSFSSLVESMSGDHTGTTEGNGSSTEPLFNFRSLAAVIGDEDKREESAEHVENTLSNPQ
FT                   AEGSASRSVLPVDHAHTDDSVFNADAATPAGSDFALQESQGYMIPKELETRSVEITDST
FT                   GNPQATS"
FT   exon            104782..105156
FT                   /number=1
FT   exon            105214..107298
FT                   /number=2
FT   tRNA            complement(107944..108015)
FT                   /locus_tag="AO090103t00001"
FT                   /product="tRNA-Glu"
FT                   /note="tRNAscan-SE"
FT   CDS_pept        109177..110001
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000034"
FT                   /old_locus_tag="AO070232000015"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TZ05"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ05"
FT                   /protein_id="BAE65518.1"
FT                   /translation="MAILDKESRSRGLRMPSLSAIKSRKKNAESPPRRDSSSDEVVIPA
FT                   RMDSAPGRFLHSQEKDLPPNPLPSPPPFPSAPADSLSNQSPYHHINPTPKYEDRPLPKF
FT                   PRVPVPKREEPPAPVPALVPAPAPVQQVTPPSSEDHYPIHYQEHIQPIEDPLESFIPEP
FT                   EPEPGVDGTSASVEPVSSEESNGPWTPPDYEPIAAPLNQLHYACYQEHRSMPTANNLWH
FT                   PLPCMTCQKYDREVRHRCVFCCLRICASCYQTLQKCPNRSLAQLMKTIPSHE"
FT   exon            109177..110001
FT                   /number=1
FT   CDS_pept        complement(join(110371..111324,111425..111553))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000035"
FT                   /old_locus_tag="AO070232000014"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TZ04"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR025239"
FT                   /db_xref="InterPro:IPR039249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ04"
FT                   /protein_id="BAE65519.1"
FT                   /translation="MAPHQNPAPDVGDEEEDDYMSMVIEEPQQKETFTQKKRRQQREAE
FT                   ARAKVPSKAERAAQEAERRDAALATSTLNPSNKGFQMMAKLGFKPGQALGKSQGERVSN
FT                   QKSDSKIGGRAEPLNLVFKEDRGGIGLDTEKKRKFREEAEEAVKKVKQEEGDYRDRVRI
FT                   ERETRRTEAQFHAAQKVAERLDAEAETGDGKTVQTKRGKTPTEHEEEESEDTTSGSNNP
FT                   QPKVKVKPTSQVNILYRGLVREREEKERSIQARHLLQTSLPSSFFPNPRLPGYDDDPTL
FT                   EREDKVALDNKPDISTILEQELDEEDPELDEFNALEPSERLARIVQYLRETHHYCFWCK
FT                   FRYETGEMEGCPGVTEEDHD"
FT   exon            complement(110371..111324)
FT                   /number=1
FT   exon            complement(111425..111553)
FT                   /number=2
FT   CDS_pept        join(112370..112594,112651..113001,113055..114089)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000036"
FT                   /old_locus_tag="AO070232000013"
FT                   /note="acetylcholinesterase/Butyrylcholinesterase"
FT                   /db_xref="GOA:Q2TZ03"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ03"
FT                   /protein_id="BAE65520.1"
FT                   /translation="MARYITFAQFFLLFCLAAAQEVVVDLEYARYRGKALSNGLVQWLG
FT                   IRYAAPPTGPLRFSAPQNPSVVAGIQNAFEHGPTCIPTSEYPIPEDTSEDCLFLDVYSP
FT                   YRAGNHSKLLPVFVWIQGGGFNQNSNPNYNGTGLIQASGMGIVVVTFNYRVGPYGFLSG
FT                   REILQDGSVNNGLKDQIKVLEWVQKHIHKFGGNPKHVVVGGASAGGASITLLLSAYGGR
FT                   DDGLFHAAAAESQSFATMLSLKQSQFAYNNLVIRTGCASDADTLECLRGLDAEILQREN
FT                   INTPLPHAQQAPLYLYGPVVDGDLVSDYTYRLFHQGRFIKVPVIFGDDTNEGTIFVPKN
FT                   VSNVGEADTFIQNQFPTIKLEQFAAINAWYLHENQTRQFPDAGPYWRPASNAYGEMRYI
FT                   CPGIDLSSIYARAGINSWNYHYAVQDPDLKESGLGVDHTVEINAIWGPNYVTGEPPSSY
FT                   FTTNAPIIPVMQGYWTSFIKTFDPNPHRYPGSPQWSTWGNEGYQRIFIRTNETRMEEVP
FT                   VDQRERCEYLISIGPELQQ"
FT   exon            112370..112594
FT                   /number=1
FT   exon            112651..113001
FT                   /number=2
FT   exon            113055..114089
FT                   /number=3
FT   CDS_pept        complement(join(114324..116774,116833..117123))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000037"
FT                   /old_locus_tag="AO070232000012"
FT                   /note="nucleolar protein involved in 40S ribosome
FT                   biogenesis"
FT                   /db_xref="GOA:Q2TZ02"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ02"
FT                   /protein_id="BAE65521.1"
FT                   /translation="MPPSQLKQLKASLRESGVLGPQQSKKQKRQNAKSGAAAQNRVQRN
FT                   AALQSIRDRFNPFEIKAGGTRTKFDVTTRDGNSGTAASRARPGVTKSLGEEKRRQTLLR
FT                   EMEKRNKVGGILDRRFGEDDPTMTPEERAAERYARASQRKMRKESMFNLEGDDEEEEFQ
FT                   LTHKGQSLNDIDQDDFQEGDLGGLEDDASDTEAARKRKRVFFDDGEMDGPEDLEDGEEH
FT                   PERKKSKHEVMKEVIAKSKLHKYERQKAKEDDDDLREELDKGLPDLFEMLRGVKPPPKP
FT                   EPPKSDLASMNPDRAALMEGIAKGDTEKEYDQRLKQLTFDKRSKPTDRTKTEEEKAAEE
FT                   AERLKALEEERVRRMRGEEVGESEEEDEEEEVEEEGSEMSEDESIPDDAKAFGLQQSSG
FT                   QISTRPELSVEDEDDFIIDDDLVETRSDVSLSIGDSDEEVLSAEESEEEMEEDEEDELI
FT                   NGFTLPTDNTGEAPAAADAPEANEGLAYTYPCPKNHEEFLQVIQDVPMADLPVVVQRIR
FT                   ALHHHRLHPDNKKKLGQFSRILIQHVAYMAEQPEHPPFAILENIFRHVHSLAKSHPESV
FT                   SQEFRARLREIAADRPLSLRPSDLVILTGIATTFPTSDHFHAVATPAHLCLSRYLGQGA
FT                   VNILADFATGAYAASLVLQYQLVSKRYMPELINYVLNALCNLAPEEPKSSLGLFPSRSP
FT                   EESLRLKISKSLKSRKLQFWDITGPDSPKAQEELKLSLINTFISLLSTASDMWSDISAF
FT                   LEIFDQAQKVLRFLNRSCKGKIPSVVQDTLQSTLDKLDGHTSKARLTRRPLLLHDHRPL
FT                   AIKTAIPKFEDTFNPDKHYDPNRERAEANRLKAEYKRERKGAMRELRKDANFIAREKLR
FT                   EKKERDAEYEKKYKRLVAEVQNQEGREANAYERERRLRQGKR"
FT   exon            complement(114324..116774)
FT                   /number=1
FT   exon            complement(116833..117123)
FT                   /number=2
FT   CDS_pept        join(117318..117360,117414..117533,117586..117646,
FT                   117702..117867)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000038"
FT                   /old_locus_tag="AO070232000011"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ01"
FT                   /protein_id="BAE65522.1"
FT                   /translation="MPSHMNDRLLWLCLGVSLFFAVRGIVTDLRRVRDLTEIKHVEKED
FT                   KMISEGTEDALKLDTLLKLSESTSYDLRAAALRIIAERSTKGETRDLLLRDLASTDTER
FT                   RSKALSAMYFLVSNRSRTDLAYSAS"
FT   exon            117318..117360
FT                   /number=1
FT   exon            117414..117533
FT                   /number=2
FT   exon            117586..117646
FT                   /number=3
FT   exon            117702..117867
FT                   /number=4
FT   CDS_pept        complement(join(118702..119680,119727..119848,
FT                   119898..120171,120217..120356,120410..120644,
FT                   120701..120774,120838..121047,121104..121157))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000039"
FT                   /old_locus_tag="AO070232000010"
FT                   /note="origin recognition complex, subunit 3"
FT                   /db_xref="GOA:Q2TZ00"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TZ00"
FT                   /protein_id="BAE65523.1"
FT                   /translation="MDLDTETQGVAKDGSNTQGVYIYRPVTSAKAHGERPSKRRKVQPE
FT                   IKEQKSESHPFVPLLDGEENESSVELRYNAYRLLWSTQETKIQEILDDVDSEVLENVLS
FT                   FVRSTSHLTYDGCIPTALITVGSNVSSLGRLLSKLNDQLAASEEGGVVILESGDAPNLK
FT                   ATLKNIIRAAVTNTEGNNGYQNFLTDREGPRLLGYDLDLLGDYVKRKGIKKLVVAFRDS
FT                   EAFDPNILTDLLSLLSSWLDRIPFTLLFGISTSVELFEGRLPRSSVALLRGRYFEIHGA
FT                   SNCVDRMYERLQADQNGRFWLGRNITGVLFEKSNDYFQTPEAFSRTVKYAYMTHFFANP
FT                   LAMLLSEEISVNRQQGKVCEAIRNLPSFRRFCEHLLDDDSTEQVRSLLENDEFLFQQSL
FT                   KYIEIGQQRMRSIFHVVKTVYLCLKSMDIRKKLTIPDLSIRALSGDLQDSTYMDDLLKG
FT                   LKTLDSSKLKEVLAFMPQDLTDCPDFQEIKKDFEALVQTYQGTEPLRSEYDSHNSIVAA
FT                   TVVQQRVKLSKSKARLPQQNIEYTKVIDRVYALSEKYFVETLVIPQDLFLHEAFLLDMK
FT                   NPLKEIFSPRPRFAIERALANPFDYLMSMSDRTEARISARQPATAILYQLYLESGALVN
FT                   VYDLWQAFYAVFESEQGDACDERMTMTLFYRAVSELKALGMLKSSRKKVDHASKSAWIG
FT                   L"
FT   exon            complement(118702..119680)
FT                   /number=1
FT   exon            complement(119727..119848)
FT                   /number=2
FT   exon            complement(119898..120171)
FT                   /number=3
FT   exon            complement(120217..120356)
FT                   /number=4
FT   exon            complement(120410..120644)
FT                   /number=5
FT   exon            complement(120701..120774)
FT                   /number=6
FT   exon            complement(120838..121047)
FT                   /number=7
FT   exon            complement(121104..121157)
FT                   /number=8
FT   CDS_pept        121395..123974
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000040"
FT                   /old_locus_tag="AO070232000009"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYZ9"
FT                   /protein_id="BAE65524.1"
FT                   /translation="MLRQAVRGARWYQHVALRTPSAPSLPLLRTFSVVALRSFQYGGPN
FT                   DKVRFYEQDTRGSKKRRQVNPEAEENADREEVEGELARLEKELQDLKEGPYGPNSQFIR
FT                   ELPEKERAIALEALRKYEAEHGKDEPEIGLEQVFDNELDEMLKEEFEGLAKEEENWHST
FT                   GQDNSPKKPVRRPYEVAVTTLEHHSYIEKFNQCLTRIASDGSNERLGAELWRWYRRCKQ
FT                   MIPEFLESIPEEALTLLWHAQVGDYTRSSRTSHIQILAEDAISVGKSLSTPHLLSYIES
FT                   LRKTGKTKEALDQWEAHQTGLSQNKQDLEAYWKLGVRLFAAENDPQRAQDIALAFLAND
FT                   KSREPRILLPVITAWGRQPGKEAEVKAWALYLQLKSFLENTLTMDDYDNISIGLLKAGR
FT                   PNLAIAVFKDMMVTGQDPANDSTSLYKAAVGLVGHLQASSISEQDVNKVSLSTLTVLPR
FT                   RFQNRFFYASWMKKLIGMGEVDSAALVIELMYERGVKPDSKHLNGLIAAWLRDGNPDAR
FT                   EKAERLGWSMVQQRIDSIWARTNSTGSSPKLTVSPDPDSPRIPKWMQREIPSANIETFS
FT                   ILLLHYTRRSDDGMIKYLVKCLGDAQIKPNSYFMNHILYAELRKQDIGSLWDKFRTMSA
FT                   SIQPDLETFACLWDCGKLQYDRGRTTFVADFPSARSLYAEMMQWHSHLPTRGRAAAQEE
FT                   FSKELYNQIIRCFCLSKDLPGTLIALYSLRSIFGFSPDDVTARLIILQVARMAGVPPGT
FT                   PKRRLRRLSTTPKSKENISHVNRLVEILSERKVSALQARGLTLETLEPQEREQYQLDIM
FT                   TDLLRIIMGRAATESSRVEDQIASAAEEMNVLGVDLGSSLEDNDLLL"
FT   exon            121395..123974
FT                   /number=1
FT   CDS_pept        complement(124473..124937)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000041"
FT                   /old_locus_tag="AO070232000008"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYZ8"
FT                   /protein_id="BAE65525.1"
FT                   /translation="MSTTEKPTPTTATTELPVQTLESLHGPELDSKDVCSYYIRDQPNE
FT                   PEDLDTLRTCCKPNVIHRYNEHQYWCEVPERYFPPTLYLNVSNRTIEQWVDGNMTQCIR
FT                   DAHPSHYAGSSTCHFARYNVRNEAASLIAASAPLYLLLLGGLWSFRLLLR"
FT   exon            complement(124473..124937)
FT                   /number=1
FT   CDS_pept        join(125917..126273,126330..126400,126456..126603)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000042"
FT                   /old_locus_tag="AO070232000007"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYZ7"
FT                   /protein_id="BAE65526.1"
FT                   /translation="MNDTTGANNPLEERQLMGHQFMCCMGDCSYELVGDGNPHTDYLHR
FT                   QMTSTGECRDGPGAKGCGVGFSTSHTFGYTVSAGANIGWFAPGFSVTESWTVGETKTCS
FT                   ADINATVCLWYDMAYTAYTVQVVNRRLYSSVCSNQPTGPLIMKAPNVNNAGGGHWYCAY
FT                   GDECRGEGEEYWCLTEDCPPKGKPKPQD"
FT   exon            125917..126273
FT                   /number=1
FT   exon            126330..126400
FT                   /number=2
FT   exon            126456..126603
FT                   /number=3
FT   CDS_pept        complement(join(127322..127442,127500..127782,
FT                   127793..128810,128904..128946,129005..129023,
FT                   129097..129146,129283..130230,130299..130585,
FT                   130644..130696,130752..130984,131042..131215,
FT                   131286..131320))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000043"
FT                   /old_locus_tag="AO070232000006"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYZ6"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYZ6"
FT                   /protein_id="BAE65527.1"
FT                   /translation="MDFIAACPRRKCFYWKAYIAVPAALGSYHQRRLLGCSIPNRPEIL
FT                   VVVWFWIMCIILNFGFHDIFIPNVTMPTISRQAWKYVAQRTSMFAYACLPWVWLFAGRN
FT                   NIFIWATGWSFSTFNVFHRHLSRLTAIFAFVHAISYTVLDTIYGPYYEEGLHVLWFKFG
FT                   IIGATMMGLLCGLSIPYIRTKCYELFLVGHILFAVILLVALFQCVLLCSLPVYDFGRCE
FT                   TGLQDKTDILPFSELNITPTSGQWLPYGAVIGSCASYASEEADVVRLDVQADGSIRPLP
FT                   GHYFHLYQLFSWRGWENHPFTVGAYTAPNPTSPLTSSSNAQQGPHYMTGALNEKNPFTS
FT                   TPTEVFTQGSQSSTTDPALGNLVFWIRPYNGWTKRLKDQCLRSSSSDDSAVNGYYQTSI
FT                   PISLEGPYGHTLPLHHYGTVVMIVGGTGIATAVPYIHDHVSRLSKAGSRVSDDTKTQTS
FT                   NLTLVWACRGHVFMQQLCGRELAGALEIEGFTGRFHCTKGCNSHCAADNKNGELRIERG
FT                   RPNIENIIHGAATEAQIARHKMAVLTCGSPHMSDEVRRSVHRILKKGYEGIEYFEEAYS
FT                   WLSWPSHSFVAKLHLCYGLKITIPKLTLSFGWYAPLFRGIDVTAFRDPYVFQNKDLDDT
FT                   VGSSSGTWYAAISGGVHDVGPGVFLYRNQGSGYEDWEYLGKWWSEPVNSTCGNGDWAKA
FT                   WGYNFEVGNVFSLDKEGYNVNGETFITLGVEGSYGPITESVTSMHGMLWASGNILKPDG
FT                   GNVTFEPTMAGVLDWGISSYAAAGKVLPATSQASEKSGAPDRFISYVWLTGDVFGGVAG
FT                   YPSEQQGWQNTLLLPRKLHKQTISNVVDNDLASETGSWCVKDSENSCLKLETMGIKIAR
FT                   ETYKAMTNKTSFTEPKRTFCEDGAVPFKQSPTTKFFVLNAQLSFPKSARDPGVQAGFKI
FT                   LSSELESTTIYYQFSNESIVIGRTQPSRPPLKLNTTTESGRLRLFDINKNCNKSDDDDK
FT                   QEERKKKDAYREHGRNRHNVKLAAEDESHIETLDLTIVVDNAVLEVYANSRFALSTWAR
FT                   TWYANSTEISFFHNGEGEVTFSDISVSDGLYDAYPDRAR"
FT   exon            complement(127322..127442)
FT                   /number=1
FT   exon            complement(127500..127782)
FT                   /number=2
FT   exon            complement(127793..128810)
FT                   /number=3
FT   exon            complement(128904..128946)
FT                   /number=4
FT   exon            complement(129005..129023)
FT                   /number=5
FT   exon            complement(129097..129146)
FT                   /number=6
FT   exon            complement(129283..130230)
FT                   /number=7
FT   exon            complement(130299..130585)
FT                   /number=8
FT   exon            complement(130644..130696)
FT                   /number=9
FT   exon            complement(130752..130984)
FT                   /number=10
FT   exon            complement(131042..131215)
FT                   /number=11
FT   exon            complement(131286..131320)
FT                   /number=12
FT   tRNA            133492..133596
FT                   /locus_tag="AO090103t00002"
FT                   /product="tRNA-Met"
FT                   /note="tRNAscan-SE"
FT   tRNA            complement(134157..134261)
FT                   /locus_tag="AO090103t00003"
FT                   /product="tRNA-Met"
FT                   /note="tRNAscan-SE"
FT   tRNA            complement(135878..135977)
FT                   /locus_tag="AO090103t00004"
FT                   /product="tRNA-Arg"
FT                   /note="tRNAscan-SE"
FT   CDS_pept        complement(join(136397..136798,136872..137182,
FT                   137256..137355))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000044"
FT                   /old_locus_tag="AO070232000005"
FT                   /note="preprotein translocase subunit Sec66"
FT                   /db_xref="GOA:Q2TYZ5"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYZ5"
FT                   /protein_id="BAE65528.1"
FT                   /translation="MVNWLSLAVPFAYLGVLIGSLATFSSLYRKRKAQKAYSLEPWFPA
FT                   HLQRDIYFSLLHIDPPATSSKEKKAPAVPESVLKAALLRRAEEDIKRVLALRSQKQALG
FT                   VLLQRGSVGDDLWQRFQRAEKEMEDEVRDVVSEANAYVPGWGQTIFQSANEMMNNTLYR
FT                   ERIAEQQAKLDEERQWWEKRRASIKEGFMKELDAEDSTSTAPPQKTEAPADTTPTTTSS
FT                   STPAIKTPESSGAPSSVTGSDDDAVLVEADEQPGSPASPSKKKKKGKK"
FT   exon            complement(136397..136798)
FT                   /number=1
FT   exon            complement(136872..137182)
FT                   /number=2
FT   exon            complement(137256..137355)
FT                   /number=3
FT   CDS_pept        complement(join(138213..138709,139100..141142,
FT                   141200..141738,141997..142643))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000045"
FT                   /old_locus_tag="AO070232000004"
FT                   /note="AAA+-type ATPase containing the bromodomain"
FT                   /db_xref="GOA:Q2TYZ4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYZ4"
FT                   /protein_id="BAE65529.1"
FT                   /translation="MEEDEETQEKQEEYIEETTTEVKGSQVEIMESAQASFEEGPISAG
FT                   DDQQGAAEADEGFVPESENEDAEHEEDEDEDEGPVTRRRTRPNRSQQIEEPEQPDEEEP
FT                   SGPRRSSRKKPKSSQRKRLNDEESDFEPEEEDSNDDDEVSQTGKSNASPRKASQARDDE
FT                   EDSAAGRRPGLRKRASRSRGQSEAAADIAEELAEELEDLRGGRPRRRLQTDIVDDEGLH
FT                   HPRGSVAGVGSALGPHGAGLLPGQTQTHDAAQGLSGTPANLGKVKDKQALADADPLGVD
FT                   MSVNFDSVGGLQGHIDQLKEMVSLPLLYPEIFQRFHIVPPRGVLFHGPPGTGKTLLARA
FT                   LANSVSSEGRKVTFYMRKGADALSKWVGEAERQLRLLFEEARKTQPSIIFFDEIDGLAP
FT                   VRSSKQEQIHASIVSTLLALMDGMDGRGQVIVIGATNRPDSIDPALRRPGRFDREFYFP
FT                   LPNAEGRRAILDIHTKGWDPPLPGHIKDELAEITKGYGGADLRALCTEAALNAVQRRYP
FT                   QIYKSDKKLLIDPKNIDVTPKDFMLAIKKMVPSSERSTSSGASPLPKEVEPLLRHPLAD
FT                   IRALLSEILPQRKRLTALEEAQFEEPEGAGSFQREQMQQEFDRSRVFRPRMLLRGLMGM
FT                   GQQYLAAAILHYFEGLHVQSFDLPTLLSDSTRSPEAAVIQLFAEVKRHRPSVIYIPNIE
FT                   SWSETVGQAVLSTFLGLLRSIPPTDPVLLLGVQEITGEEIDTGLLRQMFGFSKRNFYDL
FT                   KAPGNEARYEYFSKVVEYIKTSPAHFPDPENRKKRELETLEIAPPPPPKPTTPLTKEQL
FT                   KAQKKKDHQTLNLLKIRIQPIMDQIKKYKRFRTGVIDESQIRYLWEEDDPNIVTSDLPI
FT                   EQRTTFRPFEKAYDKHGVPGLWETVSGKFFYNMEIVTIEKRLSNGYYKRPSDFLADIKR
FT                   LAKDARQTGDQERILRANELLSNVEVDISTIEQAEPQLVAECENVYIRELAREKAAAEK
FT                   AKRVEEAEKGGFLGHTANHNVPHGNTESGPSSGPVVLGETFPDLAPKEQARPVTPTRQS
FT                   TASFLTNGYHQSGGSDLNDLSARGPTSNEHLPDTQQCDSSQPSPRPRESLPGNADSQPE
FT                   HHVNGSQSQPKTQPPVPLFDESTKPSSHPPVNLHSILNDEDHSPKLIVDSEYVQNLHEQ
FT                   LTQRTSGCSVEQLEQINTSLMDYLWRTRGEWNRSKVAAGIRDSFNEILEDMQAMQEIGP
FT                   ISQRTKEQLGSSFEHL"
FT   exon            complement(138213..138709)
FT                   /number=1
FT   exon            complement(139100..141142)
FT                   /number=2
FT   exon            complement(141200..141738)
FT                   /number=3
FT   exon            complement(141997..142643)
FT                   /number=4
FT   CDS_pept        complement(join(146321..146864,147088..148175,
FT                   148273..148278))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000046"
FT                   /old_locus_tag="AO070232000003"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYZ3"
FT                   /protein_id="BAE65530.1"
FT                   /translation="MSEPNPKRLAWDNSGDILQGMLDRQVAPTSPQLEFSSDGFLTSEY
FT                   ALSDPASFLGLQFGPDSAVIPHSHLSMLNQWPPHHQQASSPPPQPSLDVSQYHHPRLTS
FT                   NQDAWNPLQVTGVPVSTSTWGFPNANKLQQTPKGGRKNSTGQHSAISESDSHYNGFHPS
FT                   DSGYCSRSCTTRSVTTSSYAVDSVSSPFLAPHEHEQEDRASMLDLGPSHCGDTVVDALE
FT                   IVESPSLMCHDVITCDYPNCPWTGKCPSDKRYVYSFQHVLKNSLCRRIIKLTGSRKHEA
FT                   RHRKLFKCDEPGCTRKEGFGTINDLARHKKCVHKQEPERGPKVLYMCFGRNCPRRGKEW
FT                   PRLDNFRQHLSRMHNDEDTSELLKRPSNQSGLQPVEDPQTQRRYSTLDSTPSIPARDTT
FT                   QRLDLPALTTLNLGSTTDLDPSSTSSRLGHAQPDRMENMVSEMATNMVNAMARMMNSSS
FT                   NDNGNSQRRHSHHMGDKVETLGGNDGLSDQKREIMQKILSAALDQVSGNPEPSQADSQT
FT                   VPDSKSDKKGWIQCEFCTKRTRLRCEMK"
FT   exon            complement(146321..146864)
FT                   /number=1
FT   exon            complement(147088..148175)
FT                   /number=2
FT   exon            complement(148273..148278)
FT                   /number=3
FT   CDS_pept        complement(151634..155260)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000047"
FT                   /old_locus_tag="AO070232000002"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYZ2"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYZ2"
FT                   /protein_id="BAE65531.1"
FT                   /translation="MSTLSPQFVPNDSPNPAKLNDASFPDPYLSAQLDPEVASFRSSAI
FT                   RLTPVSGEDHGSRDASSSPIGSHVHSDSPRDEAHPASYSEYLSPTDDLSSEMSVHTSPT
FT                   ADYLSAAFSTDLSPDSNSWQYDGGLHPGMRSTALDPNELNSAQMIMDPSQLLTPNLTNK
FT                   SSLSSETTSIKNQTGPVALQNQPQALTLITGPPDECLDVPGDLGSPRARSPIVKIESFS
FT                   RGDSPVRDMRRPSHSSTHLSPGGPSSESDEEAGVDNSKYLGSVQSVSRGHDGSWIPNAA
FT                   TGHAGVDPTSRKNVYVPSPNELELRRQLDEKNEDIRSWSASVSVANSENGDDPTPHRGR
FT                   KHTGNRRRAKSAGDPSLQQDYFNLKVALIPGPGVLVTENSEEEYSDHESEIEGTGSETP
FT                   AASVNEARWVLGEEEIQLSPEGEEPSPHQFLGRPPWRDLAPVPSPDMARTQPASSTAAM
FT                   VEYERRVRDLDNVSRAATWGTRDVDINSLLGGGGSFENLAISNDKSRKHERRSSLRKLL
FT                   HRKSSNNLKPPNNLKRHLSDLSISLPGSDDHSKGDENKSSHQRKNSFPHRKLSLGLSPR
FT                   SPRSSRSPSLSTGGAVIAIAGQMAAIGGKDTLRVASPSSTSNPWPSLKVRGRSRSEIPR
FT                   PSTPGLIDLMTSHGGPPVANIAYSHLQPEPRSAPPNQSRLGHGTSDGDENDDNVPDERG
FT                   LVMDLSVQSRLPVPTLEGFRTQIAQLNPRLQPALLDRFANEQVRRYKKLVENKFTHTCA
FT                   VSEKGCASGKFCFAQGGEALLLTPRAGPQDSETPHTQFQIPGHGEAGDDSPALGESAVT
FT                   AAQFPPGVPLPPVKRLPAEFECPICFQVKKFQKPSDWTKHVHEDVQPFTCTFAHCSEPK
FT                   SFKRKADWVRHESERHRQLEWWTCSEPDCNHTCFRKDNFVQHLVREHKMPEPKVKKTKA
FT                   KGLSKHPVDPNSPEVLAEIQREREIEQLWNLVEQCRHDNPKGPKDEPCRFCGNVCSSWK
FT                   KLTVHLAKHMEQIAMPVLALVNERDLSSNLGPGSTGKGDLGPEPESISRETTNFAPNLN
FT                   GVQARADMSIGYTQATYPGHDVGQSDGLGVPFSSTGVPHFTTMSGAFISAEPEPMDAYD
FT                   EYSVQVGLQPGGPMDQSRLMPMHQNSVTYPPPFNAGPRPRVSNQDMSVLQESYNFSMSP
FT                   TEMQPTYDPQYMSSTGENSYVCQGTVAPTMPFTAPGAYPNQL"
FT   exon            complement(151634..155260)
FT                   /number=1
FT   CDS_pept        complement(join(158221..159121,159173..159207,
FT                   159249..159297,159383..162522))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000048"
FT                   /old_locus_tag="AO070232000001"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYZ1"
FT                   /protein_id="BAE65532.1"
FT                   /translation="MAGAKKGKGKSGSKKNNKKSKAQEESEIQTPPPAAPDVTIPEPQS
FT                   EEQQQQEQQPVEQQPVEQQSQEPQLAESQLQEQQQPEQPSDQAVEQITDQQLDQPTEQT
FT                   SEQQPEQPIDQLSEQTTDQPLDQPPAEQADQQLPDQQAEPLQDPSSEPLQEQPLEQELQ
FT                   DQPPLDQQLQDQPPLDQQLQDQQPDLQLQEEQPEQQLQEQEQQLQLQPEEAIEAEPQQP
FT                   EAPVEAPVEALVENPVENPVEVESPSAPEVAPEVAAEVVPEIATESIPETELAPAQEVE
FT                   QEQLQPTTEEVSTAPTPEQQPQPPTNPEEDGSAQVTAPDLSSSQQLDASDVQRDPEVPQ
FT                   ELHQEELGAAEHPVEKATETTPENIDVSREQVVEPPEPTPVTAPQTPLFSTDPTTASVE
FT                   TPSATETQFVEFASPTKTDAPEIESHTATVSDPSFEAVEAAPTSPTRQTTPPVSKPASP
FT                   VPKNASPTPRAVSPAPRDAAPTPKAASPAPKPASPVPQAAPPMAETVSSMQEAELPAEV
FT                   IPPAPTPPPVASVYQEPPSTLQHPSPVQKMASPVSKAASPFQKVASPVQKSASPKVTSP
FT                   LARHAYMSPMISPHATPHATPPVQPAMAPMHHMPPPSTAPSVASYATAYSPVMTTAGFM
FT                   PQYAFYPPGMQPTPRGSMEPSTATAYQHLRDLTYANGNGFFAPQNGHHNGHNGHHKGMM
FT                   SPPEHPVEEPIELLQRIQDAIPDINRLLGSYRNTKSKLQAREAEFQQMKTQHEQDLMHK
FT                   DFYIEALQTQMRKTANEAAEESTKLKNTINELRMELGNLDEKRKDLEEKLEESERSNEE
FT                   LTRNKHDLEEEVRTLNTSMKEAQEAHEKECERREQEKVDALATQKREMTESFEEIKAED
FT                   EKAAAEALAAREKELLDQQEAMKNDYEDQKRQMQEAHDTLQSNFDDKVNELDSTKTDLE
FT                   NKHKELEETRVQHANEVELLNNTHADHVADMERRWADERGELEQRITDKCDELAHCERE
FT                   KQKVEEDNVVKEQQLQAASDGMRLTIDNLGKDCDRLRKTLHSLGEATDLKSTKGDPFLL
FT                   SSVMPFLPFWPELCHNYDHDGDEDYEILDCFGQLSRLIVSLSKEHFAYLPIDPPKDVLS
FT                   KIPQELPSFLDNTPASRELRSAYVQHIITKTLTYRIFHPFLFTLGKRYGKADTFFQMLS
FT                   MDIRRKSVRREAFWRQQTLKAAYTTSDAKQSINVVAAVIVDEIIDHLKHFADPKHMDTL
FT                   HTSVRKIVKLAAETWRLARVERELIMASFPAPDSEGTSNETWEEYGTPKEGCVGSKEDP
FT                   TRHVILRTFPRIIREAAHEDFAEDEEKALSCTYTQGSVLYSDSPVVMARRQELARRSMD
FT                   SLVGGEERPRSESRGSTPNSPRRGKASFDTL"
FT   exon            complement(158221..159121)
FT                   /number=1
FT   exon            complement(159173..159207)
FT                   /number=2
FT   exon            complement(159249..159297)
FT                   /number=3
FT   exon            complement(159383..162522)
FT                   /number=4
FT   CDS_pept        complement(join(164964..165614,165688..165999,
FT                   166161..166319))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000050"
FT                   /old_locus_tag="AO070302000002"
FT                   /note="predicted methyltransferase"
FT                   /db_xref="GOA:Q2TYZ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYZ0"
FT                   /protein_id="BAE65533.1"
FT                   /translation="MASAFSFGFAGDDIDIDDSELNTVDEGYTSVTQDSSSTLPELVAA
FT                   QRHELSDLLSSLPSQVSFNKLNINTTQDDQTSVKTLTLARREVFDIRTQLMAEDTADYA
FT                   NEELISGLEKGDITPNIYEGGFKTWECSVDLAKLVANENILSNADAGDRHIIELGAGTA
FT                   VPSLALFAQSLSNPKGSSQNIRFTFADYNSVVLRLVTLPNLLLTWSYIVMRQKSVSVAG
FT                   AEDQVEEELELDITPELLEAFKKDIAERGISIEFISGAWSPAFVDLVFTSGEKAKHGTL
FT                   VLASETIYSPASLRAFSETLLALIRRPIRAGGRSRALLAAKKVYFGVGGGVDEFLEVFN
FT                   TVGGDELDVKERMDVKSEGVGRIVLEIAPKGLQ"
FT   exon            complement(164964..165614)
FT                   /number=1
FT   exon            complement(165688..165999)
FT                   /number=2
FT   exon            complement(166161..166319)
FT                   /number=3
FT   CDS_pept        complement(join(166835..167410,167483..167927,
FT                   167991..168076,168144..168251))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000051"
FT                   /old_locus_tag="AO070302000003"
FT                   /note="cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /db_xref="GOA:Q2TYY9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYY9"
FT                   /protein_id="BAE65534.1"
FT                   /translation="MTNSTNGAPAQDKRFGTLAVHSGAHHDPTTGAVIAPISLSTTFAQ
FT                   TSVGSPVGLYEYTRSSNPNRDNFEEAIAALEHAKYALAFSSGSATTAVILQSLAAGSHV
FT                   VSISDVYGGTHRYFTKVANAHGVDVTFTPTIESDVEKLIRPETKLVWIETPSNPTLGLV
FT                   DIEKVAAIAHRHGILVVVDNTFMSPYVQNPLDHGADIVVHSVTKYINGHSDVLMGVAAF
FT                   SSDSLKERLGFLQNAIGAVPSPFDCWLAHRGLKTLHLRAREATTNATAIAKALEASPHV
FT                   ISVNYPGIDSHPQRAIAVKQHRQGMGGGMLSFRIQGGEKAAHLFCKYTKVFTLAESLGG
FT                   VESLCEVPASMTHAGIPKDQREAAGVFDDLVRMSCGIEDVEDLLADVLQALKKAVASSE
FT                   QNGSA"
FT   exon            complement(166835..167410)
FT                   /number=1
FT   exon            complement(167483..167927)
FT                   /number=2
FT   exon            complement(167991..168076)
FT                   /number=3
FT   exon            complement(168144..168251)
FT                   /number=4
FT   CDS_pept        complement(join(169186..169230,169280..169457,
FT                   169513..169576,169628..169714,169770..169866,
FT                   169937..170035,170114..170125))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000052"
FT                   /old_locus_tag="AO070302000004"
FT                   /note="DNA-directed RNA polymerase subunit E'"
FT                   /db_xref="GOA:Q2TYY8"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYY8"
FT                   /protein_id="BAE65535.1"
FT                   /translation="MFILTTLSDLIQISPEDFSKYSSVAIEDNINEKYANKVIQKVGLC
FT                   IGFYDLLESSDGLIGHGTGLVNVNVKFRLIVFRPFKGEIMLGKISSATEHGIKIGVEFF
FT                   NDILVPPNLLLDGARFDYADQVWIWENEDGSTFYFDIGEVVRFRVEIEEWHDQIPNAPD
FT                   LGDAAAIERKPPYSIIGSMQMAGLGPISWW"
FT   exon            complement(169186..169230)
FT                   /number=1
FT   exon            complement(169280..169457)
FT                   /number=2
FT   exon            complement(169513..169576)
FT                   /number=3
FT   exon            complement(169628..169714)
FT                   /number=4
FT   exon            complement(169770..169866)
FT                   /number=5
FT   exon            complement(169937..170035)
FT                   /number=6
FT   exon            complement(170114..170125)
FT                   /number=7
FT   CDS_pept        join(170795..172426,172504..172737)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000053"
FT                   /old_locus_tag="AO070302000005"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYY7"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR019496"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR039136"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYY7"
FT                   /protein_id="BAE65536.1"
FT                   /translation="MGYAPMNYPGYAGQPMANPQQSIPTPQFPPSRTTNYQVPQSTTSF
FT                   PSSRPFPQSTPTHGPPYQHQPGYSAYGPSTAQQAPTYHSVTPSHQNAPPSVQPSMMGPP
FT                   MHWGYNNSASGGGYTGPPHGNQRGPRPYNAYGNQASRGGGAMPHMKRDHTSAFGKPQNI
FT                   TPRVPAPPPVPSFGNPLPSKPPPPADATRKPKKKKRKHNQLGLTPKTEEHESSEEEDDV
FT                   DEESRLAQGGASAAAAVQITFKGRTTTLQSPADIAAWIEERKKRFPTKEKVEEKKKAME
FT                   EAKKAKEEAQRQKESRKQEMKKAQKDHQQAPADPIDAAEKAKRKADKLRRKLMKEQKKV
FT                   EKAEADAERARMRVEELQRGSTDVNRDVTSASTQEAQAEPGTEDRSNTAPDQETRSIET
FT                   QGVPLASGHIPGEVSQPNNDVGPSSASESKSNGEGVIEDVRADAAVSSDISDSSDWTSS
FT                   SGSDLSSSDSEDSDSDSAPEEATSRREGPERVAPPPREAKKKLCRHFARTGRCQRGDKC
FT                   KFLHETPDRGAKTKPVEKKGRKGLLQALLARQKGEDDRKVMEAIVWLGENGFLDETKSY
FT                   EEPLEGANENSATDEVKLSQGLPEDPPLSEGIVSVQTGDSAPTTA"
FT   exon            170795..172426
FT                   /number=1
FT   exon            172504..172737
FT                   /number=2
FT   CDS_pept        complement(173526..174758)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000054"
FT                   /old_locus_tag="AO070302000006"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYY6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYY6"
FT                   /protein_id="BAE65537.1"
FT                   /translation="MQSGILLYVHFAVLILKLIPAVTRCIRRCTKRARSTTKIQFGQHH
FT                   FSVLKSMLVEFQEAQCFFMLSFQCAALIALAAGPQVFEATSLLQLQSNISMAKAVAFMG
FT                   ILPITYGLWILHRIGLHSWYISVWSAITIVTSSVTLHLCKVEPRADNLQEIATADRLDK
FT                   CGFHPPPLIYCRSDSELGSSYSLVNNLTFGLSDNTANFVCIAIYGLLLLKRLAPYPKRW
FT                   LGQKPWFQATYHRVHPWLVSRGIRILSRAVNVIIETLLLVTNFFYSFMVIARSLPTISL
FT                   DSWSFGQIIAVTIWSPIVSKYLYWLLCTYLAFLSTPVPFFCFILITEIVGTDSYSAIRF
FT                   PSPYKIIRVKTINEEENPDDEDRLFIHLPSTSDLNINPNSKKFIVTDVELTPVNDSKTS
FT                   SVSTRHSQFPI"
FT   exon            complement(173526..174758)
FT                   /number=1
FT   CDS_pept        join(177081..177297,177366..177891,178318..178441)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000056"
FT                   /old_locus_tag="AO070302000008"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYY5"
FT                   /protein_id="BAE65538.1"
FT                   /translation="MRSIFYLTLSAMASLAAAATNSANPFNIPSEGYSFEAGEPTTLSW
FT                   KPTTSGTVSLKLQWGAVMTSNTGTTIAQNIPNSGSYTWTPPANLAAQPDYTIEIFNDDD
FT                   TSEVNYLPRFTVAGATAAASTTASATTTAETTSATESSTTETTTNTKSATETHTTLTKA
FT                   TASTASSTSATASGTSTESTSASASATGTSTGTSTGSASTSTEASSTTSASASASTTSV
FT                   VNVNGGMVNRVSGGMLAIVLGAIAVLSEPNFGDNHGAIMGVSIKLGTGLVPTSSQVPGR
FT                   QWDPSVG"
FT   exon            177081..177297
FT                   /number=1
FT   exon            177366..177891
FT                   /number=2
FT   exon            178318..178441
FT                   /number=3
FT   CDS_pept        complement(join(180402..180955,181069..181504))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000057"
FT                   /old_locus_tag="AO070302000009"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYY4"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYY4"
FT                   /protein_id="BAE65539.1"
FT                   /translation="MQNSVKPPEVLLIIAPWDLSVSFLERLPTISPGIRVITFKCNMQD
FT                   MERPRAISQETWNSVTIRLTRNYLPGKEQIPNLRYIQFHTAGCNHIADTSLFEDSDVSF
FT                   GTANGVHPQVVAWVLSGRKLTTRSSQIAEWVVTTLLGFQHHYEDTEDAVGLRMCVHHPS
FT                   VGMKDRVLLSCIGCTGRQCARLANALGMDVHAFTLHERPTPESKGDHSYVEAGMDDPNG
FT                   DIPSRWYHGCDQLNEFLAGLDLLAITLPLTSLTWSMIAREQFQTLGKRNAFVSNVGQGP
FT                   IVNNDDLVDALNNGKIRGAAVDVTDPEPLPAGHPLWKAKNVITTMSEF"
FT   exon            complement(180402..180955)
FT                   /number=1
FT   exon            complement(181069..181504)
FT                   /number=2
FT   CDS_pept        join(183014..183368,183518..183945)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000059"
FT                   /old_locus_tag="AO070302000011"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYY3"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYY3"
FT                   /protein_id="BAE65540.1"
FT                   /translation="MVVMDDKYNGWRYLILSFALSDKMVMDAVLAVSTFHLSHKSGGTL
FT                   PVRPDKLYAKAILGLQNRSSLDEYDMLTRQSIFVAIITLLVGVMVNGSSDFPILFHMLQ
FT                   SALDAVGGEGGLGNAHAQESFDCLHYNGNLHPDHALTFYLNAYLRQQAYDIYLERATMG
FT                   PHGTLDPNKIEQFKETLVMFPEGSLGEHSLVWPTFIAASESLKDEHRLYFKQFLEKQYH
FT                   RNGFLNLQQALKLLDKIWARSSYTNWPALLPEPRVFIM"
FT   exon            183014..183368
FT                   /number=1
FT   exon            183518..183945
FT                   /number=2
FT   CDS_pept        join(185435..185763,185889..185943)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000061"
FT                   /old_locus_tag="AO070302000013"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYY2"
FT                   /protein_id="BAE65541.1"
FT                   /translation="MQGRYIEHQALKAFGGRERISMVTSLRLKSPFIRDETIIRPLLPT
FT                   TPKSTLYYQYAEYRLENLEERVRHQLKVMRQHKKANRDFDVASTRKFLLGEREFIDAML
FT                   EELEDPPAECTSSKVTIQSSVPL"
FT   exon            185435..185763
FT                   /number=1
FT   exon            185889..185943
FT                   /number=2
FT   CDS_pept        complement(187242..187679)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000062"
FT                   /old_locus_tag="AO070302000014"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYY1"
FT                   /protein_id="BAE65542.1"
FT                   /translation="MDGWILRDNTGLKGSAADFARQQLEEDKLPQSEAGRFITKVDCGG
FT                   GQEAAQYERHLPSCTHLVQAVGFTRDPLPELSVNGRLLDPEFDSVSGGFHDATGRVVPG
FT                   LHGAGIAFPERVVDPYGNVEHAVGFWKFMKFIKRVSPQWTA"
FT   exon            complement(187242..187679)
FT                   /number=1
FT   CDS_pept        complement(join(187868..188015,188129..188266,
FT                   188420..188580))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000063"
FT                   /old_locus_tag="AO070302000015"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYY0"
FT                   /protein_id="BAE65543.1"
FT                   /translation="MNSQRCAAVVVGAGPAGLAVIGNLLEKQLGGKIAWIDPYFQAGRV
FT                   NRKYREVPSTRIPSPFSTMAKLDQEKTCHLHHAADMVRALTEGITKMDQVYACRGLRLG
FT                   PFGSNVRTTSTKLRSLPLDSSCVRDRRRQRCRSRCVDSTSRGWI"
FT   exon            complement(187868..188015)
FT                   /number=1
FT   exon            complement(188129..188266)
FT                   /number=2
FT   exon            complement(188420..188580)
FT                   /number=3
FT   CDS_pept        complement(join(189771..190292,190367..190714))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000064"
FT                   /old_locus_tag="AO070302000016"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYX9"
FT                   /protein_id="BAE65544.1"
FT                   /translation="MLPFRFRGLRRRQSNSSNDEPEPPSNMGNQNSTADDSHGPTDSEI
FT                   FYPEFYDVLKVRYLLRWKIIPEGLPVEIVDLIVDAAEYWPSIEATLDQKRIIHQDRDQV
FT                   LVRTAPLCYDEKTLGSDSPKVLPHRTVHPCRKIVFSIASHDQGFANSGRGTFDGSYTWF
FT                   DTEVVPFEKLPTPGDSSVPEQDANGVRFGPDHPLLLPSSHKLQANRTAVRGTQHYHITW
FT                   HHLDNISADSPEAEEIQHNQGRGRATLDGSQVRNLQIGDTIAVWGRARFGAWSNHVERL
FT                   SVRVFWAV"
FT   exon            complement(189771..190292)
FT                   /number=1
FT   exon            complement(190367..190714)
FT                   /number=2
FT   CDS_pept        complement(join(191542..192922,193855..194002,
FT                   194754..194910))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000065"
FT                   /old_locus_tag="AO070302000017"
FT                   /note="RRM domain"
FT                   /db_xref="GOA:Q2TYX8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034777"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYX8"
FT                   /protein_id="BAE65545.1"
FT                   /translation="MSLLNLILFGESSMRSVSASESFSVIAFSGLGDSRSNTIFSETSS
FT                   ISLRLLDRYDLLQDRRKQALGGGRAKDDEEEGGGGRLHEAGNTTVKRCGRMNGIEESED
FT                   VSEPEDEDQVMQEASEASSDAGGEPAQAASEPPSRKRKRAAGEDLEESYMRRIAKEEQK
FT                   EEQKRRAEKAKRQKGEGEEEDEATSTDKSDDENEDESSDEDEEVAIPKHETVTGDAQSS
FT                   DIDKSNRTVFLSNVSNEAIKSKSAKKTLLKHFESFLSTLPESTGPHKVESIRFRSTAFA
FT                   SGGKIPKRAAFAKREVLDETTPSTNAYIVYSTVQAARKAPVALNGTVVLDRHVRVDSVA
FT                   HPAPVDNKRCVFVGNLNFVDQEGNADDEEKPKKKKAPADVEEGLWRTFNAHTSKPKDQA
FT                   TRRGNVESVRVVRDSVTRVSKGFAYVQFYDQNCVEEALLLNGKQFPPLLPRKLRVMRAK
FT                   KQLKKREAGGSTQGKPLREADKTLQGRAGKLFGRAGAAKVRADATKIISNNSLVFEGHR
FT                   ATDNGSSRIRVKTKSRGSKGKPKNRSSKRAAAYKAAGGKKRKTE"
FT   exon            complement(191542..192922)
FT                   /number=1
FT   exon            complement(193855..194002)
FT                   /number=2
FT   exon            complement(194754..194910)
FT                   /number=3
FT   CDS_pept        complement(join(194968..195170,195180..195647,
FT                   195701..195785))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000066"
FT                   /old_locus_tag="AO070302000018"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYX7"
FT                   /protein_id="BAE65546.1"
FT                   /translation="MCRIRAVQHFEFAIKFRDSFIIDPVGLVRRRTPALKLPAIPSQIP
FT                   VSLLRSNISTKKKRHGWRGHSNLHSSSSLAAASPSSASSRSAASSSPSASSPPPSAPVS
FT                   RAMSASSSTSLAFRPFRLPFLLFLPLAGAAGKSDSGISSTGVSSSLGLEGSSMGSSSMG
FT                   SGVSTISSAGGSLSSLLREPRRGSSSSSSSVPISSAELSRLRFFPMPSESADSSSPGVS
FT                   SPRLGTWLFFERGLLGESSGTCSSSSTSS"
FT   exon            complement(194968..195170)
FT                   /number=1
FT   exon            complement(195180..195647)
FT                   /number=2
FT   exon            complement(195701..195785)
FT                   /number=3
FT   CDS_pept        complement(join(197830..197981,198038..198108,
FT                   198165..198997,199052..199400,199455..199699,
FT                   199744..200151,200218..200541))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000067"
FT                   /old_locus_tag="AO070302000019"
FT                   /note="mRNA cleavage and polyadenylation factor II complex,
FT                   subunit PTA1"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR021850"
FT                   /db_xref="InterPro:IPR032460"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYX6"
FT                   /protein_id="BAE65547.1"
FT                   /translation="MAQSTGSLVDQIAQLNAARTLVLGDAAFYPQIVNGVLPIIGARSR
FT                   LELRRWGAEFLAETFSSPALAPAQKEQLAAIALQTLRETLELPEKDTVTLKHIVEAAAS
FT                   LYPLKCAGNQFKPAHWGIVGTDTLDNCSINHPEDSKVWENMTAIKDDILRRWDTSPFSV
FT                   KVCCIKFVQRVVQVQTHGLTDPRVRTGKKEMPAVPKGKTVDDSQRPEQNETSLAIVPRN
FT                   HSILSLPYLEAEASGLLDRLLSSIVPCPTNGPVIVSDPLLVNATLNSLAILIRTRQSIG
FT                   NKIINAILSFVPARQARTPVTPAVRVGVKSMERTARALMINIMKRNPSHPLASKMQQHI
FT                   ERLMQSRIETVDDSSKKRGLPTEPTDGLDNSKRAKLDAESPPLIKVSPLPPGPVSYSQL
FT                   YTLTEDAGLSSFDVKQLPVELLVKIVVPVLARVDQSALQQAVDGVRMRYQTLQKQQAAQ
FT                   PPPPATGEEEDDDYEPEYQPMDVPEQAAEQEDALSAEPADLQPDLVSLGPFVLPQPPPL
FT                   SENEAAEIGRSAVGRVFDMLASSGVAPNTGKGKSQQHLGFSRLAGSTFDRDAWVTLLTR
FT                   LATRAPAGLEVDHKKNDQDPSSKRPTISDSIRETLYRYILEDFRGRVNVGIMWLNEEWY
FT                   NDRIQMKFTASQRGEEDEESSVPLHYDQWSLRLLDGFLPYLDSRDTKIFIRFLSEIPEV
FT                   TIPITKRVASLAKDPERVNLCIQSLLYLIMFRPPAREMCLNAVEDVYQTYEESRPAAGK
FT                   VLARWRPQSTAVQQAQPEQQSTLVNRTVESENNTPVANGA"
FT   exon            complement(197830..197981)
FT                   /number=1
FT   exon            complement(198038..198108)
FT                   /number=2
FT   exon            complement(198165..198997)
FT                   /number=3
FT   exon            complement(199052..199400)
FT                   /number=4
FT   exon            complement(199455..199699)
FT                   /number=5
FT   exon            complement(199744..200151)
FT                   /number=6
FT   exon            complement(200218..200541)
FT                   /number=7
FT   CDS_pept        complement(join(203547..203817,203880..205008,
FT                   205059..205652,205747..205827,205954..205977,
FT                   206050..206179))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000069"
FT                   /old_locus_tag="AO070302000021"
FT                   /note="oligosaccharyltransferase, STT3 subunit"
FT                   /db_xref="GOA:Q2TYX5"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYX5"
FT                   /protein_id="BAE65548.1"
FT                   /translation="MAETPVDALLKGNTGRNTRGLLRIIILVTIAAAAVSSRLFSVIRF
FT                   ESIIHEFDPWFNFRATKYLVQHGFESFWDWFDDRTWHPLGRVTGGTLYPGLMVTSGVIY
FT                   HILRFLTIPVDIRNICVLLAPAFSGLTAFAMYLLTCEMSISPSAGLLAAAFMGITPGYI
FT                   SRSVAGSYDNEAIAIFLLVFTFFLWIKAVKNGSIMWGALTALFYGYMVSAWGGYVFITN
FT                   LIPLHVFVLLCMGRYSSRLYISYTTWYALGTLASMQIPFVGFLPIRNSDHMSALGVFGL
FT                   IQLVAFADFVRGFIPGKQFQRLLTAMVIIVFGVAFAGLVLLTVSGVIAPWSGRFYSLWD
FT                   TGYAKIHIPIIASVSEHQPTAWPAFFFDLNLLIWLFPAGVYMCFRDLKDEHVFVIIYAV
FT                   LASYFAGVMVRLMLTLTPIVCVAAALALSTIIDTYVFASRGPSPQSKAQDETSAEGLRS
FT                   TRNPVVGISSYISKAVVTSSVVIYLLLFVAHCTWVTSNAYSSPSVVLASRMPDGSQFII
FT                   DDYREAYYWLRQNTPDNAKIMSWWDYGYQIGGMADRPTLVDNNTWNNTHIATVGKAMSS
FT                   REEVSYPILRQHDVDYVLVVFGGLLGYSGDDINKFLWMVRIAEGIWPDEVKERDYFTAR
FT                   GEYRVDDEATPAMRNSLMYKMSYYNYNALFQQGQAMDRVRGSRLPAEGPQLSTLEEAFT
FT                   SENWIIRIYKVKDLDNLGRDHNSATAFERGHKRKRATKRKGPRVLRTE"
FT   exon            complement(203547..203817)
FT                   /number=1
FT   exon            complement(203880..205008)
FT                   /number=2
FT   exon            complement(205059..205652)
FT                   /number=3
FT   exon            complement(205747..205827)
FT                   /number=4
FT   exon            complement(205954..205977)
FT                   /number=5
FT   exon            complement(206050..206179)
FT                   /number=6
FT   CDS_pept        join(206539..206735,206815..206996,207055..207284,
FT                   207359..207448)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000070"
FT                   /old_locus_tag="AO070302000022"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYX4"
FT                   /db_xref="InterPro:IPR033464"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYX4"
FT                   /protein_id="BAE65549.1"
FT                   /translation="MDLPPLSKEQLSVVLKSSRSPTELYNILVEYEGEAYLMSTSDSNV
FT                   SELLSLFYSTFFFAHLLTDQIYEARAMTQRMPQELSQNDPSLQNCLTLLRAVWQRNYES
FT                   IYKILRELPWPDFLRPAVESYETYFQEKTLKEVSHAYEAIRPATAANYLGLDTAAAEQG
FT                   DPAVIQKFTAVGWVWDESTRLLHPKPIPTAPEKDTRLYDEKPGRSDWLNEELRWLRNNR
FT                   PPGPLNGGNV"
FT   exon            206539..206735
FT                   /number=1
FT   exon            206815..206996
FT                   /number=2
FT   exon            207055..207284
FT                   /number=3
FT   exon            207359..207448
FT                   /number=4
FT   CDS_pept        join(208586..208720,208796..209593,209654..210778)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000072"
FT                   /old_locus_tag="AO070302000024"
FT                   /note="cytoplasmic dynein intermediate chain"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYX3"
FT                   /protein_id="BAE65550.1"
FT                   /translation="MSSAMQQRKAEILAKRAKLAELKRQRELRQQEFSQSRANSGDASE
FT                   VVSPVPSRADSRAELDDLISRLVDRPGSASISHADGPSRKGSRPNSVISASQVSGDHAE
FT                   AFIPAARPVSHSIAVQTVGAEPYPTAPAPEPKPEIVTYSKGVQTDDSKQPQGTLSVESD
FT                   DEDGQDPTGTGKRLSKKERERDEEIRKKLRAEIEEELLATQQKAEHDAEDDSSKLRYPL
FT                   RTLDDDELKAVTSSEDFLDFVERSAKVIERALDEEYDVLADYELGGLDGDVEEDDEHGK
FT                   KRRGIREVCQFWDERWSKKRMISDVSFSPKFPELVLAAYTKNPSAPHEPDGLVQIWNQH
FT                   LQSRPEYVFHSTSDILAAKFSPFHPNLIVGGSYSGQVLLWDTRSSRAGGGAPVQKTPLT
FT                   GSGHTHPVYSISIIGTQNAHNILTASTDGVVCGWTVDMLSQPQEYLELSTPPPSKTEDL
FT                   APTTMSFPQSDPTFFIVGTEEGGIYPCHRYDRAGAKAGTDHRLAYRGHAAPIMSTAFHP
FT                   ARGPVDLGDLMLSSSLDWSVKLWRVRPPATTAPATSAIAATQVVSPILDINREDVVYDA
FT                   RWSPHRPGVFSLVDGAGNLEIWDLYTDTEVPVVRTTPSKGRGGILTSSLNKVAWEEREG
FT                   RRIATGGLDGVVTVFEVGKGLSGTPEDVPAEEWAGVKRLVGGLEQKDRIN"
FT   exon            208586..208720
FT                   /number=1
FT   exon            208796..209593
FT                   /number=2
FT   exon            209654..210778
FT                   /number=3
FT   CDS_pept        join(212418..212732,212803..213478,213512..213999)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000073"
FT                   /old_locus_tag="AO070302000025"
FT                   /note="phospholipase C"
FT                   /db_xref="GOA:Q2TYX2"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYX2"
FT                   /protein_id="BAE65551.1"
FT                   /translation="MQWQPPSAPRGPSKPELQPILRPDRVIQEDGLAHIKAGTWSPETP
FT                   RRPWLRTTLITVLLFIMSIISLLAFFSLALGINGLPHARSSSPSYGKPVNPIKDTPIKN
FT                   VVVLVEENLSFDVFAGGLTYNAKIDGLVNREYCNPSNASDPFSEKVCAKPIAKNVAPDD
FT                   PDHSITGGNQQVYSTYHPNAKNDMPGMQGFVTEQIVSYGLGSDLSRAAEVINYYTPDHV
FT                   PVFNAMAENFVLFDRWFAAVPGPTNPNRAYLTSGTSHGHGQNDHDFDISNLPQVSIFEQ
FT                   LSAAGISWINYSNTTGFLPDSLFYQWTAKSGKGTTNVKSIDQFFNDAKAECCSYMSFHP
FT                   PSPINMGEGFIKSIYEALRSSPQWNETLFILTFDEHGGFADHVSPPENVPAGDNLTYTE
FT                   TAKDGQEATFHFDRLGIRVPTVLMSPWVGKGVVQNSPADQPNEFTHTSILKYVAELWNL
FT                   DILTPRVDWSPSFRGLITNTFRETPEKLPEPADF"
FT   exon            212418..212732
FT                   /number=1
FT   exon            212803..213478
FT                   /number=2
FT   exon            213512..213999
FT                   /number=3
FT   CDS_pept        215166..216932
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000074"
FT                   /old_locus_tag="AO070302000026"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:P78581"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P78581"
FT                   /protein_id="BAE65552.1"
FT                   /translation="MRQHSRMAVAALAAGANAASFTDVCTVSNVKAALPANGTLLGISM
FT                   LPSAVTANPLYNQSAGMGSTTTYDYCNVTVAYTHTGKGDKVVIKYAFPKPSDYENRFYV
FT                   AGGGGFSLSSDATGGLAYGAVGGATDAGYDAFDNSYDEVVLYGNGTINWDATYMFAYQA
FT                   LGEMTRIGKYITKGFYGQSSDSKVYTYYEGCSDGGREGMSQVQRWGEEYDGAITGAPAF
FT                   RFAQQQVHHVFSSEVEQTLDYYPPPCELKKIVNATIAACDPLDGRTDGVVSRTDLCKLN
FT                   FNLTSIIGEPYYCAAGTSTSLGFGFSNGKRSNVKRQAEGSTTSYQPAQNGTVTARGVAV
FT                   AQAIYDGLHNSKGERAYLSWQIASELSDAETEYNSDTGKWELNIPSTGGEYVTKFIQLL
FT                   NLDNLSDLNNVTYDTLVDWMNTGMVRYMDSLQTTLPDLTPFQSSGGKLLHYHGESDPSI
FT                   PAASSVHYWQAVRSVMYGDKTEEEALEALEDWYQFYLIPGAAHCGTNSLQPGPYPENNM
FT                   EIMIDWVENGNKPSRLNATVSSGTYAGETQMLCQWPKRPLWRGNSSFDCVNDEKSIDSW
FT                   TYEFPAFKVPVY"
FT   exon            215166..216932
FT                   /number=1
FT   CDS_pept        complement(join(217328..218544,218601..219213))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000075"
FT                   /old_locus_tag="AO070302000027"
FT                   /note="synaptic vesicle transporter SVOP and related
FT                   transporters (major facilitator superfamily)"
FT                   /db_xref="GOA:Q2TYX0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYX0"
FT                   /protein_id="BAE65553.1"
FT                   /translation="MASEDCIHEAPQPQGIPYWRLLTDQGVVTSEIIDYPYKGSGTDDD
FT                   PYIVEWIPNDPRNPMLLNKSLKWAYTITVAFATFGVSLSSSAYAGGIQEVIKHFGIGEE
FT                   VATLGVSLFVLGFAVGPLVWAPLSELIGRQIVFFVSYGALAFFCAGAAGAQNSWTLIIL
FT                   RFFAGSFGSSPLTNAGGVIADIFPAEERGLATSLFAGAPFLGPTLGPVIGGFLGENAGW
FT                   RWVQGFLATFTGLIWIVESLLVPETYAPLLLRKRAARLTTLTGKVHRSKLELERGKVTM
FT                   TSAFGAALLRPWILLFAEPIVLLLSTYMAIIYGTLYMLFDAFPIVFQQLRGWSEGVGSL
FT                   PFLGVMIGMMLAVALNMYDNKRYVAIHKAHHGFAPPEARLPPTMLGSIAIPIGLFWFAW
FT                   TNAPPVHWIVSIIAAAPFGFGMVLVFLNIMSYLIDAYTIYAASVLAANSIIRSCFGAGF
FT                   PLFTTYMYRNLGVHWASCIPAFLALACVPFPFVFYKYGAVIRRKCKYAAEADDFMRRLA
FT                   EKTVSLGEEEKAVDEEVRVQAEGRGSADGGQDLGRLESGGRSSLSTMRDGNAGYEANPY
FT                   DIDRVNTRNSAISRRSRSRSRSAKGRKRGFLGL"
FT   exon            complement(217328..218544)
FT                   /number=1
FT   exon            complement(218601..219213)
FT                   /number=2
FT   tRNA            complement(220018..220091)
FT                   /locus_tag="AO090103t00005"
FT                   /product="tRNA-Ile"
FT                   /note="tRNAscan-SE"
FT   CDS_pept        complement(join(221056..221085,221214..221318,
FT                   221449..221556,221677..221805))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000076"
FT                   /old_locus_tag="AO070302000028"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYW9"
FT                   /db_xref="InterPro:IPR000072"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYW9"
FT                   /protein_id="BAE65554.1"
FT                   /translation="MLRVSAIFMACLLLATAAPTAPEKSNACLSMCLQERPACASDEGC
FT                   WGCCQKIEAVAAPVQRASCLSMCQQEKPNCASDEGCWGCCQKIEPVVPVKKEMCLSMCL
FT                   QEKPTCASDEGCWGCCQKN"
FT   exon            complement(221056..221085)
FT                   /number=1
FT   exon            complement(221214..221318)
FT                   /number=2
FT   exon            complement(221449..221556)
FT                   /number=3
FT   exon            complement(221677..221805)
FT                   /number=4
FT   CDS_pept        225674..229069
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000078"
FT                   /old_locus_tag="AO070302000030"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYW8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYW8"
FT                   /protein_id="BAE65555.1"
FT                   /translation="MSTFRSTLDEADPTSWLKDLETKLIPREKRTGWMKTFQARIRAPP
FT                   CGTVHVTAGDLFDFIRAQANAGDEMMSRYEQTGRMGDLEEAIKAFRWAVYITPENHPYR
FT                   AAMLYNYGNMLERRYEKIPDEECLKEAICVSYQVVQLVPKSHPFRLAIMDTYGKKLRLR
FT                   YKRTQQIEDLEEVIWVSCQAIQAPPTGHPRRARWLNIIGRMLKDRYEHIGQIEDLGLMI
FT                   KALRSAAQVTYDTCPDLVTYLSDLGYGLTIRYERTGEMKDLAEVLEVFRKVVQATPDTC
FT                   PDLANYLTKLGVELTRRYERIGRTEDLAEAIQVFRRAVQTTADTSSDLARYLTNVGSGL
FT                   TRQYEREGRREDLEEAIELSRRAIRAMPMDSPDLATHLTNLGYRLVLRHERTNKMDDLQ
FT                   EAITLSRQAEEASYNNDSDSTASVGNLGGVLLYGYKRTKQMDHLEEAYQICRKAVQITP
FT                   VDDPYYGKWLCNLAHVLTERYEHTRQRKDLEVAIWWSRKSIQASFDGDIDLRAQYNNLG
FT                   TMRVTRYEQTWQFGDLEEAIRISRRAIKATPDDHPYLAGQLKNLGAMLKSQYERTGCLK
FT                   DLEEAIHVSRKAARITSALPLERISAASLAIRLMLKQEDYNNSYALCVEALDLLQLVCS
FT                   RHLTLEDQQYVVSHFSGLATLACSLALQVRQPPFRALQLLEAGRSVIFGLIMNDRSNTS
FT                   KLKAADPTLCALYEELRLGINDPAESSQPQYVDEAVPTRRLQALKKLEKCLHDIRQLPA
FT                   FDSFQQDLNEEQMKDASLNGSIIVVNITRLRSDAIVVSQAGFSLVPLPGLGAVQAQRWI
FT                   DQEMTSASSSQRGEMNKRYREFLGWLWYECAEPILTKLGYNVQSSPENLPRTWWIGTGL
FT                   ASSFPFHAARGLRADENDSTSSRVLSSYTTTIKALLHARERVSASFSPNEQLLNLLMVT
FT                   MAHTPGEDDLPGVECERSIVLDLLGSSVHVNKLDQPDSASVMRQIGDCHIAHFACHGMS
FT                   DLADPFQSGLLLQTKTTIPEKEILSVRKLCKQNLPHGEIAYLSACSTAENRAKQLLDEV
FT                   VHVVNGFQVAGFRHVIGALWPSDDRVCVKVAKLFYTEICRNGVLEYTDRDVALALHKAV
FT                   SVISTSDDYRKRPLHWAQYVHYGA"
FT   exon            225674..229069
FT                   /number=1
FT   CDS_pept        join(231106..231298,231353..231450,231505..231765,
FT                   231838..232626)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000081"
FT                   /old_locus_tag="AO070302000033"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYW7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYW7"
FT                   /protein_id="BAE65556.1"
FT                   /translation="MEGKDTEKTPQALCKEQSIPSPTESSQTLDLECEYHDPKLPPVDG
FT                   GIHAWLFLAACFVVEGTVWGFAACFGVFQNYYRNDPTFQGSHAIAAIGTCAMGMAYLLS
FT                   PIVMAILIALPRMQRWASSIAFVVLSLSLALSSFSTSVTHLILSQGIAYGTAGCFAYAP
FT                   SILFMPDWFVKKKSLAFGIVWSGSGLTGIIFPLILQSLLDTYGWQTTLRICSVAIFLLA
FT                   APFMLFHKPRIPRKTTNLHQLDLSFHRNRTYLIYQAGNIIQSLGFFLPQIFLPSYAELL
FT                   GAKGLHASSTITVFNISNMFGCIFIGWLADRYHVTKCILISTVGAIFSTFLLWGMSVHL
FT                   APLYLFSIVYGCTGGSFSSSWAATSSEVGKSHPSADVSMVFAFMETGRGIGNVISGPLS
FT                   EALLKTRLWEGQAWGAYGTEYGILVVLTGVTGLLGGVSVVARALRWI"
FT   exon            231106..231298
FT                   /number=1
FT   exon            231353..231450
FT                   /number=2
FT   exon            231505..231765
FT                   /number=3
FT   exon            231838..232626
FT                   /number=4
FT   CDS_pept        complement(join(233080..234419,234475..234600,
FT                   234653..234881))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000082"
FT                   /old_locus_tag="AO070302000034"
FT                   /note="amino acid transporters"
FT                   /db_xref="GOA:Q2TYW6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYW6"
FT                   /protein_id="BAE65557.1"
FT                   /translation="MAIDEVTPAPQVTETAAGNDGDKITIKTGANPLKKFGKKKDGNGN
FT                   EDVEKDGIGGDTPPQELQRRLKSRHLQMIAIGGTIGTGLFISSGTAIAHSGPAGALIAY
FT                   IFVGTIVFSVMSSLGEVATYLPISGSFTSYTARLVDPSLGCAMGWIYWFNWASTYAVEL
FT                   TATGLIVQYWDDKLSVAIFIAIFWVVITLLNFLPVGFYGEIEFWFSMIKVLTVLGFMIF
FT                   AICIDAGVGKQGYLGFHTWKEPGAFAPYLIDASNPVSKFVGFWAVLVQAGFSYQGTELV
FT                   GVAAGETENPEKTVPSAIRKTFIRILIFFVLTIFFMGLLVPYDNPNLITDSSDASASPM
FT                   VIAAKLAGVKVLPSLINAVLLTVVLSAANSNVYSGSRVLLGLAQEKFAPPIFGWVTHRG
FT                   VPYISVAFTAAFGLLGFMNVSESGGKVFNWLVNISSVAGFICWTSISLSHLAFMRALKA
FT                   RDISRDTLPYKAALQPYLTWYGLFFSVLIILTQGFTAWIPTFNVSDFFVAYICVIIFVV
FT                   LYLGHKILYRTHFVHPLEADLQSGRLQNYSWETARPKTWQERLRESL"
FT   exon            complement(233080..234419)
FT                   /number=1
FT   exon            complement(234475..234600)
FT                   /number=2
FT   exon            complement(234653..234881)
FT                   /number=3
FT   CDS_pept        complement(join(236173..236529,236601..236759))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000083"
FT                   /old_locus_tag="AO070302000035"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYW5"
FT                   /protein_id="BAE65558.1"
FT                   /translation="MNQFNRTIHRKLIIGVLLCGGVFVMIATLLRCILSLQSINSINTS
FT                   TIWAIRETFVGIIAVNAPCIKPLFSTSTWLGSSEDPYSSSRKKGSYSLSVFGKSKPSHL
FT                   ESTKSTKMGGRSSDEFILHGGGTRTFVNDGQTGRSSSLSDEEAGRHPMGGIQVTTMYEI
FT                   RRDGSRHG"
FT   exon            complement(236173..236529)
FT                   /number=1
FT   exon            complement(236601..236759)
FT                   /number=2
FT   CDS_pept        complement(join(237197..237372,237426..237453,
FT                   237507..237665))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000084"
FT                   /old_locus_tag="AO070302000036"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYW4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYW4"
FT                   /protein_id="BAE65559.1"
FT                   /translation="MAHATPFQKEAWTEYGIGVIILLLRIVARVRVVGFKNWQGDDYFV
FT                   FVVLAFWTAELTMLELIGQYGTNIGLDDAQRASLTPEQTEILVRGSKCLLAGWTCYVTL
FT                   IWSLKACMLFFYNRLT"
FT   exon            complement(237197..237372)
FT                   /number=1
FT   exon            complement(237426..237453)
FT                   /number=2
FT   exon            complement(237507..237665)
FT                   /number=3
FT   CDS_pept        join(239520..239563,239634..239753,239804..240069,
FT                   240106..240620,240670..241273,241322..241548)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000085"
FT                   /old_locus_tag="AO070302000037"
FT                   /note="choline dehydrogenase and related flavoproteins"
FT                   /db_xref="GOA:Q2TYW3"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYW3"
FT                   /protein_id="BAE65560.1"
FT                   /translation="MGSTSEDVYDYIICGGGTAGCVVAGRLAENPDVKVLVLEAGQHNK
FT                   DLENVHMTGGWSNNFDSETDWNIVTTPMKGVDNRQVKLSRGRFLGGCSGCNGTLCVRGS
FT                   KQDYDDWELEGWSGEEFFAAMRKVYSSQSIRNLIPYLVDNWFQADPQSHGYNGPLHTEP
FT                   HDLAPISNLLIDSLVSQGMPLHHDMFSTGDVAHGCGHAPRTVHKGIRATAADFITKDYN
FT                   RSNVTIQTDTTVDRIVLEEGAAGLRATGVLTRLADGTTRTFHARKEVVVSSGAYCSPAV
FT                   LMRSGIGAREELDKFDIPCKVDLPGVGKNLMDHLIVFMFYETEKEGLTTDWHVYHDDNM
FT                   EKTYAQWKEHKTGFLSTFPFGAFAFARLDERLKDEPLWRDAPREPGRDPMGLTPQQPNI
FT                   EFFTTECYGGPKQYDQFPVDHKHAFSMIAELFAPKSRGTVTLKSKDPLENPIVDCNYLA
FT                   DPMDLLVLTEACRFGNEVVMKGTGTKDIVKGSWPPNLTHHTYTTREEWIPYVKEHATTC
FT                   YHASGTCAMGKDDNPLAVLDNKLRVKGVAGLRVADCSVMPTLHGGHTQMPAYGIGERCA
FT                   DFIKETWSGQSIARL"
FT   exon            239520..239563
FT                   /number=1
FT   exon            239634..239753
FT                   /number=2
FT   exon            239804..240069
FT                   /number=3
FT   exon            240106..240620
FT                   /number=4
FT   exon            240670..241273
FT                   /number=5
FT   exon            241322..241548
FT                   /number=6
FT   CDS_pept        complement(243008..243994)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000087"
FT                   /old_locus_tag="AO070302000039"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYW2"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR005103"
FT                   /db_xref="InterPro:IPR035971"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYW2"
FT                   /protein_id="BAE65561.1"
FT                   /translation="MKLNLASLSFLASIAPLVSGHYVFSKLIVDGQTTKDFEYIRENSN
FT                   GYQPTLASEIVNNDFRCNKGSMDSAAKTKVYTVAPGAEIGFQLAYGASMKHPGPLQIYM
FT                   SKAPGDVKTYDGSGDWFKVYQEGVCEDISDGLKDTDWCTWGKDTASFKIPKDTPPGQYL
FT                   VRVEHIGLHRGFSGNSEFYFTCAQIEVTGSGSGVPGPLVKIPGMYKPEDPNIHFDIYYP
FT                   VPTSYDLPGPSVWSGGASSGSSSSISAPPVNNAAAASSVTPTTLVTLSKTSSTPAATST
FT                   AAPTLPAPSNGTIKKYYQCGGQGWTGSGSCEAGTTCRDWNPWYSQCV"
FT   exon            complement(243008..243994)
FT                   /number=1
FT   CDS_pept        complement(join(246235..246908,247043..247283))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000088"
FT                   /old_locus_tag="AO070302000040"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYW1"
FT                   /db_xref="InterPro:IPR005193"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYW1"
FT                   /protein_id="BAE65562.1"
FT                   /translation="MLSLRLSVISVCLAAVNVLSASIRKDSVTKASLPKSFEWSSSGPL
FT                   ISPKNDNYDLAGIKDPSIVEVGGVYHVFASTAKEAAVVWCLVYQNGNAAYSTNSDISNP
FT                   DGWSAPKNFFDTMPSIISENIANRNWVDMWTIRDSSDCYLFPSDDNGLLSRSQTSLGSF
FT                   PNAMGNTVIALQGTNAYALFEVSNVYSTGDGEYLLLVEAIGRDSARYFRSWTSTSLSGT
FT                   WTSLADTEANPFAQSNNAKFSAPAWTKSISHGEMVRTNVDKTMTISPCNLCYLYQGVDP
FT                   NASGDYNAMPWKLGLLTQANSAC"
FT   exon            complement(246235..246908)
FT                   /number=1
FT   exon            complement(247043..247283)
FT                   /number=2
FT   CDS_pept        complement(248265..248834)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000089"
FT                   /old_locus_tag="AO070302000041"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYW0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYW0"
FT                   /protein_id="BAE65563.1"
FT                   /translation="MSNANNTPSSQPTHAGLSTEEAPSYQTFTDATDKLYKKLVHEESH
FT                   EWWQYRFVSTFFNLLAIVQVMVGATITALGPFGGQHLIAITVLGAINTVIAGFIALLKG
FT                   RGLPQRPRKNMLELRRVREYIEQKRTMLQYRNRRFSRDEVDSLLEDVMRRYDLAGEIIE
FT                   RNQPDTYTNAGLTGRERQPDEERGPK"
FT   exon            complement(248265..248834)
FT                   /number=1
FT   CDS_pept        complement(join(250514..250557,250815..251047,
FT                   251143..251172,251398..251462))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000090"
FT                   /old_locus_tag="AO070302000042"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYV9"
FT                   /protein_id="BAE65564.1"
FT                   /translation="MKIPAGGSAGNKSSYLGIRTHIGVRGPCGFKYDDNNAFILWQTLF
FT                   RPIMGANDRGKTYITVSAVLVALSTIVVGFRIVARWMRTTLGMDDYVICVSIILAYSML
FT                   GEAVVSFAISESRASSPAV"
FT   exon            complement(250514..250557)
FT                   /number=1
FT   exon            complement(250815..251047)
FT                   /number=2
FT   exon            complement(251143..251172)
FT                   /number=3
FT   exon            complement(251398..251462)
FT                   /number=4
FT   CDS_pept        complement(join(252121..252459,252512..252901))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000091"
FT                   /old_locus_tag="AO070302000043"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYV8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYV8"
FT                   /protein_id="BAE65565.1"
FT                   /translation="MTVTTTTRPTILVIHGAWHHPEFYAPFCRAFEDLGYEAVCPRLLT
FT                   CNNDVPPTKTLADDVALIRQTAQSLIDDGKSVVAVMHSYGGIVGTDALDGLAIKRLIYM
FT                   TAFIPPSGNSLAGMFGGQLPPFITIDDEKGMLTVPDPATFFFNDLPAEEAAAWAKKLVV
FT                   HPKSAQFDPISNEAYRSIPATYIVCEQDAALIPMVQEMMIGNVRKVGVDIDVERLPASH
FT                   SPFLSMPEETAKLVLKIASQ"
FT   exon            complement(252121..252459)
FT                   /number=1
FT   exon            complement(252512..252901)
FT                   /number=2
FT   CDS_pept        complement(join(254216..254269,254333..254563,
FT                   254617..254745))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000092"
FT                   /old_locus_tag="AO070302000044"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYV7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYV7"
FT                   /protein_id="BAE65566.1"
FT                   /translation="MKAPYFIAFLAAAVSAQNAFIGLPKKDQEITAGENLVVQVQRPNS
FT                   LTGSEEMGVAIGVASCPERPCMAPKDTLGTLLYNGPFKPEYHDSSPPYQNFTVTIPDSI
FT                   AKGDAQINVAHVAIVGASAWPYLDLLNQTVVVA"
FT   exon            complement(254216..254269)
FT                   /number=1
FT   exon            complement(254333..254563)
FT                   /number=2
FT   exon            complement(254617..254745)
FT                   /number=3
FT   CDS_pept        join(259332..259446,259500..259550,259605..259903)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000093"
FT                   /old_locus_tag="AO070302000045"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYV6"
FT                   /protein_id="BAE65567.1"
FT                   /translation="MKFTLAAASTFITAALAATLPKSFTLVADGGNTVLTDNTNAIVDA
FT                   SQANTLEILRLKSEDGKTITFTQQQAVNPNSWQNLYAIAGKSKPLGLTIPHSGATPDGA
FT                   VLNGWGITDDGYLTFNGENNFGLSEDKHQIYFLGEDATVPKVTLWVKELK"
FT   exon            259332..259446
FT                   /number=1
FT   exon            259500..259550
FT                   /number=2
FT   exon            259605..259903
FT                   /number=3
FT   CDS_pept        complement(join(260443..262003,262010..262542))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000094"
FT                   /old_locus_tag="AO070302000046"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYV5"
FT                   /protein_id="BAE65568.1"
FT                   /translation="MEKPDLIKELQSDLARKYKLHGPKIEGIWHSLGKAQREKVMRAGA
FT                   AEGQMLKSPTDRSLGDVYKFIPDWNLRDIADPDSDYLLDCLKHRATKSLPEQYIESANG
FT                   GPGDAAVILRSIQVHGLKHVEPFRYSFTLFMDEERYGQSFTVSDREKYKETMAMMKVGV
FT                   DAGLIVPQSTGELILQSILLTSMNIVIQDILEAGSTVETKARSKKSEKAAREAMSKLII
FT                   DQKPEKLSLEDLAALSLDQKSALEDYVLLCRTEPEFLAHAVNAWFFSRPELVADEKGRR
FT                   LPLITDKYINIAFFEMIHNAVVGAAVWGYIHQLLQALMTGPNDRTYKSSFLQELANVCH
FT                   FEYQRVQRLFKRFVQMGSGDKHFKRVSGVYDNGTARVTMKTKPDTLTRTDPQLNYILRL
FT                   CQPDTNASRVVEWVRKLDDLHQTHPAEQDKMVESEFDAFGDLAVTTNFVQCLSTSLPMP
FT                   PINPKKCQTYVSRIKDVGSELDPLKSEVDLSAFAVPIDNLMEPGMAQGALTTLDEFISS
FT                   RIGADIGFLYQDLNEECLSDLQNQAQQQKEKSEQIARAELASSTPEAPNREIQIEQRKE
FT                   KIKTRPPHSSVYSIAPTAAPATEPEPAAPSQAFKVKPSSLEVFSTLFSNPRPRSSITWA
FT                   AFQAAMAHMKFSVVPKTGSIYTFSPPEGFNVQRSITLHRPHQSRIEGWRLLYFASRLKR
FT                   KYG"
FT   exon            complement(260443..262003)
FT                   /number=1
FT   exon            complement(262010..262542)
FT                   /number=2
FT   CDS_pept        complement(join(262835..263783,263846..264459))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000095"
FT                   /old_locus_tag="AO070302000047"
FT                   /note="permease of the major facilitator superfamily"
FT                   /db_xref="GOA:Q2TYV4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYV4"
FT                   /protein_id="BAE65569.1"
FT                   /translation="MDPKPQGTHHEDPVKPANMDHINVVRVPLTEEDSKRIRNKTDRTI
FT                   LVILMWGYFLQILDKTVLGYGATFGLKEDTHLSGNEYSLVGSIAPIAQLAWQPFSSFLI
FT                   VKVPHRILLPVLVAGWGVAQAAMAACHNFGGLMATRFFLGLFEAGCLPLFSIITAQWYR
FT                   RAEQPLRVAAWYSTNGLATIIAAALSYGLGHIQSGVLKEWQIIFLFVGLITIVSSPFLY
FT                   WRLDNDIASARFLNDQEKLQAMERLRANQTGAGSREFKVRHVVEAGLEPKTYIWIGMAF
FT                   LLNVGASVTNVFGPLILSGLGFDKFKTTLLNMPFGALQFIIILLASYLAQKARLKAVVL
FT                   ASFMLPVVAGLAILYALPRDDSVQGALMAGYYLLSFLFGGNPLIVSWIVANTAGQTKKS
FT                   IVMSLYNAASSAGNIVGPLLFNENDAPAYQPGLRACLGIFIAMAAIVLIQWANLFVLNK
FT                   MQERRRVANGKPAKIVDRSMENNYQVSEEDAEVEAAETDNQVGNNAFLDLTDRENDEFV
FT                   YIY"
FT   exon            complement(262835..263783)
FT                   /number=1
FT   exon            complement(263846..264459)
FT                   /number=2
FT   CDS_pept        join(266674..266750,266842..267034,267111..267413)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000096"
FT                   /old_locus_tag="AO070302000048"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYV3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040632"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYV3"
FT                   /protein_id="BAE65570.1"
FT                   /translation="MSRQIDRLAQPANKKKMKVVIASCSRSGTLGLLAAMRILGFSPYH
FT                   MTEACFSGPVHMKILEEAVIAQHNRFSGIKRYERVDFDKWLSDYDCFIELPSYLGSQAL
FT                   EVYAEDPDVKFILTHRDPDKWVTSMDNTIANVVRMATSFPMNILKHFDIILKGFFRLNQ
FT                   VMFWAMSDGTNPGDPNNEAALRRNYVE"
FT   exon            266674..266750
FT                   /number=1
FT   exon            266842..267034
FT                   /number=2
FT   exon            267111..267413
FT                   /number=3
FT   CDS_pept        complement(join(267802..269287,269340..270171,
FT                   270224..271214))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000097"
FT                   /old_locus_tag="AO070302000049"
FT                   /note="ankyrin repeat"
FT                   /db_xref="GOA:Q2TYV2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYV2"
FT                   /protein_id="BAE65571.1"
FT                   /translation="MVDPNEYTVGWICAITTEYVAAQAFLDEKHESSAYLSPQNKNDYT
FT                   LGRLANHNVVIAVLPIGEYGTSSAARVAETMLHSFPNVRIGLMVGIGGGAPSADHDIRL
FT                   GDIVVSTPSNNHGGVFQYDYGKTIQGQRFFPTGYLDQPPAVLRAAVNGLQARYEIEGHH
FT                   LAGDIDQALERNPRLRKKYGRPDPASDRLYQSHIVHPPHDKSNCTISCGDDPSTLVLRN
FT                   PRTEDEDSPIVHYGLVASANQLMKDACMRDKLTMEKDVLCFEMEAAGLMNHFPCLVIRG
FT                   ICDYSDSHKNKAWQGYAAMAAAAYTKDVLRRISPQHVQAEKKIMEILSTVKTIHETTQD
FT                   IDRGVKRLRQLGDDQEYQAVINWLTPVNYALQQNDFIARRQEGTGEWFLNSTEFKQWLS
FT                   QSKQTLFCPGMPGAGKTMITATVIDHLYRTYQNKPKTSITYIYCNFRQQHQQRYTDLLL
FT                   SLLKQLVQGQPFIPNAVRVLYDECKGRGSRPSHEGILSTLYSVAASYSRLFILIDALDE
FT                   CQVSNEDRERFLRIVFGVQERTKANILVTSRFVHEIEKRFGESIRLEIRASDMDVQRYI
FT                   EQRLQSFPSFVLHNPALQAEIKTNLARAVEGMFLLAKLYLDSLVYKTTPKAIRCVLADL
FT                   EVTSAERSDNGQKSKVLDHAYNQAMERIRGQAPEHQKLANRVLSWIACATRNLTLSELR
FT                   HGLAVEFNTPELDEDNMPDIEQAVSVCAGLVIVDEKSNAVRLVHYTTQEYFERTYNEWF
FT                   FQGHINITKACLTYLSFKDFDGDHFLTPMKMAMRTWSNPLYYYAALNWGYHARKAYMEE
FT                   DKLVLDFIHNTSKLLVCGHFIRQGQLGRGLGSVDMESMHLTACLGLSKSMSILLEGSHD
FT                   VDPRDSLYMTPLLWAAMQGHEAAVKLLLENGADVNSADAWGMTSLSWAAKRGHEAVVKL
FT                   LLEWSADTEEKTRKGDTPLIMAAEEGHEAVVRALLGGNAIIEARNKSGYTALLLAVQNG
FT                   HEAVVSLLLEKGANTEIKGYLDRTPLLIAVENRDDAMVRLLLNKNPNIEARDSKGLTPL
FT                   SLAAWGGDETVVRRLLERNANINSKCGRGFTAFYLAAKGGHKAVADLLKEARAL"
FT   exon            complement(267802..269287)
FT                   /number=1
FT   exon            complement(269340..270171)
FT                   /number=2
FT   exon            complement(270224..271214)
FT                   /number=3
FT   CDS_pept        join(271748..271826,271953..272539)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000098"
FT                   /old_locus_tag="AO070302000050"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYV1"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYV1"
FT                   /protein_id="BAE65572.1"
FT                   /translation="MDESEAHLLRGICINVSVRHLHTIPDNIKIMSVNSVSLSGSHSVS
FT                   KTAVPSITLIPNHGVKGDAHAGPTVQHRPLRNARPSDVNLRQVHLMQAEILQQVSKDPA
FT                   TGTKDIVLKPGQLGENITTQGIDLLSLPKDTRLLFVDGKASSQDAPTLRLTGLRNPGPQ
FT                   LDAMKKGLKDRFLVKDSRGVVIGYMAGVMSVVEKGGEIRPGMEIVVQKPATNLALNCI"
FT   exon            271748..271826
FT                   /number=1
FT   exon            271953..272539
FT                   /number=2
FT   CDS_pept        join(273110..273361,273413..273510,273561..273908,
FT                   273970..274098,274155..274989)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000099"
FT                   /old_locus_tag="AO070302000051"
FT                   /note="predicted transporter (major facilitator
FT                   superfamily)"
FT                   /db_xref="GOA:Q2TYV0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYV0"
FT                   /protein_id="BAE65573.1"
FT                   /translation="MSLIQALHCEIQPEKRVSAPALASPPSSYSEGPGQQAESRQITLN
FT                   GNQPPETGQPVFERVPSHGTTQARRLTVTVLLILANLVQMTVNFAGIAGGSTLTSAMGV
FT                   EGTYASWIGASYALTQGTFVLMSGRLGDVFGHRKLLLIGGAWLSLCVLVGAFCNNFFAF
FT                   VTMRALAGVGGAFIMPNAVAMISSTNPPGRLRNLSLGFFAASAPLGGYCGAILLGAFLE
FT                   NTDWKWFFVFIAVTFVALWALAPYEPPVDRSGKIDWIGSALGTSSLILFNFVWNQAPSV
FT                   GWSTPYEIALLPISLILFVSFLVWEKRFAAQPIMPLEIFKAPSFLTLLLVILLNYMAVG
FT                   TLIWYQVLWLQEVWHWSPLHFAVGWTPFVVCATAAASLAAWLIPRLAAQWILAIGTVTI
FT                   LVSNALMATVPLQQSYWAQIFPSVVLFSFCPDFVYTAGQIIASNSVRRHQQGIAGSIIG
FT                   TLNLYGNSLGLGFASTIEVQVARRFHNQITGYRAALYFGVTISAVALILDVCFVRLVKD
FT                   EREGWEEEDLLAINEIELQGRAEATGAQLPAAPLRS"
FT   exon            273110..273361
FT                   /number=1
FT   exon            273413..273510
FT                   /number=2
FT   exon            273561..273908
FT                   /number=3
FT   exon            273970..274098
FT                   /number=4
FT   exon            274155..274989
FT                   /number=5
FT   CDS_pept        276664..277602
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000101"
FT                   /old_locus_tag="AO070302000053"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYU9"
FT                   /db_xref="InterPro:IPR022085"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYU9"
FT                   /protein_id="BAE65574.1"
FT                   /translation="MADCPSGSCRVRVLTREQKRQEFAYDPAGPQETWQDFKWRILNFT
FT                   QEYIEHNWDLPFVEEGLHDLWDELIHVAKRHPADSAEHDRLITLILEVREWGTVTRKKK
FT                   GASADEEPEQVILPNGQRLWVDIPYLVQEFQDAWMKESMGYTAAQREGLAALTARLCAV
FT                   GVYPSELSCCALWLFKETFETERPLIRVEGEGNATNACVPVVELLPACHAWLKYNSFKL
FT                   AMFTATNHDYPPPSTGDSVQASTAPGDLVPKSEFPCSGFSIPRWVFWRRRYKHFHHCGN
FT                   EQIAKLARACFEEAMFRGTRIGIELPGEKYF"
FT   exon            276664..277602
FT                   /number=1
FT   CDS_pept        complement(join(281421..281551,281619..282226,
FT                   282320..282339))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000104"
FT                   /old_locus_tag="AO070302000056"
FT                   /note="acyl-CoA dehydrogenases"
FT                   /db_xref="GOA:Q2TYU8"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYU8"
FT                   /protein_id="BAE65575.1"
FT                   /translation="MGRRSGMITNGIWSDYTTMAVRTGGPGASGLSVMVVPLKGYPGVT
FT                   MRRIHVSGTKTAGTTYIELDDVKVPVGNLIGREGDGMRTIMTNFNHERLTIAVQCTRQA
FT                   RVALSSAFGYCLKREAFGKTLMDQPVVRHRLAKAGAELETVSAWIEQILYQLCKLEKVE
FT                   ADRLLGGVTALAKAKAAMVLNECAQCAVLLFGGAGLTQSGQGEIVEAIMRDVPVSRIPG
FT                   GSEDVLLDLLVRQLVKIYQTQEKKLGQAKI"
FT   exon            complement(281421..281551)
FT                   /number=1
FT   exon            complement(281619..282226)
FT                   /number=2
FT   exon            complement(282320..282339)
FT                   /number=3
FT   CDS_pept        join(283954..284081,284133..284911,284960..285011,
FT                   285061..285105,285153..285210)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000105"
FT                   /old_locus_tag="AO070302000057"
FT                   /note="threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /db_xref="GOA:Q2TYU7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYU7"
FT                   /protein_id="BAE65576.1"
FT                   /translation="MSTMQAVVFQGPLKVTLEQRPVPQIEEPTDVIVKVRYTALCGSEL
FT                   HVFRGHQPSGTGFIMGHEFTGEIVEVGSAVRGFKVGDLVVSPFTVNCGECFYCARKCSS
FT                   RCAKGKLYGSVMLDGGQADYARVPSADATLVAAPAAVDEKKLVLMADILPTGFFAARNA
FT                   FKGMDRATIEESTVLLFGCGPVGLCALISALDYRPKHLIAVDSVPSRLELAKSLGAEPW
FT                   NFQTDAEGLKQRVKDLTEGRGADVAIEVVGHSDALRMAFDNLRPWGRISSIGVHNGEIP
FT                   WTGNEAYGKNLQIQMGRCPVRSIFEDALEFLIRKQDSLGFMVGDIRPLSQAIQAYDDFN
FT                   QMKSQKIIFEAGK"
FT   exon            283954..284081
FT                   /number=1
FT   exon            284133..284911
FT                   /number=2
FT   exon            284960..285011
FT                   /number=3
FT   exon            285061..285105
FT                   /number=4
FT   exon            285153..285210
FT                   /number=5
FT   CDS_pept        join(285650..285672,285820..286273)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000106"
FT                   /old_locus_tag="AO070302000058"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYU6"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYU6"
FT                   /protein_id="BAE65577.1"
FT                   /translation="MIKILHKHPYRIQPNQQPTKQLFKMIDFELSDTQTRVREHAHSFA
FT                   TKHLETAHTVYTNLLTPQARFSAIRPLYEDLIKAGLIQAQVPAEYNGLGYGLVDMALLT
FT                   EELYSADANVALTILATGLGLSPLLIGGTDAQTKRYLSPFTDGKGGTVGKLGTF"
FT   exon            285650..285672
FT                   /number=1
FT   exon            285820..286273
FT                   /number=2
FT   CDS_pept        join(287604..287710,287763..287910,287962..288215,
FT                   288277..288634)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000107"
FT                   /old_locus_tag="AO070302000059"
FT                   /note="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="GOA:Q2TYU5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYU5"
FT                   /protein_id="BAE65578.1"
FT                   /translation="MNSRQLAKAAIPAYTCPEGTKMHLLDLGSLSCEEGWLFTAGGSAT
FT                   ASNPQRPRKWRDLMVLAGLIDHPEMGLILFETGCAEDIEIKWNPANADVFPRTRYEPEH
FT                   RLPAAIKAAGYDIKDVKAVIMGHLHLDHAGGLEHFLNTDVPIYVHEEEFKHACWGAGTK
FT                   AEEGSYLPDYLPLDGSLNWQTFNDSQLDLCTGITLHLCPGHTPGLCIMQVNLPQDGTFI
FT                   WTTDQFHVRENYEKNHAQGWLLRDHKSWMDSTNFIRRLQRLYSATLIFGHDLEVGTALI
FT                   QQKPFYQ"
FT   exon            287604..287710
FT                   /number=1
FT   exon            287763..287910
FT                   /number=2
FT   exon            287962..288215
FT                   /number=3
FT   exon            288277..288634
FT                   /number=4
FT   CDS_pept        join(290667..290747,290809..291417)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000108"
FT                   /old_locus_tag="AO070302000060"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYU4"
FT                   /db_xref="InterPro:IPR025331"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYU4"
FT                   /protein_id="BAE65579.1"
FT                   /translation="MHASLALLLLPLGALSLPFEDSVQTVEASLGRRCGRSPCKGVPST
FT                   NTPDALCNNKFLGPKVLTAADDPEWSEMFKGYSPLGSYCPKDFLLEFAPSGKQYDYPEQ
FT                   DGALLDSVGVPVTTEYTLEEGMELDRFGTQYGGYLAPRGTPFAWRSIPPSNLNKYPNSP
FT                   EYNYWVWRVVESFNVTGGPIAPFFGQPGYGLQFYYEGGLKLLEDQGVIELVDKKQCSCE
FT                   VPRDDLK"
FT   exon            290667..290747
FT                   /number=1
FT   exon            290809..291417
FT                   /number=2
FT   CDS_pept        join(296567..296663,296733..296977,297028..297477,
FT                   297566..298144)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000109"
FT                   /old_locus_tag="AO070302000061"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYU3"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYU3"
FT                   /protein_id="BAE65580.1"
FT                   /translation="MRMPRGGLLGAIVCLAGIGRVVEALSIDINDADSIKSAASQTAYG
FT                   SMLWYSGNETGQIPGAFPDKWWEGSALFLSLLYYWHYTGDTTYNAEVSQGMEWQAGNGD
FT                   YMPANYSSYLGNDDQGFWGIAAMTAAEIGFPDVDDGYSWLSLAQGVFNTQVARWDSSNC
FT                   GGGLRWQIFPYQAGYAMKNSISNGLLFQLAARLARYTNNQTYTEWAEKVWDWSASSPLL
FT                   NNQTWNVADSTDIEGGCKSQGNNQWSYNYGTYLIGAAYMYNMTEKETWKTAVDGLLGVT
FT                   LNTFFPQDFNYIMSEVLCEPNEVCNDNEILFKGLVSGWLAFVALLVPSTYDEILPKLQA
FT                   SAQGAAASCSGMSNNTCGVRWHESKWDGWVGMEEQISATDVLSSVLVTEKKGSGPLTST
FT                   TGGNSTSNPNAGSGDDSSSDKSQLKSITTGDKAGASIVTIAFVGIWGGLIAFMVLGT"
FT   exon            296567..296663
FT                   /number=1
FT   exon            296733..296977
FT                   /number=2
FT   exon            297028..297477
FT                   /number=3
FT   exon            297566..298144
FT                   /number=4
FT   CDS_pept        join(299072..299114,299171..299884,299927..299934)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000110"
FT                   /old_locus_tag="AO070302000062"
FT                   /note="choline dehydrogenase and related flavoproteins"
FT                   /db_xref="GOA:Q2TYU2"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYU2"
FT                   /protein_id="BAE65581.1"
FT                   /translation="MANNTKEFDFIIVGGGPAGCTIASRLASCSEKPRVLLLEAGKHND
FT                   SEDLMVDGQRWTTLQQPGMNWGYTTVSQEYCNGRQLDYSRGRGLGGSTAISFGFWTVGC
FT                   RGDYDRWADLVDDPRFDWVHMQARFKALESFQTEDAEASYGDYVSPRRDDHGQHGPLKV
FT                   GYAKLWERDIVPMLDIFRDAGFPITRDLNSGNPLGIGPVINSCYQGRRTTAITLLQNSS
FT                   NNLTTITECSVERLVLEGKRVIGVEAAGARLD"
FT   exon            299072..299114
FT                   /number=1
FT   exon            299171..299884
FT                   /number=2
FT   exon            299927..299934
FT                   /number=3
FT   CDS_pept        300439..300903
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000111"
FT                   /old_locus_tag="AO070302000063"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYU1"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYU1"
FT                   /protein_id="BAE65582.1"
FT                   /translation="MNPQSRGEVTLQSADPTVPLLFNPRFLSHPYDRRVAIESYRDLLK
FT                   LSAHPSFSKDTIGDLIRPQGDSDEAILEFWRQFVSSTWHMTGTVKMERPDDPDAAVDRS
FT                   FRVRNLEGLRVADMSVVPVLPNSHTQVTAYLVGATCADVLIEEYDLSYQV"
FT   exon            300439..300903
FT                   /number=1
FT   CDS_pept        complement(join(301172..301534,301585..301782))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000112"
FT                   /old_locus_tag="AO070302000064"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYU0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYU0"
FT                   /protein_id="BAE65583.1"
FT                   /translation="MVDRCNAQDKTIIEHVQIIDLENDAHLPKGRCIEGMLAGNDNWRS
FT                   PEAHFKGELNKPTDMFSFAIVCIYAILGPVIFGPDDDFRKHEAQGVLPALICLQRQVSY
FT                   FGDQEGLKGLMKHTDDDEVSCQVLQMLWEERHEEHIPYKLFSEWPDVFDPVFKDFILGL
FT                   TSLDPHKRLTARQALDHPWLANF"
FT   exon            complement(301172..301534)
FT                   /number=1
FT   exon            complement(301585..301782)
FT                   /number=2
FT   CDS_pept        complement(join(302869..303038,303110..303484,
FT                   303542..303874,303925..304165))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000113"
FT                   /old_locus_tag="AO070302000065"
FT                   /note="probable taurine catabolism dioxygenase"
FT                   /db_xref="GOA:Q2TYT9"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYT9"
FT                   /protein_id="BAE65584.1"
FT                   /translation="MAPSVADSTTTPVVPIVEGDVSAAKTRTLQREPLKLSGALDSFDS
FT                   FDVTPVIGREFPSANLAEWLRAPNSDELLRDLAITISQRGVVFFRKQDGLDDDLQKELI
FT                   QRLGLLAGKPSTSGLHVHPIHNAGREHNVKDNEISVITSKNHDQLYKGRLHPKKQSARR
FT                   EWHSDITFEPIPSDYTVLRLTELPKTGGDTLWASGYELYDRISKPYQQFLEGLTATYAQ
FT                   PGFNRVAKENDFEIFTGPRGAPENVGDKLEAIHPVIRTNPVTGWKSVFAVGVHVAKVND
FT                   LSEEESDHLLRWFVSLIVENHDLQVRLRWENPNDLAIWDNRSVYHAATYDYKEKGFGPR
FT                   TGHRVVGLGERPYFDPKSTSRREALEAEAELS"
FT   exon            complement(302869..303038)
FT                   /number=1
FT   exon            complement(303110..303484)
FT                   /number=2
FT   exon            complement(303542..303874)
FT                   /number=3
FT   exon            complement(303925..304165)
FT                   /number=4
FT   CDS_pept        complement(join(305087..305301,305351..305464,
FT                   305550..305986,306052..306158,306211..306384,
FT                   306434..306651,306705..307134))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000114"
FT                   /old_locus_tag="AO070302000066"
FT                   /note="permease of the major facilitator superfamily"
FT                   /db_xref="GOA:Q2TYT8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYT8"
FT                   /protein_id="BAE65585.1"
FT                   /translation="MPVVHLPTSTTKTPSETVSALKNETDSSSSREIAPLGEPFSGRRL
FT                   WFQKGQKYDPDAIATQPSVYNNPDIAQEYQPSEDWENLHRFDPSARWTWREEKRVIRKI
FT                   DARIMIWTAIMFMALELDRANLTQALTDNFLKDLHLTTNDYNLRNTVFKLSFLCAELPS
FT                   QLVSKWIGPDRWIPTQMTLWSAVGMTQYGLQGRSSFLACRALLGLLQGGFIPDVILYLS
FT                   YFYKSHELSVRLSFFWTAYNLADILASFLAFGLLRLRGVQGQAGWRWLFLIEGLITLLV
FT                   GLIAFVLMPPGPCETANWARGKKGWFTPREETIMVNRIIRDDPSKGTMHNREAITPKLL
FT                   WKSLCDYDLWPIYAIGLTWLTPMTPPGQYLTLTLRGMGFNTFVTNLLTIPYTFAQIPTM
FT                   LILTYLSERFGQLTWAAMFTQIWALPFIIYLYVVDINSINKWVAWIILTIFLSIPSVAW
FT                   NSRNSNTVRSRTVSAAVYNMCVQASGIIASNIYRQDDAPRYKRGNKVLVALVVTNIFIY
FT                   LFTKAYYVWRNASRDKKWNAMSEEEKRVYLATTKDEGNKRLDFRFAH"
FT   exon            complement(305087..305301)
FT                   /number=1
FT   exon            complement(305351..305464)
FT                   /number=2
FT   exon            complement(305550..305986)
FT                   /number=3
FT   exon            complement(306052..306158)
FT                   /number=4
FT   exon            complement(306211..306384)
FT                   /number=5
FT   exon            complement(306434..306651)
FT                   /number=6
FT   exon            complement(306705..307134)
FT                   /number=7
FT   CDS_pept        complement(join(307865..308036,308093..308397,
FT                   308429..308519,308601..308647,308873..309122,
FT                   309192..309283,309334..309492))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000115"
FT                   /old_locus_tag="AO070302000067"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYT7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYT7"
FT                   /protein_id="BAE65586.1"
FT                   /translation="MSQEKVKVIIAGAGIAGLSVAVALRRLPYIDVELFEQATELREIG
FT                   ASIAISPNGLRSLEKLGVLNALDEDVAFRGPSGIPMIYRHWKTNKVIHQDYFVDVTVRH
FT                   HETARFHRGHLHAALLEHVPSERIHLGKTVVSADAPNDKVTLHFADGTSAHGDILVGAD
FT                   GIHSVETVGTKGELFRVSTCFDLPVETDGRIRNVKWDDEENVEVLRQRYKIAADEPFLA
FT                   TQDWNPVVKALVNSTPYTRIYPNYAGEPLPTWVFDSRVTLVGDAAHTHGGAFAAGGSLA
FT                   IDDAYALFLAFRHALGSSRAQKPKAYEVRAALALCWGPGNEHRLRRGVSRKSSEQAKHN
FT                   MAFRARCGESISKRLTKEICNRRKLGRAGYK"
FT   exon            complement(307865..308036)
FT                   /number=1
FT   exon            complement(308093..308397)
FT                   /number=2
FT   exon            complement(308429..308519)
FT                   /number=3
FT   exon            complement(308601..308647)
FT                   /number=4
FT   exon            complement(308873..309122)
FT                   /number=5
FT   exon            complement(309192..309283)
FT                   /number=6
FT   exon            complement(309334..309492)
FT                   /number=7
FT   CDS_pept        join(310123..310347,310405..310577,310633..310895,
FT                   310951..311116,311188..311398,311467..311736,
FT                   311800..311835,311888..312090,314074..314089)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000116"
FT                   /old_locus_tag="AO070302000068"
FT                   /note="permease of the major facilitator superfamily"
FT                   /db_xref="GOA:Q2TYT6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYT6"
FT                   /protein_id="BAE65587.1"
FT                   /translation="MSKATVTDSVSTVNDVAQLPKLSQRYADESYKLFSKVSVADPTPE
FT                   EAIKIRNKCLWRVLPFLCIGYHIMYVDKQTLGSSAILGIMDDAHLNSTQYNWLSSIFYF
FT                   GYLLAEWPQNWALQRFPVAKWLAINLVVWGGITLLHIPCNSFATLFVVRFLLGVAEASI
FT                   VPAFLLILSMFFTYQEQAVLMPIMWSIGNASPITSGLLSYGVLWIKTGTFAPWKWFMVI
FT                   TGGVTVMFGLAVWLFFPDNPLRASFLTPEERAQAILRIKDNHSGIEQKHFKKYQFIEAV
FT                   KDPKSWLFFLHAWSQEMANGMTNQYSLIINSFGFTVLQTTLLGCVTGIVSFFSLASAAV
FT                   VLAKTTNCRAWISLIAYIPGAISSILLLSLPWSNRWGLITGIWIRSTVGIPYAVVMIWA
FT                   ANASAGHTKKTTVIAMYHIGYGLGNILSPQLFQPRWKPRYRPTWIILLVVACILPSLVI
FT                   VYLRWYLSKENKRRDLLQSETLVTDTGVVEEVDNDGTKHARLVDKNQLDLTDRENLSFL
FT                   DPV"
FT   exon            310123..310347
FT                   /number=1
FT   exon            310405..310577
FT                   /number=2
FT   exon            310633..310895
FT                   /number=3
FT   exon            310951..311116
FT                   /number=4
FT   exon            311188..311398
FT                   /number=5
FT   exon            311467..311736
FT                   /number=6
FT   exon            311800..311835
FT                   /number=7
FT   exon            311888..312090
FT                   /number=8
FT   exon            314074..314089
FT                   /number=9
FT   CDS_pept        join(317390..317440,317707..318400,318455..318948)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000117"
FT                   /old_locus_tag="AO070302000069"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYT5"
FT                   /protein_id="BAE65588.1"
FT                   /translation="MAQHTADKKEHMEAGGKGQGPRSEQDSESNAEHVTHRKNKSKSGG
FT                   SPPMKPSQIMEEHPEHNPADLGDSEVVHSSTKIEPAQNPRTRDGKVKQMESHIVALARG
FT                   ITELDNDRKRLQAQVRSARSGSWVTKSSRQIREELSSLEAAMRQWAENYSVAEIRALDS
FT                   LSIEEKDAILERLDGYCAQVDWTTLIEKSPTMADKIPALLMQALLAKDIFGSIFANPFF
FT                   AFGESKEPSTAHSSQTLSYLYASMLEVNKEEAHIWRSQTLRLLATPPPNSVHNAPLRAK
FT                   VEAITSELAIEFLAGPVRLLFRHRNDSWAIQRNQELYQLYHTAGELAISLWTQRSFMRC
FT                   YCMDELPVFRAEHPVMSAHALHRQHGNDAKLDGKNALIIVHPAIVAFGNEYAEHYDLCK
FT                   VWAKGIIIVDEHA"
FT   exon            317390..317440
FT                   /number=1
FT   exon            317707..318400
FT                   /number=2
FT   exon            318455..318948
FT                   /number=3
FT   CDS_pept        join(320434..320781,320845..321166,321229..321992)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000118"
FT                   /old_locus_tag="AO070302000070"
FT                   /note="amine oxidase"
FT                   /db_xref="GOA:Q2TYT4"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYT4"
FT                   /protein_id="BAE65589.1"
FT                   /translation="MASQSNIGSSKTVDVVVIGAGLSGLRAALGVQAAGLSYAVVEAID
FT                   RVGGKTLTVPSKKSGPGVNDVGAAWINDTTQSEIYKLVQKYGLQVETQEIPGHDIFQSP
FT                   EGCVLFKHGELPVSEEDKAALAQVLAHFNDLVSDVNLEDPGSGPNAKELDSVSLQEYCI
FT                   QTFQSELIAGLFDTIIQSLIGVEAKDVSLLAFLISLKAGTGFEAVTSDGKNGGQQLRVR
FT                   QGNQTISQNMAKELKPGSIHLSSPVTEIKQDPATGACTVHTSNNTTFHAKKVILSVATP
FT                   LYKKITFDPPLPEYKQLLVKENKLGYYSKIIFVFDRPFWRAAGLTGAIQSQTGPFTFTM
FT                   DNSFPDDEQWSIACFTVGRRGREWSQLSQEERRQTAWEQLRSALENTDLPSGEKIKVPE
FT                   PINVLEYEWTKQDFFLGGPEPGSPPGVISRVGKDAVRKPFGSVHFVGTETALHWKGYME
FT                   GAVRSGDRGAKEVVEALTK"
FT   exon            320434..320781
FT                   /number=1
FT   exon            320845..321166
FT                   /number=2
FT   exon            321229..321992
FT                   /number=3
FT   CDS_pept        complement(join(323049..323255,323312..324063,
FT                   324151..324640,324732..324836))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000119"
FT                   /old_locus_tag="AO070302000071"
FT                   /note="cyclopropane fatty acid synthase and related
FT                   methyltransferases"
FT                   /db_xref="GOA:Q2TYT3"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYT3"
FT                   /protein_id="BAE65590.1"
FT                   /translation="MLQKHPESPPFFDFIVTPETTQTPPKEDCGVRTTTSPAIKNAPLP
FT                   ADGAGNDSWSNLLLFSLLIGVPWFISYQLGGGLYFGIFIAVCTAIPILMAFWTIFSSMS
FT                   PRMNEKAKLPGRPVEYYLNFHKESDRARYNGKKKIPIEVFYEKYFRGEVEFKNGDCLEN
FT                   LEYRHDWASFSFSWGVFKHFLFGFVPELIVHSRSQDEEQVSGNYDRGDDFYAWFLGPRM
FT                   IYTSGLIGDINKEESLEQLQDNKLTTVCEKIDLQPGDTMLDIGCGWGTLATFASVHYKA
FT                   HVTGITLGRNQTKWGNTTLRNAGIPESQSMIHRLDYRDSPRVPGGYKKITSLEMSEHVG
FT                   VRHFRGFLKQVHDMLDDDGVFYLQYSGLRKYWQYEDLIWGLFMNKYVFPGADASTPLGW
FT                   VIDQLEGTGFEIKGVDTVGVHYSATLWRWYRNWVANREHVEAKYGPKWYRTWEWFLSWA
FT                   TIVSRQGGATCYQIVLVKNINSTHRVDGIPSQFGISGAIRSAIEKLGKMPSAFIPQATV
FT                   "
FT   exon            complement(323049..323255)
FT                   /number=1
FT   exon            complement(323312..324063)
FT                   /number=2
FT   exon            complement(324151..324640)
FT                   /number=3
FT   exon            complement(324732..324836)
FT                   /number=4
FT   CDS_pept        join(328114..328237,330056..332325)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000120"
FT                   /old_locus_tag="AO070302000072"
FT                   /note="beta-glucosidase-related glycosidases"
FT                   /db_xref="GOA:Q2TYT2"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2TYT2"
FT                   /protein_id="BAE65591.1"
FT                   /translation="MPLICIVYFLQYLDKIAISYASVTGLRESANLHGNQFNWVSTSTE
FT                   SIFPDCSTGPLSKNNVCDTSLDPVSRAKSLVAAMTLEEKINNTKYDSSGAPRLGLPAYN
FT                   WWNEALHGVAEGHGVSFSDSGNFSYATSFPMPILLGAAFDDDLVKQVATVISTEARAFA
FT                   NGGHAGLDYWTPNINPFRDPRWGRGQETPGEDPLHLSRYVYHLVDGLQDGIGPERPKVV
FT                   ATCKHFAAYDLENWEGIERYAFDAVVSPQDLSEYYLPSFKTCTRDAKVDAVMCSYNSLN
FT                   GIPTCADRWLLQTLLREHWGWEQTGHWVTGDCGAIDNIYADHHYVADGAHAAAAALNAG
FT                   TDLDCGSVFPEYLGSALQQGLYNNQTLNNALIRLYSSLVKLGYFDPADDQPYRSIGWNE
FT                   VFTPAAEELAHKATVEGIVMLKNDGTLPLKSNGTVAIIGPFANATTQLQGNYEGPPKYI
FT                   RTLIWAAVHNGYKVKFSQGTDINSNSSAGFAEAISAAKEADTVIYAGGIDNTIEKESQD
FT                   RTTIVWPGNQLDLIEQLSDLEKPLIVVQFGGGQVDDSSLLANAGVGALLWAGYPSQAGG
FT                   AAVFDILTGKSAPAGRLPVTQYPASYVDEVPMTDMTLRPGSNNPGRTYRWYDKAVLPFG
FT                   FGLHYTTFNVSWNHAEYGPYNTDSVASGTTNAPVDTELFDTFSITVTNTGNVASDYIAL
FT                   LFLTADGVGPEPYPIKTLVGYSRAKGIEPGQSQQVKLDVSVGSVARTAENGDLVLYPGS
FT                   YKLEVDVGQDFPTATFTVSGKEKVLDEFPEPQQNATSAVTRRGR"
FT   exon            328114..328237
FT                   /number=1
FT   exon            330056..332325
FT                   /number=2
FT   CDS_pept        join(336209..337678,337737..339109,339170..339496,
FT                   339566..339962)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000121"
FT                   /old_locus_tag="AO070302000073"
FT                   /note="RNA-directed RNA polymerase QDE-1 required for
FT                   posttranscriptional gene silencing and RNA interference"
FT                   /db_xref="GOA:Q2TYT1"
FT                   /db_xref="InterPro:IPR007855"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYT1"
FT                   /protein_id="BAE65592.1"
FT                   /translation="MEVFLHHVPADLNRHGFKRELQPFMKTLRIQDFICEKPRKKRFGT
FT                   ITFLHVDDAERFLQAHGEKPNPLGGFKSNLKLMGVSVCCKSSRYPPKPFALRTLEHEAQ
FT                   ERAKGHRERPEESVVFGMQQYSCGRCDFVGEQLTYNPELQWSARGTIKFKTRSMIVHVI
FT                   PDCRIRIPLSTIVSLIYSTDGTLTVTLSDVPFFFKVIGTSYNSLGIESSRVRLSNLGNG
FT                   HDQIVGQCLVYQFKVSVVHFRANIEKLKDWEITIYRYNLTTARPLLCSQAVSVEFHKLL
FT                   SELAECTRNRSVPFGILFQLQALAQNAYLHPTTSRKLAEGLRKRFAEDEAAGRDPITVD
FT                   GMRKLFNMIGWPFPGDDPRVYEVDFLVATLEANHREIQDGFAYREGLHENTVNMTKVHR
FT                   VNVTPTRITLHGPEMEPQNRILRKFPNHHEYFIRVQFCDENGEDLLFNANVDYKDIFGR
FT                   FIDIMTRGIQIAGRTYNFLGFSHSSLRSRAVWFSSPFVDDNGHMQTYFSIVSAIGKFSH
FT                   ITSPARCAARIGQAFTETPFMVPLEKHGVLVSTIPDLTSPDGSRVFSDGVGAISREVVA
FT                   SIWADIPLKRGNPTCFQIRLGGAKGMLAADSRLRTAVIQIRPSMIKFDSEDMKNLEICN
FT                   MASRPYPMVLNRQVIKILEDMGASKDWFFQMQNEELTRLQSITVSTDKTARFLKDKSVA
FT                   ECIGLYRLYRQCYWTRLNYKKDGFLRAIVEAVVLRELRLLKHKARIPVKKGMTLYGVID
FT                   ETGFLQEGEVYVTFDRMEGRYAAPPGPGHILVTRSPALHCGDIQRAQNVIPPEDHPLRY
FT                   HRNCIVFSQKGSRDLPSKLSGGDLDGDLYHVIWDPELESVETFAPADYPRPTSIDIGRD
FT                   VRVDDMAAFFVEFMRSDILGMIAIRHMVMADQAASGTRDTSCRLLAGLHSKAVDFSKTG
FT                   IPVNMEDMPRVNRYRPDFLAPGPQTRLYNKSKIGLEQHVSHANYDDDDDDADVEEPYRY
FT                   YKSEKILGKLYRAIDEQSIWRKHVLSESETDEEFFWNSVIDDCLRRCKSLPRTPKEEHL
FT                   DEAKRIRAAYDDAIISAMDTYSDHPTKPISELEVVIGSIINRRGVQTRRQRDRSNKLHE
FT                   EFDRIATWITSIMRRQEIEDPDPNGLELSLACLYHGIQGSDSGHRKEVYGELKSFRVVA
FT                   ACALLAELDHRDKADPKNCFTM"
FT   exon            336209..337678
FT                   /number=1
FT   exon            337737..339109
FT                   /number=2
FT   exon            339170..339496
FT                   /number=3
FT   exon            339566..339962
FT                   /number=4
FT   CDS_pept        complement(340408..341019)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000122"
FT                   /old_locus_tag="AO070302000074"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYT0"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYT0"
FT                   /protein_id="BAE65593.1"
FT                   /translation="MSTVQSVSDSRVQEETMKVAGEKLLDRIGPAIVITHSQGGLYGWS
FT                   WADSRPDLIKALIQIEPKGPPFREAIFSKEFSRPWGLTSIPLSYEPPPSNVSSPLTMKN
FT                   VPAHSPGLLPCIIQHEPARKLLNLARVPILISTGEASYHAQYDHCFIKFLYQAGVPAEH
FT                   LELGHAGLHGNGHLQFMEMNSDDIAQVLHDWMLIKVNGTF"
FT   exon            complement(340408..341019)
FT                   /number=1
FT   CDS_pept        join(343113..343168,343219..343615)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000123"
FT                   /old_locus_tag="AO070302000075"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYS9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYS9"
FT                   /protein_id="BAE65594.1"
FT                   /translation="MLMLLPMPWLLRVKTSWTRRLQLVGLFAIGLLLIAIAIVRLPSFD
FT                   DNTSQLNRNTWGSVEEFLAAFVANVPTLYTLRRRADKSYPTYYSHGASEGRMGGSRHPP
FT                   HNEGILVTNSVQLEYMVDGRHKSQGSDHNVVRQDSNEQLVGDERWR"
FT   exon            343113..343168
FT                   /number=1
FT   exon            343219..343615
FT                   /number=2
FT   CDS_pept        join(346265..346269,347318..347468,347534..347893,
FT                   347968..348474)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000125"
FT                   /old_locus_tag="AO070302000077"
FT                   /note="voltage-gated shaker-like K+ channel, subunit
FT                   beta/KCNAB"
FT                   /db_xref="GOA:Q2TYS8"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYS8"
FT                   /protein_id="BAE65595.1"
FT                   /translation="MQLGKSGLKVSKIILGCMSYGSSEWQSWVLNEKDALPLLKHAYDK
FT                   GINTWDTADIYSHGRSEEIIGKFLRQEQIPRDRVVIMTKFYFGVDDQGRQPPNRATIHN
FT                   DGQEWVNRVGLSRKHIFDAVEASVRRLGTYIDVLQIHRLDRDTPRKEIMKALNDVVESG
FT                   KVRYIGASSMAAWEFQSLQNIALQNGWHQFISMQNLHNLIHREEEREMIPYCLDTGVGL
FT                   IPWSPLARGVLARPWDSRSTIRETTDTSLKSIIRDRESLADKSIIDRVEEVARRRGITM
FT                   SQVAIAWSLSHRTENPILGLNSKDRIDEAVAAIGVRLTEDEKRYLEELYIPKSIHPSER
FT                   "
FT   exon            346265..346269
FT                   /number=1
FT   exon            347318..347468
FT                   /number=2
FT   exon            347534..347893
FT                   /number=3
FT   exon            347968..348474
FT                   /number=4
FT   CDS_pept        348635..349186
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000126"
FT                   /old_locus_tag="AO070302000078"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYS7"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYS7"
FT                   /protein_id="BAE65596.1"
FT                   /translation="MISHIAFFFASVLAASLGISVNVNSSNLREVYQFPHGTWVENIAV
FT                   RSNGNLLVTLVNVPEVWEVFPSAQAGASGARLVHHFTNEGMSTSITEHSPDMLALITPN
FT                   TVWKMDLNAGREASPVRVATLPGGNLNGMATLDQELGRVAISDSEFGLVWVVIHILERS
FT                   RSSSGTKPHGEYEGRPISSI"
FT   exon            348635..349186
FT                   /number=1
FT   CDS_pept        join(350340..350701,350758..350983,351047..351209,
FT                   351287..352926)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000127"
FT                   /old_locus_tag="AO070302000079"
FT                   /note="beta-glucosidase-related glycosidases"
FT                   /db_xref="GOA:Q2TYS6"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYS6"
FT                   /protein_id="BAE65597.1"
FT                   /translation="MVQLKSFLLLLNVAIARSALVWDDTYFYGQSPPVYPTPNMSGAGS
FT                   WGHALSKAQHLVSQMSLEEKVSLTGGSKDSRNGCGGNIPAIDRLGFPGMCLQDGPNGIK
FT                   GVELVNGYPSGIHVGASWNKSLAYKQAKAIGGEFRRKGATIALGPPVVGPLGRIALGGR
FT                   IWEGYTNDPYLSGILAAEAVRGVQDNGVISCAKHFVGNEQELHRNPRPGGPGNRTVEAS
FT                   SSNMDDKTMHELYMWPFADVVHAGVASVMCAYQRLNNSYSCHNSKALNGLLKTELDFQG
FT                   FVMSDWGAQHTGIASALAGLDMVMPSGNKYWGAKLIEAVRNGSVPESQITNMATRIMAA
FT                   WYLSNQDDPSLPPVGAGIPADFERQHPVIDARDPHDESLLLEGAIQGHVLLKNVDNALP
FT                   LTNPRILSIYGYDAKAPDSNFAQAGLNDWTLGLESHDSRTVVCGFASIGGDCPDFPPIA
FT                   INGTIISGGGSAAVTPVYISSPFQALEARARQDKTQLFWDFKGTEAVNSEADACLVFIN
FT                   AASSEGVDRPALRDDYSDGLVLGIASRCNNTIVVIHNAGVRLIDQWIEHPNVTAVIFAH
FT                   LPGQDSGEAITQILYGDVSPSGKLPYSLPRNESDYGSLLTPVTFTDWDQLFPQDDFAEG
FT                   VFIDYRAFDMKGIAPRFEFGYGMTYTTFKYSNLTIRWTVDPSDLSEYPEGPVIPGGNAD
FT                   LWENIAAVTAGITNTGQMEAAEIAQLYVQIPGEGQPLLELRGFDKVAVPPGETRTVDFN
FT                   IRRRDLSTWDVAAQKWKLSVGAQYPVFVGSSSRKLLLNGTLYL"
FT   exon            350340..350701
FT                   /number=1
FT   exon            350758..350983
FT                   /number=2
FT   exon            351047..351209
FT                   /number=3
FT   exon            351287..352926
FT                   /number=4
FT   CDS_pept        complement(join(353342..353891,353930..354296,
FT                   354477..355194,355256..355462))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000128"
FT                   /old_locus_tag="AO070302000080"
FT                   /note="choline dehydrogenase and related flavoproteins"
FT                   /db_xref="GOA:Q2TYS5"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYS5"
FT                   /protein_id="BAE65598.1"
FT                   /translation="MDTAYDFVVIGGGTAGLVLASRLSEDPSISVLVLEAGADLTADPR
FT                   VNIPIFYAALLGSDADWKFQSSPQPGLNGRVLGLNQGKALGGSSSLNAHVFVPPFKGAV
FT                   DAWEELGNPGWNWSKLKDYFSKVYSSPTVAQDAKENLAIEDWPGLNEAKGPIQTSFGNK
FT                   THPIRRAWAELFRSSEQHNAGDPFIHSSVGSFSCLASIDSEGKRSNSASAYYKPAESRQ
FT                   NLHVLTNSFVERVLFDESKPPRAIGVQYNLDGVSKAVQAKSEVILAAGAFQSPKILQLS
FT                   GVGRAELLEQHGIDIVMDLPGVGQNLQEPEAISQAMQEYAATQSGPLASLGVHTYAYLP
FT                   LPEPDRSALQTLFTNDAPESSQHRATQAYYDIAKTTVLDPRQPSAAYLSALGQTNYPKD
FT                   LKDGTIPAASLGKFVTLGVMLSQPLSRGSVHIDCEVFFTPDSSHFTCYLPIPPEPSKNR
FT                   KSIKSDEKNSSTCNNPEKPPIIDSGYLSNPLDLEVMARHMLRIKELAESPQLGELLEQP
FT                   LKFRDPDADFQGDLDAARKYARDNLVSMWHFAGTCSMLPREKDGVVDSHLKVYGIEGLR
FT                   VVDASAIPLISTANLQATVYAFAERAADLIKQEWKSK"
FT   exon            complement(353342..353891)
FT                   /number=1
FT   exon            complement(353930..354296)
FT                   /number=2
FT   exon            complement(354477..355194)
FT                   /number=3
FT   exon            complement(355256..355462)
FT                   /number=4
FT   CDS_pept        complement(join(357466..358727,358784..359204,
FT                   359256..359327))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000129"
FT                   /old_locus_tag="AO070302000081"
FT                   /note="alpha-amylase"
FT                   /db_xref="GOA:Q2TYS4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYS4"
FT                   /protein_id="BAE65599.1"
FT                   /translation="MSPHAVHTVPSGENNWWKEATVYQVYPASFKDSNGDGWGDIPGLI
FT                   SKVPYLHSLGVDVVWLSPMYDSPMHDMGYDVSDYENVLPAYGTVEDVERLIDACHERGM
FT                   KLILDLVINHTSDQHKWFQESRSSKDNDKRDWYFWRPPRYDEQGNRLPPTNYRGYFAGS
FT                   TWTWDEHTQEYYLHLYAKEQPDLNWDNEATRKAIYDSAVRFWLDKGVDGFRVDTVNKYS
FT                   KHTDFPDAPVTDPKSYIQPAIQMWCNGPRIHEFLREMYDDALQPYGDVVTIGELANTPD
FT                   PEHVLKYVGASAKQLSMVFHLDIGHIGMGKSLEDKYIFNPWQLTEMKSIVTKWQSFIEG
FT                   TDGWTTAFCENHDNGRSVSRFASDAPEHRERSAKMLALMMMAMTGTLFLYQGQEIGMIN
FT                   APRDWSVEEYKDIEGRGYYQEAERQVAAGVDPTRKDRIMDGLRILARDHARLPMQWDDS
FT                   SHAGFTTGTPWMRAHDLYPEINVQKQADDPESVLSFWRSVLRLRKEYRELFIHGAFEVV
FT                   DFDNQQTFCFFKSRDEKKALVALNFTAENQPFTQATTTEGMKLLVSNYAELLPETLRPF
FT                   EGRIYISQ"
FT   exon            complement(357466..358727)
FT                   /number=1
FT   exon            complement(358784..359204)
FT                   /number=2
FT   exon            complement(359256..359327)
FT                   /number=3
FT   CDS_pept        359695..361290
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000130"
FT                   /old_locus_tag="AO070302000082"
FT                   /note="predicted transporter (major facilitator
FT                   superfamily)"
FT                   /db_xref="GOA:Q2TYS3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYS3"
FT                   /protein_id="BAE65600.1"
FT                   /translation="MTTPDAIEANDGAQRKSSLVQGKRAAQQEQSMTLWQAIRLYPKAV
FT                   GWSVLLSSTLIMEGYDLALLSSMYASPAFNQKFGRQASDGKWTVPASWQSALSNGARVG
FT                   EVIGLLINGLVSERLGYRWTMVSALTAMIGVIFLFFFAVNVQMLLAAEILAGIPWGVFQ
FT                   TLPAAYASEVCPVVLRPYLTTFINMCWVFGQFVAVGVNRGSIQRDDQWAWRIPFAVQWA
FT                   WPLPILIGCLFAPESPWWHVRRGNLSGAKRALLRLTSSDPAFDPDATIAMIQHTNELEM
FT                   SATKGTRYRDCFQGVNLRRTEVVCGVWLVQTLCGQNLMGYFAYFCVQAGLPTVRSFDLS
FT                   LVQYALGVIGTLGSWYLMTIAGRRTLHLAGLTSLFTLLIITGSLSFAPDSNSGAKWAIG
FT                   VMLIIFTFCYDFTIGPVTYCLVSELSSTRLKAKTIVLARAGYNISNIVVNVLTNYQLND
FT                   TAWNWSSRSAYFWAGTCLVCLVWSFFRMPEPKGRTYEELDVLFEQRVSARKFADTVVDP
FT                   YADAVEVRVDSAKE"
FT   exon            359695..361290
FT                   /number=1
FT   CDS_pept        join(361694..362442,362502..363321)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000131"
FT                   /old_locus_tag="AO070302000083"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYS2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYS2"
FT                   /protein_id="BAE65601.1"
FT                   /translation="MPRETIPQACDACRRRKVKCTSHRPCSPCRSMALVCRSTGSRRKK
FT                   GRQGRSANVLYELKTNTNSDAIDENQLSGVTPVESPNDIPPTGYVKRSGLLNDGLVQSC
FT                   AAYFYSRMLGTVPILHPDKFQEQVERMDECPHAYCLVVAFCAFVLTQTGYLSCHQGTGP
FT                   DMGRALLDEAMAARRHLDPFSAPIRLGITIAFLLYGCHIGCGNQRQAYYFLREATTFYT
FT                   ADMLDQSADEDEPCFSGKLFWLLLISERAHAIRRRRPVTLQITSTSPALDTSPIDPFSL
FT                   GFSHLVDLYRPFDESFLAIWNASQPICTRESLVHLEEHLQRSVPADLDLPDIVLADLRV
FT                   SQQWLRTMIWQLATTAGFLSSTPTHPSLDFRYPLQIARDLSLATWKLSRESMETHGVGL
FT                   IEKIFEVACTLTDVMACLSSTGLRSSGFEMGPQDYLKHLCSLVHSLHGGRKRFLPLLMA
FT                   KVGHTLPAMVMPISRHLGLEDLGSFDEGEKKGFDAVGDVERDLNWAEMSRIGDMTPDID
FT                   DTSLL"
FT   exon            361694..362442
FT                   /number=1
FT   exon            362502..363321
FT                   /number=2
FT   CDS_pept        join(365151..365429,365477..366718)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000132"
FT                   /old_locus_tag="AO070302000084"
FT                   /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
FT                   /db_xref="GOA:Q2TYS1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYS1"
FT                   /protein_id="BAE65602.1"
FT                   /translation="MIDAASVVILIIGLIVARLVTNRFRLSGIPGPSLAAYTRLWKLYN
FT                   AWKGDHHHTEIALHRKYGSLVRIGPRHISVSDPKAIPIIYGVNKGFTKTAFYPIQSISW
FT                   DKKPQMNLFSTRDELFHRDRKRPIASAYSMTSILEMEPAVDSYTELFLSQIRKMVEEKA
FT                   PIDLGMWLQYYAFDVVGELSFAQKLGFLEKGEDVDNMIEAIRGMLTYAMICGQIPEAHK
FT                   VLLGNPLFPILLPQMETWDQVVVFTLKAINRRASLQRDGDLGKDEIDEAIGGKDMMSRW
FT                   LAIHNADPTRLSTRDLMVHLSANVFAGSDTTAIALRSILYHLICHPDKMAKVRAEIDTA
FT                   DQEGKLSNPISYQESNTHLPYFGAVMKEAMRLHPSVGGNLERHVPPQGVTICGHYIPGG
FT                   TNVGINPWVVHRDPIVFPQPDSFIPERWLDSTPEQLKEMEKAFLNFGAGSRSCIGKAIS
FT                   LMEMRKILPQLLREFDIHLHQNKSWKTRNVWFVQQEEFICDLTPRVRS"
FT   exon            365151..365429
FT                   /number=1
FT   exon            365477..366718
FT                   /number=2
FT   CDS_pept        join(367306..367831,367896..368134)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000133"
FT                   /old_locus_tag="AO070302000085"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYS0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR017771"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYS0"
FT                   /protein_id="BAE65603.1"
FT                   /translation="MSSNPEIEYGFTPVISSARALLSAAKPSTPAPFISVADNPIPKTA
FT                   LAQRIDLYARSQLPEPTYNHSLRVYHYGLAIKRHVFPSWSFTDETYFLCCLLHDIGSTE
FT                   ENLNKTKLSFEFYGGLLALGVLQDGTGPFGNAVAPRDQAESVAEAIIRHQDLCEEGKIT
FT                   AVGQLLQLATIFDNTGAYADLVHPSTIDEVSRRYPRKQWSTCFAATIRRENELKPWAHA
FT                   TTLGEEAFPSKVLGNSLMEPYEQSDNLEPYIY"
FT   exon            367306..367831
FT                   /number=1
FT   exon            367896..368134
FT                   /number=2
FT   CDS_pept        join(368560..369120,369214..369411)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000134"
FT                   /old_locus_tag="AO070302000086"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYR9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYR9"
FT                   /protein_id="BAE65604.1"
FT                   /translation="MSQRSNGPYRLIYWPTIPGRGEFIRLALEEAGADYTDTAHEENGV
FT                   KTVLSLIDQNFVGDQSGLPPFAPPILEHGDLRISQTPNILLYLAPRLGLAPDGDAIYHV
FT                   NSLALTALDGLSNEPHDTHHPIAVELYYEDQLEESKRRSESYRKNRLPKFLSYFERVLK
FT                   PQAAQGRPWLYGETLTYADLVLFQGIDGLKFAFPRALSRLEKSGEYSNVFKLYETVKNR
FT                   PRIKAYLASDRRLEYSQGIYRHYPELDDAE"
FT   exon            368560..369120
FT                   /number=1
FT   exon            369214..369411
FT                   /number=2
FT   CDS_pept        join(372465..372592,372642..372709,372765..372825,
FT                   372969..373010,373074..373122)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000136"
FT                   /old_locus_tag="AO070302000088"
FT                   /note="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="GOA:Q2TYR8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYR8"
FT                   /protein_id="BAE65605.1"
FT                   /translation="MGVTKTLIAAGDGVNFPKKNETVAMHYRGYLYDPSQPDNKGKQFD
FT                   NSYDRGQPLKVAIGTGRVIKGWDEGVPQMSLGEKALLTITPGFPNLIPANSTLLFEVQL
FT                   VAINNKEMPKP"
FT   exon            372465..372592
FT                   /number=1
FT   exon            372642..372709
FT                   /number=2
FT   exon            372765..372825
FT                   /number=3
FT   exon            372969..373010
FT                   /number=4
FT   exon            373074..373122
FT                   /number=5
FT   CDS_pept        join(374092..374235,375567..375736,375805..377242)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000137"
FT                   /old_locus_tag="AO070302000089"
FT                   /note="delta 6-fatty acid desaturase/delta-8 sphingolipid
FT                   desaturase"
FT                   /db_xref="GOA:Q2TYR7"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYR7"
FT                   /protein_id="BAE65606.1"
FT                   /translation="MVDKCGQSMLMSIMPMGSSPPNRCTATRHGVRRDFVVLKQNPIPS
FT                   TASDVILSRRQIEALIAEGQSIIIVNQKVLRVDAWIPYHPGGQKVIQHVVGKDATDEFT
FT                   IFHCEETRQMSERYQIGRIEGRWANFVPPIQGGVFRSEDEEDDESTILVKEQQDSSSTG
FT                   LEVAAVDSGIHKRGSQPEPREDMATQDEMAFLDTETKEEIKLTLSKYPALDDATQDEII
FT                   AKYRLLHKQIHAEGLYTCNYTAYAWEFARCSLLFSIMLFFLHIGWYNTSALFLAWFWSQ
FT                   MVFAAHDAGHIGITQNFTIDSLIGMTIAAPIGGLSLGWWKRSHNVHHIVTNAPEHDPDN
FT                   QHLPFLAVNHRFLGNIFSTYHERLLAYDKFAKALVPYQAYLYYIILLFGRFNLYVQSWL
FT                   FLAKGQGPRKGPAKWHRWYEICGNVIFWLWFGYGILYKSIPTPLSRISFVLISHMATMP
FT                   LHVQFTVSHFAMSTTDLGPNESFAQKMLRTTMDVDCPPWLDWVHGGLQFQAIHHLYPRV
FT                   PRHNLRRAQALVMEFCRDVGIPYALYGFVGGNRKVLGGLAEVARQAAILEKCRRTVVER
FT                   GEFVWGL"
FT   exon            374092..374235
FT                   /number=1
FT   exon            375567..375736
FT                   /number=2
FT   exon            375805..377242
FT                   /number=3
FT   CDS_pept        join(377941..378155,378223..378728,378802..378998)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000138"
FT                   /old_locus_tag="AO070302000090"
FT                   /note="sterol C5 desaturase"
FT                   /db_xref="GOA:Q2TYR6"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYR6"
FT                   /protein_id="BAE65607.1"
FT                   /translation="MDVLLDILDTYVFDRFYAAILPATNPVTASAGTYNKHIGLYYPLP
FT                   PSPYADSSTWKRDDIVRQTMSLFLIGWIFATALYLIGSTIIYHTLFDKRVMRHPHFLPN
FT                   QIRQEIRQGITSIPVIAVLTAPFFLAEVRGWTKLYDFADEAPFRAYNWLQYPLFVCFTD
FT                   CGIYWIHRGLHYPPVYRWLHKPHHKWIMPSPFASYAFHPVDGWSQSIPYHVYPLLFPLQ
FT                   KSAYLGLFVFVTMWTVFIHDAEYLSQSVVVNGAACHTMHHLYFNYNYGQFLTFWDRLNG
FT                   TYRTPKEDGFIQNENRKAQALKQA"
FT   exon            377941..378155
FT                   /number=1
FT   exon            378223..378728
FT                   /number=2
FT   exon            378802..378998
FT                   /number=3
FT   CDS_pept        complement(join(379054..379355,379412..380838,
FT                   380894..380948,381002..381071))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000139"
FT                   /old_locus_tag="AO070302000091"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYR5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYR5"
FT                   /protein_id="BAE65608.1"
FT                   /translation="MFRCSQCDKSYQRKAHLLRHELTHSGQAASVCPFCKKSFLKPEVA
FT                   RRHSKACAIKYNQQPAPAAKPGRKRQSCDQCFATKRACDKGSPCSRCQSLGQQCTFESQ
FT                   QESSIGSPCPTDVSLSPSVQSPTPSKEESQFSFLRHFTDPCVERDRLAIGTTAECSVRR
FT                   NLESLYSHLEDALVPPDPMAANFGDIPGAEMFFRPPLITDEYFPTDLLSYGPTKLSEQL
FT                   HELMMELIETSKSMRPDDTEDPQLQLDIAQLAPLFTVSNVAIFISVFFHSLYWHLPVVH
FT                   FPTFDPGNVSNPLLLSIFLTGATYSSSLDEAALLPRVLDVAEEHVFRKITTLSTQVAPP
FT                   THDLTRQIPTIQLLQAALIIEMLQFGQERVETRRRIRIIRHPSLVSLMRCLGIFQLKRS
FT                   APPTVCTGDDSTWRALVTEEVCIRLASWVFLADGFLTVCFKNRPTISIFEMECPFPWRT
FT                   ELWEAENASAFSRIAATDEAKLPMPSVREAIRLLLDNSEPGPLPSSLPLSAEHLLIMIY
FT                   ALNSLAFLARTDFFGSVPLKKIKSAANKWKQIWNSVYQDSNNDQMLLLGYPKHAEELWL
FT                   LLTTMLDIATENSTKLPYLDNAATDDLGKLNEFIQWCCRDT"
FT   exon            complement(379054..379355)
FT                   /number=1
FT   exon            complement(379412..380838)
FT                   /number=2
FT   exon            complement(380894..380948)
FT                   /number=3
FT   exon            complement(381002..381071)
FT                   /number=4
FT   CDS_pept        join(382600..382946,383012..383411)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000141"
FT                   /old_locus_tag="AO070302000093"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYR4"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR033123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYR4"
FT                   /protein_id="BAE65609.1"
FT                   /translation="MVSASQLLFCLPVLGALATPTDSTTAQAVARSPEFLEHMGALIAN
FT                   ATGEATLERRDATFKTSKDGVDAAGFYYSLYNANGAGAEYSESENSGQFKLSWNTNSEF
FT                   LGGKGFKGGSPRSLSWDGQFQAEGDFTLAVYGWTTDPVTEWYVVEAHGTGTPGNGHILG
FT                   QVEDDGGIYDVYMLPYRNVPEIYGVTNFNQLWSVRREARHTGTVDVAAHFKRWQELGLK
FT                   PGNPVFQMVTAEGFKGSGNLDFTLQK"
FT   exon            382600..382946
FT                   /number=1
FT   exon            383012..383411
FT                   /number=2
FT   CDS_pept        complement(384722..385966)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000142"
FT                   /old_locus_tag="AO070302000094"
FT                   /note="WD40 repeat"
FT                   /db_xref="GOA:Q2TYR3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYR3"
FT                   /protein_id="BAE65610.1"
FT                   /translation="MTMSMNGRKFVQNFTYNLERDFASPAGEPAAWAPGHPKRWGQERA
FT                   KIGLGGIASTPTLSPDDKLVAVGVNEKILVFDVATQASLEVLTDEKRVESVQFAPGVVD
FT                   SRDGKHARYLLASQGGSDENPQVIIWELDEKGKLVTTTEPRLVFEGELGSFSPDGKTLV
FT                   FFSQNETTQEESREAAALPCINLWNIETQSFRHHLLGHTDRIMWAAMSPDNKLVASVAW
FT                   DGIARVWDAWSGSCLHVLGPMGGQLWSGAFSPDQEFLAFSQGDPRTYIHVYDIATGKQV
FT                   SRFDKLHMATRSLSWRHDGTMLACGADDGTLCIWDPYTGEERMRWCLAFDDFLMCRFAN
FT                   TRAVQFVDGGKKLVFQIREGTVEVYDFERNLKQQFTRGVDDKIDRCPVSEMVCSRDSKF
FT                   VVVPDMDGSLRVWDL"
FT   exon            complement(384722..385966)
FT                   /number=1
FT   CDS_pept        388191..388898
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000144"
FT                   /old_locus_tag="AO070302000096"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYR2"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR040366"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYR2"
FT                   /protein_id="BAE65611.1"
FT                   /translation="MSAFERAKWKTTDGEKFTDTVNRLQNATNLLRGTLRMTREVQLHR
FT                   MAETNPKMAKEEARETTAETMKANAKPDTCRNGAGCRVIECKYSHPDAEPCRYGAGCTN
FT                   SNCRFRHPKSRLCRNGAGCRKLGCTFAHPEAPDCRYGVGCTNTLCSFKHPSVPACRDGA
FT                   NCMVDKCKFFHPEVKPCRFGTRCTNKNCTFRHPPPPYTKEPTASAKSMDDKESKEPKSS
FT                   EKEVRRKLKESPK"
FT   exon            388191..388898
FT                   /number=1
FT   CDS_pept        join(389452..389537,389581..391225)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000145"
FT                   /old_locus_tag="AO070302000097"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYR1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR029498"
FT                   /db_xref="InterPro:IPR038305"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYR1"
FT                   /protein_id="BAE65612.1"
FT                   /translation="MADPIGVAGLALSGISLFFQVYAGTVQGRVHTGIQLMLVARDVPD
FT                   KYQQLRLRLEIEQGRLLSWGHSFGLLQEESEKEDTSRISIPEQVRYMVQGYIEPLWQKV
FT                   LHFTAETPGFVPRDKREETPSVHHGGMARRFRLDRMYAKARQGTIKFKDRVNWAYWQMD
FT                   KLEDLVECMRHVNGSVIALAEVKTQQEIQETVKATLMGLLSLQDTVNGLKELIVAVEEK
FT                   RLDNRSSQMPLGEPNDLLLGLANLKKMRLQIGHDKNDGSLQSDLKIQPERVWPMNKMKY
FT                   PSPQRQDATLDGKKGFWVEYKDYSSSDQIAGPTKDEIERHIVRELAALLISKLPSSFRV
FT                   AQCVGYYEEAGSFGLVFEKHAAHADQTIIPLSHCLSLETQMPSLGERIALAQGIVQTLF
FT                   QLHVVGWLHKGLRPANILLFEDHNGGIAYDKSYISGFEDARPVAQPNLTEEAHSRLLND
FT                   DWYRHPDIQTVKPAHREFQYCMRYDLYSLGILLVEIALWKPVLDIQSNVGPGDIKSFIL
FT                   SHNTQCLQRIQFAFGRKYAEIVMNCLNPGEEMDDHTQMDSYIYYFEKLVVKPMKQMSVD
FT                   "
FT   exon            389452..389537
FT                   /number=1
FT   exon            389581..391225
FT                   /number=2
FT   CDS_pept        join(391564..392755,392805..392995,393126..393238,
FT                   393262..393322)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000146"
FT                   /old_locus_tag="AO070302000098"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYR0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYR0"
FT                   /protein_id="BAE65613.1"
FT                   /translation="MATEWGGQGIGEDPNRPPSYPGQKLCERLSGRQGHWSGKEQVNVE
FT                   FRPNDVVPLKDDTQVEYKGTYGRVCRSILTVGEETIVVARKEMRLSEVSEEKVNREVKI
FT                   LQSLRHRHLVTFIGSFTARGFASILVYPFATCDLEKLLEELDYAQYHEQKDTVSTLLAE
FT                   LGWIPTTTKAAQWKPGDIFPNLRRICGCVCSALLYLHQHRIRHKDIKPSNVLVGKDGVY
FT                   ITDFNISKAFENDRSSRTMGPYAGTRVYSAPECVYDARSYPSDVYSLGLIFMEIYTYIL
FT                   GRPRSEMGEYTRSNLSLSKDSQIRHAALRVLWVRVIFDGAGRGDFGMSSGMQELILRMI
FT                   SENQDARPDAFEVLSGLWVYSPSGDFFCNECRKHRGWVGYKGLEKRYQDSLKEKASLEK
FT                   RSEQAREEVKGGQSGSSPLPQSSERSPSQISVLRSPRTGPTVARNKSGQRLDLDSLSYA
FT                   RHVRRSLRHCGISHARKLLATLEMVASTRNVYMAICAHRVHFGEDMHISDTVPVLSDLL
FT                   D"
FT   exon            391564..392755
FT                   /number=1
FT   exon            392805..392995
FT                   /number=2
FT   exon            393126..393238
FT                   /number=3
FT   exon            393262..393322
FT                   /number=4
FT   CDS_pept        complement(join(394203..394523,394566..395314,
FT                   395375..396722,398430..398798))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000147"
FT                   /old_locus_tag="AO070302000099"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYQ9"
FT                   /protein_id="BAE65614.1"
FT                   /translation="MIIETNCSIIAACLPCYGALLRGGQSLASIVRSFLVIHGRASSRS
FT                   GSSFSSLHSGKHYPIHGVRDLDTDTGSQVELTGPADRWSRTTTQVTIKVSGNAHQHDEC
FT                   RSPGIVVHTELDISTKGADPRVAPTNDEARVPPFLLFVVSRILHLQSIQQQHKHSVPLP
FT                   LLQSKLAGRLSLLFLTCTTHPHFHTHILPPFFLLLPDFLPHSPPVTSFSMPLFKKKPKT
FT                   PPTTNSAAFRSVEHLPSSVAFPGDLDRRFSVSTNEPVPPLPPQHPAHSNVVHRSQSHRR
FT                   PNTLNNYSVVPPAVAAPPRIVDADPSDQSWQHPPPAERPEEHENPRRSRRNLFSLHSHS
FT                   SSSQAPRESTGFLERRRSVRKTSPAPQQQEQRPLSVDTAADPHSPSKSREYVVDTTQDP
FT                   SKSPVLQDQGIPHEPRPPRSPQNPSITRSNTDSTLLEHIYRPSPVEPKHPDELDPGPVQ
FT                   QQQPQQNQLGLPRPSSRQSLEPPSPLPQPPAYSDHSASQAAMSDRPPSGQRAPTATPPP
FT                   GGHSSYPQGNNNQDVTPRNNAAQQPEPGRSTPSSTRMRDEGEIDVRTLVQKHDELQAKY
FT                   SKVKRYYFEKEAQVQQLQNTVAHQRMAVSRTVLDDNEYANRFGRLDGAIKDLAFAFRKD
FT                   WKSLPKWLMGYVNDDAHITGTKEMTAIGRAVISRWLVDELFERFFHPALDPTFSRQLKS
FT                   IEMNLRRQQANTLTDEDKENAIARISNWRRTTLDGLTDALHGPAAEEHRCQLIDHLVDS
FT                   LVANLVSYLGDPPPPGLDNGARMIVENAVGIADKVPLESRDVCIEYIHPGTLLHEPNMK
FT                   VEAGLPPLTNEQLEGPPDEADRESSGSTSQEGAPGGPHPGREPRMRSVISKVMGRRPNQ
FT                   GAAPNPGGNGDMRPPTAMEERNSMGAGRIRFASFITAEVRGRGPMNVLVKAPVYLMD"
FT   exon            complement(394203..394523)
FT                   /number=1
FT   exon            complement(394566..395314)
FT                   /number=2
FT   exon            complement(395375..396722)
FT                   /number=3
FT   exon            complement(398430..398798)
FT                   /number=4
FT   CDS_pept        join(401565..401607,401667..401689,401775..401886,
FT                   401963..402146,402247..402649)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000149"
FT                   /old_locus_tag="AO070302000101"
FT                   /note="glutathione S-transferase"
FT                   /db_xref="GOA:Q2TYQ8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYQ8"
FT                   /protein_id="BAE65615.1"
FT                   /translation="MTKLNTKPITVWLTPSGPNPWKVVLILEELQVPYVIESFRFNDVK
FT                   LKPYTDICPNGRVPAIVDPNTNLTLWESGAIIQYLEEVYDTDKKLTYESLNKRQLLNQY
FT                   LHFQMSGQGPYFGQAGWFNVLHHERIPSAIERYNDQVKRFLEVLNTCLEGKAWLVGDKC
FT                   TFADLSFVPWNCRLDMLLQTPPGEDPLAKYPNVQAWHHRMVDRPSWKRCMEVRDKLMDD
FT                   QGLMPNGMPKGINNIQEYEAEIAREAAEKGKE"
FT   exon            401565..401607
FT                   /number=1
FT   exon            401667..401689
FT                   /number=2
FT   exon            401775..401886
FT                   /number=3
FT   exon            401963..402146
FT                   /number=4
FT   exon            402247..402649
FT                   /number=5
FT   CDS_pept        404629..405615
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000150"
FT                   /old_locus_tag="AO070302000102"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYQ7"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYQ7"
FT                   /protein_id="BAE65616.1"
FT                   /translation="MSAIIDRLPLELLELVCDELDTRDLASLVGTCRDTYHRTINRLAQ
FT                   RYTEIHLDFSQDSFNHIHAIANNKVMRQQVHRLVVMTPEPYLGRDLQWQRSAAGHIHNP
FT                   LQIPAIQRFRDDLVERLTNCRSFVISPVRTKFVPEEEDVNDSEHFNPDDAAGILLEIIA
FT                   DASLPMKLFWYGTGVNYTSNIMDIRRLPKNLFTNPTFKSGWAQLENLHLDHKLTPYNYS
FT                   FILNMILHAPNLRKIYLSLAPRDMAIEFFSHLSQSPSLPSSLERIALCFTSVRAVDLIT
FT                   ILSHSRQTLKRLILDDIGGLSSDGSKLHNQLQGCFPRLETIEFNKCQ"
FT   exon            404629..405615
FT                   /number=1
FT   CDS_pept        join(406123..406390,406451..407184)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000151"
FT                   /old_locus_tag="AO070302000103"
FT                   /note="porphobilinogen deaminase"
FT                   /db_xref="GOA:Q2TYQ6"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYQ6"
FT                   /protein_id="BAE65617.1"
FT                   /translation="MAESSSVAQPPLRIGTRRSKLAIVQAEGIRDSLQKTAPNRSYEIE
FT                   TLHTLGDKDKSTALYNFGAKSLWTSELEEKLTSGQLDVIVHCLKDMPTTLPESCDLAAI
FT                   TLRDDPRDALVIKAGLPYTSLQTLPEGAVVGTSSVRRSAQLLRLYPHLRFANLRGNVET
FT                   RLAKVDNPESEYTCMIMSAAGLERIGLKHRINQYIGSKDGGILHAVGQGALGLETRKGD
FT                   SSTQELLNKLVDEKSTLACLAERALLRTLEGGCSVPIGVETEWVDQSEYFLRMRAIVVS
FT                   LDGTQSVQDTIDATVRTKDEATVFGKELATRLVTAGADAILKDINTNRPLKD"
FT   exon            406123..406390
FT                   /number=1
FT   exon            406451..407184
FT                   /number=2
FT   CDS_pept        408520..410397
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000152"
FT                   /old_locus_tag="AO070302000104"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYQ5"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYQ5"
FT                   /protein_id="BAE65618.1"
FT                   /translation="MISLLQSPVRRYGLLAVTAIILLGTLYRLYFHSNPLPQVIRPSGS
FT                   SPDNSNPKGKEKETGRYGHDDPEAVPHPIDGLIRNAEQEWDRLLTKKVYNLTDAAAQYR
FT                   QRRGRHPPPGFDKWVDLAQQKDAILIEDLFDQLYDDLSPYWALEPKVMRTQASGWEPRI
FT                   MVRNHTLSSAGHTGVNWLEVWMDLVSTIADFLPDMDIPLNGMDEPRIIIPWETLSEYRE
FT                   KDRASQKLLDPATAVDQYMALPAYDEAHPNEPFKPPFDGPDRPFWEIMRDACPPESPGR
FT                   NSNIPHMDFANPPPEFFNYRNFSKTGYIEDFERSKDPCWRAELQALHGSFIEPTSTSTT
FT                   HELVPLFGGSKLTVNNEILIPPAVYWDDDPRYSGGWKNQGGSWSDKKDIVYWRGIASGG
FT                   RNRVDTWTGYQRHRLVSMLNGTEVSLTNGSKSAGINFRQPDYQYYNIWAGLDGTLPDYL
FT                   NEHCDLGFLDLCCFPREDGKHCSYTDPHYKIVEGMPMKKMYQFKYLPDIDGNSFSGRYR
FT                   AFLLSTSLPIKATVYKEWHDSRLIPWAHFVPMDSLYMDIYGIIQYFIGYKGRNGHDGQA
FT                   EKIALNGKSWAEKVLRQEDMQLYVYRLLLEYARLCDDRRDSLAFVGDLL"
FT   exon            408520..410397
FT                   /number=1
FT   CDS_pept        join(413141..413244,414761..414860,414908..415416,
FT                   415472..415523,415576..415980,416027..416168,
FT                   416225..416347,416397..416561,416610..416893)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000153"
FT                   /old_locus_tag="AO070302000105"
FT                   /note="carboxypeptidase C (cathepsin A)"
FT                   /db_xref="GOA:Q2TYQ4"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033124"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYQ4"
FT                   /protein_id="BAE65619.1"
FT                   /translation="MLAEYFKSYILGGFPRRLPPNTCSLADMRQLNWISAVTLASSPFP
FT                   PEPQGLRTLPSSHVDGASISYKKTQICSTPHLDTYSGYVHLPPRADDAHPHPSNLFFYY
FT                   AKSAEKRTTPLTIYLGGGPGASSMSSMATEVGPCSVNSDSNSTSPNPWSWTRESDILFI
FT                   DQPVQTGFSYDVLTNATIDYSTSTITPTDFDDGVPVANHTFGVGVFGSQDLNGTANSTT
FT                   NGARVLWDFMQVWINEFPEYESPDKKIHIWSESFGGRYGPTYAAYFLDQNEKIRNNEVT
FT                   EISSPSPITIDTLSIHNGCSDITTQGAFYPEYAYNNTYGVQAITETQYEEAKYNWTKPG
FT                   GCLDMAVQCQELVQKLDPYNFGNNAEVNDVCFAADEYCYENVLAVYALSGRDIHDLAEV
FT                   PTTTVPLPYSDGFFNRAWVQNALGVPVNYTMNSYTIYNAFWSTGNALITRGNAMDHFSS
FT                   IMERGVKVNLIYGDRDYLCNWMGGENVSLSIKHDQSAEFSSSGYADLITNKTYVGGVVR
FT                   QHGNLSFTRVFDAGHTVPAFQPETMFRVFSRIMNSKDIATGNVTLTEKRRETYRTQGPH
FT                   STFDRKNKLPSPATPLCYTLDMPTTCTDNQQAALLNGTAIVEDFVVKWPVS"
FT   exon            413141..413244
FT                   /number=1
FT   exon            414761..414860
FT                   /number=2
FT   exon            414908..415416
FT                   /number=3
FT   exon            415472..415523
FT                   /number=4
FT   exon            415576..415980
FT                   /number=5
FT   exon            416027..416168
FT                   /number=6
FT   exon            416225..416347
FT                   /number=7
FT   exon            416397..416561
FT                   /number=8
FT   exon            416610..416893
FT                   /number=9
FT   CDS_pept        complement(join(416994..417285,417343..417496,
FT                   417560..418292))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000154"
FT                   /old_locus_tag="AO070302000106"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYQ3"
FT                   /protein_id="BAE65620.1"
FT                   /translation="MVVYRAPESRSPFLTSDEERQSFDFFLHQTRYRFPIDFTDPVLRA
FT                   AHSDEGLARAIISFGALQQIYECGDDPSLLSPQGQFAMRQYGRALEKVRVWLGNGAKDL
FT                   SLVCCLLFACFECIRGCRRAAVVHIKSGLDILLQCGEELAWDVVSRDTMISMFIRLDNQ
FT                   LVGLLGTSLSRTLKRDGERGSSILERVALGPNGEYVVQSLHGVLNSIFHDRLDMALIME
FT                   GHSPSVRPVDRRRTSRYLKEWHGGQDPDIMRIWYIIGKMYVAVPPDGSEDAWDQFRPGF
FT                   ETIVSLVESYLLRTRQLSQKRAFSFDLGIVSPLYIVGVRCRDMSIRRRAIWLLESCERR
FT                   EILWDSTLAAMAARRVMEFEGSRDIWPKSLGRRVRNVTAVLDDDNGVSIEFE"
FT   exon            complement(416994..417285)
FT                   /number=1
FT   exon            complement(417343..417496)
FT                   /number=2
FT   exon            complement(417560..418292)
FT                   /number=3
FT   CDS_pept        complement(join(418838..419229,419282..419346,
FT                   419414..419625))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000156"
FT                   /old_locus_tag="AO070302000108"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYQ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYQ2"
FT                   /protein_id="BAE65621.1"
FT                   /translation="MGALCRPLNAFWDRTVKGECFNSTALTYFVNSSNMVTDLVLFALP
FT                   IPVIVRVRTTRKKKIALITIFSIGFITCGISAARLAYVVAQGSADITWEGVPLGILSAF
FT                   ESLGGVLCANLPIIYRLFKTAAQKISSSVSGQKSKGSNLQYAYDSRAYGSKSHGRQNRR
FT                   STDSERWIQMPNESDSTEMQTHVQGMSPEMKADGFEMGPIPRDGIAVQREFHTTVEERV
FT                   "
FT   exon            complement(418838..419229)
FT                   /number=1
FT   exon            complement(419282..419346)
FT                   /number=2
FT   exon            complement(419414..419625)
FT                   /number=3
FT   CDS_pept        complement(join(419676..419908,419969..420008,
FT                   420072..420230))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000157"
FT                   /old_locus_tag="AO070302000109"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYQ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYQ1"
FT                   /protein_id="BAE65622.1"
FT                   /translation="MATWDGTPSRETLVIVGYTVPTVLLVASTVLRLFAKMSNEGLHLD
FT                   DHLIILASALEVAYSVTILACGVGHGFGRHTATIDLKDLEIFLKVKAPDDPPDLSLADN
FT                   RRRESTSPVTFTTSSLPQPNSASSSYTTAFSLSPGSARQ"
FT   exon            complement(419676..419908)
FT                   /number=1
FT   exon            complement(419969..420008)
FT                   /number=2
FT   exon            complement(420072..420230)
FT                   /number=3
FT   CDS_pept        join(421628..421683,421724..421963,422098..423106)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000158"
FT                   /old_locus_tag="AO070302000110"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYQ0"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYQ0"
FT                   /protein_id="BAE65623.1"
FT                   /translation="MEKGDDYFASGTPFTMEYRSVMCAVGVTVDDERFNPLRSTVMRLV
FT                   FRTETAYYAVLMASAHYLRSVESRFELMEIQIRSEVLRGLRRALMKDNLDWEDFCDGSW
FT                   VKHLACFQLIVKEMAYGHRKAPPVPQFFISYFSAHLVLAKSVFSIDDVLPVGKIPTNST
FT                   NHSSLVNSTNTEKVSWTSTKDLAKVMPADTLHEIDMWNGHSGHMLLIINEILSLKHDAQ
FT                   ALRHQSSDLSTPQLAVQEKHAAIADKITTLEASLATTTQIIPVSLYKDRTSAESRHGFR
FT                   LLKSTSEAYRLAAYLLLSEAVSPRFLGYTPASTQSIEQLRDSAQRAQYVDRIFHLASYV
FT                   VSSVDHLPISWPLWPLFIASCCCSRDEETRTRALEIFGSAREKAPYENIPRAQTLVELL
FT                   WKRRDMQTESDNSVRIGRFEWESAMESLGWQTSFA"
FT   exon            421628..421683
FT                   /number=1
FT   exon            421724..421963
FT                   /number=2
FT   exon            422098..423106
FT                   /number=3
FT   CDS_pept        complement(join(423256..423477,423564..423971,
FT                   424029..424292,424358..424616,424667..424791,
FT                   424853..424946,425023..425141))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000159"
FT                   /old_locus_tag="AO070302000111"
FT                   /note="permease of the major facilitator superfamily"
FT                   /db_xref="GOA:Q2TYP9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYP9"
FT                   /protein_id="BAE65624.1"
FT                   /translation="MSDYSSSPGSEPKAPSETVAEHQPLTAMEEKAILRRIDLCLLPLM
FT                   FVSYLLQYLDKTAMSYTSILGLLPGTHMNTDQYSWASSAFYFGYMVASYPVSIGFVKFP
FT                   IGKYLSIMMIIWAIILTCHAAASSFAGITTLRVLLGVFESAISPGFTIVIGMWYTPSEH
FT                   ALRSCIWFAGNGVASIFGGVLSYAIGHVHNRLGPWQWVFIIFGIITLVWSIFQFFVLPD
FT                   SPLNAKFLSPSQRGPAYRRAQACQKTYQSREWKKDQFIEALIDPKTWFLFTYNFLVSLP
FT                   NGGITNFSSLVIASFGFDTFNTLLYTIPMAAVALIFLLLSAVTCNRFRGLRCYWMIITL
FT                   LVSLIGILLMRQLPVEKKWSRLVGVWLVTVFGAGFPLSLSLVSSNFAGFTKKSTVTAIL
FT                   FIGYCVGNIAGPQLFKKNQAPHYYSAFAAILACFCIAVLDVVLLRVYMVWENKRRDRKQ
FT                   GRVIEPETKEVEDSGDSTAGKEVGDVSDWQNPNFRFCL"
FT   exon            complement(423256..423477)
FT                   /number=1
FT   exon            complement(423564..423971)
FT                   /number=2
FT   exon            complement(424029..424292)
FT                   /number=3
FT   exon            complement(424358..424616)
FT                   /number=4
FT   exon            complement(424667..424791)
FT                   /number=5
FT   exon            complement(424853..424946)
FT                   /number=6
FT   exon            complement(425023..425141)
FT                   /number=7
FT   CDS_pept        join(425771..426804,427233..427254)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000160"
FT                   /old_locus_tag="AO070302000112"
FT                   /note="imidazolonepropionase and related amidohydrolases"
FT                   /db_xref="GOA:Q2TYP8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYP8"
FT                   /protein_id="BAE65625.1"
FT                   /translation="MHRMLTDDRLYRVDADLLIPGKGDPIPHGAVVWQCKTIRYAGPRS
FT                   GVPTEFQGATTTHVPVVMPGMWDCHIHFLGATAATMNAIVDTPQALAGARSVPDLHATV
FT                   MAGFTSVREVGGYGCDLAKAVGEGRIPGPNIYSSHSAISMTAGHGDVHGVHRDSLLDLC
FT                   AHGLPLTIADGVPECLLAVRKQLRRGAKVIKVCASGGVVSAIDDPQHQEFSFEELKAIV
FT                   DEAARARRVVAAHCHGKAGIMNALRAGCRTIEHGSFLDEEAVGLMKEKGAILVATRSVI
FT                   ESGLAMKDLFTPSSYQKLLAVADAHRKAYQLAISRGVTIALGTDQFISSDNPMIGYGRN
FT                   GHEVSLGSGAR"
FT   exon            425771..426804
FT                   /number=1
FT   exon            427233..427254
FT                   /number=2
FT   CDS_pept        join(428195..428445,428499..428746,428882..429186,
FT                   429241..429555)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000161"
FT                   /old_locus_tag="AO070302000113"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYP7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYP7"
FT                   /protein_id="BAE65626.1"
FT                   /translation="MLSWLLRSLPRFPLGRTWRPLNFSNPNFGRISANQIVEEETLPDY
FT                   IASRYYPTRIGEIIKDRYQVVGKLGYGTTSTVWLAWDINCRSYVTLKIFIKAASMGKQL
FT                   DDELKMYQRIDRASKHPGRNAIRSLLDSFHIDGPEDKHHCLVHPPLFESVWEFLHRNPV
FT                   QRLHIKANNIMFELADNSVFTKFEEDELQNPSPRKELDGRSIYLSRELEMIPGKLGAPV
FT                   LCDFGSAMLGDVEHLEDVQPDIYRAPEVILEVPWWYSIDIWNVGCMIWNIFEGGSLFTG
FT                   HDPEFQTYQSRAHLAGIINLLGPPPPSLLARAKQSQKFFSNSGEFREAALLQDLTPLDQ
FT                   RETTLEGEDKESFLRMMRAYDAKDVAVGAGEA"
FT   exon            428195..428445
FT                   /number=1
FT   exon            428499..428746
FT                   /number=2
FT   exon            428882..429186
FT                   /number=3
FT   exon            429241..429555
FT                   /number=4
FT   CDS_pept        complement(join(430498..430750,430808..431325))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000162"
FT                   /old_locus_tag="AO070302000114"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYP6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYP6"
FT                   /protein_id="BAE65627.1"
FT                   /translation="MFRSLSRLTGSLAHLRQRDDREAQRGKAFGVLCDTFTRLKDMSSV
FT                   YVQPNDFESLPVKIDIKVLPINDVTIEETPRATAHNDSNFFLPLSRESISSKYKMNLES
FT                   PEIRKRFSEVNQLTDGNCPALVKIGCWNEEEHLDSIVYQLMWEADVVPRMGTDGNSRPL
FT                   RVVTGWKSPGFAFEARFEPCLHPYSPPYSEPAYCWVKGGLPHIKIAVYNTSNGDPILLL
FT                   RSEVVTIIAAIATRPMDGGLEKHLVIPVRESLLN"
FT   exon            complement(430498..430750)
FT                   /number=1
FT   exon            complement(430808..431325)
FT                   /number=2
FT   CDS_pept        complement(join(435610..436538,436588..436930,
FT                   436983..437253,437309..437553))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000165"
FT                   /old_locus_tag="AO070302000117"
FT                   /note="predicted transporter (major facilitator
FT                   superfamily)"
FT                   /db_xref="GOA:Q2TYP5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYP5"
FT                   /protein_id="BAE65628.1"
FT                   /translation="MLSSWQKKFLEKSDGPTEANPNPPEYGTNEDIHPGSKRPEEVVND
FT                   DVSREDVPDDTAQDGVAQAEAITLTWNKWSLGSAYILMWLLYFVNAFQSSITGNLSAYV
FT                   TSGFESHSLIPTISVVSSVMSAATYMPLAKILNLWDRSIGFLVMVLFSILGLVLSATCS
FT                   NIATYCAAQVFYSIGFAGLIFSIDVITADTSSLRHRGLAYAFTSSPYIITAYAGSAASE
FT                   HFYESNWRWAYGCFAIVLPVVAFPMFCLLRYNRHLAKKNGLLKPREKSGRTLMQSIIHY
FT                   IIEFDLLGTFLLAAGLVLFLLPFTIAGSAEDDWASAHIIVMLVVGFVVLIAFGLSERYL
FT                   APVPFLPYEILLSRTVLGACLIDVTYQVAYYCWFDYFTSYLQVVYGTSIATAGYISSIF
FT                   DVVSGVWLFVVGFLIMKTGRFRWLIQGAVPLYLLGVGLMIYFRNPSWSVGYTIMCQVFL
FT                   AFAGGTMIICQQVAVQAAADHNHVSSALAFLNCFGNIGGAIGGSISGAIWTHTLPDALK
FT                   RLLPDSIKSDWESIYDDLDVQLSYERGTPERQAIALAYASSQKNMLIAGTAIMALSLIW
FT                   MFVLRDIKLTKQQSKGILF"
FT   exon            complement(435610..436538)
FT                   /number=1
FT   exon            complement(436588..436930)
FT                   /number=2
FT   exon            complement(436983..437253)
FT                   /number=3
FT   exon            complement(437309..437553)
FT                   /number=4
FT   CDS_pept        438552..442535
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000166"
FT                   /old_locus_tag="AO070302000118"
FT                   /note="multidrug/pheromone exporter, ABC superfamily"
FT                   /db_xref="GOA:Q2TYP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYP4"
FT                   /protein_id="BAE65629.1"
FT                   /translation="MKLGKKLAGYPSLLLAGNPSKVDIGRLLLGMVASAASGVPFPLIA
FT                   ILFGQLLDDFNAVTCDETESTGSDADYQHDINGKILIIVYLAIAQFVAIYIHLSCWSLN
FT                   GARLAQRLRETYLQNLLRQEPSFFDDLPPGELASRLNGDIQAIRSGTSEKVGICLSTLS
FT                   FFITAYVVAFIKDYRLAAMLISLVPAYFLMSFVGSHYIEKYSGRMSDYSATAASIASEA
FT                   LSNTVVVQAFGASYRLEDKFSKALKASEQEGLKKAAAVGIQSGFLYFIAYSANGLAFWQ
FT                   GSRRVADAVGSDTAGATVGATFTVIFVLVEATLLLSQVAPFLHLFTAAVASYQKLRADI
FT                   DRQPQIDATTESGIRLSQAEGGFEFKNVSFTYPSRPEITVLDQISLSIPANKHTALVGL
FT                   SGSGKSTIAGLVTRLYDPTEGQVLFDGHDLREVNTRDLRSFLSLVQQEPSLLDRSLLEN
FT                   IAHGLINSSNPSHAHLRTTLLSTGLTDLAAEVREGVDLMAAAEKRGSEVVEIVNLVRKA
FT                   ATLADADGFISALQYGYGTLVGSSGRLISGGQKQRVSLARALIKDPAVLILDEATASLD
FT                   SRSEQRIQRAISNIATGRTMITIAHRLSTITNADNIIVMHKGHIVEQGDHATLMAKNGA
FT                   YADLVNLQTLGSAPGKKEKTASADNVSKSDQASLSDAGVEESSVSKDGLETAEKKEVLA
FT                   SAAPVTEPAEPAEEEEEPETPKKSMWALLRGYAPTLRPHLLFIFLALLGSSIVGGAFSG
FT                   EAVIFGNTVGSLNPCHSESYIRSAGNFFGLMFFVLAIIEFFANLVSWTGFGWVSEKIVF
FT                   TVRVLSFRSLFEQDLQWHQSNGRSPALLLSYITRDGNALAGLSGSVIGTLFSITVNLIA
FT                   AIILTHIIAWRIALVCLALVPLLLGAGLMELHVLGKFEERHENAYTKSVDIGVEAVTSI
FT                   KTIASLSLEEDTLRTYRRSLKGPRKETFQVTLHASLWQAMTYFLGNCVNALAYWWGSKQ
FT                   IINGNYTQTQFLIVVFSLLVSALLWSQMFALAPELSAARAAMARILGLIEIGSDKMQGR
FT                   VPSRSPTISSSEEKDVETAETKSVYVSGNNRASSVQLRNIHFAYPARPDIKVLKGLDVD
FT                   IHPGQFCALVGPSGAGKSTIISLVERLYTPETGSIVIDGVDVTRHRGVDFRDSIALVPQ
FT                   ESVLFEGSIEFNIGLGARPGHEATIEEIKEACKLANIHDVIEALPEGYKTLCGPNGSQF
FT                   SGGQKQRLSIARALVRKPKLLILDESTSALDAESEKLLQDGLEKAAKGITVIAIAHRLH
FT                   TIRAADVIFLIEGGKCIDRGSHEELLERSDSYRANVMHQTVAT"
FT   exon            438552..442535
FT                   /number=1
FT   CDS_pept        complement(443363..449134)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000167"
FT                   /old_locus_tag="AO070302000119"
FT                   /note="non-ribosomal peptide synthetase modules and related
FT                   proteins"
FT                   /db_xref="GOA:Q2TYP3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYP3"
FT                   /protein_id="BAE65630.1"
FT                   /translation="MLEFTVTQHIKSLVDTVKMCLSNPDASIEACLRPTASDLDAIWKW
FT                   NHELPPSYNFCMHDVISEQSNRFPDKVAISSWDGELTYGQIEQYSTFVAGSLKKMGVDV
FT                   HDFIPVCFEKSRWTIVAVLAVMKAGGTLVMMDPTLPLARLQNMAKQVGAKAMVSSRNQH
FT                   ELATTIMSDGKHIVVEADAFAHLSNSEPLPLLPAVPSSALMYIIFTSGSTGTPKGVKIS
FT                   HETYTSSAFPRAKAVGYTEESRVLDFASYAFDVSIDSMLLTLANGGCLCIPSDEDRLND
FT                   INEVIRRMKINYAGITPSVARILEPDVIASLSALGLGGEAAAATDVTRWGHDTRIVIGY
FT                   GPCECTIGCTVNSDTATGRDYISIGTGNGAAIWIADPNDHNVLMPVGAVGELLVEGPIV
FT                   GQGYLNDPDKTAAAFIHDPAWLVSGHNGYAGRSGRLYKTGDLGKYDPDGSGGIVFAGRK
FT                   DTQVKLRGQRVELGEIESQLNARLTAEITVIVEVIKPQSSGGQPTLVAFLASQSTKKNG
FT                   DTEIKSAELSDDLRKTLSKADAEIAKVLPRYMVPNAYISVNYIPVLISGKTDRKRLREF
FT                   GATVDLQQLDQGTNNGPARELTDLEQRLRHGWGQVLKLDPEGIRPNDNFFALGGDSLAA
FT                   MRLVSVCRAEGLDLSVTGTFGHPTLSAMASVVSIVDSKAKTETPPFSMISQAVESACLE
FT                   ASEACGSDPASVEDIYPCTPTQESLFTFSLKSVKPYIAQRVARIPSHISSDAWKKAWGE
FT                   VVAASPILRTRVAQLQERGLQQVVLKETISWRSSSDLVQYLETDRRERMSLGESLARYA
FT                   IVSDPQTETRYMVWTIHHVVYDGWSEPVILKNVSDSLQGQSIETQAQIRDFVKWVRDTD
FT                   EVAMQEFWRRELKGAVGPQFPRLPTRDYLPVPNAMVERQIPLETGSGWPFTLATLIRGA
FT                   WALVASQYTGSDDVVFGETLTGRDISLPGVESIVGPLIATVPIRVRIPRTSSVESYLRD
FT                   VQQSVVARTPYQHMGMQNIRKVSQDAQHACEAGTGLVIQPEPEYVGSELGFELGDVVRE
FT                   ALHFNPYPLMLGCGIRKGGFRICANFDSSLVEIPQMERILAQLEMACLQLTKGLSRRVD
FT                   EISCLPEAELDLIWQWNQIAPLSLDESSGRLRANTNIKQGSVYPPTVVSWVCDPRNPSL
FT                   LSPIGCVGELWLEGAFLSGDAIESPSWLVAGSSNFRGRTGRVQPTGDMVNLQEDRSLVF
FT                   VGRKENVVPVHGHAVDIADVESHFSKYLPPNVRAAAAVFQPSSDDTHSVTEQELAVFIE
FT                   QEPFEQDSVELLSAQYDITCEGSDTQNLSTSVRATISVSLLVALKRLSKFMQDSLPSYM
FT                   VPSAYVVLDKLPTDVGEVNHSLLKQLASNIPKHVLTQLREAFQQAWTKNLGQTNMSLPE
FT                   SILRSAWAKILGISPEKIDVDDNFFRLGGDSVLAMKLVSSLRAQGHSLSVADIFQHMRL
FT                   GDAAKVLKLGQVSQQKVQPYKAFSTLGHLDVEQFLSEIVRPKLADVTWSIQDVCPVTDS
FT                   QALDVRATIQGPRTSIQYTMLYLDKSIDREQLFRACNDLVKTHDILRTVFIEHESTFYQ
FT                   VVLNELEVPVAMHQADKDLGPYIKDLCTSHTESFHLGSSFFKLLHVEGNDGQECLILGL
FT                   SHAQYDGMSLPRLLQDLETLYTGGKIVDFEPFSAYIARISDEGVQTKAINYWRNLLNGS
FT                   SLSVLEGTSVQPTDKAIFHTKPVDVSQPLDLDEVTTANLLTAAWALVLACRLQKPDVTF
FT                   GGVTSGRNIDLANVENVMGPCYQLTPIRVAFQSQWTAMDLLRFVQRQSAESAAHDFLGF
FT                   NKISKKCTQWSSEATCFDSLVHHQDWDDFDTMPFAGGTCKVDILNPDGDAPYPLKVVSF
FT                   VRGGQLNVGVAGSERDAAFVDAALDELAATVKELATRPSEHVLIDGHMF"
FT   exon            complement(443363..449134)
FT                   /number=1
FT   CDS_pept        complement(join(451088..451674,451744..451972))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000168"
FT                   /old_locus_tag="AO070302000120"
FT                   /note="enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="GOA:Q2TYP2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYP2"
FT                   /protein_id="BAE65631.1"
FT                   /translation="MSIEMQHPPVQGCLVSFPAPNILLLTLNRPKQRNSIPLATSAEIQ
FT                   RLWDWFDQESTLQVAIITGTGESFCAGADLKEWNELNARGETNEMTAPGLAGLPRRRGG
FT                   KPIIAAVNGYCLGGGFEMIVNCDIVVASERASFGLPEVQRGIAAVAGSLPRLVRVLGKQ
FT                   RAAEIALSGLTFPASQLERWGLVNRVVEHGQLVATAVEIASAIAKNSPDSIRVTMEGLH
FT                   YAWEIASVEEGSTALVDRWYPKLMAGENFHEGVRAFVEKRKPKWRASNL"
FT   exon            complement(451088..451674)
FT                   /number=1
FT   exon            complement(451744..451972)
FT                   /number=2
FT   CDS_pept        join(452340..453323,453393..453764)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000169"
FT                   /old_locus_tag="AO070302000121"
FT                   /note="acetyltransferases, including N-acetylases of
FT                   ribosomal proteins"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYP1"
FT                   /protein_id="BAE65632.1"
FT                   /translation="MSLSLAESTPKSKPSYPWVKLPHPYLTSYKIHIVSESTARVLQLQ
FT                   LHDSSLGKPLPEPLHNNSLTYTDVSWDESAKEIPDNDNSPWARTRRAPGISFHWTSPEA
FT                   PTLGQIWNVIHATFLTHPQYEILRLDLIGSGSEIIRDECIRTGLTVPFPSRRVPFGNEN
FT                   KSSDVNTLVLLRSAFWQGAASPLGPRPIWAVDQDIHGLLRKSVSQYPALAQNYEFSMKF
FT                   PEERIYARHPIRPTKPTPGSLVYSRYIPHLDKHFSLMAVDWQDEEHLRLFNKWQNDPRV
FT                   AKGWNETGTLDEHREYLRRLHEDKHVLCLFGRFDDFKFAYFEVYWAKEDHYGAHYDAAD
FT                   YDRGRHSLVGESSVRGAYRVYAWWGSVIHYIFLDEPRTQAVVGEPKATNTTVLSYENAQ
FT                   GLTIQKYVDLGHKRSVHVHCSREKWFQLCPLFWDGRERPLESSDRMAFDAKL"
FT   exon            452340..453323
FT                   /number=1
FT   exon            453393..453764
FT                   /number=2
FT   CDS_pept        join(456577..456630,456691..457698)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000170"
FT                   /old_locus_tag="AO070302000122"
FT                   /note="predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily)"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYP0"
FT                   /protein_id="BAE65633.1"
FT                   /translation="MYSKFWPKGGLPGILHHYTETLVTFEYTTSTVRKPHSLLFVGGLG
FT                   DGLATTSYMADLAHALQPTEWSLFTLNLTSSYQSWGLGHLDRDTNEIAQCLNYIKEYKT
FT                   EKFGNGKIVLMGHSTGSQCVVHYLSRPNPHTTTPSFDPTLEHIKRMVLDGAIMQAPVSD
FT                   REAIKWVLKWGIGGKSPSEVREIYDKVVALAREGVAKDKDSGFDTLLPINLTGTMGYPP
FT                   NTPISCRRLLSLVSPDSPDSPGEDDMFSSDLSEEQLAKTFGKIKQGGLLKHKLMVLFSG
FT                   ADQSVPDWVDKEQLLEKWRKVTDRDGEAPIWDQEHSAVIPNASHALSNDDQAEPRKFLV
FT                   EKVMGYLRGAEKA"
FT   exon            456577..456630
FT                   /number=1
FT   exon            456691..457698
FT                   /number=2
FT   CDS_pept        complement(459948..461291)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000172"
FT                   /old_locus_tag="AO070302000124"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYN9"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYN9"
FT                   /protein_id="BAE65634.1"
FT                   /translation="MFGLGSLLSFFFVFATCLAHPGSLANRAMVTPPSADPFYKPPSGY
FT                   ENTEPGTILRHRRVTNPIALIDPIKLKLAAAYQILYRSTDNWANATATVTTVLVPENAN
FT                   TSRLLSYQIPEDSSSVDCAPSYILQTGIDDSDILSKTGIQSHTVLFRAALEKGWIVSLP
FT                   DHEGPKAAFLANRRAGHAVLDGIRAVLGSSGFTTVSPNASVAMWGYSGGSLATGFAAEL
FT                   QTTYAPDLDMIVGAALGGLIGDIEVVTYTVNKGPFVGLNFGGINGIAHEYPDIAALFEE
FT                   QLVESKKAKFYDANHNCFLANIIKYPFQDLFSYFKDPSILSYPQMQQALKDNNLGQNPP
FT                   KMPIFVYKGALDEISPVSSTEVVVSQYCAGGTVVNYKNVLTHEHILLQLDGFLEAFTWL
FT                   EKRMDGEAMETDCSRTDELLPISEPGSLGVVVPTVEGVVSDVVGTVLG"
FT   exon            complement(459948..461291)
FT                   /number=1
FT   CDS_pept        join(463173..463400,463438..463474,463535..463626,
FT                   463676..463760,463812..464204,464233..464503,
FT                   464527..464857,464933..464998)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000173"
FT                   /old_locus_tag="AO070302000125"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYN8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYN8"
FT                   /protein_id="BAE65635.1"
FT                   /translation="MEVQYILGILHNLDLAIWAVLIFIAFVLVTQAHYKAQLAKLPTFE
FT                   TDKGNEKWRRTYSDSARMLYQEGHKKVGSYLFKDQAWIMPTSDGRKNVVVPGRLLSELS
FT                   KLPETVLSFPTAINKVLEVKYTKVAPDEPFAPYCIKADLNPALSRLNPIIYREVENALE
FT                   DEIPQCEDWTPVFIYRKLLNTVAKVSGRIFVGAELSHNKDYLDTAINYTIELGNAVQAV
FT                   KQMKPWLRPFLAWKLPEVQQLNKREEMAIRFLEPIIQARREASKDPDTKSPMTCCSGSL
FT                   LRRIVKMQLLVIFAGIHNTTVTATNVLYNLAVSPEYMQPLREEICKAISDNDGTLTSRA
FT                   LQQVEKLDSFMKETIRFYPQNSLPSRAKRGQYIPPGTSIEAPLQAIYQDDSNYPDSDTF
FT                   AGFRFYKIRQGGGATVHARNQFVTSNEQNLVFGYGKHACPGRFLAAAEIKMIVSKILLT
FT                   YGFKNADNWTERYSNYEVGRLNMPERAIPLLFRKTTAQDSSL"
FT   exon            463173..463400
FT                   /number=1
FT   exon            463438..463474
FT                   /number=2
FT   exon            463535..463626
FT                   /number=3
FT   exon            463676..463760
FT                   /number=4
FT   exon            463812..464204
FT                   /number=5
FT   exon            464233..464503
FT                   /number=6
FT   exon            464527..464857
FT                   /number=7
FT   exon            464933..464998
FT                   /number=8
FT   CDS_pept        complement(466192..466905)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000174"
FT                   /old_locus_tag="AO070302000126"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYN7"
FT                   /protein_id="BAE65636.1"
FT                   /translation="METLIRNLILGFKVRTAGFKPDQPLIRVKPNNNDLELTNEFEQAL
FT                   TDVSNFSMQANFIAQYPDLAPYIRADIRSFAPTLPPSVSLPRPTPSLPVGTQALEPDTL
FT                   WPQPRLFSQSTMQHPPNPLYSSPYLYPTEGYRKEQTMVCPGSTVPIMGGNRDNQPLFTH
FT                   SSLDSFSNTGNAETLDLSGLQSGDYFDPNLPRSLPSFNPPVVDNPRDPCTAGSLDLDSW
FT                   DMFGGGDILQIPPSQ"
FT   exon            complement(466192..466905)
FT                   /number=1
FT   CDS_pept        complement(467028..467603)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000175"
FT                   /old_locus_tag="AO070302000127"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYN6"
FT                   /protein_id="BAE65637.1"
FT                   /translation="MSINRFTEAIMAWKYSMGLNNGLQLLVEHFKAQGYAAHGKNLNRV
FT                   PNWLLYFVSDKSNLDVLHERLLSSDFNERLLGLLVGDSDTGASLPCEKQTLLPLSPLDV
FT                   VRRKTAYLAYRIVAPWQDCCRSHAEMIAIFWTQFRHLLVRFPSPFSRIKAYRNFRSFLS
FT                   SHLPKTSLDAPAGIDRHPHGFSTTIPDV"
FT   exon            complement(467028..467603)
FT                   /number=1
FT   CDS_pept        complement(467661..468176)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000176"
FT                   /old_locus_tag="AO070302000128"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYN5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYN5"
FT                   /protein_id="BAE65638.1"
FT                   /translation="MPPKRRSANAGRATCPSEEDNPASSTTTSNQSWKLKFNDRQLERK
FT                   RQADRITQRRMREPSKQTAAAFKEKLELLMDGNHKALVERTLAENEDLVAKVKTFQAKF
FT                   EQIYLASKECLGLDEGPGRVDTLVSGVTGLPGVPDPCLTSSGLEAPSGSNQDVPVVEQR
FT                   SNLCRTFA"
FT   exon            complement(467661..468176)
FT                   /number=1
FT   CDS_pept        join(469042..469188,469363..470530,470569..470627)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000177"
FT                   /old_locus_tag="AO070302000129"
FT                   /note="tandem pore domain K+ channel"
FT                   /db_xref="GOA:Q2TYN4"
FT                   /db_xref="InterPro:IPR003280"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYN4"
FT                   /protein_id="BAE65639.1"
FT                   /translation="MSNCKKSVQTWGESRNVFELPDPSHSVPSRWWRSASPFPVMAVIA
FT                   ILIAGITIRVSSRMVALKAISLALAALSYITLILTMMCKRNPQQGFIVTISGWLIAGAL
FT                   LFSLIGVNARRHPIMQSRQPWKYTQSYFYGIMAAGLYTLIAILLAVYTATARSVPLSRH
FT                   DRRIVEYTSIILRTITFIAFLTGGAGVYSAVEGWSFMDAVYFTDYTVLTIGIGNIVPKT
FT                   HLGRSLLFPYATAGIITLGLVISSIQSFGNSIRHMKLKFEIQEARNKLLEQKRPTHYEH
FT                   NDSRTLCSIPSTTTFPQTSDVVELQRIRYDFNQRVRWMALIFFVVAWFVLWLLSAAVFR
FT                   RSERGQNWTYFTALYFTYTSLTTIGYGDFYPTSNFGKVFFVFWSLLAIPVLTNLVTAMG
FT                   EIGVRTLVYFAGYVLRLGKMRRKSGHGVKNCSDTEPLGNFEEAITGHKYTRDKEHFDD"
FT   exon            469042..469188
FT                   /number=1
FT   exon            469363..470530
FT                   /number=2
FT   exon            470569..470627
FT                   /number=3
FT   CDS_pept        complement(471277..471984)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000178"
FT                   /old_locus_tag="AO070302000130"
FT                   /note="predicted O-methyltransferase"
FT                   /db_xref="GOA:Q2TYN3"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYN3"
FT                   /protein_id="BAE65640.1"
FT                   /translation="MSTNTTLPTAKEVDSYVVSHLVSTDQALTDTISSCAKSGIPPIAI
FT                   SPAQGKFLSLLTKMSGAHNVLEIGTLGGYSSIWFARALNANGKKGKVTSIEILEDRREL
FT                   AMQNLRNAGVKVPDEAEVLLGPGLEVLPRLEEEIQQGKRPKFDFVFIDADWDNQWQYFD
FT                   YGVKLAKGPGAVILIDNVVQAMLGDGIVGPEKRKQGAISVVEKVGQDRRVEAALVQTLG
FT                   TKSHDGFLMALVV"
FT   exon            complement(471277..471984)
FT                   /number=1
FT   CDS_pept        join(472702..472718,472782..473226,473280..474534,
FT                   474576..474886,474951..475031,475104..475190)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000179"
FT                   /old_locus_tag="AO070302000131"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYN2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYN2"
FT                   /protein_id="BAE65641.1"
FT                   /translation="MSDPTAKLACDREYPSCTRCRKTGNSDSCSYDDSPAPSRNKQQRS
FT                   DVLGQNRPVLTAAPAPENAASSAFLESYRDNHNNRPIVSDLTEHAGTWQLIGGDVDGAT
FT                   TIKERPAIKADVTELTYPPEPKPTEAVVFRGENYKTQYYGSTNPTSLIGHFPELRSYMK
FT                   ETIKHHASLPGVQKELKALDTKWKYEKPHNLPVKTADLLLLLPDQAEMDAAIRLYFDTL
FT                   ETMYRILHRPTFMEEYEQLQQDRTAAKPGFIVLVLLIMATVSCTTATDRTYVGSSSIGR
FT                   ERGSLWIETAEAWLGKQSKKNIYLVIWQIRCLLVLAKQMCRYKKKRMWSVAGDLVREGM
FT                   AAGFHRDPSRLGGKISFFDQEIRRRLWATMAELELQASVERGMPSALAAIRMDCAPPVD
FT                   IDDEDLRPECDSTQIQESPSHNTSTSFLHLCRHSLDLRVSLNSRMNDLTSDLPYEDILR
FT                   YEDMIMSELRKLPSPTESNEDTTDRKLSQMARVVLDLQLRQFLVLLHAPFARKTEINSR
FT                   YAVSRMVCFNAAASLIDQHWRLVQSGNPMLLLLRHDYFRGALSLTHYAYVSSGIQAFRW
FT                   LINMSADLCFPVDHNALLQYIQNALTMLEDSITYLGTGFTYHWYISAAISFLRSQSQPA
FT                   KPSALKQEAINQVVRQYYRVLASQEQFPRAKERIYSSRFRQGNPSEAERHFDVLDPGEM
FT                   SLDDVGFPQFDPTVPSMDQYFFGDPAAWTFDNLWEVA"
FT   exon            472702..472718
FT                   /number=1
FT   exon            472782..473226
FT                   /number=2
FT   exon            473280..474534
FT                   /number=3
FT   exon            474576..474886
FT                   /number=4
FT   exon            474951..475031
FT                   /number=5
FT   exon            475104..475190
FT                   /number=6
FT   CDS_pept        complement(join(475360..475573,475659..476213,
FT                   476275..476395,476451..476625,476693..477805,
FT                   477885..478391,478442..479512,479569..479805))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000180"
FT                   /old_locus_tag="AO070302000132"
FT                   /note="chitinase"
FT                   /db_xref="GOA:Q2TYN1"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR036861"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYN1"
FT                   /protein_id="BAE65642.1"
FT                   /translation="MLPIKSLFLVTHFLSFATTTPSPTRFRDYDPKDPCPRQCGLVGTD
FT                   PQDWAVYYSPDALDGCNRPLLLDFKLDSELDNPNTSVPGLNSSAQNVTLQRIEYDGASG
FT                   DSLVAAGAVFHIQRYLEQNVEQDNNVIMFSTSGNATVGFFGGALMDTQRMATSLLPELI
FT                   RHITHDGFSNGVLEQICGTRRNAHEVWGIMVSFSASMSTVQETVRTWSQGKCVTPISPM
FT                   AGVTSFHSAMIPTTAFNRRPRVLNARTPTLQRRAECSTIKVLEGDSCGTLANRCGVSGA
FT                   DFEKYNTQSNLCSSLQPGQHVCCSAGTLPDFRPKPNPDGSCATYTVLVDESCKSIATAN
FT                   SITLGDLEEFNKKTWGKFSLLLKQCPVQRSCGLVGWNGCGTLWQGAKICISSGDPPMPN
FT                   SVANAICGPQVPGTEAPTDGQDLASLNPCPLNACCDIWGQCGTTAEFCTYSSSESGAPG
FT                   TAAPGENGCISNCNANVVSSGPPEEYLRIGYFEGYNLGRACLNMDAGQIDTEKYTHIHF
FT                   GFGTLTEDFNVKVGDALSQFEFEQFKQLTGVKRILSIGGWDFSTSPDTYTTFREGVKSA
FT                   NRMTMAENIANFVEEHDLDGVDIDWEYPGAPDIPGIPPGSADEGVEYAIFLILLKGLLR
FT                   DKSLSIAAPASYWYLRPYQIAALADVLDYLVFMTYDLHGQWDHSNHWAAPGCEEGNCLR
FT                   SHVNLTETYSALSMVTKAGMPSNKVITGIASFGRAFKMTTPGCTGPDCHFTGATSGARA
FT                   GRCTATQGYLSVAEIDEILSTNPSADTWTDDSLSNVLVYNETEWVAYMDDANKADRDIL
FT                   YKGLNFGGTVEWATSMHSFHEVPSDALVPGGSLSDIIKEWPVFVETVINGKSPFIHGDR
FT                   NGHWADGSITCTDDAVVGVLDIPPKKRWEDLDCSTAWQDALDKYRQFDLPRNWDFTKSI
FT                   SDTFHGRENMNCGILSAQADCSMSFQCEQSKGEGSGPAGYEVMNSLMFESLYKGIVGAA
FT                   GVVASKNLEFVNKFAPIPDYTMTFNLFMDTLGLVVPAGMAPVFNNVLSRTAYFSANPAM
FT                   LDNAKDVVYTMVGSWVNIAKDSNPADYGWDEEDQWEFMGFMTDVWHTWQNETENTSRYL
FT                   FSGTEDAIRDLSKIIRDGQLIQGSFEGATPPTEMSATEIQALIERAFYGYLIPRIWQSS
FT                   GTKAFVIDTNHACDGSNPIPDYLDDTNAETTAVCFEDKLYYLAYPDGNAGDTCQLPGST
FT                   PVCVPLKFKVPPGLDELTGAVKDYGGMKPVDIVASTVRSYQANGNKNGWTLKSMGDVQS
FT                   VDDLNLDALITYQIGAAGFSTLPLCSAEEAHLNWGIGKDTDNYPCN"
FT   exon            complement(475360..475573)
FT                   /number=1
FT   exon            complement(475659..476213)
FT                   /number=2
FT   exon            complement(476275..476395)
FT                   /number=3
FT   exon            complement(476451..476625)
FT                   /number=4
FT   exon            complement(476693..477805)
FT                   /number=5
FT   exon            complement(477885..478391)
FT                   /number=6
FT   exon            complement(478442..479512)
FT                   /number=7
FT   exon            complement(479569..479805)
FT                   /number=8
FT   CDS_pept        complement(484884..485471)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000181"
FT                   /old_locus_tag="AO070251000032"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYN0"
FT                   /protein_id="BAE65643.1"
FT                   /translation="MYTIISYATLFLFTFQVYGSNSATDSSNPVPWDSLDLGSIFEDIF
FT                   GSLIPDGTTNSTSENVGNAIDGIIGLFSTTLVKDVVSSITHMADLFDNQTSFQTKSLIQ
FT                   IGTNELTNETINEVTSLLDSANVLLTADNVESINNLLEEASPLLTEDFLNEINNLLNNT
FT                   STLLNFPLSTKPNHSSLRSTRCYPIYPPILPL"
FT   exon            complement(484884..485471)
FT                   /number=1
FT   CDS_pept        complement(join(486301..487246,487294..487499))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000182"
FT                   /old_locus_tag="AO070251000031"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYM9"
FT                   /protein_id="BAE65644.1"
FT                   /translation="MSDCSSAARVDLAQYEALIIEKHLSFTGANYRAQLLETGADLRRA
FT                   MNGLTSAIEYFCSQGRAERIPLSVLAYTAVPLVLTAIDVKLSPTPAEMTIRKRRLERLG
FT                   EIVRHSRMLYDVADYVAAGTNHILQLAYITTQEAFLRCSTNAIGSSQMEIESSSGGMSL
FT                   DASVFNAKRVTNWYDAFLSSPRAYLRISVSLDYSLATGRLPYDNALPLLVRQTPWAKKQ
FT                   QRLPWTIGLDTDDSAVYPDAPRNGRVTEDISSISQISTIPEEQPVDIPEDDDTESQGDA
FT                   RFPFIAAIGESIREETLNLAGSSSPEEGSTGDDAINLNFFEFGSQQLDDILEMETEHTL
FT                   DADQSQHLGMGASRSGKERADDVGFGHGGFQSIYTSLLRDTVA"
FT   exon            complement(486301..487246)
FT                   /number=1
FT   exon            complement(487294..487499)
FT                   /number=2
FT   CDS_pept        complement(join(488026..488137,488190..488467))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000183"
FT                   /old_locus_tag="AO070251000030"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYM8"
FT                   /protein_id="BAE65645.1"
FT                   /translation="MNSRGSIFSKFIHVFLFWMKQGFGVSLPTPLHIQYHYLFCKLFSF
FT                   RAALYVYTLSFWSFIPTNTISTSPWKRSTNADSVIDEKLEQHSTIVPSYSSISKQKMTH
FT                   SPKHKAPFSSPTTPPLTILKLAVYG"
FT   exon            complement(488026..488137)
FT                   /number=1
FT   exon            complement(488190..488467)
FT                   /number=2
FT   CDS_pept        complement(489388..490248)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000184"
FT                   /old_locus_tag="AO070251000029"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="GOA:Q2TYM7"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYM7"
FT                   /protein_id="BAE65646.1"
FT                   /translation="MDEKQDITTQNEKANGADEKLLTELENPQKIQKIVREGILLAGGG
FT                   AAILLQVAMPGVGKGVDEHSNFSYRPLDRLRTTMTYVYCMAFGTPEEKKIIIEMVHKAH
FT                   SVVRGPDYSADDPHLQVWVAATLYAVGIDLYEQVFGRMDEATAEAIYREYAVLAVSLRV
FT                   QPEMWPPTREAFWIYWDEQINKLQHQITPQAKNVCKDLLFNKQVPFVIRISMPLVRLMT
FT                   ADLLPDRFREEYGLKTSRSRRGMQKVVRGLTKVVYPATPSFIRTYPMRYYMKDMRKRMK
FT                   KAQHK"
FT   exon            complement(489388..490248)
FT                   /number=1
FT   CDS_pept        join(491308..491479,491530..491675)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000185"
FT                   /old_locus_tag="AO070251000028"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYM6"
FT                   /db_xref="InterPro:IPR022185"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYM6"
FT                   /protein_id="BAE65647.1"
FT                   /translation="MSISSNNTAVLNREQFVEALTKAVYSKQFKLSAKGSTTGHLGALK
FT                   APVTLDKDVELAGLDKLSGFSIDTASLILPAEEDGTNLRGTATLPNHSVVTFALVSQFI
FT                   D"
FT   exon            491308..491479
FT                   /number=1
FT   exon            491530..491675
FT                   /number=2
FT   CDS_pept        join(492284..492437,492487..492638)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000186"
FT                   /old_locus_tag="AO070251000027"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYM5"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYM5"
FT                   /protein_id="BAE65648.1"
FT                   /translation="MAQISDSINTIQRFTPEDVSKHNTPDNLWTIIGNEIYDLTDFQKE
FT                   HPGGAKILQAVAGKDGTKKFRKYHREALLVKYKTLLAGELVVQPKGRKWLFFKTSK"
FT   exon            492284..492437
FT                   /number=1
FT   exon            492487..492638
FT                   /number=2
FT   CDS_pept        complement(join(493054..493238,493288..493822,
FT                   493895..494021,494090..494232))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000187"
FT                   /old_locus_tag="AO070251000026"
FT                   /note="alcohol dehydrogenase, class V"
FT                   /db_xref="GOA:Q2TYM4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYM4"
FT                   /protein_id="BAE65649.1"
FT                   /translation="MDSIPSSQRAVVVQSPGNNYEMIILDDIPVRTPGADEILVKLSCT
FT                   GLCHSEIRAVLAWGAYNPIIGHEGVGTVIQTGPNVSPSLLHQRVGQKNTSRHVPGTLQQ
FT                   YVIADARFITRIPETVSDEVAAPLLCAGLTMAGAVGRLDDYRLSSGDWVVISGSGGGLG
FT                   HLGVQIAARIKGFRVIAVDSGEVKRKVSLESGAEVFIDYRTEDVAARVREVTGGEGAHA
FT                   TIVVPGTREAFAMAPQVVRNMGLIVGVGLPPNEMDWPISATVSAARGLCIVGSSVGTED
FT                   QMSELLEQAGRGEITPAIEVFEFEETPRLVDRLRNDAIAGRAVVRIPQ"
FT   exon            complement(493054..493238)
FT                   /number=1
FT   exon            complement(493288..493822)
FT                   /number=2
FT   exon            complement(493895..494021)
FT                   /number=3
FT   exon            complement(494090..494232)
FT                   /number=4
FT   CDS_pept        complement(join(496856..496881,496907..497753))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000189"
FT                   /old_locus_tag="AO070251000024"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYM3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYM3"
FT                   /protein_id="BAE65650.1"
FT                   /translation="MATSALSAETLFDSLGQQYEDAYMNNPTLKETVTDAISLLPPQSH
FT                   VLDVGCGTGKPVASNVALAGHNVHGIDISTAMIKIASSNIKGKFEKADMLTFQPTMKYD
FT                   AIFSIFSMFQLTHSQTYTKMLNYCDWLKQDGVLVLGTIPATSLVHDETLYDSTGKLVRH
FT                   ADLIFMNHRFTGTLYTTAGWHDLVQKCGFEIVSEKFASFSSPPPYEKEIQDHYFIIAKK
FT                   VVQHALMAPYPLPTKYRGPHPLSEGAWAPFSERLVRDEFDAVLDILKGNRRVLDVGSGH
FT                   GIPSPDSTA"
FT   exon            complement(496856..496881)
FT                   /number=1
FT   exon            complement(496907..497753)
FT                   /number=2
FT   CDS_pept        join(500506..500746,500791..500894)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000191"
FT                   /old_locus_tag="AO070251000022"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYM2"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYM2"
FT                   /protein_id="BAE65651.1"
FT                   /translation="MRSTVQERDQIQVVINACQELTALLTEPYEWIANAAWGYVDSVAL
FT                   SLVLSLKVHRHVPKNGGTISLVDLAAKTGSSVVLITRQDNATMRGSASSKMNAPTMLPS
FT                   QRAVTVPSAR"
FT   exon            500506..500746
FT                   /number=1
FT   exon            500791..500894
FT                   /number=2
FT   CDS_pept        501207..501632
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000192"
FT                   /old_locus_tag="AO070251000021"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYM1"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYM1"
FT                   /protein_id="BAE65652.1"
FT                   /translation="MAGHYNTPLDDPIESIYPFNVLRDNALVVDIGGGKGHHSIRLAEK
FT                   YEMMSFIVQDQTSVVETVQTENLPQSVAGRIEWQAHDLHSPQPVQGADVYILSHIMMDN
FT                   QPGCVKKIDPRYLGAIINACFLLAVPAQIYSDMPQTQ"
FT   exon            501207..501632
FT                   /number=1
FT   CDS_pept        complement(join(502145..502536,502575..502962))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000193"
FT                   /old_locus_tag="AO070251000020"
FT                   /note="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /db_xref="GOA:Q2TYM0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYM0"
FT                   /protein_id="BAE65653.1"
FT                   /translation="MQAANLLQKSLKKGEPSFGGGQMLPGTNLTRTICRSARNLEWLLI
FT                   DLEHGNISDDSMHEIVAATAACGVSPIVRVAEGQPWMIKRALDSGAHGILVPVTDTAED
FT                   ARNVVRYSKFPLLEIGVLRVFSRWRKITGMEYLQQANDSLVIAVQIETKAALENVREIA
FT                   AVPSVDVLFIGPFDLSVNIGHPITNPEKMDPELVKAIQSIHDAARAAGKASGIYCDTGE
FT                   QAREYSNKGFQMMSVMTDMVGMRKVFKQAFDAAKGDL"
FT   exon            complement(502145..502536)
FT                   /number=1
FT   exon            complement(502575..502962)
FT                   /number=2
FT   CDS_pept        complement(join(504277..504613,504729..504907))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000194"
FT                   /old_locus_tag="AO070251000019"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYL9"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYL9"
FT                   /protein_id="BAE65654.1"
FT                   /translation="MAEYLHTGDLGRFEGVLAALWTASFTIMGPEFINLIAAEAKRPRV
FT                   HIKNAFKVIYWLPSVCGTSASHQRPPHHHDLLGWKYIHVLCEPKSIWPVLGQPCTKNGV
FT                   PIYCVIVVMCFPLLSLLSLGNGSSQALTWLSNRITAGAIIDYIVVCVTYIFFYRACQAQ
FT                   SVDRKTFT"
FT   exon            complement(504277..504613)
FT                   /number=1
FT   exon            complement(504729..504907)
FT                   /number=2
FT   CDS_pept        complement(505144..505632)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000195"
FT                   /old_locus_tag="AO070251000018"
FT                   /note="amino acid transporters"
FT                   /db_xref="GOA:Q2TYL8"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYL8"
FT                   /protein_id="BAE65655.1"
FT                   /translation="MSDGIEDVSHGTDDYDAQDIEKPGEVVAGTGQLQRRPENRQIQIM
FT                   GVGGAIGTALFISIGGALPKGGPLSLLLGYAIYCLRLACVNNCLAEMTVLYPVPGGFIR
FT                   LAGKWVDDAFGFMAGWNFFLFEALSIPFEITAINMVLSFWRDDIPTGAVCGACIAAYA"
FT   exon            complement(505144..505632)
FT                   /number=1
FT   CDS_pept        join(506445..506812,506868..507183,507252..507596)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000196"
FT                   /old_locus_tag="AO070251000017"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYL7"
FT                   /protein_id="BAE65656.1"
FT                   /translation="MSTTTVRPPTISHTVVGPVRLTGARPTNELPQWLIDEAKIEEKQS
FT                   FDPKMHMNYHPPSKIYTMKEIGLEGQGISPNAVTAPFQLFNEEAIKQMRAEIFSRPVLD
FT                   ECQYTSSFVKNTIRGMGPARAPFIYDVWRSPEVLAKISEVAGIDLIPAMNYEIAAINIS
FT                   VNDQTTTVLNNTKSEDEDLSAFAWHWDSYPFVCVTMLSDYTGMVGGETALKTASDEIMK
FT                   VRGPAMGTAVVMQGRYIEHQALKAFGGKERISMITSFRAKSPLVKDDCVLTGVRSISNV
FT                   LELYREWSEYRLKVLEERIRAELENERQKQLGQRPFSISDMKTFLIHQREYLDATIAEL
FT                   ME"
FT   exon            506445..506812
FT                   /number=1
FT   exon            506868..507183
FT                   /number=2
FT   exon            507252..507596
FT                   /number=3
FT   CDS_pept        join(509756..509887,509950..510130,510186..510712)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000197"
FT                   /old_locus_tag="AO070251000016"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYL6"
FT                   /protein_id="BAE65657.1"
FT                   /translation="MTRSILHTLADHAQEVEKIIHVRFSNFVDTMPKGTRHVTLLYHQC
FT                   VIVATRPLLLSPLIERLENLDHEREYWQSFLALTKTLISIGIKSAVKMLQILSKEDYLL
FT                   EIFLLYGLEFTYAAALHLVMTNALFPQALDGQAYLEEAHWILDEMISNGNKVAEVRKAE
FT                   LVHLQMLFEELTARVKSQGLQPLTLTSPTGAEAVPQTQIVEEDGEGETVTDIGVWDLPI
FT                   PGDSLTSHPADMQMSSVELLNNIGISSSDFLYIVDQIGNPDVSYSISDLGRAGGEME"
FT   exon            509756..509887
FT                   /number=1
FT   exon            509950..510130
FT                   /number=2
FT   exon            510186..510712
FT                   /number=3
FT   CDS_pept        complement(join(511086..511414,511496..511796))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000198"
FT                   /old_locus_tag="AO070251000015"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYL5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYL5"
FT                   /protein_id="BAE65658.1"
FT                   /translation="MAIFLYLWCTTIALLLLFGIHLLRRLGILITARPLPPSRGLTASH
FT                   KANTKAGKAARTMTPVEGECYYMVNTIKEYSNKKTIIIAVLKEEQSFTYLKRKYRPKKV
FT                   IPSIDKDVQSAMREACELAGRRKNIKVIMSSYLPYMAYFQPSTIPSTAIVMMPKSYRGE
FT                   KASSQREAVARARFHSPKKVEPEVSSKGKPGIAYDTFIEVFECCYL"
FT   exon            complement(511086..511414)
FT                   /number=1
FT   exon            complement(511496..511796)
FT                   /number=2
FT   CDS_pept        complement(join(512383..512833,513913..513980))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000199"
FT                   /old_locus_tag="AO070251000014"
FT                   /note="NADH-ubiquinone oxidoreductase, NUFS7/PSST/20 kDa
FT                   subunit"
FT                   /db_xref="GOA:Q2TYL4"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYL4"
FT                   /protein_id="BAE65659.1"
FT                   /translation="MFTAHIPSCKASFTELASEIFSRTTIDQLVNWARQSSLWPLSFGL
FT                   ACCAVEMMQVSMPRYDQDRLGIIFRASPRQSDVMVVAGTVTNKMGPALRQCYDQMPDPK
FT                   WVISMGSCANGGGYYHYSYSVVRGVDRIVPVDVYIPGCPPTPEAFLCGIFQLQKKMRHT
FT                   KVTRMWYRR"
FT   exon            complement(512383..512833)
FT                   /number=1
FT   exon            complement(513913..513980)
FT                   /number=2
FT   CDS_pept        join(514409..514685,514707..515106,515160..515446,
FT                   515507..515814)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000200"
FT                   /old_locus_tag="AO070251000013"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYL3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYL3"
FT                   /protein_id="BAE65660.1"
FT                   /translation="MDSSTEQWMGLFHLFIDTAALDNPDQDKSLMYGLADTQELSNTVS
FT                   RILGLMKDMFESRFSNKGHHTMEGAESFFSPTNITLFVSAFFEHSYKASFNAHTISTQL
FT                   LLAITLMGATCVSPQDASSAEGYSDVAEYLIFDGPEFGKVFNIDNPSLARENMEILQAA
FT                   MVISVIQWSKGDVTIKRRIRTQRFPALVCAARALRLTQVTNQAVSDTESLDLDRYFYRE
FT                   SLVRAMAWLYLMDSHLTVYYRNPPQFKIAEACFGLPQHEELYDTMEPSALVNASQNATN
FT                   AGLTLTLKSVIQRLMEKDSERFEELITQPFTLFGLFLVIASLHCILFDFQALDTCVALS
FT                   GPFGSLDTALDRWKKMWDLTYTTIMPSDIRKSGYMVHALELWWLAKKLTQKPTGIYLES
FT                   GFALDSTATFHEMVRELKGFQPVQ"
FT   exon            514409..514685
FT                   /number=1
FT   exon            514707..515106
FT                   /number=2
FT   exon            515160..515446
FT                   /number=3
FT   exon            515507..515814
FT                   /number=4
FT   CDS_pept        join(515931..516020,516042..516986)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000201"
FT                   /old_locus_tag="AO070251000012"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYL2"
FT                   /protein_id="BAE65661.1"
FT                   /translation="MVYPSRVNVGVRRFFEPIVYLKPPRHWGLCLSTLLTESVIQTFPK
FT                   RTLRLNLGSSSPFSQIFLKQRSSTMSSPQNGIDYSTDSSVTTEFRRQDNTHQHALEAYK
FT                   LRDLTSCLERLTRAQLIEVLQAAGNDYVEVRKLVQSKVSEQMDDKTRIYRCEMSDVMSF
FT                   RGCREAARKAMEEAESRVRFLRLWNSLPDSGNDDFTNMVQLIADHCGAFAHPQTRLNGL
FT                   TVLCEMCYIFMDVARDDFWEQDQSKYGWDVSIENAMLEIATAMTPAERQAVVDDDDLWS
FT                   ALVYVYQESDEKIFRAFKDVIDEFPKVDTGAEDDGGENDELRSLFEESDQDGEQNEVDM
FT                   SEAE"
FT   exon            515931..516020
FT                   /number=1
FT   exon            516042..516986
FT                   /number=2
FT   CDS_pept        join(517829..518708,518771..518809,518984..519101,
FT                   519197..519238,519281..520247)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000202"
FT                   /old_locus_tag="AO070251000011"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYL1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYL1"
FT                   /protein_id="BAE65662.1"
FT                   /translation="MSSPRPTKRARANLTGDAHVTHLTEASTAQPGNGTINSEEVLRLV
FT                   DQLSHDKLCDIVIKAAEAHSDVATHIHNTIEEMREKERNRVINFDSLSKSVWYSINVAH
FT                   RKLKGSRQYDVAGDVWYEVVDTIKSIAQQCGPLTSLQTRLNGLSVLRKIGKTICLSDND
FT                   VVGHEVQKQFQSDHCLEEAMIEILSTMSEDERRTIREEESSEEGLWLKLLELDDLAYDL
FT                   CLFERLNEVLDLINPPRECDDAFDGEDSEDEEGSEYFGEEGEDEEEENSDEYDVQDYDN
FT                   PVHQPWITDSSNANLRINEFNFIIARKYVVKLPLIKGGYPTQPHEAVMVLHLKGFPRIS
FT                   SLSVPDIDATANDRDIAELQSQFGVGIICALPLEATAVSALFDTEWDSHLYGKAVGDTN
FT                   AYSTGSIGRHNVVLVHMAGMGKIAAATAAANLRASFEGVQLAIVMGVCGAIPLRKQPDA
FT                   EIHLGDVIISEGLVQYDFGRRYPSNQFARKDTPRDNLPRPSPEIRAVLAKLQVEQGRRA
FT                   LHERTIGHLLDLREKLYDVATYPGATEDKLFEPTYRHKHHVDWTCAACLKNDDVCDSAI
FT                   KLTCDHLQCHEGNLVPRQRLSEPFNPVIHFGLVASGDTVMKSGVDRDSIAARDQVTAFE
FT                   MEGAGVWELFRGVLVIKAACDYADSHKSKNWQGYAAATAAAATKDS"
FT   exon            517829..518708
FT                   /number=1
FT   exon            518771..518809
FT                   /number=2
FT   exon            518984..519101
FT                   /number=3
FT   exon            519197..519238
FT                   /number=4
FT   exon            519281..520247
FT                   /number=5
FT   CDS_pept        join(521932..522759,524147..524233)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000203"
FT                   /old_locus_tag="AO070251000010"
FT                   /note="ankyrin repeat"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYL0"
FT                   /protein_id="BAE65663.1"
FT                   /translation="MVASYFGLDSVVKELLDDYKGDLDFVDSKHERSALSWAAERGSVG
FT                   VVKLLLKGRRRSFIGIHVPSGKGAEINSIDIYMRTPLTYAAWNGHLEVVSLLLRKGAAI
FT                   NTIDEFGATPLLYATYNANKPVVDLLLAQGAKTRSGENIIMAFCSAAGKGQEPVMRLLL
FT                   ENGTDPDARRSDGCNLISWAASHGYKAALTLLIESGGDINRGNYENGQTAIHHAVKYGQ
FT                   KGAVRLLVEYGADLKLGDKNGQTPLHFASSIGDRDIVQILLSKDSRPQLELRDKVHNIY
FT                   KAAQDGEPHNCQYHTLNIAVHDV"
FT   exon            521932..522759
FT                   /number=1
FT   exon            524147..524233
FT                   /number=2
FT   CDS_pept        524668..525411
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000204"
FT                   /old_locus_tag="AO070251000009"
FT                   /note="hydroxyindole-O-methyltransferase and related
FT                   SAM-dependent methyltransferases"
FT                   /db_xref="GOA:Q2TYK9"
FT                   /db_xref="InterPro:IPR008576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYK9"
FT                   /protein_id="BAE65664.1"
FT                   /translation="MSTDPVKLLQSNNDGLPATRPDSQIDQAVAVKYWSDKPATVNGML
FT                   GGYAQVSRTDLRGSRNFLAKARRLVPGCPVTGKLKRGVDCGAGIGRVINDFLGQECEIV
FT                   DAVEPVEKFSRVLSERRLTRNCALGEVLTIGIEDWVPGVKVYDLIWAQWSVPYLTDAQL
FT                   VEYLVRCRGALTDVGLMVIKENISEEPEGDIYDESESSVTRTDEKLRRLFKEAGMQLIL
FT                   SEVQSGFPRQLRLLPVISYALRPRI"
FT   exon            524668..525411
FT                   /number=1
FT   CDS_pept        complement(join(525812..526133,526192..526214))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000205"
FT                   /old_locus_tag="AO070251000008"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYK8"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYK8"
FT                   /protein_id="BAE65665.1"
FT                   /translation="MGSVKVTDLDTYHNVVSGANYAVFNFRDSRRRSSDTDLAYDDLAS
FT                   YAYSDTVAFYEVDVGDQKHISDFAKVERPTLILYKDGKEVERYSKPLPRQLEYLVSRAL
FT                   CGLTEIGGRF"
FT   exon            complement(525812..526133)
FT                   /number=1
FT   exon            complement(526192..526214)
FT                   /number=2
FT   CDS_pept        complement(join(528517..528764,528818..529201,
FT                   529271..529520))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000206"
FT                   /old_locus_tag="AO070251000007"
FT                   /note="reductases with broad range of substrate
FT                   specificities"
FT                   /db_xref="GOA:Q2TYK7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYK7"
FT                   /protein_id="BAE65666.1"
FT                   /translation="MPEGPVVNGLFRHNNTTPPAQESVMALFSLKGKTAVVTGAASGIG
FT                   LSVAHALAEAGANVAIWYNRNSKAVEEAANIESKYGVKCRAYQINIRESEKVEELLNTC
FT                   VRELNGRLDIFIANSGIPWTQGPMIDAPLDHYRDVTQTDLDGTFYCARAAGAHWRRQKT
FT                   EGTDIFGNPLQGFTYGSFVATASMSGHIVNIPQLQAAYNAAKAGVIHLCKSLAVEWVQF
FT                   ARANTVSPGYIITDISTFVPDETKDIWKGKIPMGREALPHELKGAYLYLASDASSYTTG
FT                   ADLVVDGGYTLP"
FT   exon            complement(528517..528764)
FT                   /number=1
FT   exon            complement(528818..529201)
FT                   /number=2
FT   exon            complement(529271..529520)
FT                   /number=3
FT   CDS_pept        complement(join(529675..529757,529906..529981,
FT                   530195..530395))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000207"
FT                   /old_locus_tag="AO070251000006"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYK6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYK6"
FT                   /protein_id="BAE65667.1"
FT                   /translation="MIGIYVYNSCYFKDYVEATNIGGYLDRKTYGIWRSTSKTVVWVRP
FT                   TVRFPVSILPPAEEIGNVFHGLHTETSFRRKCTTFGTGPYGGVESTILVDNMFMEHFRR
FT                   NLSSSAISTTTSMNV"
FT   exon            complement(529675..529757)
FT                   /number=1
FT   exon            complement(529906..529981)
FT                   /number=2
FT   exon            complement(530195..530395)
FT                   /number=3
FT   CDS_pept        join(531539..531558,531661..531682,531726..531868,
FT                   531922..532244,532337..532428)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000208"
FT                   /old_locus_tag="AO070251000005"
FT                   /note="serine/threonine protein kinase"
FT                   /db_xref="GOA:Q2TYK5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYK5"
FT                   /protein_id="BAE65668.1"
FT                   /translation="MSQKRYKRAPLAPHILEERFEDLRKGQYYPVNIGDIFRSKYQVVG
FT                   KLGFGISSTVWLARDLEGHQYVTLKLYTRSESDLAEFQIYNLLNKGSSSHPGYAHVRRA
FT                   LDVFTIPRPGGDHCCLVQKPMWESFRGLLYRNPTHRFTEELLKAGLMQVFLALDYLHNE
FT                   CKLVHTDIKGDNILQEIEDESILEKFTEAEMEDPSP"
FT   exon            531539..531558
FT                   /number=1
FT   exon            531661..531682
FT                   /number=2
FT   exon            531726..531868
FT                   /number=3
FT   exon            531922..532244
FT                   /number=4
FT   exon            532337..532428
FT                   /number=5
FT   CDS_pept        join(532585..532638,532703..533116)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000209"
FT                   /old_locus_tag="AO070251000004"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYK4"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYK4"
FT                   /protein_id="BAE65669.1"
FT                   /translation="MFKTEWSYPVDIWNVGTMIWDLFEGKHMFYGNDPDGKGYSTRAHL
FT                   AEVIGLLGPPPLDMLKRGIRINEFFTEDGIYYVVLGSTKRQQAAYQYSIGQWKQDIEIP
FT                   DQSLEMSEKFLNGRNKEMFLTFMRVTSQWKPEDGKTARELLEDPWLNDRLD"
FT   exon            532585..532638
FT                   /number=1
FT   exon            532703..533116
FT                   /number=2
FT   CDS_pept        join(535145..535384,535535..535592,535646..535782,
FT                   535837..536045,536094..536862)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000211"
FT                   /old_locus_tag="AO070251000002"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYK3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYK3"
FT                   /protein_id="BAE65670.1"
FT                   /translation="MGETFLDATPSPSSASTHNHCTKDDAVLIHLILFLRMEIPVSSER
FT                   LINRLNRCKNHVVRHGPIPIKCKKWLARVHSGSGSRWVLITGITIVPLHPSGRDGYLKR
FT                   WATLQISNRFTLALLRYVSRFLQLGTPKNFQMEDLLMIVNVILYVLLTVYLIEVEKYGT
FT                   NGIPLDKVDQIKPSAIPDLIKGSKLVIVVEQLWLGVIWGCKACLLLLYSTMTSGLSQHR
FT                   IVKLIGAFCALSFVLVEILFFAAWCHPFSAYWSVPPKNIQCSVYRNHLILVLALNIATD
FT                   LMIMCIPLPLLIKAKLSLTKKITLCAVFSLGIFVILCSILSKYYSISNPYGDRWVDWYV
FT                   REAATAIVVANIPQTWTLFRRMFNWKSFLAHSSYNRSHSRSKYTNRLDSSTIHLSRFKG
FT                   GDKSHTRSVDITASGEHINPDQPLEIWEHRQFQVTNEPGGSSDSGSQSSVSLEYDTTGL
FT                   NPQGKTTVTTRS"
FT   exon            535145..535384
FT                   /number=1
FT   exon            535535..535592
FT                   /number=2
FT   exon            535646..535782
FT                   /number=3
FT   exon            535837..536045
FT                   /number=4
FT   exon            536094..536862
FT                   /number=5
FT   CDS_pept        join(538266..538338,538388..539238)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000212"
FT                   /old_locus_tag="AO070251000001"
FT                   /note="dehydrogenases with different specificities (related
FT                   to short-chain alcohol dehydrogenases)"
FT                   /db_xref="GOA:Q2TYK2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYK2"
FT                   /protein_id="BAE65671.1"
FT                   /translation="MPGLAFNPDNDIPDLSGKVIFITGGTAGLGAQSVAQMAKHSPARI
FT                   YISGRNATSAEKIIKEIAETGSNTPVSFVECDLTSLDSVKRAADEIIAKESRLDVLMCN
FT                   AGIMALPPGLTKDGYEVQFGTNHLGHALLIQKLLPLLQRTAERGADVRVIILTSKGYQL
FT                   HPYGGIIFDDLKTTQDYGFLGSWRRYGQSKLANILYTRELARRYPAITVVSVHPGVITT
FT                   GLVENLGWAHRWFIYATTYNQMVTLEEGAYNQLWAATTSKDGLETGQYYIPVGVASNDK
FT                   LTKTGRDDVLAGQLWEWTDKALEDYL"
FT   exon            538266..538338
FT                   /number=1
FT   exon            538388..539238
FT                   /number=2
FT   CDS_pept        550240..551301
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000213"
FT                   /old_locus_tag="AO070238000015"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYK1"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYK1"
FT                   /protein_id="BAE65672.1"
FT                   /translation="MQIISLSKLAILGLAGLAIAHPGAHEPSSMSHSAKRSFLNNAKRS
FT                   LSQCSSHLERRGINDRIQARRAAAYEMYRKRSIDARDYNPSVNTSHHSTLDVTSQTTEE
FT                   ELFAKNPVCILSPEGEIGPFWVKGELVRSDVRDGEAGIPIIMDGQFIDIETCEPIKDLY
FT                   WDVWNCNSTGVYSGVQDSSNGNGDDDSNLDKTFLRGIQKTDAEGVAQFKSMFPGHYGGR
FT                   TTHVHVVAHVGATQLQNNTITGGHVAHIGQLFFDQDLIYKVEATYPYNTNKVSITTNAD
FT                   DHVVQDETEDSASDPFFEYAFLGDALEDGIYAWITLGVNVSASYDTSYASLLTSSGGVS
FT                   NSNSGGPGSTVNL"
FT   exon            550240..551301
FT                   /number=1
FT   CDS_pept        join(553202..553544,553607..554821,554890..555104)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000214"
FT                   /old_locus_tag="AO070238000014"
FT                   /note="choline dehydrogenase and related flavoproteins"
FT                   /db_xref="GOA:Q2TYK0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYK0"
FT                   /protein_id="BAE65673.1"
FT                   /translation="MLFPSFVLATLSLGAAVRSHAGSPSHYDFVIVGGGTSGLVVANRL
FT                   SEMNNVTVAVIEAGESALNNFNVSNVMGYSTAFGTQVDWAYKTENQTYAGGLQQTIRAG
FT                   KALGGTSTINGMSYTRAEDVQIDNWEVVGNKGWNWKNLFQYYKKSEGFQVPTKDQIAHG
FT                   ASYNASYHGRNGPLKVGWPTSMTNSSVFPVLQQTFEKLGVQYNPDSEGGKMVGFTVHPD
FT                   TLDREMNVREDAARAYYWPYEARSNLKIISNTRADKVIWANATQGEAVAVGVEVTNAYG
FT                   TETIYADKEIILSAGALRSPALLELSGVGNPAVLNKYNIPVKVNITTVGENLQDQTNNA
FT                   LTWEGVETLTGLATFSVLPSVNQLYGDNVTALASYVKFQLVTYAKVVASASNSAVKEAN
FT                   LVEAFERQYDLIFNSQVPYAEVVFAPSGQSFSVEYWPLLPFSRGSVHIQSANASDLPAI
FT                   NPNYFMFGQDAEAQITVAQYIRKALGTAPLSGLVGDEVSPGLDVLPASASSSTWTKWVE
FT                   ANYRTNYHPVGTNSMLPREKGGVVSPELKVYGTKNLRVVDASILPFQLCGHLTSTLYAV
FT                   AERASDLIKENYRA"
FT   exon            553202..553544
FT                   /number=1
FT   exon            553607..554821
FT                   /number=2
FT   exon            554890..555104
FT                   /number=3
FT   CDS_pept        join(556904..557047,557112..557433,557519..557553)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000215"
FT                   /old_locus_tag="AO070238000013"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYJ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYJ9"
FT                   /protein_id="BAE65674.1"
FT                   /translation="MNLFDPRWKLPLHCFQLFLMVIVIGLSAPRLFMKNQPRTRASTIG
FT                   LGMAAKSLVIILYQLLTEHVTVLRKWASLKAYTILNALEIVFWAAVAVLTIQANVQMCV
FT                   APGCILGWGVAITGINLRYGINLRLGEWCGYCMANAFENSALAIYSTIICYLCDSRVSL
FT                   GCL"
FT   exon            556904..557047
FT                   /number=1
FT   exon            557112..557433
FT                   /number=2
FT   exon            557519..557553
FT                   /number=3
FT   CDS_pept        complement(join(557775..557779,558451..558606,
FT                   558682..558866,558933..559216,559359..559559))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000216"
FT                   /old_locus_tag="AO070238000012"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYJ8"
FT                   /protein_id="BAE65675.1"
FT                   /translation="MLTVCILLQALLCKSVIAWTNGASATGPTDPSVVDHCEYWVNNIG
FT                   LSDSCELIEDYFGITRRQFRLWNPSLSPSCVMTRGWSYCVAAPSSATTSTTSTTSITAT
FT                   RPSDPPGTITYSGTAAPTQSGVSSSCAKYHLVHPGDTCYTIQDEYGDFTLEQFYSWNPS
FT                   IGKGCIGIQPGYYVCVGTESKSTSISMTPTTGSSTAIPSKTSEGSSASDPQPHQTGIPA
FT                   NCNKWHYVVDGDECETIATKYGITLQQFYTWNPAIGSTCRFLWKDNYVCVGITG"
FT   exon            complement(557775..557779)
FT                   /number=1
FT   exon            complement(558451..558606)
FT                   /number=2
FT   exon            complement(558682..558866)
FT                   /number=3
FT   exon            complement(558933..559216)
FT                   /number=4
FT   exon            complement(559359..559559)
FT                   /number=5
FT   CDS_pept        complement(join(560187..560301,560485..561248))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000217"
FT                   /old_locus_tag="AO070238000011"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYJ7"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYJ7"
FT                   /protein_id="BAE65676.1"
FT                   /translation="MYFTGLPTETLCLIASYLPCQQDVYALARTNRRIYHALHDFLYEY
FT                   NSRYYHGSALAFVAKHGNIGRIAQLLRGLKTAQTRSRTPPGPRWRSEVPSEQRWEEDSD
FT                   EVEWDSDDEDMYSLTRDISSHPLKSARYSVADIVQIQKALLAAIEINNEEIVTLLIEWG
FT                   AQANFYRGNLRDDNPGRIRRRHSRAKDPPPLYLAVRCGHAGLVKYLLEKGADPDRYRPS
FT                   PLYRAVEDGQYNIIAMLLNHGAPLSYARVLKLAEDGDGMDGTIAYDHESSYCTIEEEAS
FT                   EGRGEEYGSGS"
FT   exon            complement(560187..560301)
FT                   /number=1
FT   exon            complement(560485..561248)
FT                   /number=2
FT   CDS_pept        join(564784..564852,564876..565167,565247..565351,
FT                   565406..565922,565984..567949)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000218"
FT                   /old_locus_tag="AO070238000010"
FT                   /note="chitinase"
FT                   /db_xref="GOA:Q2TYJ6"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYJ6"
FT                   /protein_id="BAE65677.1"
FT                   /translation="MDCRSFLPYCCIWTSTVLIESNQHLYYSFAGISIIDFSITTTNPR
FT                   DEDFWARFTSLKKKKPSLKTYISVGGWDVGGTPFSIMVRFPGTRKHFIKSALNMMRKYG
FT                   FDGIDIDWEYPAAEDRGGAHSDTANLVNFLKELRAALGSEYGLTVTLPTSYWYLKGFDI
FT                   ANMVQYVDFFNFMAYDIHGTWDGRTSKWTKSVVNPHTNLTGTYDALVFNHYWHDYSKSQ
FT                   TNRSILEIAAGLDLLWRNKIDPSKVVLGLGFYGRSFQLANPSCSTPGCAFYTGHGSSGG
FT                   ALAGECSGTSGILSNYEISRIIKSYDPTIEYDEAAAVNWMTWSSDQWVSFDNGRTLKQK
FT                   AKFANNKCLGGLLSWAVDLGGPGSLKNPNLFTDSDLSMDGADPGGGSDGTGNLYVGAEV
FT                   LNPDSNSVTAIAPVNIVFPISTLPSPTTIAPSGYPTSLEVAWPTTKTVTSGNIITVTST
FT                   ITRYIQTTTIAVPSLTVREHGFYNWNITDKDTTHLVRALIPSIRLPPIVITDDPNPLKE
FT                   TSVSHTPAVTRTIHLPPWPWTTDGAKYPRITFTQGGPPGPTCTAGCGTLCTQFCDGPCL
FT                   NNCGDAFSRDFISPLDDDPPTVAPCAGKDCKNGKCQGEICIEKGCTGADCQNRVCVGDD
FT                   CKPTGCTGPDCDKGHCSGKNCQDHGCVGKDCDKQSGGCFGPLCLSWGCLGPQCSSTDFV
FT                   CTGLHCRVVSCSGPSCKNGNCTGPGCMTEDGDCEAKEAESCTEWISSTMMTPASTYSTQ
FT                   TVTTACKTISACNAKGTTVTKTIDEDGLVEGTVTYIENDVPTDAADDAIASSLASYYSS
FT                   YWSTVDATSTSSTVSSTTTTTSSSGGGQTHDPIPNSLIILKEHVEDEHFDSSVSHYYKW
FT                   YSVYYSYRHQVTEKGICALSGKVDGPVKSDEGEEYPTSLGPFALGQYTGCLYSGSKHRP
FT                   GSVKCDNSELAFTCLGYKYNAHAADWNCGKTYTKDGTTHYSNYYKAVECLIF"
FT   exon            564784..564852
FT                   /number=1
FT   exon            564876..565167
FT                   /number=2
FT   exon            565247..565351
FT                   /number=3
FT   exon            565406..565922
FT                   /number=4
FT   exon            565984..567949
FT                   /number=5
FT   CDS_pept        complement(568553..570142)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000219"
FT                   /old_locus_tag="AO070238000009"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYJ5"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYJ5"
FT                   /protein_id="BAE65678.1"
FT                   /translation="MSYVEFRRVQPWGYDVAIIDTDGSELHEDEFGSLLAKIIESNDVP
FT                   MLNQYKEKHPRGITCSSEAREMDPFFVACRHGSTDVLRVLLEHYHANLGQTASLEEREI
FT                   VLLNVTSEYGQLETALFLLDSQPPLVSVGANMPGYETALLSAAQSIWNLSDELQYHENE
FT                   ALDWVDKRLTRSEQLIDILLDRGASVHDVTMCPDEDIAEVKQQPLHTVLGLAVSRAGYK
FT                   LLKRLIDEGANVHTRQECLGIGGPTFKEKHASFRDTTALHYGSMFWNVEGVQALFDLRG
FT                   TDVDIADMVSVRDSLGRLPLHWAAAGAGDSDKAIIPDGAIVQRVLDTFELLLVGNPTAI
FT                   NVQDNQGKTPLHYAVATHASGDRNHLYSIVKFLCESGANASLQDCKGQTVLHILAFWSV
FT                   YGEPMDLNVIDLLIAHGANINHADRNGITALHIMTRNLRQVKAAQFLIHRGADVNAKTL
FT                   KGDTPLCEAAGRGALLKRGVWTQGNEYVTLDDRIKAQDTMMGVLQDAGGSLDQPNAAGK
FT                   TPRQLLEQKRAS"
FT   exon            complement(568553..570142)
FT                   /number=1
FT   CDS_pept        complement(join(570383..571271,573023..573141))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000220"
FT                   /old_locus_tag="AO070238000008"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYJ4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYJ4"
FT                   /protein_id="BAE65679.1"
FT                   /translation="MHNLSTQRYWIPILAQAIIASRMVAGMRALWKNPFLFQISWEMFQ
FT                   IEYPAILGYTFGGTVVSMGPNVDSVKVGDRVAVACWGRAAVDRRFGAYQKYPLALEENL
FT                   VKLDSQTSLEGGSGVMANLATVVAALSVCMKLDYPPINERAPKNGKKILIYGGSSSVGG
FT                   LAVQYATDAGYEVVTTSSPANWDLVQRRGPSSIVDHTLPREQLLESIKASGPYDGIFDA
FT                   IGSAEVTELMGKLLAEDGGLFWSTSPTPADSRLPKNVKKEWGGYSDILVSRDENKDAKV
FT                   WYLQEYLPKGLSNGRIFSNPSYIFPGGLESVQDALDTFMAGKVSGKKVFVNPQH"
FT   exon            complement(570383..571271)
FT                   /number=1
FT   exon            complement(573023..573141)
FT                   /number=2
FT   CDS_pept        573494..574345
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000221"
FT                   /old_locus_tag="AO070238000007"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYJ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYJ3"
FT                   /protein_id="BAE65680.1"
FT                   /translation="MDRYHRIPLFGAHMDPPGEEYWPSQTFSDLLEGYTKRAFSHESDI
FT                   LRAISGILNSFYESHHYFGLPFSVFDNAILWNAADTTYSTRNPTSGDVFPSWSWVSVKG
FT                   GITTYNLPLQTLAVWAVASTDSDFLPQPLKVIAPWERPLANERQYYKLMPNHSALLILA
FT                   WKEGCFSGKLPEELKPAANWSKIERLAQKRWGANGQHRMIQDALGLGQNLDYNDKFSPE
FT                   HISLSCSSPGGIMMYTQSVRVRVVPPQNLSGRFDEHIKLYAEAGEVVACVSDGSVSFQV
FT                   QW"
FT   exon            573494..574345
FT                   /number=1
FT   CDS_pept        complement(join(575098..575430,575485..575960,
FT                   576008..576233))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000222"
FT                   /old_locus_tag="AO070238000006"
FT                   /note="isopenicillin N synthase and related dioxygenases"
FT                   /db_xref="GOA:Q2TYJ2"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYJ2"
FT                   /protein_id="BAE65681.1"
FT                   /translation="MPATRGLPILDFSAFYGENPKAKAQLVEQVRESCLHNGFFQITGH
FT                   RIPLELQHRAMNCSKRFFRLPLEEKLKIDKKKNTFNRGYELLQSQMNEAGASPDLKEGL
FT                   YIGREIPTDHPYFLEGLLNSGPNQWPDTIPDREEFQKSTMEYYHAVFDLAKDIMAVLAL
FT                   TLNHDEAYFDPLTDGAVATLRYLHYPPPPKQMGERLRGIGAHTDFSCITLLLQDEVSGL
FT                   QVLDVPTNEWIDVQPIPGAYVVNLGNLFSRMTNDTYKSNLHRVINDSGNDRYSIPFFLT
FT                   GNPKYVCKCLPGFQKDGEPGKYLPATVQEVVSSSYKETFARAERYKAEIQTKIQNNVTK
FT                   EVAA"
FT   exon            complement(575098..575430)
FT                   /number=1
FT   exon            complement(575485..575960)
FT                   /number=2
FT   exon            complement(576008..576233)
FT                   /number=3
FT   CDS_pept        join(576787..576923,576978..577332,577427..580897)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000223"
FT                   /old_locus_tag="AO070238000005"
FT                   /note="non-ribosomal peptide synthetase modules and related
FT                   proteins"
FT                   /db_xref="GOA:Q2TYJ1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYJ1"
FT                   /protein_id="BAE65682.1"
FT                   /translation="MGRAGNLAQPCFFPPLIAQFGRQSGGSEVVERRESVTVPLKELDI
FT                   QTAWAVVLRTYTAGDHIGFGLVDLENQKISASDWSDLREQIAVYESTINSLTVIRELLH
FT                   DGKQSSKSEGSESSDTANNTLHTSSWPFNSIVCIDRNDARKGNQFVRMSLSDMCREALN
FT                   EFQIIVRIHRDELTGLLTTIIDYTTTVLSYEQARAVAGTLNKTISEVVQHTNQTVATLD
FT                   ICTDFDIQQMIEWNTPPLSMPRLEQCAFQLISQRCVEQPDATAVSAWDGEMTYGELHRR
FT                   SAALAVQLAEVGVGSGVFVPLFFEKSKWAVVALLGVIKAGGAFILIDISYPLKRIRTIC
FT                   QSVSAEVAVASPQHQLLGREIVGLVVAIGDDCPETPSLPASPKLSLIHSGTPESPLYVV
FT                   FTSGSTGDPKGVIIDNVSFCSIYETVSRAFSFSPSTRLLQFASHAFTLCSREILLILMA
FT                   GGCLCIPSEVDRVNDLAGFLCRHRVNFATLTPSVAGTISPSSVPSLQTLLLGGEAVKPA
FT                   HIATWAGKVHLMIGYGASEIAGTAIVGSNLQLDNDPRNVGFACGAGLWVVDADSPDKLA
FT                   PVGAVGELILQSHGLASGYLNGNEQVNQPFFHEAKWQKRLPMEARIARLYRTGDMFRYN
FT                   MDGSLYYVERKDNQVKVNGQRIELGDIESHITASCTMVHSSVVLLLQPDQQATRSFLVA
FT                   FLCPKEPPRWGTTTNSPLAIVETPSSQFYLDIERLSRELQESLPSYMIPSIFVPLSSIP
FT                   LTLTGKANRRLLLETVARWPEDRFGTYRCGSQSSPTYKAPVNQRDDQIRRLVATALKKK
FT                   PEAISMGSSFLALGGDSISAMRLVTLAKQEGLYLTVGDIFNHPILSDLARVAREGAIEE
FT                   LQPRKVKFKGLNSYDGLLRRLAPDIADNIHEIIPTTAYQRMTLAELRPRYLRIALPSNV
FT                   DRDRLLSACQQLLERHAILRTIFEIDNETNASQGEVVQVILRPYKLKFVEYHGIDDLDQ
FT                   HCLNESLMSPSSTGGGLQFQAQLLTMRDSRLFLVLRFIHAQYDGISLPIMSQDISAAYN
FT                   RVSPDPTAPFSDHIHAVWANHNDEGLEAWRSILKGSEMTALKPKQMATTHVEKPVHEAR
FT                   PVKVIKRTRLISPPENITMASLVKAAWALAFAKFVSARDPITFCAEAVAKDIVFGQVVH
FT                   GRGLGITHENRILGPCVNTVPVRVGLSKYTNNHDLLHHVQQQHLATMPFENIGLDDIIR
FT                   NCTDWKPGTKFGSVLRFQNFDANLSCVFDGVAHDASVYHLPNRPSEKIHVIIMPSESDM
FT                   RIIMNGYDHVVGQKEAADLVDSFCAAIEDLAKTPTK"
FT   exon            576787..576923
FT                   /number=1
FT   exon            576978..577332
FT                   /number=2
FT   exon            577427..580897
FT                   /number=3
FT   CDS_pept        complement(join(581629..586873,586932..593329))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000224"
FT                   /old_locus_tag="AO080541000227"
FT                   /note="polyketide synthase modules and related proteins"
FT                   /db_xref="GOA:Q2TYJ0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYJ0"
FT                   /protein_id="BAE65683.1"
FT                   /translation="MAKAEPIAIVGRSCRFPGGSSTTAQLWKLLLEPQDLSSGPPSGRF
FT                   NADAFYHNDPRRPGTTNAVKSYFLEEPIDRFDAPFFNISRTEAESIDPQQRLLLETVYE
FT                   GLEAAGCRLEDLSGSSTGVFCGVMCDDYRSMVFRDLDTLPQYAATGTSQAIVANRISYF
FT                   FNLRGPSITVDTACSSSLVAVHLAARALADGDCHLAVAAGTNLILAPNVFLSESSLNML
FT                   SPTGHSRMWDANADGYARGEGVAAVVMKRLSDAIRDGDHIECVVRATNVNQDGRTPGIT
FT                   MPSPEAQKDLIMKTYSDAGLDPQNRPEDRCQYFEAHGTGTRAGDPQEARAIHGAFFGPS
FT                   ATASNDSSALLVGSVKTIIGHTEGAAGLAGLLKASLCIENATISPNMHFENLNPDIAPY
FT                   AGSLRVPTEVLPWPTLSPGTPRRASVNSFGFGGTNAHIILESYDVGSESHSLKGPPAIL
FT                   PFVFSASSEWALGQLLHRYCTFLDENPDTDLTNLAWSLFARRSLLSHRVWFCASSGSEL
FT                   RDAIKEEICSRQSGTLETILGAPPCGPKRILGIFTGQGAQWAKMGIELIRACPEAGNWM
FT                   AEMQKSLDELPDQYRDTGFSLMHELSLSPDTSRINQATVSQPLCTAIQIVLIKILSTLG
FT                   IKLSAVIGHSSGEIAAAHAAGFITASDAIRIAYFRGVFSRLARSRGGQAGAMAAAGLSH
FT                   EEAESLCRESKWAGRVTIAAYNSPNSVTLSGDADGIHELCSVMQDEGKFCRALKVDTAY
FT                   HSNHMLACSAKYKKALEDCRITPTQNSAAAKWFSSVLEGRIMSQDDRKLLSAEYWNENL
FT                   VSPVRFNQAVVAVTRDTSFDLAIEIGPHSALKGPFQQSLSGPEIPYTSMLKRGSNDMLS
FT                   VASMIGTCWAHLGPDSIHLAEHIKLCDSTREPQLLKHLPSYPFDHREEYWGVSRLTDVA
FT                   LNRKDAPDELLGILCPDSGEGEWRWRNHLRHEDIPWIHGHRVQSQIIFPISAYLAMLWK
FT                   GARIITNAQPFRFVEISDVELLHTVVLDGHMEQSIETLFKVDVLTEDKNVVYLDFACYI
FT                   EIEGSMRRCASGKSSLHKGEQSSMLLPTQPFDDCSLTLTDSAPFYSTLAKLGYEVSEEL
FT                   KVISKLHHHVPHTRGFLRNLEQTCPKTQVYYGAALDASIQTLLAAADAQSPRLLSVPFV
FT                   PSKIRRIVLNPMSLHSHLLKNAVVFDSILSNATSYKIEGDVDLFADGGQGIMQLEGVTL
FT                   VPSREPDAGSHTLFSEVAWGRLVPHVTADNADLPIGVEDTDLEALERISLCYLAHAARL
FT                   VPQHERIHTSGQTAALLDWIDNVLEQTSAGSHPTCRKEWMFDTIERVEALAPEGSSCRT
FT                   YGILHTAGRNLLNSVRQQGEVEASCDLLDQWQKNSVHLHKLRCRMRDVLEQICFRYPHL
FT                   NILEVGGAGYAEANDALVGMGLAFKSHVRTQPPSYCATAQSDVDNQHEQQIIHLDLSMN
FT                   PVNQGYTEHSYDVVLIPSVLYNHTAREQALLNLRRLLKPGGYLLAIQETNPSVLHTVVL
FT                   AASVGLKGEEIWTPDMWHSTLQDSGFSGVDTITPAVGASLQPYSLIVSQAVDDTVNTLR
FT                   DPLMSARTAADERDLYIIGGNTPETVNLLQGLEAILTPRFRSLVKVPELKAFRVVGQTQ
FT                   INVLYLDGIGTAYSEDLDEDRYNAIENMVNMSDNILWVKRGTRSSIWNQGNVTAVLRSL
FT                   SSQKQNLRLQCLVLSHGTQPTACSLATALLRVTDSSVSNDHQLPTHVWSNEPHLLLEDG
FT                   VVYIPRMRYSELMNQRATAYQQTTYQDVQLSKSGVRLVSSSGHHHLAIQPVVLEEPEKI
FT                   RIQVTLSSQSAIKIGDAYLYLVVGKVLNGQSSVISLSDECASVVSVPSCWVWPFERIAQ
FT                   DGPKALMAVILALTAVAAVTLAGPNTTLVVHEPCNPLRALLVACAHIQNVSLLFTTGSS
FT                   ESATSDRFIHPLSPNRVLVKLLPDNVSMILRCAEETGGIFSRSDLPLAPGVTVAGIEDL
FT                   FSSEPCIRGHKASSSTIANFLHIALGLTEGGDYARDPGCSVIDVQQLAGLKYDTGLPAV
FT                   VDWSKHSFVRTIVQKASSELLFSAELAYLVINMDGATAMLVAELLIHKGARKVVLIESS
FT                   SAVDRDWIHEMAQLGAQVNFMSMNITDQESVVAVKSTIIQDIGQIGGVISGVIRTFDPD
FT                   ITPDTASITVQSTSLPKIHGARILSDVFNGSEMNFFILSAPNMWPAGFPSQYETSLNGA
FT                   VLFDTAYERKRKGLVASIIHSKSLAKMGLSKEDIGEVFAEAIIGGRVSSQGALNVIPAA
FT                   AIDQGMKNSDVAFSQNPILWSMIGPEATPSTPVEGQSRGQDLTLKEELIRSGREIDNLQ
FT                   KIIQRRFTAKLQKTLRLRKEDPILANTALFELGVDSLVATSLRSWFVNEMGIDMPIMNL
FT                   LNNASIGSLVQYSAKEWLTQTAKQDEQGSSVSWAQGSSESSGSASPTTRSSGAASNLGD
FT                   MPLCKGEYARVEHLSYAQSRYWFLQQYYEDRAAFNVTLLFTMDGQPSEADLQSAIQIVS
FT                   QRHQSLRTCYLSEGAEMKSACQAILPISPVTLEVCDIEDESGLFDEYARICDHPYDTEK
FT                   GECIRFRLVKTPAADSTFLIIGYPHMCMDGASCFILLEELDQAYRKLSLPPVSRQYPDF
FT                   AAAQRISYEQGMLQRELDYWKKELNPLPEPVGLLPMTKVRSRPPLKEYDTHELQFCISN
FT                   TIMDRIRSQCRRHRVTPFHFSLAVLRILLARLTKTQDCCIGVADSNRLDPSNESTVGFL
FT                   LNLLPLRFRTLPDNFTDVLAGTRDACYGALTHSAMPFDKLLDELAVPRSNTHSPLFQVL
FT                   MDWQPRLGGEVKLGDITSSCTKMTVGRTIYDLTLLVTESARGDATIHFRTQKALYSKEG
FT                   SEVLARSYINLLEAFTGDLDLQVHAPCIWHPSDLERAVEVGQGPTYKSQWPSTVSRRIE
FT                   EVSVAQPSNTIAVMDTKGRSFTYRGMMDRVRTLAFALRDVGVGPGSFVCIFQHPTAEWV
FT                   CCMLAIWRLNAVYVPLDLRNPPSRLMTVIQDCQPTAIFCNDETDPNVRDLGCPGIALLN
FT                   TSEICAYGGLPLTVHDLSSPDAPAAVLYTSGSTGKPKGILLRHSSIRNQVEGYTRRWEL
FT                   GPEVVLQQGAMTFNHSLDQILTGLCTAGRVVVATRDIRGDPVSLTKLIGDEQITYTKAT
FT                   PAEYSMWLRYGSASLRTATNWKHAFGGGEHLTTTLSQGFQALELPNLSLYNSYGPGEIT
FT                   ISSHKMKIDYKEPSVTPDDIFPVGFSLPNYTTYVVDEDMQLVPPGVSGEILIGGAGPCL
FT                   GYLHREALTAEKFIESHFASSEYTQSGWTRAYRTFDRGRLLSDGSLVIEGRLDGDTQVK
FT                   IRGIRIELEDIENSIIQASDGKVLNAVVSIHGEDSQLLTAHVVLAPSTQGGAPSDLDGF
FT                   LQQLRANLPLPQYMCPSVFIPVHDFPLTIHGKVDRKAIRAMPLPQAPTSNRPVEELSGT
FT                   EAMLREIWAQVLESTSLDATGVGREDDFFMVGGNSVLLVKLQALIRQTLRVSVPLVELF
FT                   SASTLGAMAGVVQNAIPTIELNWMEETSLPDLAINHEPPRPVTDQGIVIVLTGATGFLG
FT                   HVILQRLLAEPTVSHIYAVGVRTEGRGIGRPLPSASPKFTALNGDLGQLMFGLDESTFA
FT                   TLAASAHVIIHSGANRSFWDAYPIIRGANVLGTKNVVALASHRKIPIHFLSSGAVEKVV
FT                   ESNAAPPTDGRNGYLASKWASEKILTTAAEKMNTQVTIHRLTQAPNVQPPPQDIIAAFS
FT                   AIAEQMNCIPTAQGWGRLISLLPLGELATSIVRCALISVGQQVSAKVTIENHMISTTFE
FT                   LSDAAEAVDRTVVGADQMDSLHMLYWLGRAKRESKFPWFVAAQDVIVNSECQTVRVELD
FT                   "
FT   exon            complement(581629..586873)
FT                   /number=1
FT   exon            complement(586932..593329)
FT                   /number=2
FT   CDS_pept        join(594689..594994,595050..595118,595188..595931)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000225"
FT                   /old_locus_tag="AO070238000003"
FT                   /note="isopenicillin N synthase and related dioxygenases"
FT                   /db_xref="GOA:Q2TYI9"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYI9"
FT                   /protein_id="BAE65684.1"
FT                   /translation="MAVNFTQIPTIDLAHAQSPVTKASFLSDLRDAIVKVGFFYVKNHG
FT                   VPNNVERNFVEQSVKFFDLPLEDRLEVEMLHSKHFLGYVREQNEKTAQRTDFRETFNLG
FT                   MDLAAPGEEEPAYRNMSGPNLWPNETAIPGFRAAMEDYVKHIQTLGDDFKVLVAEALDL
FT                   EPTAFLRFFDEQPQDRLKLAKYPVPSSIADSEPSGSFQGIGPHKDSSFLTFLLQGTPHR
FT                   GLEVQNKSGEWIPAPPIPGTLVVNIGRMFEALTGGVVTATTHRVSLEEKNFVDRDGRPL
FT                   GPRFSFPMFQLLALDLRRDQMTLDMPPHIVKLAKEIKVMSDAEKFFEEMFRDCAGSGLF
FT                   MARVIKHEDVARKWYPDVLDNVLKAQKAELGH"
FT   exon            594689..594994
FT                   /number=1
FT   exon            595050..595118
FT                   /number=2
FT   exon            595188..595931
FT                   /number=3
FT   CDS_pept        complement(join(596318..597667,597728..600256,
FT                   600311..600535))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000226"
FT                   /old_locus_tag="AO070238000002"
FT                   /note="multidrug resistance-associated protein/mitoxantrone
FT                   resistance protein, ABC superfamily"
FT                   /db_xref="GOA:Q2TYI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030244"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYI8"
FT                   /protein_id="BAE65685.1"
FT                   /translation="MTLDTGQGPAIESIEKDQHEQPQQEKQSSYFQWFKLNPLRSSKTP
FT                   PVPQERQVSREYGANLASLITFQWVNPIVKLGYKREMEIQDIWTVNPTRSVSILSKKLD
FT                   EAFAGRLERGGKRPLVWALYDTLKIELCIGILCQILSMCLLVLAPFVVRRLIEFAMDAY
FT                   TSQHNNLPGPNLGKGMGLVIGLVTMQLVQSISSNQAFYQSLIAGGQLKAVLTPKLFSKA
FT                   MRLSGHARAGNGTGYSDGRITTLMAVDLSRLEKGCASLHILCATPIALIIALVTLLVNI
FT                   GYSALAGYAFLVAITCLLTFAVRSIIVRRRAINTITDKRVSLTQEILQNVRFIKFFAWE
FT                   NSFLERLRMTRKLEIDSLRRFLATRHSNTVSFTSMANFASLLSFMTYVLSGHTLSSDRI
FT                   FASLAVFNAIRLPLSMMNVVVTSTTDAVTSLNRLQEFLLAEEREDSITWDRNMENAFEF
FT                   KKASFTWESVPDIEAETPGVESIPVSASASPVSSWDDATKPASKSKDNRPFRLMDIDFQ
FT                   AAPGELIAVIGTIGSGKSSLLGALAGEMRLTAGSVRMRTAPAFCPQYAWIQNTTIRNNI
FT                   LFGQEYDDARYDQVIDACALRADLATFADGDQTEIGERGITLSGGQRQRLNIARAIYSN
FT                   CDIILLDDPLSAVDANVGLHIMKQAICGLLKDRCRILATHQLHILAHCDRIIVMEAGRV
FT                   VDIGTFDHLVQRNEVLQSLVSVNHQEKEETPSSPSIADAVQVEKACPESKLKNRNAAPL
FT                   MKDEERARHARRRDIWRAYAVSSGSMANIFIVFALAVLSAGGAILGGLWLSFWASNRFP
FT                   QLSLGQYLGIYAGITAGQAAILYLFSVCVTAFAANASKVMLEDAMYRLLRAPTSFFDTT
FT                   PLGRIINRFSKDVQVLDSELGEALRLFLYLFLMVVAIMILVIVYFHYFAIAVGPLLAIV
FT                   ILITIYHRASAQSLKRHEAVLRSVVFARFNEAITGIACIRAYNMEVYFRQNIGRAIDSS
FT                   NAAYFLIFANQRWLSVRLDLVCNTLLLVTGVLVVTSRFNVSPSISGLILSYMLSISQTL
FT                   QFSIRQYTELEQHINSAERLHHYGTSLEEEEKTAPLHRVEVSSTWPAQGQITFQNVQMR
FT                   YREGLPLVLKGLTMSIQSGERIGVVGRTGAGKSSIVSALFRLTELSGGNIRIDGVNIAS
FT                   IALHDLRSRLAIIPQDPTLFRGTIRSNLDPFNEYTDLELWSALRKAHLVDPPPESPPDG
FT                   DKDARQVVNEQAAGPSQLHLDTRVDEAGLNLSLGQRQLMALARAIVRDSKIIICDEATS
FT                   SLDYQTDQKVQETIAGMHGKTLFCIAHRLRTIIHYDRICVMDKGCIAELDTPVRLWEQQ
FT                   GIFWEMCNQSGITREELERGPVGL"
FT   exon            complement(596318..597667)
FT                   /number=1
FT   exon            complement(597728..600256)
FT                   /number=2
FT   exon            complement(600311..600535)
FT                   /number=3
FT   CDS_pept        complement(601503..602198)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000227"
FT                   /old_locus_tag="AO070238000001"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYI7"
FT                   /protein_id="BAE65686.1"
FT                   /translation="MGPTEPDILELPFTDAARGLRYRLSTSDDQASMRTIDSSFVTDRV
FT                   FQLQSRISNLELGDIGFGLDIKAVQLDTPLHKSFPDDEDSDGDDESPDCFTVVVEDINA
FT                   LSTMDSPTIDPNTTGNNNKIVAFISAKFSSWNARLIITDIEISPLYRRQGIGRNLIRFA
FT                   EALGSARWPVRHVWLEVSNVNYPAIQSYLKMGFKIAGLDVSLYVGTQAEGEFAIFMWKD
FT                   VSGSAEAVS"
FT   exon            complement(601503..602198)
FT                   /number=1
FT   CDS_pept        join(605052..605488,605827..605899)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000228"
FT                   /old_locus_tag="AO070333000001"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYI6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYI6"
FT                   /protein_id="BAE65687.1"
FT                   /translation="MTATGRYGSDPNNHPDQKELSNIMRNLKSSSDGTAAFVMGTDGVL
FT                   RTLTIDYDVIDAIGLPPRLIKAFLDRDVFNQNIEDMFRGADGTKVTQEQWWRPDPSLLP
FT                   PPLTAEQKAWIKKTNEENKEIIQENIRKMESGELKPCGVVIRRTCFNCMLTTALSGVLH
FT                   MNRFRF"
FT   exon            605052..605488
FT                   /number=1
FT   exon            605827..605899
FT                   /number=2
FT   CDS_pept        610679..611119
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000230"
FT                   /old_locus_tag="AO070333000003"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYI5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYI5"
FT                   /protein_id="BAE65688.1"
FT                   /translation="MKVSRSYNVQGKCSSHSQIFYIYVLLYKIQISLAKISVCLFLLRI
FT                   FQSTAFRYTAYTIIGLNAAIAVTWVLVDGLRCTPVHLAWTGWAKEEQGKCIDFIAATFA
FT                   NSFVNIAVDAVMVAMPVYEVMKLNLSARKKLGVGVMFAMGLV"
FT   exon            610679..611119
FT                   /number=1
FT   CDS_pept        join(611976..612008,612045..612178,612215..612227,
FT                   612267..612347,612362..612440,612507..612772)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000231"
FT                   /old_locus_tag="AO070333000004"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYI4"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYI4"
FT                   /protein_id="BAE65689.1"
FT                   /translation="MADSIFDHVSNGNTPQYPAGKARIENIGNIYFSFIVMAVSLILIA
FT                   FSCQELTQGGYIAFGKKYSQVCILWEDHRNDLFISGFGILTPIHWWIDPMGLLWLCTSI
FT                   EECKLLIGVTVLIFRWNHAGRRLIVEVDVVMDSQNNFETLPNVDRAFVHIDYESTHRPE
FT                   HAKKIYNNLAAERTDPVYQGHCMRQTLNSSQEATVLRR"
FT   exon            611976..612008
FT                   /number=1
FT   exon            612045..612178
FT                   /number=2
FT   exon            612215..612227
FT                   /number=3
FT   exon            612267..612347
FT                   /number=4
FT   exon            612362..612440
FT                   /number=5
FT   exon            612507..612772
FT                   /number=6
FT   CDS_pept        613789..614619
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000232"
FT                   /old_locus_tag="AO070333000005"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYI3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYI3"
FT                   /protein_id="BAE65690.1"
FT                   /translation="MVLSLLIPTSTITASVHGTRELSPWKRRLWEWHVGWLGLCLSLAG
FT                   AFFVVLGLKDIVGKPRPDFLARCDPDLSNISAHLAGGLGLRREGAAVLVRASICQNTDA
FT                   AVIKDGFAAFPSGHSSFAWAGLLYLSLWLCAKFAIIPPSHRTGHSALTRNGPPAYPLTS
FT                   RPAAPPLYLLLIATIPVGLALCICATRYSDYMHAGWDIMSATIIGIFFACLSFRWYHTF
FT                   PSTRLISPTEDGGGWAFPPRSRPHALWVAYGSRGYAENDNISGYEDLELRPVGH"
FT   exon            613789..614619
FT                   /number=1
FT   CDS_pept        join(617373..617524,617551..617982,618139..618514)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000234"
FT                   /old_locus_tag="AO070333000007"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYI2"
FT                   /db_xref="InterPro:IPR033481"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYI2"
FT                   /protein_id="BAE65691.1"
FT                   /translation="MGIRSSLTSMNSHVIQPCGAQLTIRVYRICPFHRVPPYSDGCLYS
FT                   CNYPLISLFFSDHKLPHISPTRWLINPPAVLLAGCTSSNGMNNIYLVSLKYRNASTSTP
FT                   NDPSFINPSIAEKVYNLSQPRNTTIQEVRAGYMGLCLTRSDGAQFCSSNAAALASMVKD
FT                   QGLQGSNDTADPLNLIWIAKNFKETIVFDGLIFIAVAVAFICLLALATFPGWHEEVDED
FT                   GSEREVKPFPSRRVSQAALGMSTLGFIFALISILWQHINSSAAGTMSESLTYGAIESHV
FT                   GTAAMVLGWAAVVCLGVVALALLVMIMSISLLRQLTEE"
FT   exon            617373..617524
FT                   /number=1
FT   exon            617551..617982
FT                   /number=2
FT   exon            618139..618514
FT                   /number=3
FT   CDS_pept        complement(join(618631..620357,620414..621437))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000235"
FT                   /old_locus_tag="AO070333000008"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYI1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYI1"
FT                   /protein_id="BAE65692.1"
FT                   /translation="MAQQQPSRRVLDWIKQQHAEAGDASRRTRKLKARPRNSLEDILQN
FT                   DPAASGRTPQQIPLPGSRDGSATASDQRERGRNAAKSSLELIEHEDTFILPSSIPLPPS
FT                   LPPSPKLPPVLEQATENPPKKRQTYAEILDRAGGVFDHIKNGNVRKVPRVERTSITLYE
FT                   YYSDNTASSVEIEDPEFISNYSDAPQGLSGRVFIVEDLSERTIHALGEAFGVTPEFFEE
FT                   HLLNSGYGGAQYDDPPARSWKTAGLNKSYVSIQWVRPMYRRQPLFSSRDREDLLDLDHD
FT                   GLDYISGNSIFSLKAETNIFRPEWDLRVDPRRTAKETREFGLVERASIWKKKAKNRDYE
FT                   IVIVLLDPLPAISYSHDQTQVIPKIDMNSDSDHDYRDASDSDGAGTRPILIIEGDDGVE
FT                   ALAIPIENPRRERTGRRVFDWLLRRKRPEVHRTKVNLERTIQVLVKQMASRKPVTIDLE
FT                   EAIVTGDLLATLQDELNETRSTQQEIHHMVEKKTAPVSLLDTLFEIIRQDTLTLLRVLN
FT                   EILSDMEVDILDDTKMEDRLTLWRQLLTKAERELLDLIASIKEFLAFFGITHPANTSPA
FT                   ASDESSDILRSVSDLFDQINQMLARLRRASSSLTSNMGLLDSRRSIDEAHAVTRLTELA
FT                   FIFIPLSFSASVFGMQIEPFEDSAPVWKFFVVASTVTTFAYLMRLTMRSQWLASLKQNV
FT                   KQDVRRYAEQHSIPVQVRSLSMLLLLRWFGSVLNRSGKATWSWINKTSRKAGTELWQVI
FT                   GFPVGLILITGIVAVAPIAVLWTRNMDQGVQGTVTAAIMLAILGLVGIPYWRNSDPDFR
FT                   YALPRVILRLFERIPPTTRLILIWALGIMAFVAIPLALIWTRPLASGIKAGLTAAIVVI
FT                   LVTGVGFLVMQLLYSRALNISRGTTISSSEGTSVSAEPVVQDLRI"
FT   exon            complement(618631..620357)
FT                   /number=1
FT   exon            complement(620414..621437)
FT                   /number=2
FT   CDS_pept        623811..625247
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000238"
FT                   /old_locus_tag="AO070333000011"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYI0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYI0"
FT                   /protein_id="BAE65693.1"
FT                   /translation="MGFSSIIARLLLGTVAILSFVGAINEQDFAPDDIVIRDICILGGG
FT                   STGTYAAISLKDKAKSVVVVERHKILGGHTETLYLGNNQYIDYGVEGVFNDELSRKYLK
FT                   RLAVDYKPLLPSAQTTEYVNFRTGKKVPPPSGIPSVVEAAKVYRAAIEKFSYLKDGLYN
FT                   LPDPVPDELLQPFGDFVKKAGIEGSLQVVKIFAHGAGNILQAPLLRVLQLCGLPQVDSL
FT                   LQGGYITPKNGMYEVYNRASEILGSDIFYETSVIETERSESGINIFVQSANGIRKLIKA
FT                   KQLLVTFVPIIESLNGFDLVRPESSLFQKWNWVNYYVAVVKITGMPNATTLVNADPDNT
FT                   PGNLPLPPFQLELQYPGVDGYLVSKIIGNSTFTAQQAKDLILSDLRRMGTEGTFPGGDP
FT                   EIVVFGDHTPTTVSVSNIDVRDGFYRKLSALQGTKNTFYTGLAFCSDYSSLLWAYTETV
FT                   IGEMVASSASTCSLCVQGYD"
FT   exon            623811..625247
FT                   /number=1
FT   CDS_pept        complement(join(625865..625946,626054..626173,
FT                   626276..626607))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000239"
FT                   /old_locus_tag="AO070333000012"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYH9"
FT                   /protein_id="BAE65694.1"
FT                   /translation="MHFFTILATLSGTAIAFPTWGRFVNGTANGEADIHKTTVGDNNID
FT                   KSRNSAAVSYDDHSPSMDLKDSNNEDNSKRPSLGSLLEKANVTVGPLTGDSPLVSGPLI
FT                   SLPSPLLWFMGGLGLFDMAAKHILSTVITQVPDAMFNSSMTRNISLRMAKDNVYARGTL
FT                   GKINHSEGCSSFHA"
FT   exon            complement(625865..625946)
FT                   /number=1
FT   exon            complement(626054..626173)
FT                   /number=2
FT   exon            complement(626276..626607)
FT                   /number=3
FT   CDS_pept        complement(join(627719..628045,628096..628180,
FT                   628243..628412,628460..628966,629020..629101,
FT                   629157..629247,629290..629449))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000240"
FT                   /old_locus_tag="AO070333000013"
FT                   /note="permease of the major facilitator superfamily"
FT                   /db_xref="GOA:Q2TYH8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYH8"
FT                   /protein_id="BAE65695.1"
FT                   /translation="MVLTAAQDTSNSPEAAPAYDTAAEKALVWKQDLRIVPLSAFIYLL
FT                   CYLDRSNIALLTPGNAKVLNKDTGNDLLSETNMSNYQYTIALMVFLVAYALFEVPSNYL
FT                   LKKLRPSRWIAFLMFAWGGITMGLGGSRNFADVTGIRFLLGVIEAGLFPGLVYYLTFWY
FT                   CVSERSIRVALILASATLAGAFGGAIAYGVGYLNRSHGLSAWRWLFIIEGAPSCASAIL
FT                   VWFLLPDYPETAGWLNAAELNLAKHRLRLEGSKSSAKTMSWSDAKTVLTDWRLYGHYAI
FT                   YFGISTPFSSLSLFTPSITAGLGYENLEAQLMTVPPYAVAYVVTVAVSWSADHFNARGI
FT                   HAAIFSCIGAVGFLASAVLPADAYQHRYGCLIVAASGAFSCIPPLLGWLSSNLHSTAGA
FT                   GLAIALNISFGAPGQIVGVWIYKANEATRGYPTGHWTNAALLFFVSVSCVALHIYYVVL
FT                   NRKLRRSGQPKAYVY"
FT   exon            complement(627719..628045)
FT                   /number=1
FT   exon            complement(628096..628180)
FT                   /number=2
FT   exon            complement(628243..628412)
FT                   /number=3
FT   exon            complement(628460..628966)
FT                   /number=4
FT   exon            complement(629020..629101)
FT                   /number=5
FT   exon            complement(629157..629247)
FT                   /number=6
FT   exon            complement(629290..629449)
FT                   /number=7
FT   CDS_pept        complement(join(630499..630548,632380..632943,
FT                   632995..633606,633664..634294))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000241"
FT                   /old_locus_tag="AO070333000014"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYH7"
FT                   /protein_id="BAE65696.1"
FT                   /translation="MLNTRPIRIGNVSGATGDHPQAMLRMAQHGNVDVIVGDWLSEMNI
FT                   AWNAITKSQDPDLGYEPGFLAQLSDCLDIVVAKDIKVVANAGALNTSSLMQKVCALCKE
FT                   RGHSKVIVASVLGDDISEPIQKKEPGFQDLHHLDHDEWKLKDWPLKPHCAVAYIGAWGI
FT                   VEALNAGADIVICGRVTDASPVISAAAWWYRWQRDAWDELAGALVAGHLIECGPYVTGA
FT                   NFSGFKPLLPNLVDLSFPIAEISPDGSCIITKCEAYGGAVTKFNTIAQLLYELQGELYL
FT                   NPDVATDLRNVSVDEIGPGRVRVYGAIGQPPPPTTKAMIAAPGGYQAEAIFYINGLDVN
FT                   EKAEMLRNQLDHALRGNGFCKLSIELYGSPAINPSSQQAGTVFLRIFTQARNIEDISAE
FT                   RFKTLIYALRMQSYPGYHMNLDFRMMDAKPFMEVFPAVIPLDLLYHRIILSNGIQQGAP
FT                   SAPVTRIYPIQRPSYETKIPIPLSQFGAKEAAPLGSIVHARSGDKGDNFNLGFFVRNSD
FT                   EYPWLQSFLTVDRFKELLGDDWPKRENEPRAERCEFPKLLAVHFRVLDFLDGGIASSSR
FT                   IDGLGKGIGEYLRSRVVDIPKKFLERGNAGASEEAVVRGETG"
FT   exon            complement(630499..630548)
FT                   /number=1
FT   exon            complement(632380..632943)
FT                   /number=2
FT   exon            complement(632995..633606)
FT                   /number=3
FT   exon            complement(633664..634294)
FT                   /number=4
FT   CDS_pept        join(634844..635183,635235..635812,635852..636478)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000242"
FT                   /old_locus_tag="AO070333000015"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYH6"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYH6"
FT                   /protein_id="BAE65697.1"
FT                   /translation="MRVLSITYVFAVLQVVKGIPLGRQEKVGCASLAGAQIDNAAHIHH
FT                   AQNVPIGGLTLSSNGSPVRNELPLCHVQGTINYMAGGDATPDPRGNNTLTWELFLPDQY
FT                   HYNGRFLAVGNGGFAGDIDNATMLTNLNSGFAVAGCDSGHPLLESEASGPNDSVPFLDD
FT                   IAKVKAWIHNSIAMTTNVTRSITANYYAEQPAYSYFWGCSTGGAQGYALAQYHPTLFDG
FT                   IYAGSPGNWYSHLILSFLWNGLHATGEGFMSQDALNLITKRTVAACDELDGVKDGLIEN
FT                   PLRCDFDIRTLECQPGQTAISNNKTIYAGPKDQRTGKQIYPGFDLGSENGWLAQETYLY
FT                   SSYAAPILRQLVFKDRTYNVTSFNWGSDVDHLDYTASPAIDEISPDLSAFSQRGGKLIT
FT                   LQGWADQYNAATWPIEHLKQIQSTMKGQDVPDFIRLFMVPGGGHCGANSAYTHVPATYH
FT                   ALDALLPWVEDGIQPGEVMSSAPPDGSNTTRKLCVWPKEPRFLNGSPGDWQSYTCV"
FT   exon            634844..635183
FT                   /number=1
FT   exon            635235..635812
FT                   /number=2
FT   exon            635852..636478
FT                   /number=3
FT   CDS_pept        join(638764..639150,639209..639372,639440..640237,
FT                   640308..641079)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000243"
FT                   /old_locus_tag="AO070333000016"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYH5"
FT                   /protein_id="BAE65698.1"
FT                   /translation="MSQKTFDRAETVELLSIPRDEEPLGPNSSSEDGTDLSDRTGVQST
FT                   RKHRKKRKTENWKRSLYLGSLSSIIVLLFNVSFVAWAVSHHDLTEDRGVLYTGDCTKTK
FT                   RMSTGIHLVINILSTALLCASSYTMQCLCAPTRAEIDRAHQKNQWLDIGVPSMRNLFRI
FT                   SKMKLILWLILALSSLPLHLFYNSTIFSTITNLEYEIFAGNKPFSDFNANNVRPPHDFI
FT                   DKNNTMYTNPYFSFSRMLDKGLHNELYRLENADCMSAYATNFQSEYGSVLLLTDDFHPN
FT                   DTDFDFLSIQGASTPVKGNNPYAWMCCNQTVYACDMQTLCRDQLPEIRTHVDNWIVGGY
FT                   RVNYCLAEKVPGNCKLEYSLPLAIIVIVFNTVKAIIICAVALTMTDLPILTTGDALASF
FT                   LKTPEIRDRDHCLMTKALAKNPPSKPLPYKAKPQRWATAVSTVRWIICIICYTIAIAIC
FT                   IGLLCFGLSQITNKGNLWSGLGITNTETLISGNTWPPSLLTNTIIANTPQIIFSVLYFT
FT                   SNSVLTTMTLAAEWSNYALHRKGLRVSSTPQGSQRTTYFLSLPYTYAIPLLIFSTVLHW
FT                   LISQSLFLVNVETYDMQLERFRLFDFATCGYSPVAIVCAIVVGGVMVFGLVGLGFRRFG
FT                   SGMPVAGSCSLAIAAACYPGVSSVDGCGDAVETMPLRWGVVYQGTGDGVEVGCCGFSGG
FT                   EVGMPVDGMVYR"
FT   exon            638764..639150
FT                   /number=1
FT   exon            639209..639372
FT                   /number=2
FT   exon            639440..640237
FT                   /number=3
FT   exon            640308..641079
FT                   /number=4
FT   CDS_pept        complement(join(641653..642508,642560..642643,
FT                   642696..642821,642888..643504))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000244"
FT                   /old_locus_tag="AO070333000017"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYH4"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYH4"
FT                   /protein_id="BAE65699.1"
FT                   /translation="MGSELGITPETKPQAVYTPVSIWWACWAGVWTTAVALGMIYLIAN
FT                   RNMPTLRIRGIGMSLSAIVLLHLYWASVQFGVMIGPIMPGDAQYWIMGTYLGCGIALFH
FT                   ASNTRFLHVAKHQRKFAHHNSRISESVPDEKPKGGLFARFRRLEYTKRILILVAIAMSF
FT                   QIFLTILLWVISRKWHSSWGIPGTEVTGTPSEQAAKQGTGWEWWPTAFFQFFWAWIVAP
FT                   FVLWKARHIHDTQGWRVQTIGCAIANLHATPMWLIALYVPAMQVVNQYWIPPQWICLSI
FT                   WIMEIFTVFLPCWEVMRHHALRQETFNAIEQWESKMKKSGSEARSLNSIPTLVDSMMSG
FT                   WKSHNGSVDTTGSRDSILTMGALEHVLERNPAPLQKFSALNDFSGENVAFLTSVAEWKN
FT                   SLPKALRENTDPMDNNMKELLHERFNRALHIYVKFISVSQAEFPVNISSQDLRKLENIF
FT                   EGPARSLYGEKRAAVDPVTPFDTPSFPMKSLSSPSFGNGSQVELHPVSSDDRVQFWGEV
FT                   PEAFGPTVFNDAEKSIKYLVLTNTWPKFVKSRRSSDPIKEEAV"
FT   exon            complement(641653..642508)
FT                   /number=1
FT   exon            complement(642560..642643)
FT                   /number=2
FT   exon            complement(642696..642821)
FT                   /number=3
FT   exon            complement(642888..643504)
FT                   /number=4
FT   tRNA            648452..648523
FT                   /locus_tag="AO090103t00006"
FT                   /product="tRNA-Gln"
FT                   /note="tRNAscan-SE"
FT   CDS_pept        complement(join(649143..649328,649392..649850))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000246"
FT                   /old_locus_tag="AO070333000019"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR025568"
FT                   /db_xref="InterPro:IPR025951"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYH3"
FT                   /protein_id="BAE65700.1"
FT                   /translation="MPFIRTYFMNQRILCYISQVLSKKSVRVCELVKESCQGKSCPPCL
FT                   PQYNPNALEELTIYDRPEAQFIQLTKATDLVPESTVENVYNQLKPVPPSFLIGKWNGGD
FT                   IDTGHIGHKLLKEMKWAGKDFRSVDDGDPIMVHDAEGNRVWKEDWGHCSLREVVYRGVT
FT                   STAMIYDQKPIFDHFRYVSDDMVAGAMDTPKLFGAKGTYYFYLTRRSSSSL"
FT   exon            complement(649143..649328)
FT                   /number=1
FT   exon            complement(649392..649850)
FT                   /number=2
FT   CDS_pept        join(651974..652224,652275..652359)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000247"
FT                   /old_locus_tag="AO070333000020"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYH2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYH2"
FT                   /protein_id="BAE65701.1"
FT                   /translation="MLLSGGLIEVVKVPEGGGNETVQVIHQSVTEFLRARGLAYLATLA
FT                   ETDKKAICVMPDTEPPGNDDIHNCPAPFDGSCLNHLVTEVPDESSFRLGIPGKQLCSHS
FT                   IDNSVMS"
FT   exon            651974..652224
FT                   /number=1
FT   exon            652275..652359
FT                   /number=2
FT   CDS_pept        join(653441..653953,654006..654416)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000248"
FT                   /old_locus_tag="AO070333000021"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYH1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYH1"
FT                   /protein_id="BAE65702.1"
FT                   /translation="MLEHAGVPKSDVAKWVGFTTTITATCAGLMGVIWGMASDSMGRKR
FT                   VILLELNLMLVFVFLFGFSQHLALLVLFRALIGLVSGSVGIMRTMIAELVPEKLLQPYA
FT                   FSILPTVETIGSGFGPAIGGLLARPAEHYPGIFGRIGLFKMFPFALSSVASSCVVAFAI
FT                   TMASSSLRETQPGRKDSPDDGLMIAKILSSVWALRTRKADIRPEVVDETTALLGDTIED
FT                   VEEVLEQRAAELVGRWKSVISPQPILLVLISGVMSMHTVAFDSLFPVLLHLPKQHLKGN
FT                   PDVHLPFKFSSGLGLGKLPSALLPFY"
FT   exon            653441..653953
FT                   /number=1
FT   exon            654006..654416
FT                   /number=2
FT   CDS_pept        654484..655014
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000249"
FT                   /old_locus_tag="AO070333000022"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYH0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYH0"
FT                   /protein_id="BAE65703.1"
FT                   /translation="MVVQLVIFPWAARKHGILQCLKLACTVFPILYLVVPFVPLLPQPL
FT                   SSVAVVALLVLKMAGAAFVFPCCTILISEVAGAIGMLATVNGIATSIIAFGQALGPGVM
FT                   GPTFSFGVKLGYTILPWWLLAGFAFLSSLPVAWIKEVDIKLPEEGLLPNEEEQQVGDGE
FT                   NDMEARGRQPTLI"
FT   exon            654484..655014
FT                   /number=1
FT   CDS_pept        complement(join(657620..657780,657830..658259))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000252"
FT                   /old_locus_tag="AO070333000025"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYG9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYG9"
FT                   /protein_id="BAE65704.1"
FT                   /translation="MTAYWTLVILTQQPFTTQNRFGINLHSKVKHEAMDKCIEAAFNIR
FT                   ALAEAYQRAFTLRRAQFGIPYAMHSAVLILLQSDSQGRDDYTEACRFFWSALLKYQKGC
FT                   GSGLKKPLALLKSLMLRVAKLAPCITVNTSDAVSWSSLHAANIGTDLVPGTITLGEDGV
FT                   EDVCQFNVHDGAKHTFLDDDTIFGFFTDGAALS"
FT   exon            complement(657620..657780)
FT                   /number=1
FT   exon            complement(657830..658259)
FT                   /number=2
FT   CDS_pept        join(665756..666028,667244..667348)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000254"
FT                   /old_locus_tag="AO070333000027"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYG8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYG8"
FT                   /protein_id="BAE65705.1"
FT                   /translation="MAMPAYAEGGLYPSVEFLRGYMYPEWLHAVHDYAESTGESPCPSV
FT                   ASTTTSLLPYSRSGLLELALYNATVTNSNECSSMCYRRGVPPHNKTFQAMHAQRQHQIE
FT                   PSMGGNNSVANFKRGERLILP"
FT   exon            665756..666028
FT                   /number=1
FT   exon            667244..667348
FT                   /number=2
FT   CDS_pept        join(673027..673537,673567..673580)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000255"
FT                   /old_locus_tag="AO070333000028"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYG7"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYG7"
FT                   /protein_id="BAE65706.1"
FT                   /translation="MSLTIMTPFLAGKIRSFLRLFRRKSKPIPPPPQQELQDILIPPPP
FT                   QQELQDIYIPSPPQQELQDIFIPPLLNLPLDILFEIFPLLPLPSQVCLALSCKPLYRLF
FT                   SSTLQDEKLAWPSLLACKTFRLPDTLSSNEAPLSSPRTQLLLQLEDDWWLYCAACLKIQ
FT                   PRALFRQEMHI"
FT   exon            673027..673537
FT                   /number=1
FT   exon            673567..673580
FT                   /number=2
FT   CDS_pept        join(674177..674202,674245..674268,674333..674402,
FT                   674424..674507,674560..674709,674777..674860,
FT                   674931..675075,675157..675204,675247..675739,
FT                   675758..676019)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000256"
FT                   /old_locus_tag="AO070333000029"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYG6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYG6"
FT                   /protein_id="BAE65707.1"
FT                   /translation="MAIAHFAGRCLAIPSSWYGREPFASALCQIPSINIWDDHDPTSLM
FT                   SNIEHFKIIDGFGSYANETMECSVFRAIGALAHKYYMLFQHHLSPGNVDDSMQDTYIAD
FT                   TIPEPQYVLGPRPGPYIRAQSHNIFTRLGARIAFLGVDARTERNREQTNYRETYDCLFA
FT                   RVNAELDAAAWCGRPIKHLILLFGIPLAYPARSAGRSFQRLSDKLGIDAVFPIGKNAMN
FT                   PFDNAIELLDDLNDHYTSNAHRNERRYLIERIQCVCAAHSVRATILSGDVHLAAVGRFF
FT                   TTHKGDILPIEEDFRFINNVISSAIVNQPPPETMAKLIAHGDKIRHLNAETEECLFKLF
FT                   RSNSTTSAKKPEGTTVAMPRRNFSIITENSPNNEGKLSWRQFFAKHGNRPLHFGEANAG
FT                   TRHIAASNQHGKGNDGSLDVCFCVEADHQRHDGQTVGYGFTIPALEYRGPALSEPVWSE
FT                   TTS"
FT   exon            674177..674202
FT                   /number=1
FT   exon            674245..674268
FT                   /number=2
FT   exon            674333..674402
FT                   /number=3
FT   exon            674424..674507
FT                   /number=4
FT   exon            674560..674709
FT                   /number=5
FT   exon            674777..674860
FT                   /number=6
FT   exon            674931..675075
FT                   /number=7
FT   exon            675157..675204
FT                   /number=8
FT   exon            675247..675739
FT                   /number=9
FT   exon            675758..676019
FT                   /number=10
FT   CDS_pept        complement(679352..681304)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000259"
FT                   /old_locus_tag="AO070333000032"
FT                   /note="ankyrin"
FT                   /db_xref="GOA:Q2TYG5"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYG5"
FT                   /protein_id="BAE65708.1"
FT                   /translation="MQIEISRYCYFDDEMIPLLTPVQIAAKVNNPGLVHMLLQHGASAM
FT                   ACPVSAHPDFKLYFSRRAEEDWNVTQRYKPRYDSRQKVYTALQYGALNQNMEIIALLMC
FT                   TGVAPDSRVAPYVNDTPLQMSTRLGNVEMFRLLWSWGADLDAPPAARNGRTAVQGAAES
FT                   GNLMILLMLRRAGAQINEPAGAEQGMTALQAACLNGNSLIAGVLLAHGADLNLGPSSVE
FT                   GLTAIQAAAAHGDIRLVRDLVTLGAEVNAPASEGGMTALLAAIKHESLPLLELLVQHGA
FT                   DVNATGAYGFLSPLTEAASRNWLGGVQFLLEHGANVNDTPFDLAMSDESEEYAPRELLS
FT                   PLGWGIKSLSLKMVDILLQHDADVLVAVIYNQSVSRSALMHAIHEGSSHEVIDLLLTKV
FT                   PGLQNHPGWEDAFKVALVDSFEVDTIYCQRILAKVNSLPPLLRHRAIQKAWDALSSYDD
FT                   DLNDADETLVETIELLIESGVSLDSRAEDGCTLLLRAAYYGYDKSCTSLIAHGAAVNIY
FT                   PTNDWGTPLQEAINSSHVNIANVLLEHGADINAPPAENRGVTALQAASINGMFELAVRL
FT                   LDRGADVSAPAAPRNGRTAIDGAAERGHFDMVQLLLNAYGKDADLEPVRRQAANYAEKE
FT                   GHLEISQWLRGFSAG"
FT   exon            complement(679352..681304)
FT                   /number=1
FT   CDS_pept        complement(681368..682138)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000260"
FT                   /old_locus_tag="AO070333000033"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYG4"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYG4"
FT                   /protein_id="BAE65709.1"
FT                   /translation="MRELTPQSDSDLPQLHVGPDSRLGTKNDLNIYLPPEDLEIGNSST
FT                   TNLRALQGKSPFSILKVFLQRFAFLSANNRLDQWQFNEVFSWIVEKGGANILLFLCWLK
FT                   SPLMKVFARKVFCSAVMFGDISLGRKVLQCGVRLKTDDPTQRSRLTDYLSTAIHGRHEA
FT                   MVELLCKAGIHPEVNNRWSWRDDWDLQLPILHTLLAFGADPERFFIEEGTGFPLINAAL
FT                   NGSLKAVQLLLDRGARVNLYLARYYGTALQAAAS"
FT   exon            complement(681368..682138)
FT                   /number=1
FT   CDS_pept        complement(join(687546..687579,687616..688069,
FT                   688100..688349))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000262"
FT                   /old_locus_tag="AO070333000035"
FT                   /note="1-aminocyclopropane-1-carboxylate synthase, and
FT                   related proteins"
FT                   /db_xref="GOA:Q2TYG3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYG3"
FT                   /protein_id="BAE65710.1"
FT                   /translation="MQDVILDYIRTRAASGLDRTSLTYHEGPFGSRRLREAMAKLITTY
FT                   FYPASPITSDNILFTSSVTSLNAVCALCLTDPNDGILLDLSVPSGCQLIYTSFQGDDPS
FT                   GPSAVIQYEEAFLKARDDDGVSVRALLICNPHNPLGRCYPRETLEALLQFCQKYQIHII
FT                   SDEVYALSVYEENTSTDGFISLLSIEPANNGVNPALIHVLYGMSKDFAAAGLRLGCLIS
FT                   QNQNFLQAALSISNYLTSARQCG"
FT   exon            complement(687546..687579)
FT                   /number=1
FT   exon            complement(687616..688069)
FT                   /number=2
FT   exon            complement(688100..688349)
FT                   /number=3
FT   CDS_pept        complement(join(689076..689588,689650..689841,
FT                   689913..690322,690383..690472,690524..690917))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000263"
FT                   /old_locus_tag="AO070333000036"
FT                   /note="predicted transporter (major facilitator
FT                   superfamily)"
FT                   /db_xref="GOA:Q2TYG2"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYG2"
FT                   /protein_id="BAE65711.1"
FT                   /translation="MGYATFYRVLSPRQLNVMIQAFSLVCIFFEGYDQGVMGGVNSSPR
FT                   YVTEVGIGEPDGTVTNTTHQGGIVSIYYLGCIFGCFGGGWLADRLGRINGLLIGAFFAL
FT                   VGGALQAAAQSSDFMLVARVVTGVGTGALTGIAPVLVSETSTADHRGAFLGYVFIANYL
FT                   GISVAYWLAFGLAFINRGYSDIRWRFLLAFQCVPALILLLFIKMLPDSPRFLASVGRYS
FT                   EAQEVLNRIRCHKASQSEIDLEYKNIIATVEEGKSSSPVQFAKILIGRGGKPGANLGRR
FT                   AWLCVWLQIMASWTGITAVTAYSPVLLRQAGYSELTQNGLAGGLNTIGILGTIISAQIV
FT                   DRIGRRKCLILGSVMLFIVELVAGSVYEASLHRPDKADQLAPAAVAMLFLFNLAYAATW
FT                   GTVAFLIPTEIFPSNLRAQGNGFGITGWAIGVGMTTLVNPIMFGSIGSRSYFLLAGLNL
FT                   LWVPVIYLFYPETRNRTLESIEYLFSTSRPFHWDMERAYRLCKERKDQEHIDEQAIKAS
FT                   SQDEVQQEFYESIPQ"
FT   exon            complement(689076..689588)
FT                   /number=1
FT   exon            complement(689650..689841)
FT                   /number=2
FT   exon            complement(689913..690322)
FT                   /number=3
FT   exon            complement(690383..690472)
FT                   /number=4
FT   exon            complement(690524..690917)
FT                   /number=5
FT   CDS_pept        join(691517..691588,691659..691733,691797..692966)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000264"
FT                   /old_locus_tag="AO070333000037"
FT                   /note="predicted molecular chaperone distantly related to
FT                   HSP70-fold metalloproteases"
FT                   /db_xref="GOA:Q2TYG1"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYG1"
FT                   /protein_id="BAE65712.1"
FT                   /translation="MDPNPSMSRSLDLTVLGLNSGTSMDGIDCALCHFQQETPESPMRF
FT                   ELLKYGEIPLEQTIKQRVMNMILHNKTSPSELSEVNVILGETFAAAVKEFCAQYNVDIS
FT                   SIDVIGSHGQTIWLLSMPEEGEVRSALTMAEGSFIASRTGITTVTDFRVSDQAAGRQGA
FT                   PLIAFFDALILHHPTKLRACQNIGGIANVCFIPPDSLGGVNACYDFDTGPGNVFIDAVV
FT                   RHYTNGEREYDKNGEMGARGTVDQDLVDEFLQTHPYFRLDPPKTTGREVFRDTLALDLI
FT                   HKAESKGLGPDDVVATVTRITAQSIVDHYRRYAPKDLPIDEIFMCGGGSYNPNITQYIQ
FT                   SQYPDTKILALDQAGIPASAKEAITFAWQGMEAIVGRSIPVPTRVETRQPYVLGKVSPG
FT                   KNYRRVMRQGMRFGGDRDELSPVKEVVNYVDGKEWNNKW"
FT   exon            691517..691588
FT                   /number=1
FT   exon            691659..691733
FT                   /number=2
FT   exon            691797..692966
FT                   /number=3
FT   CDS_pept        complement(696010..697131)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000265"
FT                   /old_locus_tag="AO070333000038"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYG0"
FT                   /protein_id="BAE65713.1"
FT                   /translation="MASSTQVLPVPAPFSNSSYELSFWGPSYKCQRLGEALMEIDGVTQ
FT                   KLWDSEFPDPQFQTTRIYMGTAPSDLNNTIFISAAGSNPLWNDNATQPTELVCQLWNTS
FT                   YVVDMHFTNGIPTLTPISVDHVAYANWSEGAASSSAAPSYSGLDPTVNAGFYIMHMILS
FT                   GLLQGELVQSKRAGVWENKTVASTTTYTDTSFAYTGLFSCPELWNTSSYYYSHGNDSTG
FT                   LCRNGTLAQAIEDLSHNFTYSLLSLNGGNTTVKVVDLTYRNYYIYGPTSLLAAYMSALA
FT                   VTIACVVVGFCSLRRNGVPQNNSFSSFLMTTRNPELDRLAIGHCLGSEPLKGNIDKVRL
FT                   QFGEVEGANLQHRHAAFGSKGSVTTLSKGEDYY"
FT   exon            complement(696010..697131)
FT                   /number=1
FT   CDS_pept        complement(697350..697862)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000266"
FT                   /old_locus_tag="AO070333000039"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYF9"
FT                   /protein_id="BAE65714.1"
FT                   /translation="MSPITYNHLADCDPVPDKRPHSPAPATVSESESVQETQTPAAWGI
FT                   GWRCPALMVGLVISGAMLSVGHHYYYKSFDGGRVASREEQTWAIRIGTGFAFLIKSCLV
FT                   SAVGLAAVQETWATLRRKSVRLSGIDSMFAIRDSPLAFLTLDLWIYAKTLTVLGIVSWY
FT                   VHLHGYS"
FT   exon            complement(697350..697862)
FT                   /number=1
FT   CDS_pept        complement(join(699253..699616,699677..700305,
FT                   700375..700977))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000267"
FT                   /old_locus_tag="AO070333000040"
FT                   /note="predicted transporter (major facilitator
FT                   superfamily)"
FT                   /db_xref="GOA:Q2TYF8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYF8"
FT                   /protein_id="BAE65715.1"
FT                   /translation="MALRFRPPKPSQKILPVKPTKGHFLFAHQEFKRVPWWKRKNMRTL
FT                   YIYIVILIMTNTANGFDGSMMNGLQTLSYWQEYFNYPHGSLLGLFNASMSLGSLLGLFV
FT                   VPYMIDAWGRRLGCFVGCLIMLLAVGLQSGATGFGMFIAARLLIGFGDCLVLGSAPLLI
FT                   AEIAHPQDRAVLVTLSGASYHSGAFIASWVTLGTLKIQSDWSWRLPSLLQAICTIVIVC
FT                   GIWLMPESPRWLMSKGRHDEAMRNLVKYHGEGDPDDAFVHLEYAEIKAAIDLDKEIDQT
FT                   RWVDFLKTKGNRKRIGLITALGLFSQWSGNGLISYYLKQVMDSVGITKASTQLGINAGI
FT                   KTEALVTNFTLAFFIDRLGRRPVYMVSTVGTCVVFNAWTIVSARYAITANQALGYTFVV
FT                   LTVLYGVFYDIKSGLMATYTTEILPYGLRAKGFTWLNFCVTAALFFNQYINAIALDAIG
FT                   WKYYIVYCVFLGMEVFVIYTFLIETRYTPMEEIAKYFDGDDAVDVGEIAVADMKEQARE
FT                   SEGKAAAVHVEVKE"
FT   exon            complement(699253..699616)
FT                   /number=1
FT   exon            complement(699677..700305)
FT                   /number=2
FT   exon            complement(700375..700977)
FT                   /number=3
FT   CDS_pept        703020..704102
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000268"
FT                   /old_locus_tag="AO070333000041"
FT                   /note="beta-xylosidase"
FT                   /db_xref="GOA:Q2TYF7"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYF7"
FT                   /protein_id="BAE65716.1"
FT                   /translation="MQGSGGIGPGTTINLFEINLKTGARLSEEKIIWRGTGDIYPEGPH
FT                   LYKHKGWYYLLIAEGGTHGGHMVTMARSQNVFGPYDSCPNNPVLTARDTQEYIQYTGHC
FT                   ELFKDEKAQWWGVCLGGRLDTQGRCPMGRETFLTRVDWDGEWPVFDQVELNPRGLLATR
FT                   SSPRLTAEGGLDYLYIRDAIMSNYRLENDHSSLTLTASSVDLSHPADSPTFIGKRQRKL
FT                   AGTSSVVLKGIEDSWSSAKIKAGLACYKEEHRFSRIYYDADQQAVVLELVNAAKKIVRT
FT                   EKHTLGEAPCSLLFRIEYTEKQYSLLYSFEPHVGNDWTCLGTVDTLDITDPDFTGPIIG
FT                   VYAVGQMEGVQVQFDGLSVE"
FT   exon            703020..704102
FT                   /number=1
FT   CDS_pept        709278..710936
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000269"
FT                   /old_locus_tag="AO070333000042"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYF6"
FT                   /protein_id="BAE65717.1"
FT                   /translation="MTASKTGVDLSNPGDLTLKKQLDLLEASGAIKRFDSHPFVKNIID
FT                   SRSLPTRKDIEVGPNDPTTTSQLRRAAAKNNTLVVGGAVVKNLSLLLAKDQDTVAEVPL
FT                   RAFPAVTKPTPKANSLLIAPVNADHLTLLLSPPSPTSYFQFTSHVAPDPVRASSFADEA
FT                   TDADKSMPADIINGYSLSGDLENFWGIKGLTGKLYVYNGDTVREKVRFSDFAFDAGKNK
FT                   PLSKLEHSPLAKFFPHIDMEPIKQLPINNVEFTYTEADNDFLYKKGLRLEGDVLCTGHL
FT                   QPVADMLRRIYGDKDAPSKLHVSAHLSDERDWTKAPKITKLILSATLVDGKLKVWDFLA
FT                   FDSVDVQILALQKDKQEKVKDDKDKDESNDAATEAKDEKQATEPESKAGKVADKATEKV
FT                   SKATGIASKASDYKAQKKAEATSSQEVSKKATKESTEKGKEDAKDDKQGEGEAQEDDTA
FT                   AIDEKADQKAPAKPEKTWEFGLCILGTGSLINLPKATKPLWVKYRMERDPQETTKALYK
FT                   VHITAEDWKNAFGVKNLNVRLCPLLYIYSKCYSEC"
FT   exon            709278..710936
FT                   /number=1
FT   CDS_pept        complement(join(711394..712079,712253..712352))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000270"
FT                   /old_locus_tag="AO070333000043"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYF5"
FT                   /protein_id="BAE65718.1"
FT                   /translation="MKILSVAPSVNLGSVATSIPAVNFSRPNLGCSFAIGIGGSIIAHS
FT                   EIPTREAVNRLVDVHQDVVKYGIQRRTILDSIALHIDLAVVYITLGRSHQSHILKGKVK
FT                   IGVLNVMEEFRQVESINNAIHKPFSLLGLSLASVEQAYPEITSGVVDVTSHRELALAVA
FT                   EILVNDLFLLFDLVVFCAGVNRIGRLCFRVSSLFLGSIFDGLGFFLFLFLIFFLLTLIG
FT                   LVDLWRLGPNFNIQSCLLHGNFRAFNLEVSNITVYGQPS"
FT   exon            complement(711394..712079)
FT                   /number=1
FT   exon            complement(712253..712352)
FT                   /number=2
FT   CDS_pept        712702..713832
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000271"
FT                   /old_locus_tag="AO070333000044"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYF4"
FT                   /protein_id="BAE65719.1"
FT                   /translation="MKVSETDGEMLSVSVDKFNVCKIIRYAGQLTEIKELQKIGNGEDV
FT                   FIINQGSLYISSGVGIGGKSYPRGISASASVTIFDQTGQFDARVDDSGFTGKGSIDRFK
FT                   LGALEVSAASDVTKPATFDIAMTQDEQKIKVDGMIHYHDIKLLALVDADLQKLPPMFNA
FT                   HLLLEFTGQYKIDFFFNASLGSVKSLSEVNLDFSALIEGDLFDLICDGVNSFLDRTQKL
FT                   VDQGFDSAKQKLENELSEKNKELKSLQEDLERRDQGMKEHEKKRQHDLEEAKRKVKENN
FT                   DKLAALEKDVKDAKKNKEDAEKRYRNELKKQQEERNEIVARKRREYEEKLRKLENDERD
FT                   YRTKKENLEATHRTNYGEKETALAWFKQHKEDTWSE"
FT   exon            712702..713832
FT                   /number=1
FT   CDS_pept        join(713892..713983,714319..714817)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000272"
FT                   /old_locus_tag="AO070333000045"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYF3"
FT                   /protein_id="BAE65720.1"
FT                   /translation="MISKKLKKQCMTGMTDGTMPHGWIKALMSICNSKEQKAIRDAEGK
FT                   LDANKSNILEIIQENDNKIRELEENNERKVLQQEYDNKRAECTKLENAVHTVEHVLNSL
FT                   QADFDNGIIAIKGEVTAWRDFLPRITRIEAKASSNALKSNEPIFVIVTAVYKGITKTFG
FT                   VQWTPNSKSKPYDLYKAIGDSAKGSFPVPAGSS"
FT   exon            713892..713983
FT                   /number=1
FT   exon            714319..714817
FT                   /number=2
FT   CDS_pept        716414..717271
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000273"
FT                   /old_locus_tag="AO070333000046"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYF2"
FT                   /db_xref="InterPro:IPR038883"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYF2"
FT                   /protein_id="BAE65721.1"
FT                   /translation="MSLQTPSPLLRLPSELRLEIYRHLFGIAPHTRLRVGEACLDSDLP
FT                   HSTERSWRLSKAFEVYMHRPSPPNASEYAEMDYKHCSATEQSRRNIYREHRHLFLAILA
FT                   TCKTIYEEAMPFFYSSTFFAVSGNIAKASNWLYAMSHERRKYIRRLTFHFWSKALSECF
FT                   SNQGNMEHLAKQLTYMDQIDVVELLITDTRTEDELLDFADAESQGIPQYAVSRRPCEPL
FT                   VLFGVEQLEAVPNLGCLRIVGRIDRLLVYTEDKEYLKAFAEGRKRAGLGKENGHRPVVE
FT                   LVQL"
FT   exon            716414..717271
FT                   /number=1
FT   CDS_pept        join(718717..720306,720372..720815)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000274"
FT                   /old_locus_tag="AO070333000047"
FT                   /note="sodium-neurotransmitter symporter"
FT                   /db_xref="GOA:Q2TYF1"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYF1"
FT                   /protein_id="BAE65722.1"
FT                   /translation="MVLVPYLKKIARWLAPPPPKSEDGRDQWPSRAAFLLAAMGGCAGQ
FT                   GNLLRYPSVVYNNYGLQWFIPYLLAVFLIAIPALILEISIGQAYRGGSVIAFNNINRRL
FT                   KGVGLGPILVSFIVTQYFTVNLAWIMNYFRNSFYSPLPWEGRIEEFYMGDVIHNVDPVQ
FT                   GSLSEGNKDVVAFTKYPGLAVIGETVGWSAFIWFLIWVSIFRGVGLTGRVVYWTMGLPI
FT                   VTTIIFVGRSLSLENASEGVRLLWATWRSSELASGTVWQTAVGQVFFSTGIGFGYFTSY
FT                   ASYNAKHSNAVMDAILICGSNVLFENFAAFAVFGVVGYLRRWPQEGERLGAFVVGFLTL
FT                   PEAVLHMPGSNFWAILLFFTLVVLGFSSAFVMLDAVTTLAVDSGLKVSRPIIVTALTLI
FT                   SFLLCLPYCTEFGFYLLDGIDRWINNIALIFVVWSELVGATTVYRWTDVVGQTGLPAFV
FT                   VYNFGYFGGQIVGISVGHGTENPSVGAGAGFGLYIVSVAVAVCIATTPEAEAARFWNRN
FT                   AVLRRFWFLVFYSGNQLRRDLNQIIGGGRNWKIPVFWPVLLRYISAPVLAIIFSFAYPE
FT                   FHTLRYDPMMIAGFILAHLCLLAMLLGLVLPRYYDCFIPPSRYGESTQGTIPNEPRPQD
FT                   LGQPAMTSFHGTEIEAVPAVSALGDIQSLEFKSHSGHVGMKL"
FT   exon            718717..720306
FT                   /number=1
FT   exon            720372..720815
FT                   /number=2
FT   CDS_pept        721634..723247
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000275"
FT                   /old_locus_tag="AO070333000048"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYF0"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYF0"
FT                   /protein_id="BAE65723.1"
FT                   /translation="MFQAESHSHDKIAEKVLECKQLARDVKKKRPSRGCLPANLYRSFP
FT                   DRRVMDELIEIYFATFESCYRILYAPSFREDYRSYINHPESARGPLLLQLALLMALTGT
FT                   LHRDVNIRSEMMSKASTWIHIAQTWLSAPLEKDRLTLEGIQLHCLLLLARQVSRIGADL
FT                   VWISAGSLVRIAMQMGLHQDPDCLEEMSITQKKIRRRLWYTILEINVQSALDSGMVPMI
FT                   TDIDYNTQPPSIAINGEAQDNTQVNTSNGMSFQHLLAKSLPLRLRATRVINNLQDEPSY
FT                   DEVLALGDELALECGKAAMAIEHDVSDTDTRSVSFASSFCNHLLRRFPLCLHYRYAVKA
FT                   KKNPIYCYSQKACLSGAQSLLLLLEDDMYHRLLLTGGGMFRDLITWGAMFIFLELCPEP
FT                   DADMSMFARKTNRARNQPLLQDARRVVQYARDRMWNGETNVKVYVCLSMMMAQAEARLG
FT                   GLPVKDAITKALHESLGECHSLLKAMAADSSVSTTDPVLDSWASSGLMMPLFADLDADF
FT                   DFLGDGNVDMSFLDTCFDLQ"
FT   exon            721634..723247
FT                   /number=1
FT   CDS_pept        complement(723476..724762)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000276"
FT                   /old_locus_tag="AO070333000049"
FT                   /note="2-polyprenyl-6-methoxyphenol hydroxylase and related
FT                   FAD-dependent oxidoreductases"
FT                   /db_xref="GOA:Q2TYE9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYE9"
FT                   /protein_id="BAE65724.1"
FT                   /translation="MPQLKVLICGAGIAGNALAFWLSKLGHETTVIERFPKIRASGLQV
FT                   DLRGPGIEVMRRMGLEEAFRARSVPEQGLQLVDDKDKSWGYFPANRSGRGLQSFTTDFE
FT                   IMRGDLCQLLYDVTKDRVEYRFGFCVKKLAQTEDYVDVLFSDEGRERFDLVVGADGSGS
FT                   HTRKMILDAGAKDPVHPLGVYAGYFTIQKSLQPGEGYNATAFIAPGNKGIMTRRADPHK
FT                   YQAYLFCNPNSSHRLNSATKGDIEDEKKGLAEAFCGAGWKTSEILKGLVDADDFYCERM
FT                   GVVTMDYWSQGRIVLVGDAAYCPTAMTGMGTTCGMAGAYVLAGEIGKHCGKGFKGGIPV
FT                   PKNSITVALAEYEGRLRPFINTVQKGLTDNKNYMAKFPSSPLGVQMVYVLFWVASLLRL
FT                   DFLAKWVLREDTKGWKLPEYKLMTDCACN"
FT   exon            complement(723476..724762)
FT                   /number=1
FT   CDS_pept        complement(726486..727253)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000278"
FT                   /old_locus_tag="AO070333000051"
FT                   /note="dehydrogenases with different specificities (related
FT                   to short-chain alcohol dehydrogenases)"
FT                   /db_xref="GOA:Q2TYE8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYE8"
FT                   /protein_id="BAE65725.1"
FT                   /translation="MHTGRAYIVTGGSSGMGQAVVKKLLSLSATVHTIDKAGQMPIVSL
FT                   PDSDRLHFHPNIDISSHEKVTQTFESIIQQSPVISGLVNCAGIILPSNILEPVENFNKV
FT                   MAVNVGGTWNMGTTYLRYVLERHADTMRDKKEGSVPEGIGSMVNIGSTASLFGSPGIAS
FT                   YCASKHAVLGLTRTWAKDFGDKGVRVNCVAPGATDTPLLGGVPPAFVDYYVKNVPLRRL
FT                   ARPEELANTVAFLLSDDASYINGQVIPVEGGFH"
FT   exon            complement(726486..727253)
FT                   /number=1
FT   CDS_pept        complement(join(729338..729404,729483..729748))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000279"
FT                   /old_locus_tag="AO070333000052"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYE7"
FT                   /protein_id="BAE65726.1"
FT                   /translation="MQAIHLLCLSSPRRPRRLHQRDGFVPLNPARRNGFVEHPHRTGSW
FT                   YQKSGRNPHIADLGAVVAVGQASAEVGMNVRGVCSTLQSSRHTYLLNLHAMLLLQAGIP
FT                   ADHVSG"
FT   exon            complement(729338..729404)
FT                   /number=1
FT   exon            complement(729483..729748)
FT                   /number=2
FT   CDS_pept        join(730269..730697,730758..730796)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000280"
FT                   /old_locus_tag="AO070333000053"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYE6"
FT                   /protein_id="BAE65727.1"
FT                   /translation="MFMREDTIPLSITGASASQTHQLDGNAFVAMYFVALRNQQTPSGT
FT                   IISELVSCINCYASQEVLAMVVNTPDDTDFNLGAYFGGEPPVRFQFVFTITLRGKESMG
FT                   VIRKAQIDFEEKIESLDLPATWIGFGERAVVLDQTENVKFDARRQPFKRST"
FT   exon            730269..730697
FT                   /number=1
FT   exon            730758..730796
FT                   /number=2
FT   CDS_pept        join(734171..734320,734379..734435,734501..734566,
FT                   734629..734784,734965..735077,735130..735251,
FT                   735567..735619)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000281"
FT                   /old_locus_tag="AO070333000054"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYE5"
FT                   /protein_id="BAE65728.1"
FT                   /translation="MQFKLFVAPLLFALAMAAPSFEDGHLAKRTCGTLTGEKLKICQEA
FT                   CKAICSAGTAGIASGLCEKACDLGPLKREAAPEPEPSFGQKACDVACDVACNSTVLALE
FT                   QRKCLEKCVSVIHQYSFPGFHSADWIPCYRRPSATTRFRGLHVIPSLCDSESEEDELIS
FT                   LSLSEINLENVYVRGNDQRKCRYSGHAAYSNRSDYIVYKPVHLDLIYTRSRVSLLYITN
FT                   EDMMLLGNIHWIAMKL"
FT   exon            734171..734320
FT                   /number=1
FT   exon            734379..734435
FT                   /number=2
FT   exon            734501..734566
FT                   /number=3
FT   exon            734629..734784
FT                   /number=4
FT   exon            734965..735077
FT                   /number=5
FT   exon            735130..735251
FT                   /number=6
FT   exon            735567..735619
FT                   /number=7
FT   CDS_pept        join(736105..736221,737522..738670)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000282"
FT                   /old_locus_tag="AO070333000055"
FT                   /note="hydroxymethylglutaryl-CoA reductase"
FT                   /db_xref="GOA:Q2TYE4"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYE4"
FT                   /protein_id="BAE65729.1"
FT                   /translation="MRDMSSTFESLLYHTSAPLTSLGRVFPYMLPAYYFVRLRYFMNMT
FT                   RIPQAITSKFQTSRASDGETSSVKIENCVGFTRVPLGVAGPLQVQGSDGTTGSFYGPLA
FT                   TCEATLIASCSRGCKALNMCQGVRFKILHDSMSRAPAFWFANTEDAVAFFDLVPSLQPK
FT                   FKKDAESTSKHIRLRTVIPHIVGSSVHVRFEYLCGDAAGQNMVTIATQRVCDRFSASAE
FT                   AHALRLQRITTDNQMSSDKKLAWGNIIRTRGVRVLVWGSVSNDVSKRVLGCSTELLYQS
FT                   ILNSKEGAAMNGQLGYSVNPSNVIAAMFIACGQDAASVAEAAWSQLTAEYDADTKLLRL
FT                   ISYFPSLPVGVVGGGTAYPTQRESLEILGCNVPGTKHRLAGLIASFSLALDISTLAALA
FT                   TQTFSRSHEKLARGRWSPETKL"
FT   exon            736105..736221
FT                   /number=1
FT   exon            737522..738670
FT                   /number=2
FT   CDS_pept        join(738862..739012,739070..739395,739429..739996,
FT                   740046..740068,740112..740170,740222..740268,
FT                   740319..740369,740493..740700,740757..740925)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000283"
FT                   /old_locus_tag="AO070333000056"
FT                   /note="fatty acid desaturase"
FT                   /db_xref="GOA:Q2TYE3"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001522"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR010357"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYE3"
FT                   /protein_id="BAE65730.1"
FT                   /translation="MKNEPLPFNWVTIVVSPITGFLAAVYTPLKRETECFAVIYYFVSG
FT                   IAITAGYHRLWSHKSYGATLPLKWFLAIFGAACCQWSIRTWAECHRSHHRYTDTDKDPY
FT                   SVRHGLVHAHIEWVLQPEIRAGPTDLSDLDADPVVRLQHRYYLTFAIIMSCIFPSGGFI
FT                   YAGVIGLFFCYQAIFSIHSIAHWVGDQPYDDRHTPRNHTLVTLLCFGEGYHNYHHEFPA
FT                   DYHNVVEWYQCDVTKWCIWVWKQLGLAYGLKKAPDNVVGKGTYQQARKKLERKANKLDW
FT                   GLPLSQLPGITWDGFQEAVKDGRQLIILSGMVYDIATFIPFRPGGVKILVSHIEKDATK
FT                   AFNGEIYSHFHCRTKLKLSHVPIPAVIQDSKGKRLYTFEIHEVLVLRYSRPGRDETNRK
FT                   QDKADRRTPHFKLPTSPKQLELPEGADAKAFIVFVTSDDPTTGQSWCPDVRAAWPVLEA
FT                   TFSGVNAPALRVVEVGQKPEWKDLNNVYRTNWKVPCIPALVRYERVNGETAETGKLVEG
FT                   EILDKKRLGEFIGTTL"
FT   exon            738862..739012
FT                   /number=1
FT   exon            739070..739395
FT                   /number=2
FT   exon            739429..739996
FT                   /number=3
FT   exon            740046..740068
FT                   /number=4
FT   exon            740112..740170
FT                   /number=5
FT   exon            740222..740268
FT                   /number=6
FT   exon            740319..740369
FT                   /number=7
FT   exon            740493..740700
FT                   /number=8
FT   exon            740757..740925
FT                   /number=9
FT   CDS_pept        complement(join(741186..741198,741216..742154,
FT                   742451..742542))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000284"
FT                   /old_locus_tag="AO070333000057"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYE2"
FT                   /protein_id="BAE65731.1"
FT                   /translation="MGTSVRGFWIDQECIDQDNEAEKQRAVQSIELESEFCIKSTDFRS
FT                   KATKLCMEYRKDPELQHMCERILDRASKYNVQLLELDNEGKRTIRQSMSPIIFSNVGKR
FT                   GMRDESDRLAVIANCLGYFVRLDSQRLEREAYSLSISMLALFLLNGEILMNGPDNSQSA
FT                   IRSNIFNNLRSQSLRTFQTPDIDQKLTFIKSCRFAEVELLEQGVITSGHLWRLGRIVED
FT                   LGRTRPPQRGHDYQLSWYQRMRLGQLARHLGPGECGSRYGYIASAIDEYLDQDERWGDK
FT                   DVTFSKFYKDLTAEEVVKAMMDDPRSPRLRLGALISQGDRTGTDPYSGIFIREAGHRWE
FT                   KDETMSG"
FT   exon            complement(741186..741198)
FT                   /number=1
FT   exon            complement(741216..742154)
FT                   /number=2
FT   exon            complement(742451..742542)
FT                   /number=3
FT   CDS_pept        complement(join(744490..744599,744662..745045,
FT                   745151..745391))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000285"
FT                   /old_locus_tag="AO070333000058"
FT                   /note="enoyl-CoA isomerase"
FT                   /db_xref="GOA:Q2TYE1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYE1"
FT                   /protein_id="BAE65732.1"
FT                   /translation="MRTVFDRLSTDPSVRAIVFSGSGEKGFSVGIDLKWVSNKDSPFMA
FT                   RPDEIVDPGRRAVTTLRRFGVEFQECISSIERCEKPVICAMHGYALGMAMDVCSAADMR
FT                   ICSKDTVFCVKEVDIGIASDIGILARLPKVVGSYTWVKDVAMSGRNFNADEALRVGFVS
FT                   TVLPTKNDVIGEAFRVARNLSEKSPVAVQTIKHFLDYSRDRTVAEGLQYQLAYNVAAVQ
FT                   TKDVPVAISSILSKEKPIFGKL"
FT   exon            complement(744490..744599)
FT                   /number=1
FT   exon            complement(744662..745045)
FT                   /number=2
FT   exon            complement(745151..745391)
FT                   /number=3
FT   CDS_pept        join(746229..746271,746324..746406,746506..747192,
FT                   747245..747391)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000286"
FT                   /old_locus_tag="AO070333000059"
FT                   /note="dioxygenases related to 2-nitropropane dioxygenase"
FT                   /db_xref="GOA:Q2TYE0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYE0"
FT                   /protein_id="BAE65733.1"
FT                   /translation="MPFNTALTKTLGIKIPVVQGGMHWVGYAELAAAVSNAGGLGLEIR
FT                   KCRSLTNRPFGVNITLLPSLMPPDYGAYVQAIIDEGVKVVETAGNNPGSVIRPLKEANI
FT                   IVIHKCTTTRHAKSAVKLGADFLSIDGFECGGHVGEDDLTNLILLNRARQVLSVPFIAS
FT                   GGFADGHGLAAALALGAEGINMGTRFMCTVEAPIHIKVKEAIVAAQETDTALVMRRWKN
FT                   TTRLYANKVAKDALKVETQSESGKFEEIAPYVNGKRGQQVFLEGDVDSGVWTAGQVIGL
FT                   IHDIPTCADLLARIEQEALTSMKRTESLWTGEASQSRL"
FT   exon            746229..746271
FT                   /number=1
FT   exon            746324..746406
FT                   /number=2
FT   exon            746506..747192
FT                   /number=3
FT   exon            747245..747391
FT                   /number=4
FT   CDS_pept        complement(join(748948..749115,749166..749325,
FT                   749378..749934))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000287"
FT                   /old_locus_tag="AO070333000060"
FT                   /note="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="GOA:Q2TYD9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYD9"
FT                   /protein_id="BAE65734.1"
FT                   /translation="MAGIQTQLDQGAVPNAISNVCPPGTKFQVLEVGWLECDKGFVIRG
FT                   GNTSTKSTETGSFVNERCEMPMYCILIDHPHEGLILWETGSGKDYPTVWGPAIADIFAR
FT                   VKYEPRHELRAAVEATGHKLDDIKKIIIGHLHLDHAGGLDEFLHRTDVEVWVHEKELTN
FT                   AFWSVATGADVGVYLEHYLKLSLNWKTFNDQTLDFCQGITLHHLPGHTDGLIGMQINML
FT                   NTGTFFFISDHCHVIENWRDGIPQGWLARDHPSWFRSTQRLKHLQRITKGQVIPGHDKE
FT                   TFLALQSQANVFT"
FT   exon            complement(748948..749115)
FT                   /number=1
FT   exon            complement(749166..749325)
FT                   /number=2
FT   exon            complement(749378..749934)
FT                   /number=3
FT   CDS_pept        complement(join(750791..750970,751026..751335,
FT                   751384..751439,751449..751615,751710..751731))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000288"
FT                   /old_locus_tag="AO070333000061"
FT                   /note="carbon-nitrogen hydrolase"
FT                   /db_xref="GOA:Q2TYD8"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYD8"
FT                   /protein_id="BAE65735.1"
FT                   /translation="MGFLNIWSTGKVQNLANATQKVLQAASKGASLIILPECFNSPYSA
FT                   TKFREYAEPLSASPDPAKLRCIGTNSQGYRCIHHRWHILSPKGELIAFHRKMHLFDMDV
FT                   PGGMSFHESDTLSAGKKTTTVDLEGYGQIGLGVCYDMRFAELSTIAARQGAFALVYPSA
FT                   FNTTTGPLHWELLGRARAVDNQGYGMVTDPMGQVVAGTNQSEDIAYALLHPETIKRSRM
FT                   AIPITFQRRHDVYPDIGKLVQT"
FT   exon            complement(750791..750970)
FT                   /number=1
FT   exon            complement(751026..751335)
FT                   /number=2
FT   exon            complement(751384..751439)
FT                   /number=3
FT   exon            complement(751449..751615)
FT                   /number=4
FT   exon            complement(751710..751731)
FT                   /number=5
FT   CDS_pept        join(751982..752539,752552..752726,752790..753167,
FT                   753286..753316,753373..753999,754043..754244)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000289"
FT                   /old_locus_tag="AO070333000062"
FT                   /note="serine racemase"
FT                   /db_xref="GOA:Q2TYD7"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYD7"
FT                   /protein_id="BAE65736.1"
FT                   /translation="MADLDTCLPLTVDPFHTAHRSISLYIHRTPVLTSKTLDRIASTPQ
FT                   ERSALEGTHFEDQEPAKPVFRLYFKCEKFQKIGALKARGAFHAVLRLFSGLGLEEVRKR
FT                   GVTTHSSGMKLNAHQNGDCYLLLSKGNHAQALALAAATLKIPAHIVMPSISTSSKIAGT
FT                   KAYNVRVLFGGSTEPERVAVVNETCAILVPPHDHPDIILGQGTAALELEKQVAALMKDV
FT                   DTEVDIKKDHPLNVVITPLGGGEPSFQGGDDGRHGLAAGSRIPTVSTLTIADGLRTPVG
FT                   EINWTVIPDQKKVRGVFAVTEDQIKDAMKLVLERMKLVIEPSAAVPLAVVLFDEEFRTI
FT                   AEKEGGEKGWDVGVIFSGGNTTVEAIWNLHGITLFQLTFTSEGALWNKLFPGYAKLLGI
FT                   YSHSSLSYAGTKPQEAMQHLIKEIEGCKEGLQRHLQFFPLKDLVISVGATTQALSSQFL
FT                   LQDGYPDPELNTLRNLLANPFGNDLDAKVKIEIHAGVYPLLNMQQFSTNASIEMGRPED
FT                   DIAILVLAEVCSVCNDGERPRPEALLVAGTLALGRPVSFTRPIVERISQEHSIVSWEEK
FT                   QADSSGIPRSRTVLFISDIFEDDTYPQHQCFRNLKAVLESAGSILEKTVEVKVFLSDME
FT                   DFEKMNEVYLQWFGDIKPART"
FT   exon            751982..752539
FT                   /number=1
FT   exon            752552..752726
FT                   /number=2
FT   exon            752790..753167
FT                   /number=3
FT   exon            753286..753316
FT                   /number=4
FT   exon            753373..753999
FT                   /number=5
FT   exon            754043..754244
FT                   /number=6
FT   CDS_pept        complement(755154..757067)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000290"
FT                   /old_locus_tag="AO070333000063"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYD6"
FT                   /protein_id="BAE65737.1"
FT                   /translation="MLDTSDSIALTAFVVSIIALAATASQLLQQYFTTAYGYNRCSRRF
FT                   IGDWSRFRHRRYIWREFRFETTFVRPHIYIGFADAKFNAPAPPSPSWNVLDLIPPVRKD
FT                   NAWQSKYLGKSILISQLGDDFSDVRTHVSWTLFLQHIKMFNDLSNRRMQTVSSSLHAGT
FT                   DRDSETSRLYDQLSDSDQIDDRELEDGSGYVLSAKADHSVEPNRHFGICVKFEPCTWDD
FT                   LPGTANILTGTVSLRDLAVFGRLLGLQWNCGPFMGTPGRLEQQGASAGVDSLPPRGGFQ
FT                   AIGNSLALTEKELPQLRYEQREQSPPGFRFPRMETFIIHEATVAMFYGHIVPDDDLLPG
FT                   YLPIRVGDAAAWETRLQQMWIHQRPAASSTFVHCLVPLLSTVISDRFTYAVRVPKPHQF
FT                   TIGPFARPNITDSFRETVDRVIQSCSHLDNMVQERRPGTLVRKIAAAIDDLRQYPRRAN
FT                   TGVQDLNYWTVCQGEASAWAHFENDNNKEAEIFFHKVHDYIDMVQEELSSLIRRKDAAI
FT                   GIYTNLYFDLVCAFFEFAIEQNNNGQSGKANKTRKGPIMQWRATMEALFDNLNVIEASF
FT                   RERGKRRAIMHANGMSAGTLGDQFDVVVRCEGIRGYDSVDSDEIREATIAMVFRAMCWL
FT                   VT"
FT   exon            complement(755154..757067)
FT                   /number=1
FT   CDS_pept        join(758734..758998,759049..759561,759679..759725)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000291"
FT                   /old_locus_tag="AO070333000064"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYD5"
FT                   /protein_id="BAE65738.1"
FT                   /translation="MTKVFRACVVLTLFLLANAADDRTCYYLDGSTANNHVPCTTNSVT
FT                   NCCGSNDICLSNGLCYLQGSQGLSLSRGTCSDKNWGTECYKPCFNETITNSHLMLASYR
FT                   RNTGMPIMNIGYNYSSTQYCCGTVIVDNNAVGCKYEDPFELTEATVIPGVAYLANNGVS
FT                   GNSTSSPSSSSCIAVEAGVSIPLGVIAIAAGIWALWERRRGRRQLRNYSPMSDAEGTVS
FT                   VAPAPSHQHQTAELGGQGVAMSLPELMDTRTEYREAPKRCIPRVQKGNVEGK"
FT   exon            758734..758998
FT                   /number=1
FT   exon            759049..759561
FT                   /number=2
FT   exon            759679..759725
FT                   /number=3
FT   CDS_pept        join(761254..761528,761577..762084)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000292"
FT                   /old_locus_tag="AO070333000065"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYD4"
FT                   /protein_id="BAE65739.1"
FT                   /translation="MRLLLIAPLFSAVSYGAQATNSSISICPPATKPANASDAIPATFP
FT                   GYAFEESSFVYYAGNKTNPNRISQNLIRAVSQKTKTRPVIRVGGTSLDRATYDPNLSDP
FT                   IYNPDPNSGIPTHLKIGPSFFDLFANFPEAKYVIDIPMYHDNLSNSILFAASANKRIGA
FT                   SNIYAWEIGNEPDNYGNTGADWNEKQFSEKWGNWSKAISKALNASLDSQTYQAVALSSQ
FT                   TGVTGTPGGDADSWKMYVLSLMVFQGDTYQKKIQRGDF"
FT   exon            761254..761528
FT                   /number=1
FT   exon            761577..762084
FT                   /number=2
FT   CDS_pept        join(762268..762489,762548..763072)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000293"
FT                   /old_locus_tag="AO070333000066"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR031728"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYD3"
FT                   /protein_id="BAE65740.1"
FT                   /translation="MTEIADLMNHDEVIKGTAFIKTALQNLATIGVDVPIVLGEVGNTL
FT                   GNGSSGVNLEGVLGSALWEVDLSLYTMFLGVHGISMQSGTKFPFALWHPQYSNTAGAVL
FT                   PAFYAQIFAAEFIGSHGNVTVANIDLGQPHLSAYAAYEGANLARLAIINLELWDGRHES
FT                   QEKRHSKQMLLHVPAGTDSVTVKRLTSPAGGMARSSNQITWGGMQWTYENEGRGENVST
FT                   GAERLTVKDGTVHIAVNASEAAMVFF"
FT   exon            762268..762489
FT                   /number=1
FT   exon            762548..763072
FT                   /number=2
FT   CDS_pept        join(765504..765717,765812..766329)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000294"
FT                   /old_locus_tag="AO070333000067"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYD2"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYD2"
FT                   /protein_id="BAE65741.1"
FT                   /translation="MVMLYRCRYKIGRSTGGAAARGHIYYSSGFLLNVQLAYLTSPFRY
FT                   MFFQTQSSHQYLHSRVEDGPIFQISGVIVRPRFAEDVAALVSVLATNNVPFSVRVGGHD
FT                   MFGRSQIHDAVTIDLREIAYVDIDHTGHTARLGGGILVAELIKELEKDNLVTPHGVIPG
FT                   VGYVGWATYGGYGLLSTQYGLGVDQILDAQVVDCEGRIRRADKDMLKAIRGAGGLLGII
FT                   VEVTIKVYPLGQVSEASPSRT"
FT   exon            765504..765717
FT                   /number=1
FT   exon            765812..766329
FT                   /number=2
FT   CDS_pept        join(766652..766670,766803..767092,767165..767245)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000295"
FT                   /old_locus_tag="AO070333000068"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYD1"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYD1"
FT                   /protein_id="BAE65742.1"
FT                   /translation="MPKSVHVPSLDSVIYTRSPHFVLEIGAIVETPHLLPDAIKWGQSF
FT                   YNAVHKTDLANIMPSTYLPLTGPEKVDMGAIYGPNLEVLRDIKQRYDPRDVFRHALVKL
FT                   LRGALEGSSVGGVLNTIAGAKLGDD"
FT   exon            766652..766670
FT                   /number=1
FT   exon            766803..767092
FT                   /number=2
FT   exon            767165..767245
FT                   /number=3
FT   CDS_pept        complement(join(767783..767957,768017..768236,
FT                   768295..768414,768441..768496,768536..768639,
FT                   768678..768776,768801..769392,769442..769549,
FT                   769610..769845))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000296"
FT                   /old_locus_tag="AO070333000069"
FT                   /note="acyl-CoA synthetase"
FT                   /db_xref="GOA:Q2TYD0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYD0"
FT                   /protein_id="BAE65743.1"
FT                   /translation="MIDINASVSQLLLCNIRAQANQTFTSARDVRRPTLEASVVYQNVQ
FT                   DYDCFIFDSLSINYISISVQVKHIAMPQRSRWNVDALAFADAEDPETLSMTWTEPRLWS
FT                   QRLAAGLQAAGGIYQSANPHSNARELAYQFKLTTPHFILASQETLVCALEAAEMVGIGR
FT                   ERVYVFNHAPLAKDGSGNDDSKTGVKHWKNLLASTEIGRSFYWKRLTPSESKLTTVYMI
FT                   MTSGLVILRLPMISSHPNLTIGSTTGLPKAAEVSHYGILSNCVQTDFVMSLEPNLRTKE
FT                   LAAKNSRWLCTIPLYHGLALCYFCTISVARQYEIHCMLESIEKYRITELHLVLPIIVAM
FT                   TKDPATFSCAAPLGPEPTFQYESLWPEGQVNIKQGLASTDLKSMPLLTSPVDPAVIQSA
FT                   GSVGEPIPNCEIRLMDDDENEVEPGQSGEIWFRGPNLMKGQGMWPARMRMGGITSWTER
FT                   RQVTVDEGLKPMRADILWQEMIKVKGVQVWRAELEALLLDHPAVRDAAVIGVRKDHEEH
FT                   PRAYIVAAPETSVTSDDILQFVNNRVSTIKRLTGGVVFTNTIPRSPVRLTRY"
FT   exon            complement(767783..767957)
FT                   /number=1
FT   exon            complement(768017..768236)
FT                   /number=2
FT   exon            complement(768295..768414)
FT                   /number=3
FT   exon            complement(768441..768496)
FT                   /number=4
FT   exon            complement(768536..768639)
FT                   /number=5
FT   exon            complement(768678..768776)
FT                   /number=6
FT   exon            complement(768801..769392)
FT                   /number=7
FT   exon            complement(769442..769549)
FT                   /number=8
FT   exon            complement(769610..769845)
FT                   /number=9
FT   CDS_pept        771777..772823
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000298"
FT                   /old_locus_tag="AO070333000071"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYC9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYC9"
FT                   /protein_id="BAE65744.1"
FT                   /translation="MATITRNPLDSMKSTWRSWDRTQWTAAHWLIETLNIHHIDLDKEV
FT                   PIHQKTDKVPYAPELQFHRWVLIHASIPLIIHQLYINYIGQPSALLVFIFYSLSLELIA
FT                   IHEVHVLRRVGHKIGFFDGDKHPRDGVPDVGVRKTVQTLLSVIFLRPMATVIISYRADE
FT                   PPSSIRWFWLIFETGVYAVVLDFWYYLFHRSAHETEFLWQFHRRHHLTKHPNPLLTAYA
FT                   DLVQEFFDLVGTPLITYGTMKLMGFPMGFYEWWFCQQYIIFTEILGHSGLRMIATAVNP
FT                   WTSFLRLFDMELLLEDHDLHHRKGWKSSYNYGKQTRVWDRLFNTCTTRIEGHRDNIDYV
FT                   NTAEIPLH"
FT   exon            771777..772823
FT                   /number=1
FT   CDS_pept        join(773557..773685,773754..774523,774614..774738,
FT                   774865..775112)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000299"
FT                   /old_locus_tag="AO070333000072"
FT                   /note="metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /db_xref="GOA:Q2TYC8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYC8"
FT                   /protein_id="BAE65745.1"
FT                   /translation="MTQITSNLSSPLQAPGQQAGCTLDVIVHAIDAHDKELQLINEQIH
FT                   KNPELAFEEFKAHDNITTLLEDLGFSVTKHAYGLATAFVAEYGSGGRVVAFNAEYDALP
FT                   GIGHACGHNLIATSSIGAFLGVVAALKASTLPGRVRLIGTPAEEDGGGKIKLIEAGAYE
FT                   DVDACLMVHPAAHKRFPDGVTGVSYVTSNAIVKFRARFTGKPAHAAGAPWQGINTLDAV
FT                   CLSYNGVSMLRQQIQPHERIHGVIVEGGTKPNVITASGTVDYFCRSTSLEEAEALKDRV
FT                   IKCFDGAAIATGCSVEYETREAYADLRPNKALCANYDSAMATLGFPVASSGATQPGSTD
FT                   MGNVTYVCPGFHGGFAVPADPGAFNHTPSFTKAAGTSKAYELALNTAKGMAVVGWNVLS
FT                   DDSLAEGVRNDFEEDKKMRESSRR"
FT   exon            773557..773685
FT                   /number=1
FT   exon            773754..774523
FT                   /number=2
FT   exon            774614..774738
FT                   /number=3
FT   exon            774865..775112
FT                   /number=4
FT   tRNA            780022..780122
FT                   /locus_tag="AO090103t00007"
FT                   /product="tRNA-Tyr"
FT                   /note="tRNAscan-SE"
FT   CDS_pept        complement(join(781235..781378,781912..782656,
FT                   782719..782786,782851..782970))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000301"
FT                   /old_locus_tag="AO070333000074"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYC7"
FT                   /protein_id="BAE65746.1"
FT                   /translation="MPNRPDKRDYITLASSILQFHPEPVNGVFVDDIDKKAYPSNWDHG
FT                   KLPAEMGAWRAHMNVMQRIVHERISTAFVLEDDADWDVNLKKQLQRFASASQLVQGDTG
FT                   PSHSPYGDLWDLLWIGHCGIQYKTGPIHVTTDDITTVPLPELPRYWHGFPAGADNGTRL
FT                   VARMHDGVCSLGYAITYLGAQKLLSALSLTPKGDGAPFDVAIGRFCQNGWLRCIAPFPS
FT                   LIGLWKAAGPKARESDIHNDDGWIEKETPVGTVYSAMDNAHRLLNGERTVHAVLNDAPA
FT                   PEIDPTKLELPEGTLKMLDDTGISEIIKGNPQMSSSSLRLISLGYPPHGRDAGPQRNYP
FT                   ELEPPMKRGCRMIRYSYT"
FT   exon            complement(781235..781378)
FT                   /number=1
FT   exon            complement(781912..782656)
FT                   /number=2
FT   exon            complement(782719..782786)
FT                   /number=3
FT   exon            complement(782851..782970)
FT                   /number=4
FT   CDS_pept        complement(join(786523..787157,787219..787270,
FT                   787324..788229))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000302"
FT                   /old_locus_tag="AO070333000075"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYC6"
FT                   /protein_id="BAE65747.1"
FT                   /translation="MATQLDFPALSKQMMGKWTTEGFDILVSYSEEKVNQLLRARSEQL
FT                   KSILKMGPLETSYVDPLTDETIHLNVFMDLEHPLLQFEDEHGNITLTFDIQKGHYVIIA
FT                   KNITKDLPSGMAISFKTTLNNVKGTVELSQSEDESTGKGVKTASANELVIFNPGEKDIS
FT                   QHVCITFEKASADFIGTTEESKKRVAGMAFLLGAVKEYFQQHAELKYFVAGVSNKYNPE
FT                   SGSDSLQPRSFRFNTLKGKTENDESALCMWISVKEGTNRPESYTQAFEGTFYANGLIPI
FT                   PRGRTCSLIMHNDLLIKQFIMPNLSKGFKSFKDKTSGKGGLNLSATMIADDIDIKEMKK
FT                   KESWGPGGIKTTTVDPMKFSLSDPETTISFGDGIISKSNKINYTNKQQVKWKIDTVTGR
FT                   VPGHEHGTTNLEFKWTATGSWKDKKTPGHPNLLGFDWAGDKNWTITKSAEDVHWWEAFG
FT                   GASNKIPEPLQNLQVPSPNTKLEMNTLDYFLTTNLLYPGKHIFDADDPSSGSTDKGLAF
FT                   PHDLILTGETKIK"
FT   exon            complement(786523..787157)
FT                   /number=1
FT   exon            complement(787219..787270)
FT                   /number=2
FT   exon            complement(787324..788229)
FT                   /number=3
FT   CDS_pept        join(790616..792135,792246..792253,792372..792444,
FT                   792579..792741,792769..793393,793470..793996)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000303"
FT                   /old_locus_tag="AO070333000076"
FT                   /note="serine/threonine protein kinase"
FT                   /db_xref="GOA:Q2TYC5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYC5"
FT                   /protein_id="BAE65748.1"
FT                   /translation="MLDAQKEAEAKIDLLTSSNGPLVTGIYKISSLTKEVKTKRQLLTK
FT                   KLTNIQFAAKQFDWTILLDAASTLVSLRADPKSIVDTVKQGYEIYKKGTDESTAKNLHG
FT                   DAVKKEYIIDQLAQCSDTLESLEKAFTTRKDNQIEIDDPGALKIMATKGNIQKILREFK
FT                   NAIVEKDKKDIESALDDYIAVTLNRNNAVLDYNSSLQLLFEASNAREYSKSQAESLGQR
FT                   RHTLDPNTPAILFWLRKTRDNMRLQLMQRLNYESRAIRFWGLKKHLDYSSPGPLRSFIE
FT                   LRDGQSKLNAAYEDSLNSYANNIRVTWPREEKEKGLFYILSNAELKSFKQRQRLTTSKG
FT                   DDGVYSASIRLEPGAPPFGPGRADVRINQVRLWLLGVEVKADNAGRKQLMVKIAHSGNE
FT                   TLENTDRQALGFSHDAVNIQFEYNTAKVQTPDDFKTDVVFGKQGLENDWSGGDSKPTAS
FT                   TFAAIGPFTEWRFSIRESENVGLDMGSVTAAYVEFRGANRPFSVDYRKAPINPMVDQRI
FT                   KPHSTGRKLDMIDIPYGALADNEWKFEPITLPCEWVEDYRPGGYHPVVLGDIFNNGQYK
FT                   VIRKLGEGSYSTVHLLYFVVHRYLFRFRNRRYVALKILVSEISGSTTELRILRHITEVA
FT                   PAEAGRHITRLLGEFEHHGPNGVHRCLVFEPMGPSVNTMVEELPQFKPRMRGMKIRYPL
FT                   RMAKSILKQSLQALAFLHENGIAHGDFQPGNILFTLDDIGSTPEDVLRQEEDVQAESIS
FT                   PPVQRLDGKEDKWAPRYLCVAQSLVPFTYYAEGFKVKLSDMGGAYFFTDPPTKPVTPLG
FT                   LRAPELILTGAVDNTLDIWSFGCLVFELITGQPLFCIPGSDFEDDDHLLSLTDRLGALP
FT                   DELFKHWKTSSLYFTSERKLFNCQLGGVAPGGEPLMVEQTSMEELFDQAGPDLDEEEAR
FT                   KVKALIRWILQYDPAKRPSPAEILSDPWFCEIDVESESARV"
FT   exon            790616..792135
FT                   /number=1
FT   exon            792246..792253
FT                   /number=2
FT   exon            792372..792444
FT                   /number=3
FT   exon            792579..792741
FT                   /number=4
FT   exon            792769..793393
FT                   /number=5
FT   exon            793470..793996
FT                   /number=6
FT   CDS_pept        join(794301..794430,794487..794677)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000304"
FT                   /old_locus_tag="AO070333000077"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYC4"
FT                   /protein_id="BAE65749.1"
FT                   /translation="MQSQIIPTNSRSPPASLPKRAAALAFINCLSNVCQIYAPYLYLDS
FT                   GAPRYTTAFSVNIGMSSTTIIFSTILRIYLGSLNKKLDQEEGIDLGTDAHDNEEHGLPG
FT                   LL"
FT   exon            794301..794430
FT                   /number=1
FT   exon            794487..794677
FT                   /number=2
FT   CDS_pept        complement(join(796055..796234,796274..796605,
FT                   796749..796764))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000306"
FT                   /old_locus_tag="AO070333000079"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYC3"
FT                   /protein_id="BAE65750.1"
FT                   /translation="MQRVYTFIIGGAIGGGIGGSLGVKKSTNPQPSIPASTTSSAPVTS
FT                   TSATSSSESGRSITASTTSSAPVTSGTSGIAANSCPGINETIVTGSTGSAFTVLCGVDW
FT                   PKGVQAINGKGKECIDSCLGSHKDDCKGVTYSANLTSSFDGGQDGNCFFKDQAGIYFPG
FT                   GDTIISAGVIGG"
FT   exon            complement(796055..796234)
FT                   /number=1
FT   exon            complement(796274..796605)
FT                   /number=2
FT   exon            complement(796749..796764)
FT                   /number=3
FT   CDS_pept        join(798209..798455,798509..799017)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000307"
FT                   /old_locus_tag="AO070333000080"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYC2"
FT                   /protein_id="BAE65751.1"
FT                   /translation="MTDSLKEVSQIQGIEVVQAGLEPIPNQNNPHHVVVPVLANESVPR
FT                   ESRICGLRKMTFWLAVIVAALVAIVIALAVGLGVGLTRSHSVSTPPMATTSSKSTSTPS
FT                   SSPSSTSSDTASSSSTSTSAPSPTSTTFFNKNTNYTCPDANNTEIRNVSGGSGNSSYYI
FT                   FCDADISSSSKKDLSSSVQSSFADCLALCNSMNNFQDRTDVGCTYNFEGTGSQDKGTCW
FT                   CLSGGNKSIITNVGNMAAVLSTENALLNL"
FT   exon            798209..798455
FT                   /number=1
FT   exon            798509..799017
FT                   /number=2
FT   CDS_pept        join(799511..799625,799682..799756,799816..800082,
FT                   800138..800415,800471..800761)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000308"
FT                   /old_locus_tag="AO070333000081"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYC1"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYC1"
FT                   /protein_id="BAE65752.1"
FT                   /translation="MAWLMSLGFVHLVSLLSLGEAKVLSDLSDGFCRSYTFGANIVNDV
FT                   LYMVDLDGGLIPGDTNSSNNYLVQLDLSSSFSTDDGEKYKMSLVDSEVPKIKGQALWSD
FT                   KANTTLFTYGGNYLDVASVDQGLWTYTIADGSWKLQQTSIKPVRLQGGAYVDAPQIQAA
FT                   YWVGGFQNSDTTPAITDSTVDYATGMIQFNTTTGTFTQLDAPFAPVQQGALVYLPIGEK
FT                   GVLVFVGGEVPSIQNGINATLTPNQWNYAWVYDIAGNKWYNQTTTGSVASRTQFCAVVE
FT                   KDLSTSSYQVYVIGGADYKSKDSLTDVYVPIIPYRTIQPNTDSPAPIYRSHRSNGFKPR
FT                   R"
FT   exon            799511..799625
FT                   /number=1
FT   exon            799682..799756
FT                   /number=2
FT   exon            799816..800082
FT                   /number=3
FT   exon            800138..800415
FT                   /number=4
FT   exon            800471..800761
FT                   /number=5
FT   CDS_pept        join(800773..800781,800974..801433,801507..801535)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000309"
FT                   /old_locus_tag="AO070333000082"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYC0"
FT                   /protein_id="BAE65753.1"
FT                   /translation="MTHPGLSTYSLPSATANDIKSSPYPSTWADPALKSLFVQKPNDTT
FT                   NSPDAQPDPSTSTSGSSTKVGPIVGGVVGGVAGAAIILAIIFFALRKRRRDYQKEPQGE
FT                   KWPDNAPVTMGRVGGELPAEAPRRELDARSNARSELRGTTRSVYELDGGRGTGSQIIKT
FT                   RQ"
FT   exon            800773..800781
FT                   /number=1
FT   exon            800974..801433
FT                   /number=2
FT   exon            801507..801535
FT                   /number=3
FT   CDS_pept        join(802419..802618,802661..802841,802849..803583)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000310"
FT                   /old_locus_tag="AO070333000083"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYB9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYB9"
FT                   /protein_id="BAE65754.1"
FT                   /translation="MAVENAIPTTSSTDAQALPDEPKPAKKGYGWRFWAIFPGLCVGGL
FT                   LSALDTTILSTVLPTISHNLDSQTAVQPLYGQVANIFGRRWPTILSVALFALGSGLGGG
FT                   ASSTEMLIAARVIQGLGGGGINVRSLLPTWCLPVYFQLVLEATPKKSGIDLFASFIPMV
FT                   PGAIVGGVLITVTGKDKPLLVAGFILMAVGMGLFTMLDDRTNTVRWVIYQVILALGSVI
FT                   SLIATLPAVLASLPESDVATATATWAFLRSFGSIWCVSIPSAVFNSRFTDLVGRIASPQ
FT                   LRGVLLGGGAYQLATKAFMESLDDTPVVKAQVVSVYVDSLKLVWQVGIAFAALGVPLSL
FT                   LIRSLALRDELNAEFGLEETRTENVEEVRVQ"
FT   exon            802419..802618
FT                   /number=1
FT   exon            802661..802841
FT                   /number=2
FT   exon            802849..803583
FT                   /number=3
FT   CDS_pept        join(805908..805933,806275..807249,807327..807609)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000311"
FT                   /old_locus_tag="AO070333000084"
FT                   /note="3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) reductase"
FT                   /db_xref="GOA:Q2TYB8"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="InterPro:IPR023282"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYB8"
FT                   /protein_id="BAE65755.1"
FT                   /translation="MSSKHLDWILEKTLENIVSAGSSSTATTRLEAFTRAVRIRRITVS
FT                   RTPSTQDLSGGIQNSLLPYHSYNYELVHGACCENVIGYLPLPLGLAGPMVIDGQAYFIP
FT                   MATTEGVLVASASRGCKAINAGGGAVTTLKGDGMTRGPCLGFPSAKRAAEAQRWAESPI
FT                   GRRVLTDTFNATSRFARLQSLTFAQAGTYLYIRFRTTTGDAMGMNMISKGIEQALQAMT
FT                   AHGFPDMNTITLSGNFCADKKSAAINWIGGRGKSVIAEATIPAETVRKVLKTEVDALVE
FT                   LNTAKNLVGSAMAGSMGGFNAHASNLVQAVFLATGQDPAQNVESSSCITTMKNIDGNLH
FT                   IAVSMPSMEVGTIGGGTILEAQGAMLDLLGVRGAHPTDPGANARRLARIIAAAVLAGEL
FT                   STCSALAAGHLVNAHMQHNRSAASSRVN"
FT   exon            805908..805933
FT                   /number=1
FT   exon            806275..807249
FT                   /number=2
FT   exon            807327..807609
FT                   /number=3
FT   CDS_pept        complement(807884..808735)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000312"
FT                   /old_locus_tag="AO070333000085"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYB7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYB7"
FT                   /protein_id="BAE65756.1"
FT                   /translation="MPLREAGLTEPIPVVVSSGGFDSTQEELYFYIAAGARRRGYAVLT
FT                   FDGPGQGIFHRRLDQRAGFPAQAPEGAYMRHDWEAVIRPVLDRLWTYSKANQHLHLGLN
FT                   RVSIFGESMGAYFALRGAGGPRIKACIAMDGFYDMWDIADSRIPPVFVKAWDRLGDRFF
FT                   DRVIRSLGRVHFRTRFEFAHARFALGLPTYAQATRAFQKFSLRGDGEQGEYLARVQCPV
FT                   FVTGAADWAYFPAQGNATRIFEVFNQLHPEMAKLWVTKGVGSSGLQAKVAAISVVHDKT
FT                   FE"
FT   exon            complement(807884..808735)
FT                   /number=1
FT   CDS_pept        join(809402..809479,809554..810105,810107..810457)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000313"
FT                   /old_locus_tag="AO080541000307"
FT                   /note="polyketide synthase modules and related proteins"
FT                   /db_xref="GOA:Q2TYB6"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYB6"
FT                   /protein_id="BAE65757.1"
FT                   /translation="MSSVILSSNNYYICIRFPDHLAQCSSFLNLLPLSGALVGSLVEPL
FT                   LPPNCGSCCILPATSFARFPPNDSTQPAFIIHDEHHGASNAQHPYLLEEDPCVFDAPFF
FT                   SWNAREAEAMDPQHRVLLETVYECLENAGTSIQELQNTQTGVYVGLMTNDYHDIHLRDM
FT                   ETIPKYSGTGTTRSILSNRVSYFFNWKGPSMTIDTAFSSSSLVAVHPAVQSLRSGETPV
FT                   AIAAGANLIFGPEMYIIESKLHMLSPHGRSQMWDDKADGHGRGEGVAAVMLKTLSGGSY
FT                   IRTTWLRLSARIDQWHAEACGSSGGRLSTSFVAKQPLVLAYEVGG"
FT   exon            809402..809479
FT                   /number=1
FT   exon            809554..810105
FT                   /number=2
FT   exon            810107..810457
FT                   /number=3
FT   CDS_pept        join(811682..812149,812234..812266)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000314"
FT                   /old_locus_tag="AO070333000087"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYB5"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYB5"
FT                   /protein_id="BAE65758.1"
FT                   /translation="MLCYLHIVMDGISLRTFLGDLNQSYVSPGVSQPASQYLDYAIAES
FT                   KQLKGQAIKDDLKYWKQQFETPVDCLPLLPFSRVQSRPPLSISKSFTARAFIKKETVAR
FT                   VKECSRQSGSASFHFYAAALQVLLFQLLNGSFDELCIGIADANRHDDRYFDTNIHVRGP
FT                   RAL"
FT   exon            811682..812149
FT                   /number=1
FT   exon            812234..812266
FT                   /number=2
FT   CDS_pept        814218..815300
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000316"
FT                   /old_locus_tag="AO070333000089"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYB4"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYB4"
FT                   /protein_id="BAE65759.1"
FT                   /translation="MARRLWSNHSVSSSHFAWEDEACVLISDLDLEYANLEAESASLTG
FT                   DAGKIMILTGASGFLGKQILQGLVSSPSVSEVHCIAARSQTSMEKLNANESSKIIVHTG
FT                   DLTLPRLGLDITTARSLASRANIIVHNGTDVSFLKSYSSLKKSNVDSTAELVRLAKPCR
FT                   IPIHFVSSAGVAGFVPRNELPLREVSVAAYPPPRDSSAHGYQIAKWVSERLLEMANQQY
FT                   GLDIVLHRPTGIVGEDAPDANILGNLLHYSRQLELAPDMDGWDGYLDLVDVEAVAQQIV
FT                   AVLESPNVSETGVRAVRVVHTCNPGAFPVHELAEYLGRTRGKPLGALPMTEWIGRAMQA
FT                   GMNEMVGLYLQEVTSKRLSW"
FT   exon            814218..815300
FT                   /number=1
FT   CDS_pept        complement(join(816856..817344,817406..817602,
FT                   817656..817773,817826..817857,817912..818104))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000317"
FT                   /old_locus_tag="AO070333000090"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYB3"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYB3"
FT                   /protein_id="BAE65760.1"
FT                   /translation="MVTRQHPRCSITSGKRTIDLINSLTGPVVDHIKSEAARTEQELRE
FT                   LKNARVTPSTTTATGQHLTYYHSLLYSLLSWEQPRATAVSFATVVTFIFAARYLPLLRW
FT                   FFKFIYVALGFTAAAELGGRLVLSQGLASSFRPRKYYTIPKETIEGVYEDLEQLLNFVL
FT                   LEFQRILFAENIVHTVAAFAAAFSAYWLIKWLPFWGLSLIAVTIAYIGPLVYMNNREVI
FT                   DAQIENIQEVVNSQAHQLKDLAEERTSHATGLMKQYVDDYSAKAQEYIGQRRSVSPQMT
FT                   KVSTPEPVIKKEIDTEPVFKTTDFPEAPKEEPVAVKEEPVAVAESIEHPALNAEKEPLL
FT                   AA"
FT   exon            complement(816856..817344)
FT                   /number=1
FT   exon            complement(817406..817602)
FT                   /number=2
FT   exon            complement(817656..817773)
FT                   /number=3
FT   exon            complement(817826..817857)
FT                   /number=4
FT   exon            complement(817912..818104)
FT                   /number=5
FT   CDS_pept        join(821021..821199,821255..821345,821397..824183,
FT                   824246..824548,824603..825163)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000319"
FT                   /old_locus_tag="AO070333000092"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYB2"
FT                   /db_xref="InterPro:IPR005635"
FT                   /db_xref="InterPro:IPR039130"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYB2"
FT                   /protein_id="BAE65761.1"
FT                   /translation="MAASGARAQKPVGSAAWISTEKENFTNLLNQEMEEVEYPVRHEMD
FT                   WLNEHMAEIFSNNQFNFTEAFKTPGKLRGKTPRTARKRDPAENRVPLSEIFSTSHNRFE
FT                   DKVASPTPHRSPAKQKAPVSVPTPAPAAATPTKPKHATENAPRLQYPDLSKDLNSLTTY
FT                   NTDSGYHEMPDEGEEEEDDDVVLTQVQPESQISTQPFDSQPTPKDVQEHRSSISRRSTA
FT                   ASFHSAHEDVQQRGNTVEPMQIDSTPKEATKEHTPQPLPKPKEPEPKPETEVQPEPEPE
FT                   PEVEPEVQSDVEPDGEDDAEPEAKEPTPALQQEAEQVEEPEAAPETQLPKTISSPAKSS
FT                   PMKTSAPQPSEPREEVKDDAKDDMALDDENLDDIGSPSDGSTPDRPLIRKSSLSFASLP
FT                   AREPLMKKSLGGSRISRTSHIDIAKINNTGGSGFLGRQTGGHKSTQAALDENATNGEKM
FT                   DLDDDKQGSQEDTDADTKASKLHNKSSTQRLHEKISMLGKLQPSRPTKSIPAVQGLSST
FT                   QVTYPELPSSKADTKPETASQKSHGTPAPEPMETEDDDWIRPFGSPSKANFPRGQTADA
FT                   PEKRSGVGASHATDHDDAPAARKESAASEEPARSSAKQGLEAVLGKYSTPTYSSPQRPS
FT                   HQAKVSTSHLDSQVSTTPAGSPLAQDGLVSASKSRLQSIVRSAKGLFTNSGGVAAAARM
FT                   EASSPDEHRVQRSERVEPDRTSRKVPQPTRDHSPPRQEGRRTRSSTEREERRKQKELED
FT                   RQREEEEEQAERARQQEKERQRAAQLKAAQEKLSAENESRKAPVAPTPQKMSQLQKHSS
FT                   REPEPSYEAASKPTARPSVSQQQSTRQRPPRPTRETLQKPKPQPQPVSIRVGSALSRHI
FT                   PLASSSVSGAAESSVPAPTPASASKQPTLKKKASNSSLHTASSNSSFKSSVSSQTQRKA
FT                   QLASERKREQEEREARRREEQRRELERKRAAQQQEETRRQEMRSRAEAERRERLASEDP
FT                   KKAAQMQAIEKRRLENARRLERQGSQQPEMNTTHPPERPASQAARPASRLGSMQPYNRT
FT                   INPPQPNPAKPPKRGLDDEPGHRSAAPKPGTMQPSGETKRRRTEDEHNPVMRPTMAPPI
FT                   RQSNIRKESMIRKEPTKPSMYGHAQPGSSIFKTAQSQRPAHPMDMAKYASGKIPFAEPS
FT                   NAPQPATHKTPVASSSAKKSAHKPSPNYPNGENIHLPEIATDSEDEDSDAEMLPVPKWA
FT                   QPKELESLLRQQEGLEADSIFGPIAPFSLEETFKSDKRIKKFRERTSSANWAGTDALTQ
FT                   EEIRRDLAERQRLRLNGGWSFN"
FT   exon            821021..821199
FT                   /number=1
FT   exon            821255..821345
FT                   /number=2
FT   exon            821397..824183
FT                   /number=3
FT   exon            824246..824548
FT                   /number=4
FT   exon            824603..825163
FT                   /number=5
FT   tRNA            825738..825808
FT                   /locus_tag="AO090103t00008"
FT                   /product="tRNA-Gly"
FT                   /note="tRNAscan-SE"
FT   CDS_pept        complement(join(826181..826354,826407..826604,
FT                   826667..828967,829055..829465))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000320"
FT                   /old_locus_tag="AO070333000093"
FT                   /note="predicted signaling-associated protein (contains a
FT                   PDZ domain)"
FT                   /db_xref="GOA:Q2TYB1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR025926"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2TYB1"
FT                   /protein_id="BAE65762.1"
FT                   /translation="MDLNGDAGAKRKRSSIVPAERPAKHLKPESSALTPGDSTPANGTV
FT                   YDIEDEDDASRLLPIGPAQADSPEWQATIEEVVKSVVSIHFCQTCSFDTELSMSSQATG
FT                   FVVDAERGYILTNRHVVCPGPFWGYCIFDNHEECDVRPVYRDPVHDFGILKFDPKAIRY
FT                   MNLTELKLQPDAARVGSEIRVVGNDAGEKLSILSGVISRLDRNAPEYGEGYSDFNTNYI
FT                   QAAAAASGGSSGSPVVNIDGHAIALQAGGRADGAATDYFLPLDRPLRALECIRRGEPVT
FT                   RGTIQTQWILKPFDECRRLGLTPEWEATVRKAAPTETSMLVAEIILPEGPADGKLEEGD
FT                   VLLQVNGELLTQFIRLDDILDSSVGQTVRLLVQRGGQDVEIECQVGDLHAITPDRFVTV
FT                   AGGTFHDLSYQQSRLYAIATRGVYVCEAAGSFKLENTLSGWLIDSVDKRPTRNLDEFVE
FT                   VMKTIPDRSRVVISYRHIRDLHTRGTSIVYIDRHWHPKMRLAVRNDETGLWDFSDLADA
FT                   LPALPPVPRKADFIQLDGVSQPAASEIVRSFVRVSCTMPLKLDGYPQAKKTGFGLVVDA
FT                   EKGLVVVSRAIVPYDLCDINITVADSIIVNAKVVFLHPLQNYTIIQYDPSLVQAPVQSA
FT                   KLSTEYIKQGQDTIFVGFNQNFRIVVAKTAVTDITTVSIPANASAPRYRAINLDAVTVD
FT                   TGLSGQCSNGVLIGEDGVVQALWLNYLGERTPSSHKDVEYHLGFATPSLLPVVSKIQQG
FT                   VMPELRILNMESYVVQMSQARIMGVSEEWIEKVTQANPSRHQLFMVRKVDCPPAGFDNM
FT                   ADTFQEGDILLTLDGQLITRVSELDVMYDKEFLEALIVRNGQEMRIQVPTVPTADLETD
FT                   RAVVFCGAVLQKPHHAVRQQISKLHSEIYVSARSRGSPSYQYGLSPTNFITAVNGVPTP
FT                   DLDRFVKEVSKIPDNTYFRLRAVTFDNVPWVVTMKKNDHYFPMSEYLKDPSQPCGWRTV
FT                   SHNKSKHKDGIAPDAANLNPDAMEQGYDGASDIEPEAE"
FT   exon            complement(826181..826354)
FT                   /number=1
FT   exon            complement(826407..826604)
FT                   /number=2
FT   exon            complement(826667..828967)
FT                   /number=3
FT   exon            complement(829055..829465)
FT                   /number=4
FT   CDS_pept        complement(830747..831304)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000321"
FT                   /old_locus_tag="AO070333000094"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYB0"
FT                   /protein_id="BAE65763.1"
FT                   /translation="MASISANNLVPAQPQRPAPQQNPQQASAPPVTPSPATAREKARVT
FT                   VLLDINSMLLQEVVNLQAAGKAGGPPAQPQDSNPPSDQNPDTAKGPTQKPSQEYIDCMR
FT                   RLQANLAYLATIADRAKKSGGVPPTAPSIMTPPPHMPSMNEMYKKLAELFPRTAPGTTG
FT                   TPQPSPQGNGKPSPSPATETVV"
FT   exon            complement(830747..831304)
FT                   /number=1
FT   CDS_pept        complement(join(831629..831714,831789..832017))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000322"
FT                   /old_locus_tag="AO070333000095"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYA9"
FT                   /protein_id="BAE65764.1"
FT                   /translation="MDPNATGFSMLQQQQQHFPVTSQSPQQFPYYPNAIPSYPQQKAPS
FT                   HLPQQHSFGAMPMQAGAPGGAMMPAGFPQHSGWLSILALFLYSGLPSTLCAPLDNGMDR
FT                   "
FT   exon            complement(831629..831714)
FT                   /number=1
FT   exon            complement(831789..832017)
FT                   /number=2
FT   CDS_pept        join(836978..837045,837096..837631,837685..838190)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000325"
FT                   /old_locus_tag="AO070333000098"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR021264"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYA8"
FT                   /protein_id="BAE65765.1"
FT                   /translation="MAGKSPMSPQSPGTSNLSRKNSMFQTHQDGHQAKRKRVSHECVVP
FT                   MSINCHQKTMLPIRNHGLLRKYYEKAFESLQQINCRILAKAYIKLVEPRKQVNYPYNGR
FT                   KIISGSSQQFDPELTKPAWWPSGVTHREPDHLLKAERIRLLVHILCELRSSHAICVEKL
FT                   READQSIRRQILPGERLQVLDEIYSVREEEEAFLDGRTDGQAVVCVSRVNLPDMAEAQA
FT                   MGSPGSTMQTDLNPVYRKEVPDMESHTSVFPSTGSSPTSDTTKHSMASTKSTSSVSTTW
FT                   DPCLPPSLPSLSTLKRTRPGESSYPLEFNTNIFQHEPPTTVSIDSHYPLKYYSEPHLGH
FT                   NQHSQPLPVMGMTGTADMGCANPYYFTSY"
FT   exon            836978..837045
FT                   /number=1
FT   exon            837096..837631
FT                   /number=2
FT   exon            837685..838190
FT                   /number=3
FT   CDS_pept        complement(join(838733..838764,840178..840738,
FT                   840796..840909,840969..841101,841173..841329,
FT                   841405..841457))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000326"
FT                   /old_locus_tag="AO070333000099"
FT                   /note="beta-1,4-xylanase"
FT                   /db_xref="GOA:Q2TYA7"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYA7"
FT                   /protein_id="BAE65766.1"
FT                   /translation="MRFQHLTTALAVGVSAHLAQAAGLHDAAVAKGLLYFGTATDNPEL
FT                   TNTSYVTQLNNTGDFGQITPGNSQKWDSTEPSQNEFSFTNGDVIADLADANDQKLRCHN
FT                   LVWHQQLPNWVSSGSWTNETLTAVLQNHITNVVKHYKGRCYAWDVVNEALADDGSYRDS
FT                   IWYKTIGEAYIPIAFAAAAAADPDVKLYYNDYSIEWGGAKSTAAQNIVKLIQSYGGKID
FT                   GVGLQAHFTVGQTPARKDLASNLKAFTDLGVEVAYTEVDVRMETPATDANLQQQSTEFS
FT                   NIVGACLDTEGCVGVTIWDWTDKYSWVPSTFPGYGAACPWDENFEKKPAYQGILEVLGG
FT                   WIALRLLFV"
FT   exon            complement(838733..838764)
FT                   /number=1
FT   exon            complement(840178..840738)
FT                   /number=2
FT   exon            complement(840796..840909)
FT                   /number=3
FT   exon            complement(840969..841101)
FT                   /number=4
FT   exon            complement(841173..841329)
FT                   /number=5
FT   exon            complement(841405..841457)
FT                   /number=6
FT   CDS_pept        complement(join(842439..843154,843217..843489,
FT                   843596..843704))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000327"
FT                   /old_locus_tag="AO070333000100"
FT                   /note="Hsp90 co-chaperone CNS1 (contains TPR repeats)"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019412"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYA6"
FT                   /protein_id="BAE65767.1"
FT                   /translation="MPPAMEAVRSHTTDEIADMMNKTPLFMTDIDKAKDENGENVFLDA
FT                   LQALQNEGTRAEVAQNFREQGNEAAKELRWIDAKEFYTKALAVIFAKVDKWEKPEDLDA
FT                   EQKLLRQVEEASYINRALCNLELGNYRQCTLDCASTLKMNPKNIKAFYRSAMACLKLDK
FT                   VDDAEDAAKRGLAIDPNNKSLQIAAEKAAERKAAIERVSAKRKAEEERKKQEKKLLDVA
FT                   LKAREIRTRTTDNPADLQDAVMHLVPDPLSPESTLEFPAVFLYPMDAQSDFIKAFSEMH
FT                   SIEDHLEYIFPLPWDANNEYTIKSVDCFMETATGGLIKAGKKLPLLQILSGSKVEVVDQ
FT                   LVKFFIVPTAKSGQFIAEMKKRKQV"
FT   exon            complement(842439..843154)
FT                   /number=1
FT   exon            complement(843217..843489)
FT                   /number=2
FT   exon            complement(843596..843704)
FT                   /number=3
FT   CDS_pept        join(844428..844905,844987..845404,845475..845694)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000328"
FT                   /old_locus_tag="AO070333000101"
FT                   /note="3-isopropylmalate dehydrogenase"
FT                   /db_xref="GOA:Q2TYA5"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYA5"
FT                   /protein_id="BAE65768.1"
FT                   /translation="MTIAKTYNILVLPGDGIGPEIMAEATKVLSAFNTSTVQFNTRSEL
FT                   IGGCSIDLHGKPITDAVKEAALASDAVLFAAVGGPKWDNMRRGLDGPEGGLLQLRKAMD
FT                   IYANLRPCSADSPSRSVAREFSPFRQEIIEGVDFVVVRENCGGAYFGRKVEEDEYAMDE
FT                   WAYSTSEIQRITRLSAELALRHDPPWPVISLDKANVLASSRLWRRVVEKTMAEEYPQVK
FT                   LVHQLADSASLILATNPRVLNGVILADNTFGDMISDQAGSIVGTLGVLPSASLDGLPSE
FT                   TRRRTNGLYEPTHGSAPTIAGKNIANPVAMILCVALMFRYSLDMEREAQQIEEAVRTVL
FT                   DSGIRTPDLGGKAGTTEVGDAIVAVLRGQKL"
FT   exon            844428..844905
FT                   /number=1
FT   exon            844987..845404
FT                   /number=2
FT   exon            845475..845694
FT                   /number=3
FT   CDS_pept        join(847624..847733,847836..848664)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000329"
FT                   /old_locus_tag="AO070333000102"
FT                   /note="catalase (peroxidase I)"
FT                   /db_xref="GOA:Q2TYA4"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR002207"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYA4"
FT                   /protein_id="BAE65769.1"
FT                   /translation="MSTPGDYDAVRRDIVAQLKKPDYDDGSAGPVFVRLAWHSAGTYDA
FT                   ESDTGGSNGAGMRYEAEGGDPANAGLQHGRAFLEPVKERHPWITYSDLWTLAGVVAIKE
FT                   LGGPEVEWKPGRTDLVDDSKVPPRGRLPDAAQGAEHLRFIFNRMGFNDQEIVALAGGHN
FT                   MGRCHMDRSGFHGPWVNNPTRFSNQFYNLLLKLEWTPKTLENGIQQFVYVDPDAEEGDE
FT                   QLMMLPTDVALITDPKFRVWVERYAQDKELFFDHFAKVFAKLIELGIKRDAKGVIINSD
FT                   NVKGGYVSAPKKSNVPTGLSQRGGGCPMARL"
FT   exon            847624..847733
FT                   /number=1
FT   exon            847836..848664
FT                   /number=2
FT   CDS_pept        complement(849332..852367)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000330"
FT                   /old_locus_tag="AO070333000103"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TYA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYA3"
FT                   /protein_id="BAE65770.1"
FT                   /translation="MSSENSDARSLKEEDDFKYNPELNYPMVKLADLPEPPKNWRVCGR
FT                   TAEEASKARKATSEEAKKWVRYHSWGIDMGVKGDLTNLRCFKVLWKLFYYQQDKHRPQD
FT                   FDQIKDFKTRDAGPRLLQCSLDVPGLLPISRYYPHPPPATRLPAEGFHRPLDALASRPD
FT                   SHIEQMLYPVFGVPKEVDNFPEEIETPTAQATGNSTGNRNQHKIRLPKVMARSVMEAIE
FT                   RTVMQFAYEDLARDCSAVAQDGQVHLTAKTEEDLRQANIGSFPATSHVKLAVDPDNSDR
FT                   LVFSADGDKYPYRGRGPVYRNNSSGIDSIIVLGKLLDAGSTVLDRKDPEWRGRFTNVEK
FT                   AFIEATDVNWDLCSRGDSRDRFWAVMAAEAENVGVGVQSPLLDMWNVSTEHFDQFLFTY
FT                   DEQTTFCSPCTNRTTNAAYQSATVAPPTCPEDMKGVSMQQLISRSFASEYISRCGKCQD
FT                   KVVKCRRMLHGLPMRLTVTLDGSVPVKKHTRDISFDYITNGGERGTAAYRWLGGIYCKA
FT                   DHYRVYWNDTKRGEVDTGQIQMYDSAMLSGVIVGGIAQAHRDDKVPETWWKNKPVPLLV
FT                   YERIMNPDDEVMNVALHALGDMVKVRNQQKLLLQGHISWTPSEPPRARAGFPWRRLIDR
FT                   KEDRFHLASGAYDPRNQGQISTEPSGVDRHANIPGPSSAGPSKIDVGSSTSSAPVPEPQ
FT                   PEIGRISPSLWEAPTASMFAEISPLFALAPTPSLSGLESIIEDTALINEQLNGPHQEQY
FT                   RAQSNVQNNAQYATQSSSQLHAGHNMQQTTQPSGQQHGQADRQYNATQTNTQYQRPYNP
FT                   HHRTQTTAQQPNGYNAQQHQVQHNAQYRVQPSTHPHEPHGTFNDTSFGLQDIMHDGLFQ
FT                   DWTSGGIDDFGFSFPELSSSIFFSPKPSHASSTNSAPAPVENSIKHSHQNTNNGGSMPQ
FT                   YIDPSVLTAAPQNPSSLPQQVRPRPVDGQRPASHVAPAAGIRWHSHGNVASSHMSANQT
FT                   PQGSKRKRVDEAEPRRHPPNLR"
FT   exon            complement(849332..852367)
FT                   /number=1
FT   CDS_pept        join(853540..853543,853761..853926,854077..854374)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000331"
FT                   /old_locus_tag="AO070333000104"
FT                   /note="ribosomal protein S18"
FT                   /db_xref="GOA:Q2TYA2"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYA2"
FT                   /protein_id="BAE65771.1"
FT                   /translation="MSLVSGEKTNFQYILRLLNTNVDGKQKIMYALTQIKGVGRRYSNL
FT                   VCKKADVDLNKRAGELTTEELERVVTILQNPTQYKIPTWFLNRQRDITDGKDSQVVSNN
FT                   LDSKMREDLERLKKIRSHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKG"
FT   exon            853540..853543
FT                   /number=1
FT   exon            853761..853926
FT                   /number=2
FT   exon            854077..854374
FT                   /number=3
FT   CDS_pept        complement(join(855169..856334,856387..856849))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000332"
FT                   /old_locus_tag="AO070333000105"
FT                   /note="serine carboxypeptidases (lysosomal cathepsin A)"
FT                   /db_xref="GOA:Q2TYA1"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR008442"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2TYA1"
FT                   /protein_id="BAE65772.1"
FT                   /translation="MRVLPATLLVGAASAAVPPLQQVLGRPEEGMSFSKPLHAFQEQLK
FT                   TLSEDARKLWDEVANYFPDSMDHSPIFSLPKKHTRRPDSHWDHIVRGSDVQKIWVNNAD
FT                   GEKEREIDGKLEAYDLRIKKADPSALGIDPNVKQYTGYLDDNGNDKHLFYWFFESRNDP
FT                   KNDPVVLWLNGGPGCSSLTGLFMELGPSSIDENIKPVYNDFSWNSNASVIFLDQPVNVG
FT                   YSYSGSAVSDTVAAGKDVYALLSLFFKQFPEYAEQDFHIAGESYAGHYIPVFASEILAH
FT                   KNRNINLKSVLIGNGLTDGLTQYGYYRPMGCGEGGYKAVLDEATCESMDNALPRCRSMI
FT                   ESCYNSESAWVCVPASIYCNNALIGPYQRTGQNVYDVRSKCEDESNLCYKGMGYVSEYL
FT                   NKAEVREAVGAEVGGYDSCNFDINRNFLFHGDWMKPYHRLVPGLLEQIPVLIYAGDADY
FT                   ICNWLGNKAWTEALEWPGQKEYASAELEDLKIEQNEHTGKKIGQVKSHGNFTFMRLYGG
FT                   GHMVPMDQPEASLEFFNRWLGGEWF"
FT   exon            complement(855169..856334)
FT                   /number=1
FT   exon            complement(856387..856849)
FT                   /number=2
FT   CDS_pept        join(857458..857524,857682..858646)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000333"
FT                   /old_locus_tag="AO070333000106"
FT                   /note="predicted exosome subunit"
FT                   /db_xref="GOA:Q2TYA0"
FT                   /db_xref="InterPro:IPR002140"
FT                   /db_xref="InterPro:IPR018978"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="InterPro:IPR036786"
FT                   /db_xref="InterPro:IPR037188"
FT                   /db_xref="InterPro:IPR039100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TYA0"
FT                   /protein_id="BAE65773.1"
FT                   /translation="MPIMQPSNQIKFTNVSVVRLKKGKKRFELACYKNKLLEYRSGAEK
FT                   DLDNVLQVPTIFLSVSKAQTAPSAEIAKAFGANTPADEIRQEILRKGEVQVGERERKEI
FT                   IERVEKEVLDIVSGRLVDPTTKRVYTPGMISKALDQLSSASGQMQQAQSQNNNGEASGA
FT                   GDESRPAQPRKPLWTGVTPNKSAKIQALEAMKALIAWQPIPVMRARMRLRVTCPVPLLK
FT                   QTVKSAAPAGLNKEKEAPSGGNSKSNKKGGKGSKKSARQQDSDAEGGSDAEPSQPKAPT
FT                   NVKDKILSFIESVESQEIAGDEWEVVGFAEPGAFKGLNEFVGNDTRGRGRVEVLDMAVT
FT                   HED"
FT   exon            857458..857524
FT                   /number=1
FT   exon            857682..858646
FT                   /number=2
FT   CDS_pept        join(860012..860085,860152..860275,860326..860366,
FT                   860420..860629,860693..861029,861107..861196)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000334"
FT                   /old_locus_tag="AO070333000107"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY99"
FT                   /protein_id="BAE65774.1"
FT                   /translation="MKTGDDIMLTRTVLTGTIIARLSTDVCTGGEVNKHSNILTVPYSH
FT                   HMFTMLLGNKLCLAPISDDVQRVLDIGTGTGIWAIDFADEYPSAEVIGTDLSPTQPSFV
FT                   PPNLQFEIDDAEDSWAYPENHFDLIHVRALYGAISDWPAFYRNVLIGLRPGAWFDQLEM
FT                   SIQFRSDDGTVTSDHILAEWSRIFIEAGERFGKTFRIADLARQHMIDAGFENVTERRFK
FT                   LPVGPWSNDEHYRQLGRWNLLHCEQGIEGWSMALLTRVMGWSYEEVQVFLAKMRKGLRD
FT                   YSKIHAYFYV"
FT   exon            860012..860085
FT                   /number=1
FT   exon            860152..860275
FT                   /number=2
FT   exon            860326..860366
FT                   /number=3
FT   exon            860420..860629
FT                   /number=4
FT   exon            860693..861029
FT                   /number=5
FT   exon            861107..861196
FT                   /number=6
FT   CDS_pept        862741..864474
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000335"
FT                   /old_locus_tag="AO070333000108"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY98"
FT                   /protein_id="BAE65775.1"
FT                   /translation="MTRQIVSPVPADDEYYDLGSFGHSITTNSGDAQIWFNRGLTWVYS
FT                   FNHVEGAYCFEQAIAHDPTCAMAYWGLAYAVGPNYNKPWEKFDLGDLHRSVQRGYEASR
FT                   EAAKHAVNATHLERALIEAIQSRFPTDQPATDYAALNKGYAAAMKLVYDIFGRDLNIAT
FT                   LYADALMNMTPWSLWDLFTAKPNPNAPTMEVKAVLERALAQEEDGPYLNPGLLHLYIHF
FT                   IEMSPTPELGINVADHLRDLVPDAGHIHHMPTHLDILIGDWRRSIASNHNSTLADDKYF
FT                   RKSGAKNFYTFYRLHDYHSLIYAAMFAGRRKTALDAVTRMEATVPEDVLRIQSPPMADW
FT                   LEQFMSIRLHVMVRFGMWEELKRKELPHDQELYAGVTATTHYAKGIAFAATGDVATARE
FT                   EQERFHQAWARVPATRRAYNGKIVDVLGVASAMLEGEIEYRCANYDKAFASLREAIDLE
FT                   DKLPYSEPWSWMQPVRHAYAALRMEQGYLEEAAQTYRADLGLDHSIIRQRRHPNNVWSL
FT                   QGYYECLVRLGRMDEAAMIEQPAKLALAAADVPIKASCFCRLDTAEIPQVLNGCSKGKC
FT                   C"
FT   exon            862741..864474
FT                   /number=1
FT   CDS_pept        865197..866522
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000336"
FT                   /old_locus_tag="AO070333000109"
FT                   /note="1-aminocyclopropane-1-carboxylate synthase, and
FT                   related proteins"
FT                   /db_xref="GOA:Q2TY97"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY97"
FT                   /protein_id="BAE65776.1"
FT                   /translation="MGSIGYPDVQPLEIFSKRGQNAVELGSKRIIWDVISDMWNPDTNP
FT                   SGILSIGMAENTLLHNTLLQYIEANFRLSAEHLTYNNGSMGSNALRKAVSHFLNRHFNA
FT                   FRPVEPSHILMTNGCSSAIEHLSWAFVNPGEGVLLGMPYYSTFIADISLRPEAVVIPVK
FT                   MGNVDPLSIESVDLYEKAAVEFEASTGRRVRAVILCNPHNPLGRCYPRETIDKFMEFCQ
FT                   SRQMHLISDEIYALSVWENRVDKDIPFTPFESILSRDITRLIDPSLVHVLWGMSKDFGA
FT                   NGLRVGAIISQSNPELHIAQKCLSLYSFVSGMSDQITASILSDDHFTDKYIEMNRERLS
FT                   LSHQFLVHALNKHKIEYLRGCNAGFFLWVNLGAKYLAAHPEEEGRATDLTDRIFQKLLD
FT                   NKVYVAHGTAYGSENPGWFRLVFAHPIPWLMEAMARIVCAIQ"
FT   exon            865197..866522
FT                   /number=1
FT   CDS_pept        join(867365..867745,867821..868001,868050..868513,
FT                   868564..869130)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000337"
FT                   /old_locus_tag="AO070333000110"
FT                   /note="amino acid transporters"
FT                   /db_xref="GOA:Q2TY96"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY96"
FT                   /protein_id="BAE65777.1"
FT                   /translation="MGIYMENATDKAQGEPVDHGADTQLHRTLGTRHLTMVALGSAIGM
FT                   GMWLGSGTSLANGGPASLFIGFLISSSIIWSVCQSIGEMAVIYPLPSAFVQWATIFISP
FT                   AAGFALGWGYWFSYWITIANELQGVVTVLNYWTDEVPKAAWISIFWAVIILINIWAVRF
FT                   FAEVEVVASTIKFGWMFICVIALIVVTAGGSPQGGPIGFRYWNAQPVNNGFKGFISVIP
FT                   TCIFAMAGSENAALVATEVANPRESVPKAIKSVWFRLGLFYILGSLMITLTVDPNDPSL
FT                   FGGSGSNASPFVIAFKNAGIPILAHITNAVIFISVISTGSISGYGGSRILMGLAHVKMN
FT                   HKDVLQVFGKADSVGRPWAGYIATIGIGGALAYLNVTHTGAQVFTWLSNLVSLLTLFGW
FT                   SMICLSHLRFRYTWTLQGRNEAHLPWRSWAYPYAAWWGLIWCLVVFGIQFYLSIWPLHE
FT                   KTSAKNFFANYISVIAVAIIWVCAQVWYSCPLWADARNIDLDMCRRFYADTVDEESTPV
FT                   AKSLARKLRVVCK"
FT   exon            867365..867745
FT                   /number=1
FT   exon            867821..868001
FT                   /number=2
FT   exon            868050..868513
FT                   /number=3
FT   exon            868564..869130
FT                   /number=4
FT   CDS_pept        complement(join(870701..871517,871579..872268,
FT                   872325..872674))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000338"
FT                   /old_locus_tag="AO070333000111"
FT                   /note="purple acid phosphatase"
FT                   /db_xref="GOA:Q2TY95"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR014390"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR025733"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY95"
FT                   /protein_id="BAE65778.1"
FT                   /translation="MKATTASVLLALLSAVNGRPTVDNRFPYKGPAVPVGDWVDPTING
FT                   NGKGFTRLVEPPAVKPASSHPTNNVNVISLSYIPDGIHIHYQTPFGLGQSPAVKWGTSP
FT                   YHLVNVARGFSHTYDRTPSCSQMKAVTQCSQFFHEVSLPHLESGKTYYYQIPAANGTTE
FT                   SEVLSFTTARKAGDPTEFSVAVLNDMGYTNAQGTQKYLTKAASEAAFAWHGGDISYADD
FT                   WSSGIMACEDSWPVCYNGSSTSLPGGVITSEYKKPLPQGEIPNQGGPQGGDMSVIYESN
FT                   WDLWQQWMGNITKKIPYMVLPGNHEAACAEFDGPHNVLSAYLDHNEPNSTWTKNDLNYY
FT                   SCPPSQRNFTAFQHRFRMPGSESGGVTNFWYSFDYGLAHFVSMDGETDYANSPEWSFAE
FT                   DLTGDETFPTESETFVTDSGPFGAIDGSVKNTKAYEQYKWLKKDLSSVDRTKTPWVIVM
FT                   SHRPMYSSAYSSYQKNIREAFEALLLQYGVDAYLSGHIHWYERLWPLGANGTIDTASVL
FT                   NKNTYRVNPGKSMTHIVNGMAGNIESHSEFSAGQGLTNITAVLNTKEYGFSKLTVANAT
FT                   ALKWEYVKGSDGSAGDTLWLVKPEAAGFQGRGKSPYGKKTRS"
FT   exon            complement(870701..871517)
FT                   /number=1
FT   exon            complement(871579..872268)
FT                   /number=2
FT   exon            complement(872325..872674)
FT                   /number=3
FT   CDS_pept        complement(join(875369..875652,875743..876067))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000339"
FT                   /old_locus_tag="AO070333000112"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY94"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY94"
FT                   /protein_id="BAE65779.1"
FT                   /translation="MSLREKVRRVFRRSPSGSKSKDNSNSIKIEYYKRHEIPPSKFKGP
FT                   FDREHQKRLAAWSFDDAQAERPRSPDLSLSPCASLPDYLRPRVQEDSVAPDEVPSLAPE
FT                   GLSDASATISDNERAERQDDSGSTSSTAYDPDSYSSSMMTLFDEAIRQDSIAQFKETIR
FT                   YTSPVVRAISPPPLSPKGSYMPFAPEDLTRALNAVQICG"
FT   exon            complement(875369..875652)
FT                   /number=1
FT   exon            complement(875743..876067)
FT                   /number=2
FT   tRNA            877967..878038
FT                   /locus_tag="AO090103t00009"
FT                   /product="tRNA-Arg"
FT                   /note="tRNAscan-SE"
FT   CDS_pept        join(879812..879915,879999..880252,880314..881842)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000340"
FT                   /old_locus_tag="AO070333000113"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY93"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY93"
FT                   /protein_id="BAE65780.1"
FT                   /translation="MPKKGGKGKNKNKGGKAGGAGVAATKKVTDIQNPVTPGHEVEETV
FT                   AKGEGEVSDVVTEPVEAVTASPTATVPDAITNIPSAAPPASTEEAREILQDAVNKAETG
FT                   PTDKPELVEGEAIGAVEPSVTDEPLKLTPETLPATTGTETSLPERPKETVTDTSDVHAK
FT                   RPYESSLTAKDDELPHKIAKVDDTVAAAGATSGHVAETGSLARKPGVPAETGSVQPQIV
FT                   PGLGADPNDNVSTVLNVPGLSPIEEKSTVPSAAEASAVPAPNTSTEPKGAEDIAPTGAP
FT                   TSDANADATEKSKDSEISKAEEETVATEPKGAEDIAPTGAPTSAGNVDVAEQPKDTELS
FT                   KAEETVASEPPTTAAPAVASEPEAPSTAELTTAAAPSEVTGTETVSPSGATAPSATDST
FT                   TKAASASADTGTGTATSAPAPPAEPVLKVPSSIHDGPDSKVTSANKSAADQAVSNVEQE
FT                   AEGASANTQAPVTETIPEETKPAAEVQEGTGAVKNQVPENQPTAREAQEAGAGAAKQPE
FT                   EIQKPEEAKTKEPRAVQDAQEEGAATVKKPEELKPEDIKKPEEAKTKEPQAAQAAPADA
FT                   TSKPEGKETVKTEAGKAQDQAQESAKAEAAKLEKRKSGFFGWFKRKLKGEKA"
FT   exon            879812..879915
FT                   /number=1
FT   exon            879999..880252
FT                   /number=2
FT   exon            880314..881842
FT                   /number=3
FT   CDS_pept        complement(join(883813..883841,883897..884425))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000341"
FT                   /old_locus_tag="AO070333000114"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY92"
FT                   /protein_id="BAE65781.1"
FT                   /translation="MEVPMGCFTKIPMEILLEIASLLDIKCLSNLLAANEDIAAHCLHL
FT                   VTLPRLVHVIQQIDIDSLMNLLIVGIEPNTTDSEGNTLLAIAMKRSETVEENVPQNGEE
FT                   RAKEKPRQSDKLPELIALLLLCDADPKLPNRYNRLPLDFASLEILKNRELCAALYEEGA
FT                   RVTDLATVGRIYEFYEEASTKT"
FT   exon            complement(883813..883841)
FT                   /number=1
FT   exon            complement(883897..884425)
FT                   /number=2
FT   CDS_pept        join(885471..885706,885763..885790,885844..887009,
FT                   887068..887182)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000342"
FT                   /old_locus_tag="AO070333000115"
FT                   /note="glutamate decarboxylase/sphingosine phosphate lyase"
FT                   /db_xref="GOA:Q2TY91"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY91"
FT                   /protein_id="BAE65782.1"
FT                   /translation="MVHLAQVHRNADLDSTIKRVDSIQLENTDEDGFYSSVYGTRFATE
FT                   QLPQTEMPEREMPREVAYRMIKDELSLDGNPMLNLASFVTTYMEDEAEKLMTESFSKNF
FT                   IDYEEYPQSAEIQNRCVNMIARLFNAPVHSEDEHPMGTSTIGSSEAIMLGTLAMKRRWQ
FT                   NKRKAEGKDYSRPNIVMNSAVQVCWEKAARYFDVEERYVYCTEDRYVIDPQQAVDLVDE
FT                   NTIGICAILGTTYTGEYEDVKAINDLLIERNIDVPIHVDAASGGFVAPFINPKLEWDFR
FT                   LPKVVSINVSGHKYGLVYPGVGWVVWRSPEYLPKDLIFNINYLGAEQASFTLNFSKGAS
FT                   QVIGQYYQMIRLGKRGYRSIMTNITVTADFLAQELEKMGFIIMSQRRGHGLPLVAFRLP
FT                   AEREGQFDEFALAHQLRERGWIVPAYTMAPNSNNLKLMRVVVREDFTKSRCDALLSDIK
FT                   LGLKTLGDMDKAMLDKYTQHVRTHATHSHKSKHNHPHYKGETHSLQGKHGKTHGVC"
FT   exon            885471..885706
FT                   /number=1
FT   exon            885763..885790
FT                   /number=2
FT   exon            885844..887009
FT                   /number=3
FT   exon            887068..887182
FT                   /number=4
FT   CDS_pept        join(889514..890375,890426..890521,890576..890694)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000343"
FT                   /old_locus_tag="AO070333000116"
FT                   /note="threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /db_xref="GOA:Q2TY90"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY90"
FT                   /protein_id="BAE65783.1"
FT                   /translation="MRAVVYTGKDTISVEERPKPSLLEPTDAIVKVQHTTICGTDLHIL
FT                   QGHVQTCTPGRILGHEGVGIIESLGTGVTRFSVGQPVLISCITSCGSCNFCRKRMPSQC
FT                   TSGGWILGNTIDGTQAEFVRIPHASFSLHALPNGLDPKVAVTLSDVLPTAYECGILNGQ
FT                   IQPGSTVAIIGTGPIGLMALQMARNLFGPSMTAVVGRGQPRLDTAKEMGADHAISVLGG
FT                   QADAVASALAVTSNQGFDVVIEAVGTTDSFELAQALVGPGGTIASLGVFGTPCALHLED
FT                   LWHRNICIRTRLVDACTTPDLLKIVESGKISPHFLVSHNFSFDQIYKAYETFQTPSKSG
FT                   SLKVVISMAELQPANPRL"
FT   exon            889514..890375
FT                   /number=1
FT   exon            890426..890521
FT                   /number=2
FT   exon            890576..890694
FT                   /number=3
FT   CDS_pept        join(893860..893950,894302..895068)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000345"
FT                   /old_locus_tag="AO070333000118"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY89"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY89"
FT                   /protein_id="BAE65784.1"
FT                   /translation="MGDIAEYPRHIPYNSDKKSFSEKTGRESFEGYWMPFEAAKAVAAT
FT                   FCWNIRHALTPLFGLDFPSLCVPPTNTSQYGHMLIDREIVQKATETAHYYRMLELRSPV
FT                   DTSLRPPKLHNSELDRPASSPERSTPDRYYGTPTSPFHNTFTPVNTPRSTEAASSSPRQ
FT                   VLASLSSVRGIPNDDSSSEVTHSSTPYSESMDTPTESDDEYHASDSDNGNAIGNIIGPQ
FT                   NPTNDDDEYNVETRARRKYRSALFAREVKAAHALLSLCMQDATGSDEEYVWVDRGRKRR
FT                   RASA"
FT   exon            893860..893950
FT                   /number=1
FT   exon            894302..895068
FT                   /number=2
FT   CDS_pept        complement(join(895314..895640,895713..897158))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000346"
FT                   /old_locus_tag="AO070333000119"
FT                   /note="synaptic vesicle transporter SVOP and related
FT                   transporters (major facilitator superfamily)"
FT                   /db_xref="GOA:Q2TY88"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY88"
FT                   /protein_id="BAE65785.1"
FT                   /translation="MQSYLQYRRIGRAVRKQFADHPEWGQRVQGESTDPSGNTSENDET
FT                   VWEKRSESRPLALPPGVQRRDITDSSGTPSSVFLVSWEQDQDPMNPRNYSMTARITATL
FT                   IVSALAFAVGAASSIESAVIPQNAAAFNVSEVVASLATGLYLLGFAAGSLVSGPLSEIL
FT                   GRNAVYIGSLTLFMIFIMASGLAPNIGAQLAFRFLAGVFGCPPLTCAGGTIADLWNPLE
FT                   KTLTFPLYAILSFGGPVFGPVIASYMGQGTLSWRWTNWIMLIMSGLVMGLILLLQPETY
FT                   GPLLLKWKAAHLRQVTGDKRYRSAMDVQKIALIERILGACKRQFSLTVHEPIILLISLY
FT                   MTVIYIVLFTFFDGYPFIFQDVYGLSQGLTNIVWVAMYVGIAAAGLWVPVVYGWTKREF
FT                   EAASSSSTTTTSGTGVVPCVTGIDPNVNAEGEQGQQEQEPEGGRDEQNTKNPHPARPEN
FT                   RLWFAMLGAPFIPIGLFWMGWTDYEKISIWPPILASTIFGFGTITVFISSYMYVIDSYD
FT                   IYAASALGFMTVSRYCAAGGMTVVGIPFYRNLGVQYTLTILACISVLMTPVPYVFWFWG
FT                   SRIRGMSRFAVSGV"
FT   exon            complement(895314..895640)
FT                   /number=1
FT   exon            complement(895713..897158)
FT                   /number=2
FT   CDS_pept        complement(join(897675..897842,898398..902477,
FT                   902909..902974))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000347"
FT                   /old_locus_tag="AO070333000120"
FT                   /note="DNA topoisomerase type II"
FT                   /db_xref="GOA:Q2TY87"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR031660"
FT                   /db_xref="InterPro:IPR034157"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY87"
FT                   /protein_id="BAE65786.1"
FT                   /translation="MDDSIMDDSVFEDDGSDFEPEPLTQLEHIIKRPDTYIGSIERTSQ
FT                   QMWVYSTESDGMEFREVSYVPGLYKIFDEIVVNAADNKQNDANMDEIRVTISRETGEIS
FT                   VWNNGRGIPIEMHAKEKIYVPELIFGHLLTSSNYDDTQQKVTGGRNGFGAKLCNVFSTE
FT                   FSIETQDSRQKKKYKQTWTSNMTKMGKAKITDAKGDDYTKVTFKPDYAKFGMDGMDNDF
FT                   EALVKRRVYDLAGTAKVAVKLNGSRVPVRNFKKYMEMYTKAIRRERGDDGPAAKDEIIT
FT                   CSPDPRWEVGFAVSDGSFQQVSFVNSIATTSGGTHVNYIADQICSKLADQVKKKNKNGA
FT                   TLKPAQIRNHIFIFVNAQIVNPAFTSQTKEQLTTKSSQFGSKCVLEEDFYKKILKTDVM
FT                   SNILHFAQQKADQMLKKTDGGRRARMNNPKLTDANKAGTKDGHHCTLILTEGDSAKGLA
FT                   MAGRAVVGPDLFGVFPLRGKLLNVRDATFEQISKNAEIQNIKNFLGLQHKKEYTDTRGL
FT                   RYGHLMIMTDQDHDGSHIKGLLINFLQAQFPSLLRIPEFLIEFITPIIKVWKGDPKNPT
FT                   KQRSFFTMPEYEAWKEEHKHERGWEHKYYKGLGTSTTEDAQVYFRDLDRHLKEFHTMQD
FT                   NEVGLIELAFSKKKADERKEWLRQFKPGTFLDHSVSKISYTDFINKELILFSMADNVRS
FT                   IPSVVDGLKPGQRKVLYTCFRRNLKKDMKVVELAGHVSGMTAYQHGDISLQQTIVGLAQ
FT                   SFVGSNNVNCLEPSGNFGSRLQGGSDCASARYIYTRLSPFARRVFHAHDDPLLTYNEDD
FT                   GEKIEPEIYVPVVPMILVNGADGIGTGWSSSIPNYNPEDIVDNLKRLMDGEETRPMQPW
FT                   FRGFTGEVTDVGGDRFKFSGIIKETGEKEVEITELPIRTWTQDFKDKLEDIIKAEKTPS
FT                   FIKDYKDYNTHTKVHFVIQLDEKNMKSALSEGLEEKFKLSKTVATTNLVAFDPEGRITK
FT                   YATVDDILKEFYTYRLKFYEKRKQYQLSQLQKELDKLSNQARFVQEIIDGKLVVSKKKK
FT                   NVLVQELKDKGYKAFPKVAEAVKAGEEERVVEEDDDESDSQDTEVLSSAYDYLLGMAIW
FT                   SLTQERVEKLRRQIGEKEVEVDALIKMSKEDIWKRDLDDFIAEWRFQLEDEHRRQRKVA
FT                   MMGRRTSAKLMTAAGRGAGAKKRKAALGDDPDDEDFAAPKTKKSAAAKKAEPKGGLLNY
FT                   LNKPATKSKSPPKDEDNSDEDFAMEVMPKKNRGASKPPKEEDEDDEMGLSEVEEVMPKK
FT                   SRSAPKAAAKAAPKAKEVDEDVMEVEAPPKRGRPAAKAKPKPKPKDEADEDDLDDDDFA
FT                   EITKAEAAKSSAPPSRSRKPVKYAIESDSDDNGDDLLGDAADSEEEDEEVRPARKPAGR
FT                   PARRTAAAKKTYVIEDDDSEDGGDASEDDFEEDSD"
FT   exon            complement(897675..897842)
FT                   /number=1
FT   exon            complement(898398..902477)
FT                   /number=2
FT   exon            complement(902909..902974)
FT                   /number=3
FT   CDS_pept        join(905342..905740,905805..906406,906459..906815,
FT                   906866..908189)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000348"
FT                   /old_locus_tag="AO070333000121"
FT                   /note="predicted GTPase activator NB4S/EVI5 (contains TBC
FT                   domain)/Calmodulin-binding protein Pollux (contains PTB and
FT                   TBC domains)"
FT                   /db_xref="GOA:Q2TY86"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY86"
FT                   /protein_id="BAE65787.1"
FT                   /translation="MDNSETITPQIHSPGVPKNIPAIHQHSDSMVTVPLSDVQSSSEHT
FT                   QPDWRTLDIPQTPIEVTSPTGESVDDDEPTSTTPTRDSEPQILQPRTYRASVVSRSSEE
FT                   IFRGDIDGVDWRELDKSEEQEPRGEGSDESTSLLLARLEQENNALATDPKSGLQAQQFR
FT                   GVRKSRSQSLRQVKQLINDDPRSLRYSQLPPPPLTELEFWAALVSDYPQTAQRLPTLTS
FT                   NKIRCGIPPPLRGVVWPSLAGARDTTLLAEYQRLCGETSPYEGLIGKDIGRSFPNVEMF
FT                   RDPNGEGQQMLARVLKCFSLYDTKIGYCQGLGFVVGPLLMHMTDAEAFCVLVRLMDHYD
FT                   MRTCYLPDLSGLHLRVYQFQNLLARLRPALYAHLESLHVEPIYVSQWFLSFFAVACPMP
FT                   MLLRIYDIIFLEGACETLMRVALSLMQRNEKKIMACAEFEDVMQLLLSRSLWDTYACHA
FT                   DDFVNDFVSLTSLVTKESLQTLEASYNQSQGVPTGISFPQMQAAASRFLGRFWAGSGSH
FT                   TSAKPFTLNPNHASSSASIRRTTSKQSMTSTLNSIESTSDASTAPTELSTDAPKPRVKS
FT                   VMSQHKDRDLHSQIEDLLMALSDLQRQHADLTRELQQEREEREADQELSKSMLSYIKEL
FT                   ETPPTDLITKVEERFGATDAPARESIGQTKQQLLEDLNRWKEMHSVESGRCHDLTRRID
FT                   EHEKENASLREQVREARGRIQDGYRERQRLERMLRELRTARNPRSSAETSTDYGSPVSE
FT                   PGEGIPGGLRELRLVRTNSQKSTFTRRTSSLGLQNVLSTENNKPAAEEALLLELVNAKT
FT                   AEAVAKQELEEMKVKMEGMRKLIAASQRSPSQNGDRNSIVRSPSSAGSLHKASTEPATG
FT                   GGGFFGWGRRAASTSNEQYAEK"
FT   exon            905342..905740
FT                   /number=1
FT   exon            905805..906406
FT                   /number=2
FT   exon            906459..906815
FT                   /number=3
FT   exon            906866..908189
FT                   /number=4
FT   CDS_pept        913936..914367
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000351"
FT                   /old_locus_tag="AO070333000124"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY85"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY85"
FT                   /protein_id="BAE65788.1"
FT                   /translation="MARIRVPESGSRNCNDGQKLLLIRAQKARWPRPLLPTSEPFSVKG
FT                   FKRQLKPHQVYGAYQLLKWEPTTEIGGFLVDGICLGKTTPPLAVMVLLRLIGVACLGEG
FT                   FSGRVGMGQKSITITPIKGKSVASPMESFPFHSAAPVSR"
FT   exon            913936..914367
FT                   /number=1
FT   CDS_pept        join(915215..915686,915778..916019)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000352"
FT                   /old_locus_tag="AO070333000125"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY84"
FT                   /protein_id="BAE65789.1"
FT                   /translation="MNKSLPRIACFHGGGSSAAIYEIQCSFLTALLAHEFQFEFFEGPF
FT                   DSIAGPGILPAFGGFEPYKSWFSKGESNGHNWTEQDSLEWVWTMMEERRAGQGGEWVGV
FT                   MGFSEGTRIASGLLLDQQRREKLGLRPAVPSIQLRFGVLCMGGGPPMAAHFDYVSAGTT
FT                   TNDQRVIRIPTLHMHGLRDKFLALGRDQYNTYFDPSRAFLFEVDYHHAMPWLEKESLAL
FT                   AQRIQSLHKKTQASR"
FT   exon            915215..915686
FT                   /number=1
FT   exon            915778..916019
FT                   /number=2
FT   CDS_pept        complement(join(916110..916966,917027..917218,
FT                   917280..917557,917592..917675,917743..917777))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000353"
FT                   /old_locus_tag="AO070333000126"
FT                   /note="asparagine synthase (glutamine-hydrolyzing)"
FT                   /db_xref="GOA:Q2TY83"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY83"
FT                   /protein_id="BAE65790.1"
FT                   /translation="MDQTPFSKAYIIFDRVTTSSVRASVHWSKPNTGTVSSPTSTHTGQ
FT                   RALEPRSEEEIILGLRKHLLEAVKLRLRADVPAGVYLSGGLDSTAVAGMVSHLMKNGER
FT                   LGNNPDGLKSQLHCFTVQFDRDSGYDESDVAERTATWLGANCHLVPVDEAVLAAGFEDT
FT                   IWFSESPLPDLCGVGKLALAEAVHKEGIKVVLTGEGADEHFGGYSYLRLDALAEPDPSW
FT                   PAAQFPESERLQMHEKLYRQVDSSGSVGRVESAERMLNGSFYGQEMAYFNFLPFASWTD
FT                   LYASVPPHTALAESFSGSTRDRMMNKWHLLHTSEYISIKTFLSTFILRNAGDNVDMVHQ
FT                   VESRPPFLDHRVTEYANQIPPSLKMSVDPVSKTFRDKHILREAVKPFIPDEIYSRPKRS
FT                   YAAPVRYPKDGPLCQLFNQLVTEENVKKLGFVDWGKAKGNLHRAFEGSDDMAFRFTLTL
FT                   AQFVVLMQRFGVATCCPSPNALS"
FT   exon            complement(916110..916966)
FT                   /number=1
FT   exon            complement(917027..917218)
FT                   /number=2
FT   exon            complement(917280..917557)
FT                   /number=3
FT   exon            complement(917592..917675)
FT                   /number=4
FT   exon            complement(917743..917777)
FT                   /number=5
FT   CDS_pept        complement(join(917852..917861,917912..918200,
FT                   918259..918412))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000354"
FT                   /old_locus_tag="AO070333000127"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY82"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY82"
FT                   /protein_id="BAE65791.1"
FT                   /translation="MCGIGAFLDFHNHSQPVSHQQLESEIDNGLDFIKHRGPDARGKWV
FT                   NADGRVGLGHIRLSIVDPSPSGNQPFHDSRGDIHAVVNGELYDHERYREQLASEFDFKG
FT                   NSDCEIVIALYKHYGASFLSHLRGEFALVLWDAKRELFFAARDRRN"
FT   exon            complement(917852..917861)
FT                   /number=1
FT   exon            complement(917912..918200)
FT                   /number=2
FT   exon            complement(918259..918412)
FT                   /number=3
FT   CDS_pept        join(920082..924521,924584..935773)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000355"
FT                   /old_locus_tag="AO080541000347"
FT                   /note="non-ribosomal peptide synthetase modules and related
FT                   proteins"
FT                   /db_xref="GOA:Q2TY81"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY81"
FT                   /protein_id="BAE65792.1"
FT                   /translation="MGSIGETVKAWNHNDGVENQWMWNAKVPTCAESTVHELIAQRVQD
FT                   QPNAAAVCAWDGSLTYQELDRLSRRLACHLVQKLGIGEGSIIPLCFEKSMWTPVAMLAV
FT                   MKTGAASVALDVTLPKPRLQSITQQIQPNVILSSKAQCSLAGNLAASPVLTVDCPALDA
FT                   MDTAGVCLPNVDPSSTLYVVFTSGSTGTPKGVMISHRNICSGLRHQRALGYANARRVFD
FT                   FASYAFDAAWLNFLHATVSGACLCIPSETDRRENITTCMQDMRVDFALLTPSIARVINP
FT                   AAVPALRTLVLGGEAMAEVDIMTWASQVDLRNAYGPAECTIVATAARIGDSTGQSGNIG
FT                   YGLGLNTWVVSLQGDCLASIGSVGELWLEGPLVGKGYLNDPGRTDASFVHNPPWLTQGC
FT                   GLVTGRRGRLYRTGDLVRYEKDGSLVFVGRKDSQVKIRGQRVELGDIEYHVQSGLSQQL
FT                   QGPAVAILATPCGSDKTFLVVFLSVSRAFMESYHERRRMVQDLTSALHDKLVEDLPMYM
FT                   VPSAYVPVAEMPMTATGKTDRRQLREMANAMKVEELVQLHPKWEGKRAPVTEMEKRLQE
FT                   LWAQVLNINSSSIGLDDTFFSHGGDSISAIQLSAKCRAAGFSITIPQIFRHKSLQDLAT
FT                   AASPLPSLVTKPIVETNNARFALSPAQQYFFEHHPDGNNHFNQSFFLRVTQTIDPARLG
FT                   KSLQQLVSWHPILRARFNRAGDGSWMQSIQTEAAQCYHYHVTRIEEPNQVKDVLNSAQK
FT                   RLDIEKGPLISFDLIQTVDSQFLFLVAHHLVVDLVSWRILIEELEELLTTENTTREHSS
FT                   LSFQAWCKMQETYSMQHLLPEKSLPFPVTIPSYDWWGLERKENTHAHAVRKSFLTCKSV
FT                   THLLLGEANHAFQTRPVEILHAVLLHSFAMTFRDRPPPTVFSEGHGREAFDDTIDLSRT
FT                   VGWFTTIWPAHVEWNNRHSITEVVRRTKDARRRVPMNGWAYFASRYLNESGKDMFRGHG
FT                   LPEILFNFEGLYQQLERPNSLFRNTDKPHDTISDFSGTTHMSAIVDVTALVVDGCLTFQ
FT                   FLYNGNMKQRDGVERWIAQCKESLELAGHELVRLKPSYTMCDFPLLSLTDETLKKLNED
FT                   VLPELGISYGEVEDIYPCSPVQQGILLSQAKNSGWYNTQVVWRIRSSSPISVTRLQLAW
FT                   KEVVKRHPILRTVFTDGVSPESYRDQIVLRKLEPEVNCDCQENGTHIAASKTPQPNWKV
FT                   RPLHSLSLVSRSSGDVTAELNINHAIIDAASMEILRRDLCLTYSGLSLPTNDVSYRGYI
FT                   EVVQGFPVDPARAFWKKYLEGVKPSIFPSLRSDTPTDRTHVELPVTRVAQELQANIHTF
FT                   CERHGVTPSNIFQLAWALVLRYYLNDEAVCFGYIVSGRDAPIAHVEDIVGPFINMLVSR
FT                   FDLNDSVTVLEILKDTQDNYLEGLDHQHYPLASVLNSLGMTGKQLFNTVLQVQRNVTSN
FT                   EIEGSAISVDIIEYDDPMEFDISITVTENTRDMAISLQYDPAIMTETQAISLIGSFQKF
FT                   VEEIIQLPKSKPDNLIAIGNQDLSRVWGWNKEILSPNSICVHDLFSECVRQQPDAPAVC
FT                   AWDGDLTYSQLDELSTSLAYRLLAHGIGPGSIVPLCFEKSLWTPVAVLGVMKTGAASVM
FT                   LDVTLPRQRLLSVINQLEKGRVGASVILSSTSQYKVASDLVAGLTICVDALDQINQPPG
FT                   PKLPNVDPSNTLYVVFTSGSTGTPKGAMISHTNFSSGIWYQLQVLGLSSTSRVFDFASY
FT                   AFDVCWSSILHTLVAGGCICTPSTAQTRNDIHGALAMMRANWALLTPTVARLLDPATVG
FT                   HGFVLVLIGEKMTDEDVTKWQPHVDLVNAYGPAECTVINTVNRVNDIPQGSGNIGRGFG
FT                   CHTWVVSPSNHHHLLPVGCTGELLIEGPLVGQGYLNDPAKTVSHFVEAPSWLKQGSPTV
FT                   PGRKGLLYRTGDLVQYQEDGSLKFMGRRDDQVKIHGQRVELGDVEHHVRQILHDQFQEP
FT                   DGVVAEILQTGIGDAPVLVVFLTAGKEDGVSGHGTYPALHRHSGVLREGLLTQLPLHMV
FT                   PASLIVVEAIPTTATGKTDRRKLRELGGLLTREELAWAVPTHTEGVDTEGSPTLNSMEL
FT                   QLRELWAQVLRISPSRINGQDSFLQIGGDSVGAMRLVAAARNQGLSLNVEKVFQSPRLC
FT                   EMALATGISHETRQPIPCFSLLSSDVHVSQMCEDVAQRCNVPVDKIQDVFPCTPLQEGL
FT                   LALSAKQPGNYVNQLTMKLSQGTNLAQLIGAWNKVIQETPILRTRIVDTPGLGLVQAII
FT                   SEEVTWRTAYDLSVYLKQDTQTHIGLGTPLVRFVVVKDEQSGEGSIVWTIHHALYDGWS
FT                   MQLILDQVHKVYHTKDTLPLGQFQRFLQYTLQTEDSQDEFWQRYLSGADIASFPSLPSP
FT                   SYRPQANAIVSHNLTNIKWPESDNITSATVIRAAWAILQSQYTNTSGVCFGAIVSGRQA
FT                   PVVDIERIAGPTIATVPIHVNIDWMKDIRGLLLQIQADAAAMIPFEQTGLLKIRRTKSD
FT                   VAKVSEFQTLLVIQPVARDEQPPHVGDLWSIEKSAHDTSAPGLNDFNNYSILVDCELKS
FT                   NGAELTVSFDTHVIDECFVQRMVTQLEHVIESICNHPLDSTLVKDMTTISTTDLDDIRR
FT                   WNRTVPEPHTVCVHDWIIDQARKHPAKMAILSWDGSLTYEELDKLSTSLAQSIIPMINP
FT                   GSIIPLCFEKSMWTPVAMLAVMKAGAASVALDTTLPKQRLQAIADQVKPRLILSSKVSA
FT                   TLALTLLGDVKGSQVITVDYDGIKTLGVKSPKLDLPIVDPSSTLYLVFTSGSTGSPKGA
FT                   MVSHANFSSGLFHQLSALQYNTDTRAFDFASYAFDVSRTVCLRTLAAGGCLCVPHETDR
FT                   RNNTAQSMCQLGVNHAHLTPTMARLLLPSEVPALRTLVLGGEPIGKDDVDKWYGHVSLI
FT                   NTYGPAEATSTNTIQRINNTEAPCIGRGIGCTTWIADPLNPNHLLPIGCAGELLIEGPL
FT                   VGQGYLGDGESTMTNYIENPPWLLKMGRRGILYRTGDLVRYNSDGSLMFIGRKDAQVKI
FT                   RGQRVELGDIEHHVRSILVASEFQGSIAAGVTKPQGNSAAFVVAFLTGDKTHSEPNTYI
FT                   QSLTNRLNDGLANELPSYMIPRVYIPLNAMPLTATGKIDRRRIQEMSERLTLDDIRKFQ
FT                   PQHQDRHAPTTDMELRLAQLWGRVLNISTREIASEDSFLQVGGDSVGAMRLVGAARDQS
FT                   LSLTVEQVFKSPRLRDMALLVKAVESSEKPVAPFSLLHLGVPEEGCPNIDTWRARAALL
FT                   CNVKPRQVEDVFPCTPLQQGILALSQKRPGHYINHAILQIDRAKVSLDRLKQAWQQTIQ
FT                   MTPILRTRIIDVEGHDILQVVISEENALKSLVGCTLESYIENDRRNTMTFGTPLARVAF
FT                   VEESNQSGDNAIENKSTRAVYIVWTMHHAVYDGWTMELILNQVHNIYREKDNRPCLEPF
FT                   QKFLQYSIKRNDAEERFWNDYLSKSDMFSFPALPSTSYEPQANTSLQHEINDLTWRRKD
FT                   DITASTMMRTAWGILLSCYTTTPDVLFGATVTGRQAPVAGIENVAGPTIATVPVRIGVD
FT                   PHITVHELLHQVQRQALDMIPFEQTGLQRIRRISANTNRGCQFQTLIVVQPPPSNQKVR
FT                   EESIWQVVGREGEGISSFNSYAVLVECQMNSEGAHIEVSFDSQVIDTNTMSRMLKQLHH
FT                   ILRLLCADQSNELQVSALGITGPEDLHTIWSWNSLQPAAYETPVHEMIVARARKSPDAL
FT                   AICAWDGELTFKELDDLSTCLADYLLAHHSCVGSIIALCFEKSMWTPVAMLAVMKAGAG
FT                   AVALDVDLPKQRLQSIVSQVKPVVILSSVASYELANGFNGGAVIVVDHQSIYSMKCSLN
FT                   SNMHKLTSSSTNPSLPPVDPSSILYIVFTSGSTGTPKGVMVSHGNFSTALRYQQDVLGY
FT                   ASATRVLDFSSYAFDAAWLNFIHSTVAGACLCIPAEHERKTNVGACIDRMRVDFALLTP
FT                   SVARLIDPESVPTLRTLVLGGEAHNPTDVARWKSDRVDLRNAYGPAECTVVATVTRLAN
FT                   GTTKPGNIGRGWGLNTWVIDVSGNNRLAPIGAVGELWLEGPLVAQGYLGDSKKTLESFV
FT                   KTPPWLARGIPTVFPGRQGRLYRTGDLVRYNHDGSLTFVGRKDSQVKIRGQRVELDDIE
FT                   YHVRQSLPKQFRGAVIADVFAPRESDHAILAVFLSLAEDVTLSNLLEGLGDKIMDLLPE
FT                   YMIPTAYIPVHEIPMTATGKTDRRKLREIGSSLTIAELAGLRPSQNSEPPVSEREWQLN
FT                   AMWAEVLNVEPSLIGRNDSFFGFGGDSITAMQLCAKCRMAGISMTVPQVFHCRTIARLA
FT                   SVVTADVAVQHHNEVPETDFSLSPIQLRFFEYEPNGHDHFNQSMLLQLTRQVSSLDVAQ
FT                   ALESLLVHHSMLRAQFSKGPQGAWTQRINATAGGSGYRYRSHQMLTMKDSIHAINESQK
FT                   SLNIREGPLMAADLFTTEEDGQYLFVVVHHLAIDLVSWRVLLEDLEEHLTTGGISSATP
FT                   LPFQAWCEGQVRYARKHLSSHILPPLDISSHAHDYWGVDMTNNIYGTVLEESFTISPDI
FT                   TQVLLGPANTTYQTQPVEIFHAALVYSFAQVFQDRRPPPIFTEGHGREPWNLALDPSRT
FT                   VGWFTTLWSVLVTPNIADGFKDTIRRVKDSRRRVPMNGWASFTAMYLSSEDNRRRYDVP
FT                   EIMFNYLGLYQQLERPKGLFRLADAPAGALSNIADNVHRFSLIDVSALVMQGGLHFKFS
FT                   YNRFIRNQEAIADWIIACKSVLEEAASTLVRSTQARTLSDFPLLPLSSYDELDTLINHT
FT                   LPSHGIMLDQVEDIYPCSPIQQGILLSQAKNESRYWTRKRWQVRSSSPICLQRFKDAWN
FT                   KLVDRHPILRTVFIESALPDAYLDQVVLKSVTPEIHIITLADVDLESSLIKHKRLRKPQ
FT                   DRLPYVLVLYATPSGRVICELLINHAITDGMSMRLIQDELQLAYDDALPLCSTPPYSDY
FT                   IAHLRSLAPDTSRTHWQQYLVGVSPCMLPHMNVNHQESDSVKRLPAMHLGNELNSCLRD
FT                   LCKRHVLTASNIFQVAWALVLHFYTGHETPCFGYLTSGRDAPIDNVAAIAGPFINMLIS
FT                   RICLSHDRSILSIMQETQADYLRNLEHQHLPLAEILHSLPASTSPLFNTAISVQTSRSG
FT                   PADSVTSTIRLQDTATEDPSEVCNPVAPKGV"
FT   exon            920082..924521
FT                   /number=1
FT   exon            924584..935773
FT                   /number=2
FT   CDS_pept        join(936497..936706,936855..939730,939787..940233,
FT                   940292..940405,940472..941135)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000356"
FT                   /old_locus_tag="AO070333000129"
FT                   /note="multidrug resistance-associated protein/mitoxantrone
FT                   resistance protein, ABC superfamily"
FT                   /db_xref="GOA:Q2TY80"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY80"
FT                   /protein_id="BAE65793.1"
FT                   /translation="MPPPICNDHLFGPVVSGCSGRTFDFTRTFEDIFLSLVPNTLFLIT
FT                   ALVRIGYLVRQVRVANGLLCQLLKLLTTARTAMTVVSAAAMIPLSFLEHTRSPRPSDLL
FT                   TIFLVLTILCDIVLTRTSWLAGSQSWQIGDACIQTAAVVVKCIILAVESKSKDNCIMNH
FT                   SGVEHSPEETSGLLSLAFFSWLNPLFLQGYRENLRVDSLYALDEKLKAKTMFSNLATAL
FT                   NGMPFPRGFARTLAKELIGPFLLPVAPRLAMLGFTFSQPFFINALVANIAESNSVSAVN
FT                   DGYGLIGACVLIYGGIALSTSLYSYYSLRALHMLRACLVSVIYQKMLESDTNTLDNGTT
FT                   VTLMSTDIERIMTGWMDIHSVWASVIEIALGCYLLHSQLGMAFLSPIIVILVCFSGMAC
FT                   VSAKAGNSQSAWMEKIENRVSMITTLLANIKPCKISRMASEFAHILQTARDEEIQVGSH
FT                   FRWLQVIAATLAYTPMCLSPVVAFAFAGQHLNVAGFFTSLSFLTLVTSPLTAIFQQIPG
FT                   VIAGFTCLSRILLFLEGGIRSDRRTVFRLQDNQKPAASSAPSAALVSVTNGHFGWTQTH
FT                   SVLRNINVNVPRGQLTVVVGPVACGKSTLCKAILGEVPFVEGEVLLTSRIPSVGYCAQT
FT                   PFLSNLSIRDNIIGFSPFHPGKYQEIITATALGPDIAMLPAGHDTIVGSCGAMLSGGQK
FT                   QRVSLARALYQETPLLLLDDTLTGLDQATEAEVFARVLGAEGLIRRRGTTVILFTSSWR
FT                   YLSSADYIITVGKDGTIREPGHETELLEQKDELFNPEKNTETAFPASTDSNASVTQQSH
FT                   NMVVKGKASQNLHVRASQVRDLDVYKNYFGTIRTAVLVTFALSCTLFGFGGSFPTVWIS
FT                   FWSSNSYNAPNSYNAPNAFYIGIYSLLSFLQLLGFFLAALMALGPMVTDAGSKLHSNAL
FT                   TTVIRAPLRFFTDTDTGAITSLFSQDITIIDGELPERLFNITAGLCGIIGAACVIAVAS
FT                   PWLALVYPVLVIIFWIVQRLYLRTSKQLRFLDLEAKGPLYANFMETTQGITTIRAFGWT
FT                   TQKLEHNHYLLDQSQRPSYLLGVIQFWLLLTANLITTGIATSLTVLATQLRTDPGFTGA
FT                   SAVTLMTFSGLVTIFIRDYTAFETSLGAVSRLKTLSDNVKAEAREGEDLHPDEQWPKKG
FT                   SIEIERLSASYDDVPVDHPSGESHPNLILKDLSLTIAPGEKIAICGRTGSGKSSLVLLL
FT                   LRLLDPIYSPSAKLTIDDIPIQHVDRSTLRERIIGVPQDAVFLPNGNTVKDNLDPSGLA
FT                   TEDECLSVLSTVNLDGLANGSHGLHTPLTTNHLSGGQKKLFGLGRAILRRIIRDRATTD
FT                   TESHGGILILDEISSGVDAATERTMHEIISHQFEDYTVLEVVHGLDIVPHFFDRVIVIE
FT                   NGSIVESGSPAELLQRPSSWFKQLLLMNSACDQP"
FT   exon            936497..936706
FT                   /number=1
FT   exon            936855..939730
FT                   /number=2
FT   exon            939787..940233
FT                   /number=3
FT   exon            940292..940405
FT                   /number=4
FT   exon            940472..941135
FT                   /number=5
FT   CDS_pept        join(943831..943906,943975..944033,944090..944464,
FT                   944510..944707,944761..944844)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000359"
FT                   /old_locus_tag="AO070333000132"
FT                   /note="reductases with broad range of substrate
FT                   specificities"
FT                   /db_xref="GOA:Q2TY79"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY79"
FT                   /protein_id="BAE65794.1"
FT                   /translation="MVLAQPENKHVLKAFDLSGKVAAVTGGARGIGLEVSIALAEAGAD
FT                   VALIYNSSKTAETLATEVATKHNVKAAAYQADVANQEDIEKAIKQIAADFGKLDIIVAN
FT                   SGICSNVPAEDYTAEQWHNITKVNLDGAFYTAQAAARIFKEQGHGNVIFTASVSATLVN
FT                   VPQKQAAYNASKAAVVQMAKCLSVEWVDFCRVNCISPGFIATDILDIHPKEWREKWFDM
FT                   IPAKRMAEAYELKGAYVFCASDASSYMTGANIVIDGGYTLP"
FT   exon            943831..943906
FT                   /number=1
FT   exon            943975..944033
FT                   /number=2
FT   exon            944090..944464
FT                   /number=3
FT   exon            944510..944707
FT                   /number=4
FT   exon            944761..944844
FT                   /number=5
FT   CDS_pept        join(945831..945991,946050..946283,946393..946972)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000360"
FT                   /old_locus_tag="AO070333000133"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY78"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY78"
FT                   /protein_id="BAE65795.1"
FT                   /translation="MSGRNINLLSLDGGGVRGLSSLIVLKEIMESIDRENPPKPCDYFD
FT                   LIGGSGSGGLIAIMLGRLEMDIDQCIHAYKLLSKNVFSQKRLLPIGSNLRSRAKYDIKK
FT                   VELALRKILRELSYEKDTLLREEAGCKVFVCATDDTNRRLVHLTSYPSKYCSNELFKSA
FT                   KVYEAGAASFAHSPLFDSVKIGPSGRRFHDSSLEANNPMREVWIEARGVWPAGALENQL
FT                   KCMVSIGTGEPSIKRSRRRLFGLVKGADVDAVDPEIDTNRFIQEHTELDDENRLFRFDV
FT                   PNGLGEIDLDSIEEMETIVDATQDYLEKELVYKQIRRCGRALA"
FT   exon            945831..945991
FT                   /number=1
FT   exon            946050..946283
FT                   /number=2
FT   exon            946393..946972
FT                   /number=3
FT   CDS_pept        complement(join(948513..948586,948651..948861,
FT                   948965..949222,949301..949409,949471..949561,
FT                   949586..949734,949786..949854,949902..950151,
FT                   950206..950219,950276..950437,950470..950495))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000361"
FT                   /old_locus_tag="AO070333000134"
FT                   /note="predicted flavoprotein involved in K+ transport"
FT                   /db_xref="GOA:Q2TY77"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY77"
FT                   /protein_id="BAE65796.1"
FT                   /translation="MAKPRTTEKKLRVVCIGAGLSGLTIAYKLKHEKPLDFLDLTIYEK
FT                   NPEVGGTWFENIYPGVACDVPVHSYQFPFAPNPAWSSYYASGKEIQEYIVSTAEKYDLK
FT                   ENIKFNTKLVKAIWCETQGKWKLQLQQGGLIIEDEADIVLDGSGVLNQWKWQEIEGLDT
FT                   FKGKLLHTARWDPEYNYEGKKIAVLGNGSSGIQVIPSLQPNAAKLVNCIRHAIWTTPNL
FT                   GGTNFQYTEEEKQRFQDNPDEFLEYRKSIEGAINSVYNAMISGSEESKAFYEWVQGVMR
FT                   SRLSKNPELEDNSRIAFSKINRITPNGIETDEGEEEFDLIVCATGFNYSFIPPWELIGR
FT                   DSRRLDEGWKDTAEAYFATCAAKVPNYFIFGGPNYPSFPSNSRQELISSRPVVVKDSVV
FT                   HAYNKFAQETLKRCVWSKGCHAWYNKRNEGADNTVTAMYPGSVLHFKEKLRPEHFEIQY
FT                   NTSNPFRFMGNG"
FT   exon            complement(948513..948586)
FT                   /number=1
FT   exon            complement(948651..948861)
FT                   /number=2
FT   exon            complement(948965..949222)
FT                   /number=3
FT   exon            complement(949301..949409)
FT                   /number=4
FT   exon            complement(949471..949561)
FT                   /number=5
FT   exon            complement(949586..949734)
FT                   /number=6
FT   exon            complement(949786..949854)
FT                   /number=7
FT   exon            complement(949902..950151)
FT                   /number=8
FT   exon            complement(950206..950219)
FT                   /number=9
FT   exon            complement(950276..950437)
FT                   /number=10
FT   exon            complement(950470..950495)
FT                   /number=11
FT   CDS_pept        complement(join(951716..952091,952142..952170))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000362"
FT                   /old_locus_tag="AO070333000135"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY76"
FT                   /db_xref="InterPro:IPR021487"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY76"
FT                   /protein_id="BAE65797.1"
FT                   /translation="MVKDKNTVIEEFNDLVNMTPNELRNWLKEEQSQSSGWSGESGETI
FT                   GHERSHLLTPLLQSLYEKLTKHSGRKIVDILEHNPSKDPEGYSDQDIDHMRRVVSYCKR
FT                   HLAQEEKAKQDPNSKSHRSLKNWGHDPFKS"
FT   exon            complement(951716..952091)
FT                   /number=1
FT   exon            complement(952142..952170)
FT                   /number=2
FT   CDS_pept        complement(join(952615..953041,953096..953355,
FT                   953396..953424,953488..953968))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000363"
FT                   /old_locus_tag="AO070333000136"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY75"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY75"
FT                   /protein_id="BAE65798.1"
FT                   /translation="MGTTTDGTKSGHFMPITYVYHPILDVGTSFDANLFKFLQHPDEGV
FT                   GGPGCYSNFIVLYPSELSIYWPSYLPCCRQRKHWKMAERMTRELLDAIYEDSCRETRDD
FT                   GVMPPELQDMSSEVRMRKETELIATSVKSAAYMYPNASPVRAGISSQSMLLVFLHDDVV
FT                   ETSPLDAVNLKGSTITDAIFATYEPKTGIAQSRREALGGFLTAMIEEDPSLGKRLLSSI
FT                   FTWLNHTKGYGSISPAIFESLRNYLEFRSDDIACEFIIAQALFACNIHLSEMEIQVFNN
FT                   VVRIYVTHISLTNDLYSFEREREEYERTDGLLINAIGVIRKVYQVSPVVAKQLPWGFIL
FT                   DTECAFSGEFKKLISSGLLNSAQIRFVKALAECLAGQIFYSISSGRYGGDKAARVIST"
FT   exon            complement(952615..953041)
FT                   /number=1
FT   exon            complement(953096..953355)
FT                   /number=2
FT   exon            complement(953396..953424)
FT                   /number=3
FT   exon            complement(953488..953968)
FT                   /number=4
FT   CDS_pept        complement(954644..955834)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000364"
FT                   /old_locus_tag="AO070333000137"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY74"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY74"
FT                   /protein_id="BAE65799.1"
FT                   /translation="MPRYISHASPLEDGSGDALEGLLTDLSLTDARETGTVEKGSSAFN
FT                   PFLALLSPAPVTGPIEKNTGGFNPFLPYLVASAGEPNPEQTIEKLTRDVIPQQLAELQK
FT                   PRRFILNETDDLYLQGRRFQKKWGISEEGFNNWKSLLLGWVEFPAILLLNPSPWDHLPF
FT                   DEMVDESPTLSWLQKTLKELQLQLEDVIILDTFPMLRDKLGDDTLRQMGPARRDELARE
FT                   SFALTRASLALIQPRVLVSCQCCTRPGNDRWGFFNNDELAEQLCSSGVRARSRQVRELD
FT                   LSGHKMHVVQGMHPQYVMEREPTQKEVLVELFTQVFRPFGMWQSRRAAMQQQLRDAGAV
FT                   LLGLVMLLQQQMKLYGQLCAQSGSGVEGPLAAEHVEELRKQLAEWEDGNKLKRKEG"
FT   exon            complement(954644..955834)
FT                   /number=1
FT   CDS_pept        complement(join(957630..957973,958032..958352,
FT                   958412..958541))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000365"
FT                   /old_locus_tag="AO070333000138"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY73"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY73"
FT                   /protein_id="BAE65800.1"
FT                   /translation="MDNGPSEVVFTTTSSPIESGVVFRYGQGSVKVPAPRKRGRPIGST
FT                   KRRKTGNDVDEPERKDHERFQFINLGSNSANIDRDTRKYIRKRVMLNHTHTNQKRKQLS
FT                   TERTKEKTSTATGLSPEVMPSQFGRVDPFDTLPIQFEPYMHDLLSLYITTIWETLYSIE
FT                   KRSGCNPMVNYWLPLAFNDPALLHSLIGCAASFLVTANQLCGYPFFVKHLNEAIAIVNQ
FT                   RMADSTISVSDETLVVVASIAMIKVCCRNVQILGFTLLLTSK"
FT   exon            complement(957630..957973)
FT                   /number=1
FT   exon            complement(958032..958352)
FT                   /number=2
FT   exon            complement(958412..958541)
FT                   /number=3
FT   CDS_pept        join(958936..959469,959528..959708,960122..960162,
FT                   961325..961522)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000366"
FT                   /old_locus_tag="AO070333000139"
FT                   /note="dehydrogenases with different specificities (related
FT                   to short-chain alcohol dehydrogenases)"
FT                   /db_xref="GOA:Q2TY72"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY72"
FT                   /protein_id="BAE65801.1"
FT                   /translation="MPQYNAPTTAEEVANDCRASIANKTILVTGVTLGSLGAGFATAIA
FT                   NYAPSLIILAARDVTKAQQTATEISIINPSVKTRILHLDLGSQVQIREAAKEVLEYEEH
FT                   IDVLVNNAGVMAPPFSLTQDGVESQFGINHIGHFLFTNLIMSKLVTPGKSSRVVNISSD
FT                   GHRLGPIRFDDWNFDDGNTYDPWLAYGQSKTANMLFSVSLAQKLGTKGLISVSLHPGVV
FT                   STQILRHDVDESVKALDETAICYYYIRYESVAANLTEIISEFASSRLQKALSEAYRTIR
FT                   RLRPIVERDRRDGSGACYRELKQHLSPGTFKATSGL"
FT   exon            958936..959469
FT                   /number=1
FT   exon            959528..959708
FT                   /number=2
FT   exon            960122..960162
FT                   /number=3
FT   exon            961325..961522
FT                   /number=4
FT   CDS_pept        962403..964382
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000367"
FT                   /old_locus_tag="AO070333000140"
FT                   /note="ferric reductase, NADH/NADPH oxidase and related
FT                   proteins"
FT                   /db_xref="GOA:Q2TY71"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY71"
FT                   /protein_id="BAE65802.1"
FT                   /translation="MLSPRHADIPDSGPGVEHHWGYLNRQLPCTSGVEKCAYLDTVYHS
FT                   HDLSVLYSAIFWATILGIILLCFIGHYCNPISRKSTSSCVQKEGEIEHRSQSSFYRMRR
FT                   SLGSIYHRYFVQESLTFIFGRTTRFNILILAILAGYLVIFSFVGIVYKTWYIPVKGTNL
FT                   TSTPNGIGPWADRIGVLAYALTPLAVLLCTRESLLSLCTGIPYHHFNFLHRWLGWIIYL
FT                   QSALHTFGWTLMEGRMYKPQPSTWNAFIAQEYIIWGVVAMIFLSFLVFFSTKWAIRLTG
FT                   YEFFRKAHYVVAMLYVGACWGHWKQLSCWMIASLVVWLLDRGIRLLRTFLTHFGPHASE
FT                   TYSFWGLHIPKARMTSFPNDEDGDVVRLDFEHDHSPWEIGQHFYLCFPGLSIWQSHPMT
FT                   PSSVPGGSKQSHTYIIRAKNGLTKDLAHMARQPQESNSEEPPSTSIVLSGPYGQTIVDN
FT                   DLHCSDDINLFCVAGGTGVTFVLPILQAIVLNRYFSTRRSLVELIWIVRRKSDMRWLSD
FT                   ELEIFRTAAQACTHFRIRVYVTREDDRANVRNSFTPQYITDSEIKRPVSTVSHETHLSD
FT                   SPFSVHCLRPGNSDTSVHPDVPADLTDFVQRTVHGPTRVIASGPTGLISSLRTTVASLN
FT                   DPGQVWKGNERYDVELIHDDRLEY"
FT   exon            962403..964382
FT                   /number=1
FT   CDS_pept        complement(join(965455..966254,966566..966704))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000369"
FT                   /old_locus_tag="AO070333000142"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR013243"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY70"
FT                   /protein_id="BAE65803.1"
FT                   /translation="MHPCRNNKSYPKMSPTNQHTQSVPVNVEQQCGVTLPDGGQCTRSL
FT                   TSTTPPIPTNPPPENEFKPNQHQIHFTDPTIKQYLQYPEILQSNAQNHLAITEATSHTT
FT                   IAKDSLTYLLQFTEPYTTTPSKIKTSYLLSYATNYWAVHARLAHPETDPELTALILRFL
FT                   GSETAYLNWTAFLDGYTPFSGTDGSSLIRHPHQIYYATSFGLTNIVTALLDTGAPVNSR
FT                   GPSGSALAAAALAGHLDTVKVLVDSGADVNLAGPFGTPLVLASGRGFVDIVRFLVERGA
FT                   DVEARGEWSETALVEARKNGFEDVVGVLLGR"
FT   exon            complement(965455..966254)
FT                   /number=1
FT   exon            complement(966566..966704)
FT                   /number=2
FT   CDS_pept        complement(966912..967949)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000370"
FT                   /old_locus_tag="AO070333000143"
FT                   /note="proline racemase"
FT                   /db_xref="GOA:Q2TY69"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY69"
FT                   /protein_id="BAE65804.1"
FT                   /translation="MPFSRSLTVVGCHSEGEVGDVITGGVLDVPGKTMYEKLAHISTKY
FT                   DHLRQFLLNEPRGRSSMNTNLLLPPCDPRADAGFLIMESEEYAPMSGSNLICTTTVLLE
FT                   TGMIPMKEPVTELALDTAAGLVTVTAECEAGKCKTVEFNNVPAFVFELDFKVQVPGIGE
FT                   VSVDIAYGGMMYVLVDAASVGLKVDNSHARQLIEIGERIKRAVEASYTAVHPENPGVKG
FT                   FSVLEYTEPIKIEDGVKVAVNTVVVSPGRFDRSPCGTGTCARLAVMHARGEIAEGEVFK
FT                   HRSIIGTEFICHIRGTSMVGDYKAVLPTVKGRGWITSFKQIVLDSTDPFPEGFRVGDQW
FT                   HMAPN"
FT   exon            complement(966912..967949)
FT                   /number=1
FT   CDS_pept        join(968818..969486,969547..969783)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000371"
FT                   /old_locus_tag="AO070333000144"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY68"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040632"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY68"
FT                   /protein_id="BAE65805.1"
FT                   /translation="MYALQRLLYGFPAPAPHKRTKPVEVLCLGMPRTGTESLSMALRTL
FT                   GLQTYHGWDLVFEPDGSKLQLCAELVRRKYKGARDGDVHISRAEFDILVGDSQAVVDSL
FT                   CILFAPELLAAYPEAKVVLNVRPDSNAWYRSINKTIVEEVDQSWVIWGMQWFSAEFHWL
FT                   YSLYLRDGYPGIFHSGTTQDGIQRNAKWVYRDHCNMVRGMVPKENLLEWSVEDGWEPLC
FT                   KFLDKPVPNEPFPRTNNPGDYAERADKLIKQRLAQCLRNLTLTAVTLGGITTTVVIWWQ
FT                   GRIPKVTRLGDLLVRFTKMT"
FT   exon            968818..969486
FT                   /number=1
FT   exon            969547..969783
FT                   /number=2
FT   CDS_pept        complement(970247..971113)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000372"
FT                   /old_locus_tag="AO070333000145"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY67"
FT                   /protein_id="BAE65806.1"
FT                   /translation="MQYAKPRMNYYRSNTDFEMPTEYIDLIEKYLRIVPHITHCEPDTA
FT                   DLLQPTLWHSDLHLNNIYVDLDTETITDIMHWQSITVAPLLLQAKIPRMARHINPLPLG
FT                   WVMPEKPEGYETFFQKDKLKADKLYESALCQKYYEVCTAKKNQRHYAAMCHNDTWKSPL
FT                   ILPLKSISGAWSSREVFMLRSSLMEVVDHWAEIQPAADCPISFTDEERNLHNEEMENRD
FT                   YIEGLMEEFQGAGILPSDGIVDPEDYEVVQKTNYAQKERFMSLAEDEEQREWMDKIWPY
FT                   QDRASEA"
FT   exon            complement(970247..971113)
FT                   /number=1
FT   tRNA            complement(972814..972897)
FT                   /locus_tag="AO090103t00010"
FT                   /product="tRNA-Lys"
FT                   /note="tRNAscan-SE"
FT   CDS_pept        join(975581..975713,975747..976270,976422..976544,
FT                   976598..976603)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000374"
FT                   /old_locus_tag="AO070333000147"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY66"
FT                   /protein_id="BAE65807.1"
FT                   /translation="MSPNLELTSHITLPPFTYPTLPPEPYTTRMIRLLPHKDKSAPIQC
FT                   MGTHLYQALSYVWGSEVKPESIILNGCIFHVTTNLHVALSHLRNSLFERILWVDAICIN
FT                   QDEEDQGHEKSKQIPLMRTIYAQAERVIVWLGGATEDGDKALEEIRCLGESADIWHDRE
FT                   RQRYTNSILDILESSYEEIRSPGEAAAIWYEDDPDPIENSDACLRLLQRDWFSRIWGIF
FT                   GFSKHDWTCRLSHKRCILSPKIRAWFTRVYLYGGAHWNV"
FT   exon            975581..975713
FT                   /number=1
FT   exon            975747..976270
FT                   /number=2
FT   exon            976422..976544
FT                   /number=3
FT   exon            976598..976603
FT                   /number=4
FT   CDS_pept        join(977041..977557,977595..977674)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000375"
FT                   /old_locus_tag="AO070333000148"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY65"
FT                   /protein_id="BAE65808.1"
FT                   /translation="MPQERCSTNGLCDILLTWKTPLAERENKEKSGIMFPLMNKPLKFR
FT                   EEPYEAEKRLKHIMLVVIDIAMRTLAQAIFRSKVIKQLLRQSGTKDPIIQELVADDVRG
FT                   YNKDMEPKPWDLFLYQDNDQPISEETVIAATVTCGTYGCIIMELFLQHQGANLPVSEDV
FT                   VKAVAGSLYEGRISQSLKRWSGKLQGIMEIMDLKS"
FT   exon            977041..977557
FT                   /number=1
FT   exon            977595..977674
FT                   /number=2
FT   CDS_pept        complement(join(979245..979821,979874..980482,
FT                   980610..981433,981494..981634,982439..982494,
FT                   982533..982605))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000376"
FT                   /old_locus_tag="AO070333000149"
FT                   /note="putative alpha-1,2-mannosidase"
FT                   /db_xref="GOA:Q2TY64"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY64"
FT                   /protein_id="BAE65809.1"
FT                   /translation="MAEAYYKSLSATISMRTGIKWIVKGTQYTHYGFTPRGHTILFDRL
FT                   KPAANIHKGMAKAVADTQGENQAGFAFDTETVTGFSHTHDSGTGGSPSMGNFPIFAQPN
FT                   CPDDDLNQCKWQQNDRAVAWVRDSPKARPGYFSIAMENGVQAEMTVTNHSALYRFTFNN
FT                   VPTESLSPVILVDLMDLPQSRKGGIASVDSSGRLTGNATFNPSFGIGSYELHFCVDFKG
FT                   GDIRDTGTWVKNRANSSQKTVSLVEDGSNTPATLSAGTFARFHTLRDNTITARVGVSFM
FT                   SVEQACSNVETELPNFDFANTVSAAESAWRDKLNVISVNAEGISSDLQKVFWSGAYRAM
FT                   ISPQDYTGENPLWKSEEPYYDSFYWSLVDIYRHEGYLPDCRMSLCKGYTQGGSNADVLI
FT                   ADAFLKNVSDVDWDTAYEAIVKDAEVEPANWGVEGRGGLRSWKGLGYIPTDDYDPDGSG
FT                   LHTRSISRTVEYAYNDFCIAEVAKRMGHDSDYEKYLMRASNWQNMFKDDQRSTINGVDT
FT                   GYVGFMQPRYLNGTWGYQDPIFCSPLMNFTSCYLNPDGHETYEGSSWLYTFYAPQDMSL
FT                   LIKRLGGAQLFTSRLNYLHDSGILYVGDEQAFLTVFQFHYAGRPALSAARSHFYIPSQF
FT                   NTSVSGIPGNDDGGAMGSFAVLSMMGLFPVHGQDVYLITPPFFKEISIRNSVTGAVATI
FT                   RNLNFDPTYKAIYIQSATRDGKPWTKNWIGHDFFNQGGVLELELGLTESAWGTQNEDLP
FT                   PSMSHY"
FT   exon            complement(979245..979821)
FT                   /number=1
FT   exon            complement(979874..980482)
FT                   /number=2
FT   exon            complement(980610..981433)
FT                   /number=3
FT   exon            complement(981494..981634)
FT                   /number=4
FT   exon            complement(982439..982494)
FT                   /number=5
FT   exon            complement(982533..982605)
FT                   /number=6
FT   CDS_pept        join(984713..985038,985092..985571,985630..985682,
FT                   985723..985760)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000377"
FT                   /old_locus_tag="AO070333000150"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY63"
FT                   /protein_id="BAE65810.1"
FT                   /translation="MNAVNFMANQPITDTTPTEIIGLNQSRSTSSRSAGHSPLNFNNAT
FT                   SPHVPGNAYNIVRSRPPSSNTASGSPSQPSERDEFQDIFSELLTGTEHEIAFLVRHFSE
FT                   SLGPWLDVSDSTRFFEVHVPIRAINDPFLNFAIAALAAKHLGRMKGATSPASGGMFTSP
FT                   ATMEIYPNATQVDWFLKATNYYYIAASRMNSAISEAYTSVSSSAILEESAIQIASRWLS
FT                   SQPQQSSSAAEEAAASTFSRKAENILAASTIMTMYKILDEPAENWQSHLSGIKSLFDSL
FT                   IEVHSGRRSGTLPGWIT"
FT   exon            984713..985038
FT                   /number=1
FT   exon            985092..985571
FT                   /number=2
FT   exon            985630..985682
FT                   /number=3
FT   exon            985723..985760
FT                   /number=4
FT   CDS_pept        join(988379..988753,988807..988936,988988..989405,
FT                   989461..989802,989857..990391)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000378"
FT                   /old_locus_tag="AO070333000151"
FT                   /note="alpha-amylase"
FT                   /db_xref="GOA:Q2TY62"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY62"
FT                   /protein_id="BAE65811.1"
FT                   /translation="MSPFNSGTRSESSSPVQKNVKKWWKESTVYQVYPASFKDSDGDGI
FT                   GDIQGILSKLDYIKSLGANILWLNPIFCSPQVDMGYDISDYYNIYRPYGTVEDLDQLIA
FT                   AIHERGMKLVLDLVVNHTSDQHRWFQEARSSKANPYRDWYIWRKPIYGEDGKPQPPNNW
FT                   KSYFGGSVWEYDEPSGEYYLHLFAKEQPDLNWENPYVRAAVHDIIRYWLNKGADGFRMD
FT                   AINLISKDQNFPNAEITNPDSPWQDGTKHFACGPRLHEYLQGIGKILKQYDAFSVGEMP
FT                   EVYDLNEMLRSVGSDRNELSMVFHFETVSLDHGPGGKFTSRKWELHELKTIVSRWQTFM
FT                   HENNGWNTLYLENHDQPRIVSRFGSDEPEYRVPSAKMLATFLGFQSGTLFIYQGQELGM
FT                   PNVPKHWGINQYRDIETLNHWNEITSNAPQNTPLHEACLAEYRLKSRDNARTPMQWDDS
FT                   PNAGFSSVRPWLPVHDDYQSLNALDQVNDKESVYHYWASVLRLRKAYPDVLVYGSFELL
FT                   SPEHPDLFVYARMASSGRAVIVTNFRPHEVTWSVPEKAFNSSGDVALSSYPGRTSHSLL
FT                   QPTVTIKPFEAFVWLSGTETSRL"
FT   exon            988379..988753
FT                   /number=1
FT   exon            988807..988936
FT                   /number=2
FT   exon            988988..989405
FT                   /number=3
FT   exon            989461..989802
FT                   /number=4
FT   exon            989857..990391
FT                   /number=5
FT   CDS_pept        complement(991214..991792)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000379"
FT                   /old_locus_tag="AO070333000152"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY61"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY61"
FT                   /protein_id="BAE65812.1"
FT                   /translation="MLALTLHMAYPNPVEPPWFNFGFCTCYDEYQERALGGLFGKLLSG
FT                   DNLFDDVPTSILRMQNIQTATFTEFRKAYESGTMIQLMDSKGFKQYRLQFPYLEEFFTS
FT                   PPCGPHLSVWSLKQFLAIYNPAEFPPDNTISADYGFMNCKTFTETCTLMELYKRLLRKA
FT                   SLLDLHEACVAGKLFEFAECFHKMDQAHR"
FT   exon            complement(991214..991792)
FT                   /number=1
FT   CDS_pept        complement(join(991951..992009,992110..992447,
FT                   992513..992745))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000380"
FT                   /old_locus_tag="AO070333000153"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY60"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY60"
FT                   /protein_id="BAE65813.1"
FT                   /translation="MTPGSWEKISNALIQLQRRLKKELKAEIKKEISQEKTSVVGGSSI
FT                   LTNHDPSGARRKADIERVRIKAEQNRVAEAFKRLEKEEGASAHQASSSDVQPNASSTQH
FT                   GHAEYLAECDICSRETSRNCSLCQRDFYCSQSCEDKRSGRHLFTCAKRPLTSADVLYRS
FT                   IGEDRMPEEEDVCAGFGFNYFESFADKKKFFTRYLSDTGVDISHGF"
FT   exon            complement(991951..992009)
FT                   /number=1
FT   exon            complement(992110..992447)
FT                   /number=2
FT   exon            complement(992513..992745)
FT                   /number=3
FT   CDS_pept        complement(993575..994033)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000381"
FT                   /old_locus_tag="AO070333000154"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY59"
FT                   /protein_id="BAE65814.1"
FT                   /translation="MNEQFTWTSPNLNQHHFITFANLLALRNGGQVEPASSPHDSEEKE
FT                   EEEDNPNNTNDADSINTTQVHQISDSGNTKLKRKFLDCLAELAANDKGARFVACSCMRE
FT                   GEDEVTVWISRNEGFREVDYTVFERLGRLLRGLGSGDSGEFLSQCRFI"
FT   exon            complement(993575..994033)
FT                   /number=1
FT   CDS_pept        complement(995599..996591)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000382"
FT                   /old_locus_tag="AO070333000155"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY58"
FT                   /db_xref="InterPro:IPR019258"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY58"
FT                   /protein_id="BAE65815.1"
FT                   /translation="MNTEFQTTLTNLENKLNTLITSLTTSPTATGAPAAAVNLLDADDA
FT                   LTTSISTLRHHQDNYARILRLRNEAASLEEKVKEIVKTVVNYEKEIRTVCNSDEIDSDS
FT                   DFDSDSSGYDSDAEMQDAGGRPRKLRGIREVDYRLLLDFARRISKYNHQAAADAEAGAK
FT                   ARVQIGEDRDTEMTGTGAIGTNGVEDGEAEPVSSVTKDATSWLDESANMTRQVYMLPYP
FT                   MEDRIRLGLMGQIQLAAGEGRPGFDPDQEVERLIREAEGLGAADAPPVANVSDEESRVG
FT                   EAAKAAVKAGSGAVGSGAGTGGVSAAVPKPKPKATLDLDLDDDDDEDDF"
FT   exon            complement(995599..996591)
FT                   /number=1
FT   CDS_pept        complement(join(997276..997330,997383..997996,
FT                   998061..998077,998134..998182,998232..998483))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000383"
FT                   /old_locus_tag="AO070333000156"
FT                   /note="mitochondrial carnitine-acylcarnitine carrier
FT                   protein"
FT                   /db_xref="GOA:Q2TY57"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY57"
FT                   /protein_id="BAE65816.1"
FT                   /translation="MSSASASTPETIRDDVKVAETKAVNQTIAQIRSLVAGAAGGVCAV
FT                   VVGHPFDLVKVRLQTAEKGVYSGAIDVVKKTVAREGLVRGLYAGVSAPLVGVTPMFAVS
FT                   FWGYDVGKTLVSKFSEVRVENNTPQYTIGQISAAGFFSAIPMTLITAPFERVKVLLQIQ
FT                   GQNPPPPGQKPKYSGGLDVVRQLYKEGGIRSVFRGSAMTLARDGPGSAAYFAAYEYIKR
FT                   SLTPKDANGNATGQLSMPAVLAAGGAAGIAMWIPVFPVDTIKSRLQSAPGKPTIGGTIR
FT                   SVYASGGFKAFFPGFGPALARAVPANAATFAGVELAHNFMKKFFDDE"
FT   exon            complement(997276..997330)
FT                   /number=1
FT   exon            complement(997383..997996)
FT                   /number=2
FT   exon            complement(998061..998077)
FT                   /number=3
FT   exon            complement(998134..998182)
FT                   /number=4
FT   exon            complement(998232..998483)
FT                   /number=5
FT   CDS_pept        complement(join(999599..1000339,1000397..1000480))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000384"
FT                   /old_locus_tag="AO070333000157"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY56"
FT                   /db_xref="InterPro:IPR008427"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY56"
FT                   /protein_id="BAE65817.1"
FT                   /translation="MKTTALSFALLAAATTMVSADVSVGECAQMCISNMNAKASELGCS
FT                   SGDLDCLCKSGNYSYGVRDCTTEACPSEDAAAVVAAALASCPNGSSDSSATGTNGGGAS
FT                   KTGDSASATGTDASKTGDSTATGTATGTDASKTGDSTATGTDASKTGDSTATATGTDAS
FT                   KTGDSTATGTDASKTGDSTATGTDASKTGDASTTVTGSTLSTSASTTTDGSSSSETGSN
FT                   GSSSTDGSNGGSNGGSATETAPSSTSTNSGASKTVLGSGALGALALAAFFVL"
FT   exon            complement(999599..1000339)
FT                   /number=1
FT   exon            complement(1000397..1000480)
FT                   /number=2
FT   CDS_pept        join(1001534..1001900,1001986..1002047)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000385"
FT                   /old_locus_tag="AO070333000158"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY55"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY55"
FT                   /protein_id="BAE65818.1"
FT                   /translation="MVTAQYQGLIWRAHGIGAGKFIRALDRLKGNGSPVDPITSDQQIV
FT                   IEQQTPIIPPTVQLSCGSLLQWELHQPHFSRLRGSFSGTLDSVTVQNPLDVEKALVFRH
FT                   PLTATIAYGNRGRLARRERLGRFPATAVMRSGWNEGLH"
FT   exon            1001534..1001900
FT                   /number=1
FT   exon            1001986..1002047
FT                   /number=2
FT   CDS_pept        complement(join(1004309..1004361,1004469..1005489))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000387"
FT                   /old_locus_tag="AO070333000160"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY54"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY54"
FT                   /protein_id="BAE65819.1"
FT                   /translation="MTTPNPIPLPTLSTFTQTTLNIPSATLTRHPKIEGDDHMIFTIAE
FT                   SPNHLLRVTKPRKDRPLTGTQMQKFDIAVRELVASEYVSRGLDGDIIPRAVAHEVLSGD
FT                   GVYAVSLETMLDGTGLCRGGLGEFLSERTVGGLVELMSVMKGVDISGLEGRLRDLGVGF
FT                   EVPFIPWPEIRGMRERAVIAWRRLVSRGQILAGDFGVTDGDEFEGLGERKTAFIDRVKR
FT                   PDEGVSRKVLIHNDIKGEHILVDSDGGITGILDWADAGVGYPATDIAGLVLTVGMRLAV
FT                   RIAREVGYNEDEVLQGLMQARCECVLRLDDRLNGDDEMTPVDLLKGQLVLSMEDCELVD
FT                   YRIARDYDNVGLRHVTD"
FT   exon            complement(1004309..1004361)
FT                   /number=1
FT   exon            complement(1004469..1005489)
FT                   /number=2
FT   tRNA            complement(1006123..1006194)
FT                   /locus_tag="AO090103t00011"
FT                   /product="tRNA-Arg"
FT                   /note="tRNAscan-SE"
FT   CDS_pept        complement(join(1006367..1007152,1007211..1007423))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000388"
FT                   /old_locus_tag="AO070333000161"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY53"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY53"
FT                   /protein_id="BAE65820.1"
FT                   /translation="MLLRFLSLTGALCLSSCAALSLPEHKVELSGLDPEFRSRIISNAR
FT                   PTNVPTALCSFSDSECSKDIDLHSQLTLDFSTENGTLLANHDPIFPPTFPMRFHAVRHF
FT                   QSGRETVDLAYELDVRPMPSRPDEALGGVFLLKLRLFDLQGRPASDHLVTITLNQDSEG
FT                   NLQITQLETNPVLGHHHHDGPPSWMAQLTASLQAMKDAVKDCMHGPGPRHPTARPQHGH
FT                   MQPPVDHHRTIAPEHHRYHHRPGYWAGREKNFGRLMRPVVMPALLGVMAGVIACMVGFV
FT                   LGKIFISVFYCVRGYRKQHQKQNETAIPRIVVVESAPSEKERLMAMCDDQC"
FT   exon            complement(1006367..1007152)
FT                   /number=1
FT   exon            complement(1007211..1007423)
FT                   /number=2
FT   CDS_pept        complement(join(1008886..1009127,1009271..1009346))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000389"
FT                   /old_locus_tag="AO070333000162"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY52"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY52"
FT                   /protein_id="BAE65821.1"
FT                   /translation="MSGEDSTLVVGHQHRGMPGHSIENDRPDSMWRLSQVKPGHSMTVH
FT                   ELGFGDNNHEEIFYTRVNRVGFRRVLASREVERAHYVPEDVSEVDDGSEAPNDKKGYLM
FT                   E"
FT   exon            complement(1008886..1009127)
FT                   /number=1
FT   exon            complement(1009271..1009346)
FT                   /number=2
FT   CDS_pept        complement(join(1010217..1010532,1010621..1010695,
FT                   1010868..1011285,1011363..1011657))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000390"
FT                   /old_locus_tag="AO070333000163"
FT                   /note="dienelactone hydrolase and related enzymes"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY51"
FT                   /protein_id="BAE65822.1"
FT                   /translation="MAAPPLPSASPVSLGQNILLQPPLSRCGRGPGLIIIRPYSYAECQ
FT                   AKNTSLDPEPVQKWAEESYAVVQITLEHEMSADGGGVLGLVERGIAAFESSNEFYGSPA
FT                   DYAPGFGKILGNVITALNKKLAAAVFFSSWDMSEESNPILSHIPGNFQPTGPAKKDNHT
FT                   VYSYADVSSAGFIVPGHADFKITSAGVAHTRSLTFLKKHLNGPYFDLEKIWEEHTWYEF
FT                   GDRSVEKTMATMVQEPRTVGTDRIVDEFIFSLTHNKEIDWLLPGIPPTGKPLRIPFTSV
FT                   VNIRGDRLYHEHIAWDQATVLVQLGLMPEYLPYPYALPGGQLPGPGKRFEYRVPAAGVE
FT                   TAMKLQDEHAVPSNGMFEFKVREVDDE"
FT   exon            complement(1010217..1010532)
FT                   /number=1
FT   exon            complement(1010621..1010695)
FT                   /number=2
FT   exon            complement(1010868..1011285)
FT                   /number=3
FT   exon            complement(1011363..1011657)
FT                   /number=4
FT   CDS_pept        complement(1011989..1012744)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000391"
FT                   /old_locus_tag="AO070333000164"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY50"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY50"
FT                   /protein_id="BAE65823.1"
FT                   /translation="MAIQKYDTIGASYNDVSQLATGKLQLAAIQALIGDIKGLTVLELA
FT                   CGPGFYCRKAISWGARHATGVDISPTMVHAARANAKGDKRMEFHIADCIQPFNFNIGQF
FT                   DIILAPWLLNYARNESELVGMWRNVYNSLKPGGKVIGITTNLHLLDNPAAFPTGRRFGQ
FT                   ELEVLGAIEDGGLEVRATLFTSKPFSFTNYYLPSVLYEKSALLAGLSDFRWISITEALL
FT                   GDCEVDWDAFSKCPPFLTFTAVRPLDVLK"
FT   exon            complement(1011989..1012744)
FT                   /number=1
FT   CDS_pept        complement(1014089..1014694)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000392"
FT                   /old_locus_tag="AO070333000165"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY49"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY49"
FT                   /protein_id="BAE65824.1"
FT                   /translation="MIEALPLELLEMIIQIALDLDEQHKPTGVPKVWEAYPGRRRKRPP
FT                   GQSVSRTALPLILSCKTLCTITHAIILSHVQFWSPHHWQMDSLLKSLDQANLLPKLRTV
FT                   AIKLDSDDDITWDDKGQSYEDDGRSDQLVARTQTLLERLPDGLLTLSLATKFEDYSSYI
FT                   YVGRIQPAFHPRLEKFRNLRHLELDSSGFRSSHKQPFR"
FT   exon            complement(1014089..1014694)
FT                   /number=1
FT   CDS_pept        complement(join(1015303..1015773,1015786..1015919,
FT                   1015930..1016249,1016346..1016476,1016555..1016587))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000393"
FT                   /old_locus_tag="AO070333000166"
FT                   /note="sorbitol dehydrogenase"
FT                   /db_xref="GOA:Q2TY48"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY48"
FT                   /protein_id="BAE65825.1"
FT                   /translation="MLATPLLTQCRNPSFVLRKVKDVVIEDRPKPVLKDPDDVIVHVKQ
FT                   TGICGSDVHYWQRGRIGDYVLAGPMVLGHESSGKVVEVGVAVSHLKAGDRVAMEPGVPC
FT                   RCCNQCRSGAYHLCGGMSFAATPPWDGTLAKYYVNTADFCYKVPDHMSMEEAAMVKPAA
FT                   AIAKTADLRAHQTVLVFGCGPIGVLCQTVAKAHGAKTIIAVDVLEVAKSYGVDHVFMPE
FT                   KPEPGADPIAHAEKMAQKLKEECGLGEGADVELECSGAEPCVQMGVFAARHGGTIVQAR
FT                   MGKEVINFPITAVCTRGLVVKGSIRYLTGCYPAAIDLIGKGIIDVKRLVTNRFKFEEAE
FT                   QAFELVKAGRQDVFKVMIAGVV"
FT   exon            complement(1015303..1015773)
FT                   /number=1
FT   exon            complement(1015786..1015919)
FT                   /number=2
FT   exon            complement(1015930..1016249)
FT                   /number=3
FT   exon            complement(1016346..1016476)
FT                   /number=4
FT   exon            complement(1016555..1016587)
FT                   /number=5
FT   CDS_pept        1017160..1017918
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000394"
FT                   /old_locus_tag="AO070333000167"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY47"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY47"
FT                   /protein_id="BAE65826.1"
FT                   /translation="MEREARFLRNGHEHPWLFRGQLDQLRSFICRWCGGLAVSDRFTVH
FT                   VHLRSLCNCPMASRVAEVRCLPLFRPIDVSPITDLLCHPKRRWLMQKGYEKEAIEILSC
FT                   IEDKPIDDPYVVAQKNEIEYTIYYERENAIRWRDILLRRKTDSTDSKSLRRLILGAGTQ
FT                   FMQQFEGINIMSYYLPIVLMKFVGLSDSMVRLLTAVNSVTYLICTCCAVGLIERMGRRG
FT                   LIMLSTAGQFFAFLIITILLRYAEANAGTV"
FT   exon            1017160..1017918
FT                   /number=1
FT   CDS_pept        join(1019573..1019607,1020603..1020710,1020769..1020822,
FT                   1020877..1021338,1021399..1022332)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000396"
FT                   /old_locus_tag="AO070333000169"
FT                   /note="synaptic vesicle transporter SVOP and related
FT                   transporters (major facilitator superfamily)"
FT                   /db_xref="GOA:Q2TY46"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY46"
FT                   /protein_id="BAE65827.1"
FT                   /translation="MTEDLRRYHKIKLKGFFGFDNDVDPDELRNSKDIEIHSWNGPNDP
FT                   ENPFNWSLKYKWLLTVTVCFISILTGLPAGTYGSGNDWMEEKFHVQNSPFPNLYWATTS
FT                   WNMGAAFWPLIFVPLTESSGRMPGYFVAYVILVISLFPSAFANNFATLVVTRFFGGGAS
FT                   SVSINIVGGSISDVWLGEKARSLPMSLFGFTSVVGIALGPFIGSAIVQIHKSDPWRWIF
FT                   YIQIIYNAALIPVFYLILSETRPDVILKKRARKIRKETGRPVYAQAELNKVNTLKLLQI
FT                   SFQRPTRMLLTEPVVIFFTLWISFAWGILYLFFSSVVQTYSTNYGWGVMATGLVQLAIS
FT                   VGAVIGTAINPIQDWIYLSSARRNSEKPGKPIPEARLYTAIPGSLLFAAGLFWYGWASM
FT                   PDVHWIVPTIGITAAGIGIYSIYMAVVNYLTDAYEKYAASALSAASLGRNSFGAFLPLA
FT                   SPQLFSNLGFGWAGSLLGFIGIALSVVPVVLVLKGPQIRNSSPFMRESMWTSDEVDEVD
FT                   EPSAEKVPTAEIP"
FT   exon            1019573..1019607
FT                   /number=1
FT   exon            1020603..1020710
FT                   /number=2
FT   exon            1020769..1020822
FT                   /number=3
FT   exon            1020877..1021338
FT                   /number=4
FT   exon            1021399..1022332
FT                   /number=5
FT   CDS_pept        join(1022998..1023098,1023333..1023564)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000397"
FT                   /old_locus_tag="AO070333000170"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY45"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY45"
FT                   /protein_id="BAE65828.1"
FT                   /translation="MDPFKATITLSARLDTFITINTFFKKDPKDDDVCWVGERQTPRTS
FT                   CNYKWDMLCLQRWLVVEVLGVEQGYDCLLLKDISSLKQLVKERSSCLVEDVHSIFDNSI
FT                   PLLSFV"
FT   exon            1022998..1023098
FT                   /number=1
FT   exon            1023333..1023564
FT                   /number=2
FT   CDS_pept        join(1026172..1026327,1026412..1027350)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000398"
FT                   /old_locus_tag="AO070333000171"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY44"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY44"
FT                   /protein_id="BAE65829.1"
FT                   /translation="MVVSSLVRRGMELASDMPMNSKNPEVPSIHLSGWLAGLFVFSVLA
FT                   FFFVVFSIEYTYGMVVAALAAVEETNPDIYIRVKTDSNPDKDVDAAEPEADILRPQPIT
FT                   SKLRTTIKHLRARAGFWSRFRGFGLFFTYSLAEGFLFSILPVSMTNFAGQLVARMIIGM
FT                   ALANLEMTWVHIVISEPSPKRFYQRIPGFKSWLRIAPVVAFEQGAVCAAFYIPLLIAGA
FT                   AGALSDLVVDPNANLPPAELVSRAATVIAIPSLLAGLVSIPVRAVTIRVAASMLPKEDE
FT                   AIIPFDRSFGGKVVPATLGGSGKLSIKDAWTTFDGPARIRYLKVIGKVFAMEFAATILF
FT                   SFVLGCQVHAGALAYGVRRSEVSA"
FT   exon            1026172..1026327
FT                   /number=1
FT   exon            1026412..1027350
FT                   /number=2
FT   CDS_pept        join(1028030..1028189,1028289..1028381,1028450..1028695,
FT                   1030051..1030076)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000399"
FT                   /old_locus_tag="AO070333000172"
FT                   /note="ubiquitin-protein ligase"
FT                   /db_xref="GOA:Q2TY43"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY43"
FT                   /protein_id="BAE65830.1"
FT                   /translation="MATSPAGRMLVRQLQQMQSAKDLPGISCGLVDENNVFEWEVMLMI
FT                   SDDVKLYGGGFFRARLSFPPEYPHMPPKMKFETPLFHPNIYPNGDVCISILHPPEEDKY
FT                   GYESAAERWSPVQTPETILLSVISMLSSPNDESPANVEAARLWREDPKEFKKKVRKCVR
FT                   DSLGLIAGHVT"
FT   exon            1028030..1028189
FT                   /number=1
FT   exon            1028289..1028381
FT                   /number=2
FT   exon            1028450..1028695
FT                   /number=3
FT   exon            1030051..1030076
FT                   /number=4
FT   CDS_pept        1031724..1032308
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000400"
FT                   /old_locus_tag="AO070333000173"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY42"
FT                   /protein_id="BAE65831.1"
FT                   /translation="MICIALPRLPGSRGESSSMTENLIFIFELLKGVTKIFTITRSWLE
FT                   NNLFASKNGFYEKSVTPLDAGTEAALTRLADLNDTLLSSVEPGQHSIIKDAISHLRRCF
FT                   ARYAHEQDAASVLSWLAGVDKEFVHVVCRRQPLALLVLMHWGVLLAELDGKTWWARKSG
FT                   SALVSEILIALQGGDARWEEAVLWPKQKLGL"
FT   exon            1031724..1032308
FT                   /number=1
FT   CDS_pept        join(1033474..1033527,1033574..1034002,1034069..1035634)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000401"
FT                   /old_locus_tag="AO070333000174"
FT                   /note="copper amine oxidase"
FT                   /db_xref="GOA:Q2TY41"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015800"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="InterPro:IPR036460"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY41"
FT                   /protein_id="BAE65832.1"
FT                   /translation="MTLSMHPFDPLTPREISKAATITRSALPGESPIFRVITLKEPPKQ
FT                   DTIHFLDREHSGQPLDVRPTRVARVQVITRSESKNKLTELLIDLDHAAVVKQEHLAGKH
FT                   SYIDSEYMKSVEQACLADARIQEEIKKLKLPTGATVIVEPWAYATDGMNDMSERLSMCW
FT                   FYMRLLDNPDANYYAYPLDLCAEVSEQLQVTKIYQLPSSSEERIHNHPQPYDQRKVHST
FT                   EASEYHPSLRPPPRNTTKPYQVVQPEGPSFNVEGNVVTWEKWRMHVGFNYREGLTLHDI
FT                   RYDGRSLFYRLSLAEMFVPYGDPRAPYPRKAAFDLGNDGAGINANNLRLGCDCLGLIKY
FT                   FDGWHNTNSGEPLKLPNVICCHEQDDGILWKHTNFRTQNAVVTRARVLVLQTIITVSNY
FT                   EYIFAFYFGQDASIHYEVRATGILSTCPINIGHKVPYGTIVAPGVLAPYHQHLFCLRID
FT                   PALDGHSNSLQIEESIPIPLSDPTNPNPFGVGYTTTSRIIEHEAGLDLDFTKNRTFKII
FT                   NEHSTNPITGTPIAFKLLPYYSQMLLADPSSYHAKRSEFASHAVWVTRYHDDELFPAGR
FT                   HTMQSAGGEGIASVIESRRRQSSPHSSVRNQDIVVWHTFGSTHNPRIEDWPVMPVDKMV
FT                   VGLKPVNFFTGNPALDVAVSTQERNKSVLFEGVGKASSGGGAACCKL"
FT   exon            1033474..1033527
FT                   /number=1
FT   exon            1033574..1034002
FT                   /number=2
FT   exon            1034069..1035634
FT                   /number=3
FT   CDS_pept        complement(join(1035998..1036883,1036935..1037153,
FT                   1037201..1037419,1038388..1038779))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000402"
FT                   /old_locus_tag="AO070333000175"
FT                   /note="putative Zn2+ transporter MSC2 (cation diffusion
FT                   facilitator superfamily)"
FT                   /db_xref="GOA:Q2TY40"
FT                   /db_xref="InterPro:IPR002395"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY40"
FT                   /protein_id="BAE65833.1"
FT                   /translation="MSTGAPVSSVDTISPTLSTQGHYKPTPSRGHSRSKRWSQGPISYS
FT                   ASDAASTQQSSQPLTGPTDVNGNASSSSHGHQHSHSHSSSHGEPWGKFDHANGLHTHIS
FT                   KHSHSGSVTGLVPDTPIVSSNPESLRTGVLAGIAVLASRFEDRQLRLVMQAHNHHHHHH
FT                   THSIDDASNITKLILRYSEPYPLLYSILKESDSRRIFYFMTLNFAFMLVQLSYGFLTGS
FT                   LGLLSDSIHMFFDCLALVVGLCAAVMSKWPPSARFPYGYGKVDTLSGFANGVFLMIISI
FT                   EIIYEAVERLSSGSQMHRIGELLVVSAAGLAVNLVGIMAFDHAHHRHDHGHDHSHDNEN
FT                   MHGIFLHILADTLGSVAVVISTILVHYSGWSGYDPIASCMIAILIFASAVPLVSSTAKK
FT                   LLLTLPADVEYNVRETLAGVSTLRGVVGYTVPKFWLDDTAKSDHDHGCSHSHSHSHSHN
FT                   HSHHDHDHGHEHSHNHSHGHGHDHSHNHNHSHSHSHSHSHSHSHSHDHDHAHEKSNPNV
FT                   LGVIHVIASRSSDLEDVRQRTVDFLREKGMDILVQVEREGDGRCWCGGGGNKSS"
FT   exon            complement(1035998..1036883)
FT                   /number=1
FT   exon            complement(1036935..1037153)
FT                   /number=2
FT   exon            complement(1037201..1037419)
FT                   /number=3
FT   exon            complement(1038388..1038779)
FT                   /number=4
FT   CDS_pept        join(1039538..1039775,1039837..1040033,1040100..1041044)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000403"
FT                   /old_locus_tag="AO070333000176"
FT                   /note="beta-1,4-mannosyltransferase"
FT                   /db_xref="GOA:Q2TY39"
FT                   /db_xref="InterPro:IPR026051"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY39"
FT                   /protein_id="BAE65834.1"
FT                   /translation="MIESVVSVAFYISTAVTLFILLLPSQYAPKRSTAQDASTDPKTTV
FT                   QILVLGDIGRSPRMQYHALSIAKGGGQVEIIGYHESEVHPDISSDPRISIVALPPHPAY
FT                   LQTSNKLLFLVFGPLKVLFQVACLWWSLAYRTRPVKWLLVQNPPSIPTLAVASLTCFLR
FT                   QTSLIIDWHNFGYSILALKLGNGHPLVKLSKWYEKTFGRYATAHLCVTTVMASVLKKEF
FT                   LLEAPILPLHDRPANHFRPILDDNVRQEFLLSLPVAASVQSLINSGALRVLVSSTSWTA
FT                   DEDFSLLIDALCRYSQLAATTMPELPQVLAIITGKGPQKEMYIKQIADLEKAGKLQKVT
FT                   VRTAWLTTTDYAKLLASASLGVSLHTSSSGVDLPMKVVDMFGAGLPVVGWNRFEAWPEL
FT                   VTEGVNGRGFGSSNELVEELVDLFGDTSKLDRLRVGAQKESTRRWDDEWNPVAGKLLGL
FT                   I"
FT   exon            1039538..1039775
FT                   /number=1
FT   exon            1039837..1040033
FT                   /number=2
FT   exon            1040100..1041044
FT                   /number=3
FT   CDS_pept        complement(join(1041104..1041282,1041346..1042021))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000404"
FT                   /old_locus_tag="AO070333000177"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR024764"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY38"
FT                   /protein_id="BAE65835.1"
FT                   /translation="MTLSGIQSSDELPETPWKKQLDNAREQFDIARDLGGYTISRIWGL
FT                   ASHDSLVVAAFTLHPGDTVEYRTSAEERTMLVFSHANAELTEHDDLAFPYPLPDRSPDT
FT                   LRRKREAALGYILFTEGGDYSRLALSRKMLYAAACCAIVDSQNDKILSQARKALEWLAS
FT                   GIDVDLSNEIGKCSAPGSTIDAKTAEQLEGSGQQIFEQCTICDAGLSWYSAVEAQCAAG
FT                   HLFVRCGVTFLAIQEPGLSKFCSRCGTEYLSEDLVHDELKHTCRILSDVFDTCIYCSGK
FT                   FQA"
FT   exon            complement(1041104..1041282)
FT                   /number=1
FT   exon            complement(1041346..1042021)
FT                   /number=2
FT   CDS_pept        complement(1042370..1043377)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000405"
FT                   /old_locus_tag="AO070333000178"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR024761"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY37"
FT                   /protein_id="BAE65836.1"
FT                   /translation="MKQSTVKINDHILVNRANERQTPKHTTEKEGGNGPGSQAATKNWN
FT                   VTRIRTNVFTNGEWPIIYPQKRENFSIGPEQSISTVVGLAWSPPGLAKYRRCVLAVLTS
FT                   GLLLSFYDISPQGKWTRVAIVNDCLNSYFKSLIDDEELRLRKSNIRSFTWCPPLKVPIP
FT                   EQDATSYAVPPPESRWGMYLLSVTNDDNDVILLQARRSTDPTSASLYSFEVLSLTSLYE
FT                   HTENQNVQPGSIFSSALRNRARASFMSPGPWIYQPTKENKGVCSAIGNVAITLGVKLKM
FT                   VRHVVTLILDNDQTDSAVKYKARCVSEENTSYGGLLNNYHLTGALHWIHTVSLH"
FT   exon            complement(1042370..1043377)
FT                   /number=1
FT   CDS_pept        complement(join(1043939..1044139,1044193..1045137,
FT                   1045195..1045347))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000406"
FT                   /old_locus_tag="AO070333000179"
FT                   /note="acetyl-CoA acetyltransferase"
FT                   /db_xref="GOA:Q2TY36"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY36"
FT                   /protein_id="BAE65837.1"
FT                   /translation="MAIQASATRLFKRAAIPASRQWQRQFSAAAPALKEIQDAYILSAS
FT                   RTPTAKFNGSFASVSAPELGAVAIKSAVTKSGLPVEKITDVYMGNVLQGSVGQAPARQA
FT                   SIFAGLSPTVESMTVNKVCASGLKAVALAAQNIQLGLADAQVAGGMENMSRVPYYLPRS
FT                   SQLPPFGEIKLEDGLIKDGLWDVYNKFHMGICAETTAKKYEISREEQDEYAIQSYQRAQ
FT                   KAWNENKFADEIAPVTVKGKKGETVVERDEGYENLRVDKMKTLKPAFLRDGTGTVTAGN
FT                   ASTMNDGASALVLASKDLAREFGQGNRALARIVSSADAAIDPVDFPVAPAKAVPIALER
FT                   AGITKDQVAVWEFNEAFAAVIKANEKILGLQNARVNPLGGAISLGHALGSSGSRILVTL
FT                   LHQLQPGEYGVAAICNGGGAASAMVVQKLDRVD"
FT   exon            complement(1043939..1044139)
FT                   /number=1
FT   exon            complement(1044193..1045137)
FT                   /number=2
FT   exon            complement(1045195..1045347)
FT                   /number=3
FT   CDS_pept        join(1047249..1047290,1047445..1047509,1047582..1047806,
FT                   1047871..1047994)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000407"
FT                   /old_locus_tag="AO070333000180"
FT                   /note="ubiquitin-protein ligase"
FT                   /db_xref="GOA:Q2TY35"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY35"
FT                   /protein_id="BAE65838.1"
FT                   /translation="MSTSARRRLMRDFKRMQTDPPAGVSASPVADNVMTWNAVIIGPAD
FT                   TPFEDGTFRLVMHFEEQYPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAA
FT                   ILTSIQSLLNDPNTSSPANVEASNLYKDNRKEYIKRVRETVEKSWED"
FT   exon            1047249..1047290
FT                   /number=1
FT   exon            1047445..1047509
FT                   /number=2
FT   exon            1047582..1047806
FT                   /number=3
FT   exon            1047871..1047994
FT                   /number=4
FT   CDS_pept        join(1049041..1049045,1049202..1049319,1049400..1051816,
FT                   1051879..1052107)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000408"
FT                   /old_locus_tag="AO070333000181"
FT                   /note="kinesin (SMY1 subfamily)"
FT                   /db_xref="GOA:Q2TY34"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY34"
FT                   /protein_id="BAE65839.1"
FT                   /translation="MAITDQFSVVVARFRPQNKVELSSGGEPIVEFENEQSCQISSKEG
FT                   TGSFTFDRVFPMNSKQTDIFDFSIRPTVDDILNGYNGTVFAYGQTGAGKSYTMMGSDID
FT                   DDIGKGIIPRIVEQIFASILTSPSNIEYTVRVSYMEIYMERIRDLLVPQNDNLPVHEEK
FT                   SRGVYVKGLLEVYVSSVQEVYEVMRRGGTARAVAATNMNQESSRSHSIFVITVTQKNLE
FT                   TGSAKSGQLFLVDLAGSEKVGKTGASGQTLEEAKKINKSLSALGMVINALTDGKSTHIP
FT                   YRDSKLTRILQESLGGNSRTTLIINCSPSSYNDAETISTLRFGVRAKAIKNKAKVNAEL
FT                   SPAELKQLLRKAQSQVTNFESYISALETEVHVWRSGESVPKDRWTPGRNDVVSATKAEA
FT                   RPRPSTPSRLQEARSETPRPDSRVGDRSSTPSLVLEKDEREEFLRRENELQDQIAEKES
FT                   HIVNVERGLREAREELRALKENSARSGKDNEKLNTEVNELRMQLEKVSYESKEAAITMD
FT                   GLREANSELTTELDDVKQQLLDVRMKAKETSAALDEKEKKKAEKMAKMMAGFDLGGNVF
FT                   SDNERKLQDLINRVDTLHQISEAGETIAPDDLLELRTSLSETQGLIRQAELTMNDRGEL
FT                   SELQDSRRIEVEQKLADLERDYEKLLERNLGEEDVEEIRERLEKVYVTRKDAEMQAASE
FT                   LRKEIAHKDEELSKLRQSLADSQTRVSTNGAAGKNLQQQIAEFDAMKKSLMRDLQNRCE
FT                   RVVELEISLDDAREQYNNVLRSSNNRAQQKKMAFLERNLEQLTHVQRQLVEQNSSLKKE
FT                   VAIAERKLIARNERIASLESLLQESQEKLTQANHRFEAQLTAVKERLEAAKQGSTRGLP
FT                   SMDSGGNFSFGGSRIAKPLRGGGGGSESSAPVAGVQSQETGKRTSWFFDRR"
FT   exon            1049041..1049045
FT                   /number=1
FT   exon            1049202..1049319
FT                   /number=2
FT   exon            1049400..1051816
FT                   /number=3
FT   exon            1051879..1052107
FT                   /number=4
FT   CDS_pept        complement(1052882..1054024)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000410"
FT                   /old_locus_tag="AO070333000183"
FT                   /note="protein involved in rRNA processing"
FT                   /db_xref="GOA:Q2TY33"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY33"
FT                   /protein_id="BAE65840.1"
FT                   /translation="MATATQQPETSGLQNISALLETITGCLTAAGSSLPKDKRDAPSEV
FT                   SIEPPQDGISLLDTKSDLLLSYTHNLVFLMLFQLRGLSKDRDDEAEADQSLREETVKKL
FT                   AELRVYLDRGVRPLEGRLKYQIDKVIKAAEDAERTERTAAKTKATEAEYSGSDDESASD
FT                   GEGDGADESDEDQEDIDEMAYRPNVSAFAKKVEPEARAEKSNKMAPSDGIYRPPKIMPT
FT                   ALPTTETRERRERGPRRSTVIDEFVNAEMSSAPMAEPSIGSTIVHGGRHTKSKKEREHE
FT                   MERTTYEETNFIRLAKESKKDRAKRGGQAARSTYGGEEWRGLTEGADRISRLTRRAKGS
FT                   GGALDRSRKRKHGEDGQRGDGAAVGQIFEKRRKKIEGWKR"
FT   exon            complement(1052882..1054024)
FT                   /number=1
FT   CDS_pept        join(1054442..1055549,1055603..1055940,1056008..1056443,
FT                   1056502..1056569)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000412"
FT                   /old_locus_tag="AO070333000185"
FT                   /note="endosomal membrane proteins, EMP70"
FT                   /db_xref="GOA:Q2TY32"
FT                   /db_xref="InterPro:IPR004240"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY32"
FT                   /protein_id="BAE65841.1"
FT                   /translation="MAFNKRTFSIYSLLLAAPSLTTAFYLPGVAPTSYDEGQSVPLYVN
FT                   HLTPGLAQQDEQLHSVFSYDYYHPAFHFCAPENGPKYIRESLGSILFGDRIQSSPFELF
FT                   MGKNETCKAVCKEEAKFDSRSAKFTNRRIIQGYNFNWLVDGLPGAQINVESVTEAKFYN
FT                   PGFALGSLNDNGQAVLNNHFDIFIEYHAVGYGAKDKYRVVGVLVQPDSRGNSKVQGDGT
FT                   VDCGSSDVPVILDEDSETGVTWTYSVYWRESSTPWATRWDKYLHVYDPKIHWFSLINSA
FT                   VFVVFLVGMVSMILVRALRKDIARYNRLDMINLEDLDGTSAAVEDGIQEDSGWKLVHGD
FT                   VFRCPKSPLLLSVLVGNGAQLFMMTGATVLVALFGLLSPANRGFLATATLLIYTLFGFI
FT                   GGYVSARVYKSFGGEAWKRNIIMTPALVPGFIFSAFFLLNLFVWAKGSSGAVPFGTMLA
FT                   LVAIWFVISVPLSVAGSWLGFKQRAVEGPTKTNQIPRQVPPMTGSLRTIPSLLLTGILP
FT                   FGAIFVELYFIMTSLWTNKIYYMFGFLFLCYGLMIITTAATTVLLVYFLLCAENYRWQW
FT                   RAFAGAGMTGGYVFLSALLFWATRVSFGGFTGAVLYVGYSALIGFVVFILTGSIGFFAS
FT                   WAFVQRIYGSIKVD"
FT   exon            1054442..1055549
FT                   /number=1
FT   exon            1055603..1055940
FT                   /number=2
FT   exon            1056008..1056443
FT                   /number=3
FT   exon            1056502..1056569
FT                   /number=4
FT   CDS_pept        join(1057414..1057424,1057660..1057745,1057812..1058107,
FT                   1058165..1058344)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000413"
FT                   /old_locus_tag="AO070333000186"
FT                   /note="Ca2+ sensor (EF-Hand superfamily)"
FT                   /db_xref="GOA:Q2TY31"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY31"
FT                   /protein_id="BAE65842.1"
FT                   /translation="MGKSQSKLSPSQLDELQKATHFDKKELQQWYKGFLKDCPSGTLTK
FT                   EEFQKIYRQFFPFGDPSSFANYVFRVFDSDNSGMIDFKEFICALSVTSRGKMEDKLDWA
FT                   FQLYDIDGDGKITYDEMLAIVEAIYKMVGSMVKLPEDEDTPEKRVRKIFRMMDKDENGS
FT                   LDMEEFKEGSKRDETIVSALSLYDGLV"
FT   exon            1057414..1057424
FT                   /number=1
FT   exon            1057660..1057745
FT                   /number=2
FT   exon            1057812..1058107
FT                   /number=3
FT   exon            1058165..1058344
FT                   /number=4
FT   CDS_pept        join(1059452..1059465,1059584..1059909,1060050..1060317,
FT                   1060504..1060534)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000414"
FT                   /old_locus_tag="AO070333000187"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY30"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY30"
FT                   /protein_id="BAE65843.1"
FT                   /translation="MAATGRNRWVSLKIMTADLRDSRDLEKLKVLGSHSRGGLSSNYIV
FT                   QLLDSFSHEGPNGVHQCLVFELLGPSVDRVLADYREGHDKLCPETVLQMSTQLLKALKF
FT                   IHSAGMSHGVLGTPEIELLARVDGAPLHNGLPTQLVKAAEWVEWVDEDDEEIRLLDVGE
FT                   SFLQGEEPNVLAQPGTLRVPETFSQTILIIASICGAQGACHDLTMEQGE"
FT   exon            1059452..1059465
FT                   /number=1
FT   exon            1059584..1059909
FT                   /number=2
FT   exon            1060050..1060317
FT                   /number=3
FT   exon            1060504..1060534
FT                   /number=4
FT   CDS_pept        complement(join(1064506..1064539,1065753..1067930,
FT                   1067982..1068961))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000415"
FT                   /old_locus_tag="AO070333000188"
FT                   /note="helicases"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY29"
FT                   /protein_id="BAE65844.1"
FT                   /translation="MEEFVVRIYNCIFGPAGRRAEPFLNFLADVVQLDVELHSDATSTY
FT                   LELSLQVFCKIIELNSTAFIQEPLKPVARRFYDLFMILHALKTAGSLDLSRHHLEVLQR
FT                   RLKIGAALPPLLGSSKPLQTYKSPVTFVTPKDPPGGRHDNDHADICSVQILPTFQEIMS
FT                   PRSEYLPGKHPQQWHIGGLAGLLDRNFRLLREDTIGQLRDVIHAELMPSHLRQVQRSQV
FT                   RTNVYQNVQVRGLDFDRLTGLQFVVQFAQPLNVRTMSEAHRREWWELSKRLQSSALVCL
FT                   TDHQGFAIFCTVAGPERPRTDGRQERRQRKVSSLWKEASVVSVTMEPRHSNRAVSLIEF
FT                   PGILLPSFQPTLKALQSMKKAADLPMSEFLAPDEMLTGLVDMPPPKYAAVPGFSFNLRC
FT                   LMNDQSDLLLSPSQPLDLKKLQEKSTLDDAQAQALVHTLQRKIGLIQGPPGTGKSYTGV
FT                   ALIKVLLANKAKVKPRLGPIICVCYTNHALDQLLEDLLDDKITTQIIRIGSQSKSERLQ
FT                   PLNLRTVARQIDKTRLEKQEQWKLQMNFDEYENSFDALRLDAIGTDRSLEFHLKRNHPR
FT                   HFSQLFDKDEDGFEKVTGRRRQHLLQTWLRSGPATKGQQRAVNDLLEVPVDNMTSKERR
FT                   ILYEHWIRESREELHTQAHSILTSHQENKASYDKIRDELDLRCLRNADVIGVTTTGLAR
FT                   NLNMLRRLQSKVIMCEEAGEVLEAHLLTSLLPSAEHVILIGDHQQLRPQIQNYGLSREN
FT                   RAGQQYSLDRSLFERLVEPDDDAGIRLPFSTLETQRRMHPSIAQLVRDTLYPRLQDAPS
FT                   VSLYPEVAGMRKRLFWLDHRRPEGNSSVQDAMATSHWNDHEIELTLALVNHLLRQGEYQ
FT                   AGDIAVLTPYLGQLHRMRRKLSQAFTITLGERDQDDLDKAGFTEDERPTTPSAVSRSTL
FT                   LQALRVATIDNFQGEEAKVVVISLVRSNDQNRCGFLRTPNRINVLLSRAQHGMYIIGNS
FT                   ETSRGVDMWHKVLNIFEGHDNFGTSLELKCPRHPSTPITVSQPDDFVQFSPEGGCSLRC
FT                   GKRLQFKGHLTIKSD"
FT   exon            complement(1064506..1064539)
FT                   /number=1
FT   exon            complement(1065753..1067930)
FT                   /number=2
FT   exon            complement(1067982..1068961)
FT                   /number=3
FT   CDS_pept        complement(join(1070196..1070740,1070835..1071047,
FT                   1071112..1071124))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000416"
FT                   /old_locus_tag="AO070333000189"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY28"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY28"
FT                   /protein_id="BAE65845.1"
FT                   /translation="MEDPVSEIPTVIQHLTQSPPAQQAQTIDKYFTPDASFVHPFCRIQ
FT                   HFRGSRWVVKKIYQWYKVMSPRIELKIHSVAYDSDNQKLYVTMSQIFTIWIVPFHVAPV
FT                   TLTTVLSLTTNPHGYLSSSDSSTAASEKAHEPKEEEEASYADVVANGNPDHKTPLTAHT
FT                   NGHRKLYYITKQEDLYQTSEFIKFVLPHIGHWIVLAIHAFATVFCVLGAFLWWPFVWME
FT                   EQGWIPGLVLRGGNIAYDIRWKKRAIGAGSGPSS"
FT   exon            complement(1070196..1070740)
FT                   /number=1
FT   exon            complement(1070835..1071047)
FT                   /number=2
FT   exon            complement(1071112..1071124)
FT                   /number=3
FT   CDS_pept        join(1071760..1071837,1071914..1072323,1072377..1072637,
FT                   1072687..1073172,1073223..1073332,1073421..1074085)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000417"
FT                   /old_locus_tag="AO070333000190"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY27"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY27"
FT                   /protein_id="BAE65846.1"
FT                   /translation="MSEQQQRRKRERDINEGISWSGRSLTTIYAGISVLHRDYEDSRAA
FT                   IAFRNSAYLFDYIVFDLLAESSNTPVHTICNRIVSELRTYSEKHKEKIVGLAMPLSLAD
FT                   KYPPLCPQLWRELDILPLVLEHKERARADADQGELATFASWNTKELDEQADSMVRKCLR
FT                   SFGAGHVLQGEIGLGSLVGVDRNFRVRLADLQDYQETVNARTWSMAQYYAEELKRRNVK
FT                   IAFFSLSSHGRPDIHTRHSLVRFLHYLGGLNMWSRYVPKPRPGINSIIRKMQDSLEGLG
FT                   ERDDSITVDEEMCILQWVYENARRYWLCEDDPLQARSKGGADIVVIDDVPLTPAALLSK
FT                   QTDPGRPVIIENRLQVQKGALQDASNFSTRPWNFLRERLKHVDLVVSQAPKELLPNIMP
FT                   QKKVVYIPVSVDQLDGLNKCMSDFDLTFYGREFNTLCRSFETPTLNYPNEEYILHLSQF
FT                   RNLDETITVLNAYQKFRSHCMDAGMNTLFPKLLIYHYGPSRSSRSTLIYDAILSYIETD
FT                   MPRLKSCIYVMQIGPPDQLWNTLLTRAKVVIELSMCEGIPAMLLAAVQKGKPIITAKEI
FT                   GQFSFTKGVNNILFCEKGDADVIARLLRDLWTDPRLSELLLPGPRRLRDEYTTVGNAVN
FT                   WLFLAAEMSREGNVVEPDGRSIYELAGQGAGLCA"
FT   exon            1071760..1071837
FT                   /number=1
FT   exon            1071914..1072323
FT                   /number=2
FT   exon            1072377..1072637
FT                   /number=3
FT   exon            1072687..1073172
FT                   /number=4
FT   exon            1073223..1073332
FT                   /number=5
FT   exon            1073421..1074085
FT                   /number=6
FT   CDS_pept        complement(1074308..1074844)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000418"
FT                   /old_locus_tag="AO070333000191"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY26"
FT                   /protein_id="BAE65847.1"
FT                   /translation="MEGLFIEGSIATFGYWEAQHIFSSCLILVISALLNPNVATSDLLQ
FT                   TSINILRTMRDHGNIPAVDYSKRLSLIQAGVSTGSGSEHANPNLGRSQQTDRVQQVGRT
FT                   RNHGRPSDIAELAVQHSISHSLVADSGMNCADTLAHPLMDTFLDENLSAWPSSMFMDDN
FT                   AWRSLATEMEEHFLF"
FT   exon            complement(1074308..1074844)
FT                   /number=1
FT   CDS_pept        complement(1075171..1075833)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000419"
FT                   /old_locus_tag="AO070333000192"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY25"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY25"
FT                   /protein_id="BAE65848.1"
FT                   /translation="MQEIEAVYQTTVRPTVLWLCKLLALLALGELYTNRRKLNDAQIIP
FT                   GTNYYLQALHMLHDTYEEATLLHVEVLILIVSASQSLNQRHIDQRQAWYSNSLGRIRSA
FT                   YSYSGVAMRLALSLGLHRSGSAPATATAVELESRRRTWWMLYYFERMSASKLGLPITVR
FT                   DEDIDVELPSMNGLTEEEQQEFADPAHICANVKLARITGNICTSATSLTYKSMLTRQ"
FT   exon            complement(1075171..1075833)
FT                   /number=1
FT   CDS_pept        join(1076828..1079984,1080014..1080813)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000420"
FT                   /old_locus_tag="AO070333000193"
FT                   /note="oxoprolinase"
FT                   /db_xref="GOA:Q2TY24"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY24"
FT                   /protein_id="BAE65849.1"
FT                   /translation="MIRNGIRIAIDRGGTFTDAWADIPGRPDHVVFKVLSVSPDEYDDA
FT                   PTECIRRILELASGEEIPKGSLLDLSSVESIRMGTTVATNALLERKGDRVALMVTKGFR
FT                   DSLLIGNQARPNIFDLSVQRLKQLYETVIEVDERITIEGYSEDPEPKPIDTASDPNLVV
FT                   GLTGEVVRILRTPDLDAVRSQLDTLQSQGYQNLAIGLMHAYTYPEHELQIAKLAEQMGF
FT                   KVSASSVLQSMAKFVPRTQSAVADAYLTPMTASYLEGFRKGFRGQLDDENTNKVLLSQS
FT                   DGGLATWNSFSGLRGVLSGPAGGVVGLSRTCYDAEEGRPVLGFDMGGTSTDVARYSGAL
FT                   EHIFENTIAEVTIQTPQLDINTVAAGGGSILTWETGLLKVGPRSAGANPGPACYGKGGP
FT                   LTVTDANLLLGRIIPEYFPKSLDLDIVKQKFAHLTDVVNRDKGGGDAFTSETLALGFLA
FT                   IANATMTRPIRKLSEGRGYSAASHNLGCFGGAGGQHAVFIARDLGIQKAIIPRYSSILS
FT                   AYGMALADVVVENQEPVAWKFEDDTLSELQARLDLISKKGIEALKLQGFDEESIVHECF
FT                   LNMKYQGSDTTLMIRKPDQLSDFGAAFNTRHAQEFGFSQSRDILIDDIRVRSIGRPRVV
FT                   DTSSPFNELNKLDDRSTVQPPAPAFTRRVFFDILGWADTNVYTLPDLKPGTRINGPAMI
FT                   IDETQTIVVDHASRATILPEHVVLEVGSVNQEQLSTNAVDPVQLSVFSHRFMTVAEQMG
FT                   HTMEKTSISVNIKERLDYSCAIFSADGGLVANAPHIPGHLGSMSTAITAQIERHPPGDL
FT                   KPGDVIISNHPAAGGTHLPDITTITPVFDDDENPSAILFYVANRGHHADVGGIAPGSMP
FT                   PNSTELWQEGAAIESFRLVNQGVFDEAGLIRHLYEIPGTFPGCSGTRTLSDNIADLKAA
FT                   VASNQKGIQLIQALIKEFTWPVVEFYMKAIQENAAQAVRDLLKGFAQRYEGGVLEAEER
FT                   NDDGIPFHLRVTIDKETGKTIFDFTGTGPEHSGNLNSPQACLHSAIMVGVHGLIDIQSL
FT                   LTNDNIPLNHGCLAPIHVVCPKGTILSPSITAATVGCTTETSSKIADLVLKAFQAAAAS
FT                   QGTMNNLTFGYGGTDPITGKVIKGFGYYETIAGGAGAGPDWEGTSGVHTHITNTRITDP
FT                   EILEKRYPVILHEFSIRRGSGGAGLHRGGDGCVRDMEFRIPLQVSILSDRRVTAPYGMA
FT                   GGKEGKRGENVWIRKDPVTGSTRKVALGPRQTAHFRAGDRIVILTPGGGGWGEEISRDQ
FT                   KESVGLRQKIDSAGQSLLKTQGSLYERNAIAVGN"
FT   exon            1076828..1079984
FT                   /number=1
FT   exon            1080014..1080813
FT                   /number=2
FT   CDS_pept        join(1081853..1081859,1083099..1083359,1083415..1083676,
FT                   1083738..1084734)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000421"
FT                   /old_locus_tag="AO070333000194"
FT                   /note="permease of the major facilitator superfamily"
FT                   /db_xref="GOA:Q2TY23"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY23"
FT                   /protein_id="BAE65850.1"
FT                   /translation="MSELQGNVPTRRIMDNTKSPEDPVVKPPVDLGKDEPETRVVAGDS
FT                   IDACAERALVRKFDFRILPVLAIMYLFNSLDKSNLGNAKTAGLEETLNLKGDQYNIILS
FT                   IFFIPYVLTAPFLGILGKMYGPNLVLPCMMLTFGLCTVLVVVVYNFGGLMAIRWFLGMS
FT                   ESAFFPLVIYYLTTFYRRGELARRLAIFYAAQSIASAFSGLLAFGVFQIHSGPLTPWRY
FT                   LFLIEGLATVLFALFVFWYLPRSASEARFLSEAEKALAFTRMQLDSSAVVNEKLNLRDA
FT                   FRIFKHPTSWAIVGIQICLGVPLQSVQLFLPQIISKLGYGTVKTNLYTVAPNVSGAVVL
FT                   LILAFCSDWTRWRFPFIALGFLFTFLGMIIYVAIDPEKNINVAYFASFMMTWGTSAPSV
FT                   LLDVWYNNNIASEGKRIVLTSIAVPLANLMGVVSSNIFRNQDAPKYLPALITTASFGGT
FT                   GIILTLLLGFWMMLDNKRRDRAQGIKLRAMDVPTERLAEGPSSPDFRWFL"
FT   exon            1081853..1081859
FT                   /number=1
FT   exon            1083099..1083359
FT                   /number=2
FT   exon            1083415..1083676
FT                   /number=3
FT   exon            1083738..1084734
FT                   /number=4
FT   CDS_pept        1085925..1087406
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000422"
FT                   /old_locus_tag="AO070333000195"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY22"
FT                   /protein_id="BAE65851.1"
FT                   /translation="MQRLPPPARSNRKKTPWTRLLPEVGGGIRWITNTDERRCFSYFQY
FT                   YTIPTLSGFFNSTLWEKLVLQMSYAEPAVYHAAVALSAIHQDVEMHGMPLPGQELELYN
FT                   TWHRFTLEQAGRSFAILNERHFSQDPRLREVMLLCCLLFVLMELLRGKYDDAFQHLEGG
FT                   LRILNELKAQRQLVTWVPHESPVEEALVAVFAQLDIQAASFKVGGPILRIENELEASVT
FT                   EDCLLFSNVREARRAIEPLLSRAFGFLLDCWSKSDKEIICHYKWLQQEQQKLISELNRF
FT                   SAQFDNFYNYSYTRVSRKDQRGADMINILRHTTSLAIRTSLIRDEVLLSQYQPEYKVNL
FT                   ALIEGVMYKFRERPNYTLDMGVVPPLYIISIGCPDYTLRWRAIELLRSWPHREGVFDSN
FT                   WAAFIAEEHIKVQLQLQGFHGIDGLSSYVGDSGSPTSSVESKEDSGTDEKLEKGRWSTL
FT                   GQEEYTIEQGLEKTKCMEDWPCVQSLMAARRRCML"
FT   exon            1085925..1087406
FT                   /number=1
FT   CDS_pept        join(1088140..1088377,1088425..1088465,1088517..1088565,
FT                   1088629..1088750,1088801..1088946,1088992..1089080,
FT                   1089275..1089363,1089413..1089478,1089535..1089624)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000423"
FT                   /old_locus_tag="AO070333000196"
FT                   /note="beta-1,4-xylanase"
FT                   /db_xref="GOA:O94163"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94163"
FT                   /protein_id="BAE65852.1"
FT                   /translation="MVHLKALASGTLFASLASSAVISRQAAASINDAFVAHGKKYFGTC
FT                   SDQALLQNSQNEAIVRADFGQLTPENSMKWDALEPSQGSFSFAGADFLADYAKTNNKLV
FT                   RGHTLVWHSQLPSWVQGITDKDTLTEVIKNHITTIMQRYKGQIYAWDVVNEIFDEDGTL
FT                   RDSVFSQVLGEDFVRIAFETAREADPDAKLYINDYNLDSADYAKTQGMVSYVKKWLDAG
FT                   VPIDGIALTALASTGVSEVAVTELDIEGASSESYLEVVNACLDVSSCVGITVWGVSDKD
FT                   SWRSSTSPLLFDSNYQAKDAYNAIIDAL"
FT   exon            1088140..1088377
FT                   /number=1
FT   exon            1088425..1088465
FT                   /number=2
FT   exon            1088517..1088565
FT                   /number=3
FT   exon            1088629..1088750
FT                   /number=4
FT   exon            1088801..1088946
FT                   /number=5
FT   exon            1088992..1089080
FT                   /number=6
FT   exon            1089275..1089363
FT                   /number=7
FT   exon            1089413..1089478
FT                   /number=8
FT   exon            1089535..1089624
FT                   /number=9
FT   CDS_pept        complement(1090042..1090935)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000424"
FT                   /old_locus_tag="AO070333000197"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY20"
FT                   /db_xref="InterPro:IPR010567"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY20"
FT                   /protein_id="BAE65853.1"
FT                   /translation="MKLDIPAGDLAFLVTVLKETIKQHLKGGREYKVASFALSNQDAEK
FT                   YNALIPRLADFSFVKDPEKPGRSNLLMLMQTASPSKGEIYFNKPLLASGQEFMVLISNQ
FT                   VFLQNFVMPAMIENVKKQAKQKDKVASQIAVKSLSEPYLYQVYNTQDINLQKDHDPWIS
FT                   SLTASVDTTEKALCFYLDVKADVTFAGFRVETWDKSWQKFQIDEKQKITLKQTKEDKGK
FT                   STKAEPWEWLVAAVSWITLLIFGVMYAVVENKNQDLGGTVVETAPLVVQWPNQKYVTLK
FT                   SITTPNHVVLDLSVQF"
FT   exon            complement(1090042..1090935)
FT                   /number=1
FT   CDS_pept        join(1091038..1091363,1091391..1091469)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000425"
FT                   /old_locus_tag="AO070333000198"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY19"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY19"
FT                   /protein_id="BAE65854.1"
FT                   /translation="MSFSPLGMVTFVVFRVTLHSMHGEQDVNLTTRAVLNLQLRLMDSD
FT                   VDMSDICISQKLERDICLDTHWWYLGKLRIERVLGSSGDQIPAIASSFVLRHCGVGCQH
FT                   ITPHPTNGSNFAPFFSITYPSLLHNFCPLS"
FT   exon            1091038..1091363
FT                   /number=1
FT   exon            1091391..1091469
FT                   /number=2
FT   CDS_pept        join(1092740..1093611,1093702..1093761,1093865..1093868)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000426"
FT                   /old_locus_tag="AO070333000199"
FT                   /note="shikimate 5-dehydrogenase"
FT                   /db_xref="GOA:Q2TY18"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY18"
FT                   /protein_id="BAE65855.1"
FT                   /translation="MTLPTPQHYHIFGQGISQSLSPTIHNAAFAHYGLPHRYDIQECNS
FT                   LQDVKSLIDDPTFGGSSVTMPHKLSAGVFCAHVSDSATRLGAINTLIARSIESGDGTLT
FT                   REIHGDNTDWSGLYSLIKEYASGERKQVGLVIGAGGAARAGVYAMAQAGIERIYVGNRT
FT                   LAKAEQIARDFEDLCRVIPVQFPSALPEAPDVIIGTVPGEAMPQEAFKGLFRNEKGLCI
FT                   EMAYKPRLTNLLAVARENPGWTTADGVEVLLRQGFEQFRLWTGLDAPEAVMRKAIEAAT
FT                   EGKVGGTSSLPSNMGCLSTGYPINHLTCEV"
FT   exon            1092740..1093611
FT                   /number=1
FT   exon            1093702..1093761
FT                   /number=2
FT   exon            1093865..1093868
FT                   /number=3
FT   CDS_pept        complement(1093965..1094708)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000427"
FT                   /old_locus_tag="AO070333000200"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY17"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY17"
FT                   /protein_id="BAE65856.1"
FT                   /translation="MPDLHSLPAGTRPQHAIRNNGPPQLALERYMLRELAEGWPCYRDA
FT                   CEWENLLSIFHPEAHIYTTWTGLTHHKKFIEASQAGMDKGAFIMHRIHGSTTDIDPDAT
FT                   RAVTKMKATITQRFSDVSCVSGGTCDADAESDCRFIFFWEKMMDPAYPDLRGQWRARFV
FT                   RHWYEKDKLIPVNPGRVPVLDEERLKKYPPGYRYLAYMQEETMGVKVLLDLPGHRREGS
FT                   TINGQKHDLLYFQAKDWMDGKDVAW"
FT   exon            complement(1093965..1094708)
FT                   /number=1
FT   CDS_pept        1094995..1095903
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000428"
FT                   /old_locus_tag="AO070333000201"
FT                   /note="shikimate 5-dehydrogenase"
FT                   /db_xref="GOA:Q2TY16"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY16"
FT                   /protein_id="BAE65857.1"
FT                   /translation="MPSETDPRAYAYLVGVGVTHSIAPPMHNYIAKALGHDWTFIAKEC
FT                   PTVEDAVELFRRSDFAGGVVTMPYKRTIMDHLDGLDEYAIRLGACNNVYRTSDGKLRGT
FT                   NTDWRGIKGCLLGASAEGRGKPAVLIGAGGAARAAIFTLHDQLECRQIYLVNRDRDEVK
FT                   VLLEEVKQVYGDGLEIIYVERVEQVAGLPSPYYIVGTVPDAEPSTPDEVEVHQIIGSFL
FT                   STPQEKGVLLDMCFKPRKTRILQAGQANGWKTVEGTEIIGHQIHEQYRLWCGEEESSQI
FT                   PVTDAWAVLRKAAEESPAINF"
FT   exon            1094995..1095903
FT                   /number=1
FT   CDS_pept        1096122..1097126
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000429"
FT                   /old_locus_tag="AO070333000202"
FT                   /note="sugar phosphate isomerases/epimerases"
FT                   /db_xref="GOA:Q2TY15"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY15"
FT                   /protein_id="BAE65858.1"
FT                   /translation="MPCAPAIASMSLGRAWVHSLPEKLSQAAKAGFKGVEIFYEDLEYL
FT                   AKEKGPVNDSTLFAAAQEARAICDHYGLEVIGMQPFLFYEGLTDRAQHREKIERLKLWF
FT                   AIVKILGTDIIQIPSNFQSEGISGDLDLIVSDMIEVADMGLKEEPVVRFAYENLAWGTF
FT                   ISTWEDLWEVVRRVDRPNFGCCLDTFNIAGRVWADPASASGKTPGADAALAASLQSLVR
FT                   TVDVNKVFYVQVVDAERMQQPLIEGHPFYVEGQPARMSWSRNARLFLYEQERGGYLPVV
FT                   QVAEAFLKRLGFEGWVSMELFSRSMADPDPTVPETHAQRGINAWRKLAEELDL"
FT   exon            1096122..1097126
FT                   /number=1
FT   CDS_pept        join(1098829..1099019,1099553..1101602,1101651..1101848)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000430"
FT                   /old_locus_tag="AO070333000203"
FT                   /note="pentafunctional AROM protein"
FT                   /db_xref="GOA:Q2TY14"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY14"
FT                   /protein_id="BAE65859.1"
FT                   /translation="MDSISVFETFTGVWVVRSGLCVSHDSHWWSSSPSPRASYISSCET
FT                   GANRRLTPLATLELRHIDVFQVPSSHVQHHGLPSSSRRYSSDASLVLVGFPGAGKKTLG
FT                   IMAAVALRRRLVDFVAVFQQRHGMHPQAYIVSHGSERYRKLELEVTEEILTEHRKGCVI
FT                   VGLGWLASRQQQVLLEEFASCHPVLYIRRDRRDLQQLIATSQDKFERMWDAGNSFFESC
FT                   SNLEFYNVTEGSTDEARSALPAYLKLKETERTFVRFLHRIWGREHLTRYSADPLSASYT
FT                   YALQVPMACLEGPLESYEELENGADAINLKVELSEFHGRRPSESMARAVAMLRRHSRAL
FT                   VIVDIIPSSVPDILSYRKLLGMALRTIPDAITCSMAHGDDLAQEVAAAKGYIKAIATYH
FT                   QEYSLARNETRPELFTFRQKAQSIGFDAIHITGESTAPGDSLHGISFPHTLAKDSLIPT
FT                   IAYDTGLFGRTSVCLNPILSPVVLESMKPTGVTLREAEMAVSACFLRRRKRFGIFGQQL
FT                   SHTLSPAMHNAAYAACGLPYTYGIAERERLSDIREILDDESYGGVAVSLPYKTEVLPYL
FT                   DEISPEALDINAVNTVVLHQECQPNGVRKTIRKGYNTDYLGIKDCIYKHLSPANAIRDG
FT                   STALIIGAGGMAHAAIYACYQLGVRRICVYNRTLSNARRLVDYYREWVKSKDKAPLELT
FT                   ILSSADDPWPAHLRQPTVIVSCIPGQKCDIESSSALNIPDHWLQSRTGGVFVEVAYDPL
FT                   ETRLIRSMRQHVSRGWIIVDGLSVLVEQGIAQYELFTTRPAPVHVMRRAIQQSILERTV
FT                   "
FT   exon            1098829..1099019
FT                   /number=1
FT   exon            1099553..1101602
FT                   /number=2
FT   exon            1101651..1101848
FT                   /number=3
FT   CDS_pept        complement(1103047..1104069)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000431"
FT                   /old_locus_tag="AO070333000204"
FT                   /note="shikimate 5-dehydrogenase"
FT                   /db_xref="GOA:Q2TY13"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY13"
FT                   /protein_id="BAE65860.1"
FT                   /translation="MSEHTLDTEALLRDSYKYGTSFFSPVSQKDTQTLKTYLLGSPLRN
FT                   SLAPLLHNTLFSLAGAACTYEAIETDNSEKLLELLVKPDSLGTAVTMPLKVRSMDMVDA
FT                   VTDEARSIGAINTVFIRRGDNGRSRLIGTNTDCIGVKESFLQNVDAKDLAFGSSQPGLI
FT                   IGGGGACRSAVYALHFVLGVKTIYLVNRLKEEIDDIIESFRRVPDFKAKLQFVDTVESA
FT                   AELSRPYLVVGTVPDRDPETEAEILAKRIVDTLMGCDAGGMQKSQGVVLEMCYHPRVQT
FT                   SFYQFAERNGWRVISGTEAMIWQGVAQHILWTEKGEVFEKESTLSTIRAKIRDALMRRN
FT                   "
FT   exon            complement(1103047..1104069)
FT                   /number=1
FT   CDS_pept        complement(1105041..1105901)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000432"
FT                   /old_locus_tag="AO070333000205"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY12"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY12"
FT                   /protein_id="BAE65861.1"
FT                   /translation="MARIANLTGHQADAHRYADLSHDIRNAFNTAFWNDSNHRYTDAGN
FT                   NDTSNATQTAQELALDSGLVPEKHRQQVLNALVELTYDYPSRDGVGPHLSGGQIGLGPI
FT                   VRALSAGGRDDVLWDALQQNDRPSYGYFVAPTVANPNGFTTIGEQWDHSDSKNHMILAQ
FT                   IDEWFHAGVVGIQPVALTTLSSTWENRLIFQPKLVGDLTSASGTYQMLQGEARCEWQRT
FT                   AEGNFHLTVNVPANAEAEVRLPSVGKVNASRRARFVRVDSDYTIYAVPAGTHVFNNETA
FT                   HAVGG"
FT   exon            complement(1105041..1105901)
FT                   /number=1
FT   CDS_pept        join(1110194..1110264,1110296..1110338,1110407..1110545,
FT                   1110590..1110999,1111016..1111774)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000433"
FT                   /old_locus_tag="AO070333000206"
FT                   /note="predicted transporter (major facilitator
FT                   superfamily)"
FT                   /db_xref="GOA:Q2TY11"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY11"
FT                   /protein_id="BAE65862.1"
FT                   /translation="MDVSSDLPGPGQLTLSMLALFMGMSQLFHASRMISTVLVFKYFHL
FT                   KWSYLLSLFIFELGSLICAVAPDSATLITGHAIAGIGTAARALASFHGCHGVSYALASF
FT                   IGPLLGGAFNERISWRWCFHINLPIGGVAALIISLFFWTLNAAKPMAAPLRERIIQLDP
FT                   IGCALIMGGVVCYLLALKWGGLQKSWSNSSVIGTLIGFILLFAAFGINEWCFGEYASIK
FT                   RRILVNSTVVFFNLSGFFVPIYYLPIYFRSIKGTSPITSGVYNLPLLIGGIFSMIAGTL
FT                   LTATQQFVPFMVVSAALSAVGGGLIYTLDQNTSTGKWVGYQIIAGSSTGFISQIPIMAN
FT                   TACVEMQDMSTASAMTLFFQLIGGSFSVSAAQSVFGNVLFNRIQNTVPGLSPEAVIGAV
FT                   AANLRTSFSAEQLPGVLTAYMDGLKGTFAVATVLLAMSAPLVLLPKWERLRPEAPQSID
FT                   LEVAVEKSPIESESK"
FT   exon            1110194..1110264
FT                   /number=1
FT   exon            1110296..1110338
FT                   /number=2
FT   exon            1110407..1110545
FT                   /number=3
FT   exon            1110590..1110999
FT                   /number=4
FT   exon            1111016..1111774
FT                   /number=5
FT   CDS_pept        join(1112417..1112813,1112871..1113097)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000434"
FT                   /old_locus_tag="AO070333000207"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY10"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY10"
FT                   /protein_id="BAE65863.1"
FT                   /translation="MSIEILTTASDDGNVLADIFFAAFNTDFDRRILPPTPDVRDWLTA
FT                   KFNRVSKAQYVSPAGSVLIKAVDTTTGDIVGFAQWKLPPIELSTPGENVDKEKQVTWPK
FT                   SGDTALCEKHFKAIDEKEEEFMGSTPHFSLEMLATHPKFGGRGIGSQLLGWGLEQADDE
FT                   RTPTFLTATVAGKPLYEKKGFQVVGSNEITEGFVQIYMVRPAKA"
FT   exon            1112417..1112813
FT                   /number=1
FT   exon            1112871..1113097
FT                   /number=2
FT   CDS_pept        complement(1113738..1114766)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000435"
FT                   /old_locus_tag="AO070333000208"
FT                   /note="flavonol reductase/cinnamoyl-CoA reductase"
FT                   /db_xref="GOA:Q2TY09"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY09"
FT                   /protein_id="BAE65864.1"
FT                   /translation="MASETVLITGASGFIATHIVESFLRAGYNVRGTVRSERTANRVRY
FT                   AFQEYKDKLSFVIVSDVVAAKAFDEAVEGVTGVIHTAAPFQTEVEDKERDLLQPAIEGT
FT                   INLLDSIKRNGHQVRRVIHTSSFGDILDASKGDRPGHIYTEADWNPMTYAEALSESTPD
FT                   VVSYCAGKTMAEHAAWDFMATENPSFDLVTICPPYVFGPVKNATTSLVNLNTSSMDVYR
FT                   LMSPMSKPSHAVPPTLVWAWADVRDVADAHLKAFEVPEAGGQRFLVAQGRYSYQRIADI
FT                   LRDKVAEVRDRVPLGKPRSGMGDVYGIDASKSENVLGLRYRPLEDSIVDAARSYLKLEQ
FT                   AN"
FT   exon            complement(1113738..1114766)
FT                   /number=1
FT   CDS_pept        complement(join(1115506..1116045,1116102..1116226,
FT                   1116493..1116607))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000436"
FT                   /old_locus_tag="AO070333000209"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY08"
FT                   /protein_id="BAE65865.1"
FT                   /translation="MIAPSEPVPSSNSAAALTQFFPNANFKEAFDEKVVLIVASLFDRV
FT                   FKTYKRIDHVVVTAGSMEAGNNWFDQKLNLESVQQPPSTKDIDVNLIGSLYVTRIASVY
FT                   LRHNRGPGVDRSILLFSCAAGFKETPGVSIYQASKHGVQGLMRSLRPYFPSPYKHNLRI
FT                   NTICPWMTETRTTLTKTVQDRWTKEGLPVSTPQEVALVSAGVLANDSLNGTSMYVEGGR
FT                   AWEIEANIDRLEPEWLGEEPSKTLALGQKVLNDAWAA"
FT   exon            complement(1115506..1116045)
FT                   /number=1
FT   exon            complement(1116102..1116226)
FT                   /number=2
FT   exon            complement(1116493..1116607)
FT                   /number=3
FT   CDS_pept        complement(join(1117271..1117500,1117541..1117652))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000437"
FT                   /old_locus_tag="AO070333000210"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY07"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY07"
FT                   /protein_id="BAE65866.1"
FT                   /translation="MVTEGISGSADVGKAAAIRVGGFGGSDVNPVADGWKDGNLKPLDS
FT                   YFGTDTSGLHREQKRMVALSSPVRYSIEGDGFLFRSCPVLSCWWPEKLTEAQDRKVNNV
FT                   WKVWRWVVI"
FT   exon            complement(1117271..1117500)
FT                   /number=1
FT   exon            complement(1117541..1117652)
FT                   /number=2
FT   CDS_pept        complement(1119383..1120084)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000438"
FT                   /old_locus_tag="AO070333000211"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY06"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY06"
FT                   /protein_id="BAE65867.1"
FT                   /translation="MASPSVCARTVRISLFSYGHANGPVVQQHREAQYHKTLAYNIRHL
FT                   PNPPRHLRLKATGLSRRLQKEFLQNDNVEAFLVKVQREILLVVKEGCDQLLYSTEQGET
FT                   KQGPEEADKHSDSNAPSSEEVALEGAGIDIAVTICCEEGRHRSVAFVEELARRLAMFKY
FT                   EDGFSQHWQLIINVTHRDIGDLEDCEQSSGQNKGSNKTQAKTRQRERREKGNRYKPRLG
FT                   DDYDEDQVTTH"
FT   exon            complement(1119383..1120084)
FT                   /number=1
FT   CDS_pept        join(1121102..1122696,1122790..1122856,1123027..1124397,
FT                   1124455..1124631)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000439"
FT                   /old_locus_tag="AO070333000212"
FT                   /note="2-polyprenyl-6-methoxyphenol hydroxylase and related
FT                   FAD-dependent oxidoreductases"
FT                   /db_xref="GOA:Q2TY05"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY05"
FT                   /protein_id="BAE65868.1"
FT                   /translation="MIQKIPREESDVLPVSVIDCHKREIVPVCGPCDYVALSYVWGQTA
FT                   AQEAPKGDSLPHHLPRIVEDAMTVVRELGLQYLWVDRYCLDQSKKAEFQAQLNQMADIY
FT                   RHALITIIGAAGSDGDYGLPGVSSRHRIKQPRIKIGDYTLWYSMTDPRKLVRESAWMTR
FT                   AWTYQEGVFSWNWIAFTDEQVFFQRSNTEQTNLERWWKTSCEMFPDGGLGADANCPLLN
FT                   MYDKVWQNEGAIHQLLAQYTARKLTYQSDAINGTLGLLKRCGNGPYRMNHYFGIPILGP
FT                   LVIHRKAMGRDPSRRWPLMEAFLVNLCWKTKGPGPRRAEFPSWSWAGWQAVYEGSAQPL
FT                   AHIGLTGRSLTKVKLSVKMKQVLVDWEAMCNMIHWDLYGDLKSLPPELYIQAPTVPLTV
FT                   CQGLKESEDNFAGHAAHLAPMSWCAVLNDNEYQILIEIDLVDEEVASTLQTKDSLLLKG
FT                   IILRHLDPHAALEYNYYDNQVWAFALVVLEDKGGTRRVGSLELRPDNYLVRWKYSVDHS
FT                   SAKSGKCWVRGLLKEVSADVEIPPSSGASSGPNTSILATSVHQPVIIVGASLVGLSAAL
FT                   CLSKHRVPTIVLEKHAAISKHPRAIGFTSRTLEIYRWLGIADQIPEVPKDFNLMRARVE
FT                   SMTGKWFESTSWSDTGNSNKRSSQEVPAPKKQYSPSRGAALPQDQLEAILQVTAIDRGV
FT                   DIRRQHWVKNVMQNQASVIVTVVDPQGKEIQIEGSYLIAADGSRSTIRELLQIPRNGRG
FT                   HMQTMRSVLFRAPLEEYMQGVHQFNIDQPDLKAFMTTYNDGRWVLMFHDDVERDEPTLR
FT                   SAINQAIGRSDLSVDIITTGRWDLAALVADTFQSGRVFLAGDAAHTLPPNRGGYGANTG
FT                   IHDVDNLAWKLAAVLSGKSSPELLDTYDVERRPVALLRHDQIFARADYKVHLDKATPAG
FT                   KKLDDDAMEFGQLYLSNGFIGVDNNLPRALKPDEWAGQPGTHVPHFWVIQDGTPFSILD
FT                   RVGEDSWTLLSESAEWGNVVAQFADEGSFQETLGVSATGASLLRPDGYIAWRTKEMPAN
FT                   PAKCLDDVVTQVAFRVNSRQN"
FT   exon            1121102..1122696
FT                   /number=1
FT   exon            1122790..1122856
FT                   /number=2
FT   exon            1123027..1124397
FT                   /number=3
FT   exon            1124455..1124631
FT                   /number=4
FT   CDS_pept        complement(join(1124943..1125409,1125473..1125659))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000440"
FT                   /old_locus_tag="AO070333000213"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY04"
FT                   /protein_id="BAE65869.1"
FT                   /translation="MTARPLVFYVIQRRLDAEARGSATEDWKDGLSQNTVAVIDSCITA
FT                   ARATTVIMDAAAKHNLVATYGYLDGEYIFSAALLLVMVNAAFPHNETNARAMETALSLL
FT                   RGMADRGNTYLGSRHSLLLELQSAIGPNRTRGEDAVLKAPVTPDSTQQPTPSTNVVEEQ
FT                   PPAVSPWPLEQDLPTMRDITFNFDINDDPGLWEEVLHQIDIDMDTDWIENTLRK"
FT   exon            complement(1124943..1125409)
FT                   /number=1
FT   exon            complement(1125473..1125659)
FT                   /number=2
FT   CDS_pept        join(1128173..1128448,1128502..1129522,1129570..1129610)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000442"
FT                   /old_locus_tag="AO070333000215"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TY03"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY03"
FT                   /protein_id="BAE65870.1"
FT                   /translation="MVVCVITVLILGFLASVRALCNYTRLSTVPGPLFTGLSDLWRTYA
FT                   RSTSDYGCSLAGLHMKYGKVVRLGPRSISVSDPTAIFPVYNGRPSERPIFEHGDRIVFT
FT                   QGSFTKSADIESSLMSKVDRRRSLDSAMRYEGIIDQAANNLITSLRQRPLVRLTTLLQG
FT                   FATEFINRLVLEESATQVMPFSAQGASCHWYNRTGKWLKLPMIEYVLLRSPAARLKRRR
FT                   GISFVPRKVQGGINGSQSSRAMNDGGISYNISLPRSYSNADGAYACIAMAFVSTFSSLL
FT                   KHENVMTRLRSEIDTAFSKGLLSDPPRWQELGKLRYLDAVIKESMRQLPSLGYNREVVT
FT                   PPEGAIVAGYYIPPGTMMELHSEALRDDPGIYGEDVHTYRPARWLTADLRQRWAMNQNL
FT                   QQLSTSINDCPKVRVTWLELKKIVVLILLKFNVAAARTSWRRTNSQ"
FT   exon            1128173..1128448
FT                   /number=1
FT   exon            1128502..1129522
FT                   /number=2
FT   exon            1129570..1129610
FT                   /number=3
FT   CDS_pept        join(1130277..1132799,1132856..1134175)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000443"
FT                   /old_locus_tag="AO070333000216"
FT                   /note="oxoprolinase"
FT                   /db_xref="GOA:Q2TY02"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY02"
FT                   /protein_id="BAE65871.1"
FT                   /translation="MAGDGKITISIDRGGTFTDVHAIVPGKPDIILKLLSVDPAHYQDA
FT                   PTEGVRQILELVTGEPHPRGQPLKLDRIGSLRMGTTVATNALLERKGARSVLLTTKGFR
FT                   DLLKIGDQSRPNIFDLSMARPGVLPEGVVEVNERIVPCHPSADKDCFSGARIVEGVTGE
FT                   KFRVVQELNLEEVRSELQRYKEQGYQSLSVALVHSFAYPEHERQIGELAESMGFSVTLS
FT                   SKLQPMIKIVPRGMSAAADAYLTPVIKTYIDSISSSFEGGLERQRECRFEFMQSDGGLV
FT                   DFRRFSGLKAILSGPAAGVVGFAATSWDPTEKTPVIGFDMGGTSTDVSRFDGHLEHVFG
FT                   SKVAGVLIQSPQLDINTVAAGGGSILSYRNGLFYVGPESASAHPGPACYRKGGPLTVTD
FT                   ANLFLGRLLPEYFPHIFGPNEDQPLDIEVTTKLFNELTQKINAERKEKGQPEYAPEEVA
FT                   LGFLKVADESMARPIRNLTQARGFETASHHLACFGGAGGQHACSVAASLGISRIIIHKY
FT                   SSVLSAYGLALAEVVKESQEPVSADFETSQSSLEKRFNDMTDSATAEMSTQGFSADQVR
FT                   HELYLNMRYEGSDTSLMILKPEDDSGFLEQFKTRHRREFNFNSDRAVLVDDIRVRTIAS
FT                   SNVRTEKSPLVQLREASLQDVSGTPDNTTKAYFDGYSSRIDTPVYLLDKLQKNARVHGP
FT                   AVIIDKTQTIVVAPNSIAKILDTCIVIDLKEEQTTVNGVPSELSSEIDPIRLSIFGHRF
FT                   MSIAEQMGRTLQKTSVSTNIKERLDFSCALFSPDGGLVANAPHVPVHLGSMQFAVRYQH
FT                   QKWLGNLRDGDVLVANHPSCGGTHLPDITVITPVFDKPGGSEIMFYVASRGHHADIGGI
FT                   LPGSMPPKSTELWQEGAAIEGEKIVSNGVFEEERIIDLLVNKPAEHPGCSGSRCISDNL
FT                   SDLKAQIAANTRGIALIQSLFAEYGVETVQKYMYAIQATAETAVRNLLKDLYKRFNGEP
FT                   LEAVDYMDDGTPIRLKVTINESDGSAVFDFSGTGPEVYGGWNAPIAITHSAIIYCLRAM
FT                   IASDVPLNQGCLAPIDIQVPSHSILSPTKTAAVVGGNVVTSQRITDVVLKAFRACAASQ
FT                   GCCNNLTFGTNSKVDPDTGATIPGFGYYETIAGGSGAGPTWKGESGIHVHMTNTRITDP
FT                   EILEKRYPTLLRQFTLRSGSGGKGLHPGGDGVIRDIEFLAPMECSILSERRVHRPYGLE
FT                   GGEDAQSGLNLWISKDEETGEERIVNIGGKNTVSMKTHDRIVINTAGGGGWGAAQ"
FT   exon            1130277..1132799
FT                   /number=1
FT   exon            1132856..1134175
FT                   /number=2
FT   CDS_pept        complement(join(1134610..1136101,1136155..1136348,
FT                   1136430..1136640,1136706..1136809))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000444"
FT                   /old_locus_tag="AO070333000217"
FT                   /note="5' nucleotidase"
FT                   /db_xref="GOA:Q2TY01"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY01"
FT                   /protein_id="BAE65872.1"
FT                   /translation="MSAVETDGLTITHSSERTGTPDLRLIHYNDVYHVEPGSAEPVGGV
FT                   SRFQSVINHYRSDPRFAGQPDVLTFFSGDAFNPSLESTVTKGRHMVPFLNKAGTDVACV
FT                   GNHDLDFGVAQLRHLRSQCQFPWLLANILDPALGEDVPIANCERTRMLTSSNGLKVGVI
FT                   GLGEREWLGTINSLPPDLIYKSAAQTALDLVPRLREQGADIIVAVTHQREPNDYKLAER
FT                   LPPGFIDIILGGHDHYYAHAIVNGIQVLRSGTDFKQLSYIEAWRKADGPGWDFNIIRRD
FT                   IVRSIPEDPATVALVAKLTSSLKSKLEKPIGYTVRPLDARFSTVRQRESNLGNFVCDLM
FT                   RFYYAADCAMMAGGTIRGDQIYPPGILRLKDILNCFPFEDPIVLLRAQGRALMDALENG
FT                   VSQLPALEGRFPQVSNITFSYNASAPPGSRINWAKIGGHPIEYDRTYSLATRGYMGRGK
FT                   DGFASLLVQSAGGEVEEVVDEESGILVSTLLRQYFLSLKVMGRWQRWSKSLARHWDTVH
FT                   QNLHCNGWLKPASGQTSPVTEKAPVRPQRPTLQRSKQYYQYGRFTEIDTEESPEKEAQS
FT                   HEDMDSDSDSDPEILTSPQPTTNYVTLPAQSAAEEERRLRLARRVVRKWMQKAGFQPTT
FT                   LNGTDDAGFTPTWTPGISPRLEGRIVIEDTR"
FT   exon            complement(1134610..1136101)
FT                   /number=1
FT   exon            complement(1136155..1136348)
FT                   /number=2
FT   exon            complement(1136430..1136640)
FT                   /number=3
FT   exon            complement(1136706..1136809)
FT                   /number=4
FT   CDS_pept        complement(join(1137707..1138976,1140759..1140871))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000445"
FT                   /old_locus_tag="AO070333000218"
FT                   /note="phosphatidylserine decarboxylase"
FT                   /db_xref="GOA:Q2TY00"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR022237"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TY00"
FT                   /protein_id="BAE65873.1"
FT                   /translation="MDHAKPSYLRQQGERIDLPWDDQFVDEIKVALMACRVIPGLWLPK
FT                   DYHIQQEWTKKIARDTIANPKPLHPAVQDLKDLIEGDSRIYLLANGMYDDIPANFTDPS
FT                   GQPVVRSYTDMLSIMNHLLTIAPSWSEHENQVGLVGLPMHALLDWPMGTFHGHGFFLDP
FT                   AVNAILKRVLDVWKDYLQSPASAEVLNNSTTGWFSPAAIKQLTAVANVDGSSYSFNELF
FT                   VCDPSEKHYNFTSWDGFFTRAFRSERRPVAEPHNDSVIANVCESLPFAIAHNVKRRDRF
FT                   WVKGQPYSVEDMLGKDELSEHFVGGTIYQAYLSSLSYHRWHAPVTGTIVKVAKFNGTYF
FT                   SEPLFASMEIYGAWPKAPRYSQGYLSAVAARAVIYIQADNPAIGLMAVVEVGMSEVSSC
FT                   EVTVKEGQRVVKGDEMGMFHFGGSTHCLLFGKGVKVSGFPEPGSRTDNVPVRSRLAVVE
FT                   EL"
FT   exon            complement(1137707..1138976)
FT                   /number=1
FT   exon            complement(1140759..1140871)
FT                   /number=2
FT   CDS_pept        complement(join(1141392..1141542,1141614..1141738,
FT                   1141814..1141869,1141920..1142092,1142153..1142181))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000446"
FT                   /old_locus_tag="AO070333000219"
FT                   /note="H+/oligopeptide symporter"
FT                   /db_xref="GOA:Q2TXZ9"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXZ9"
FT                   /protein_id="BAE65874.1"
FT                   /translation="MKEPTEEQIITPGDNENAPSTNEQVGPTREELETLPRIADKIPYT
FT                   IFMVVIAEAAERFTFRSITGPLQNYVQNPLHDDRLPGALGKGQATATAIGYFFQCWCFL
FT                   MPILGAVIADCYLGRVKTILLGSITATIGTLILFLTSLPVSLENGAGWPGLLVALIIIG
FT                   LGYVKYTTRAVNNT"
FT   exon            complement(1141392..1141542)
FT                   /number=1
FT   exon            complement(1141614..1141738)
FT                   /number=2
FT   exon            complement(1141814..1141869)
FT                   /number=3
FT   exon            complement(1141920..1142092)
FT                   /number=4
FT   exon            complement(1142153..1142181)
FT                   /number=5
FT   CDS_pept        1142891..1144486
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000447"
FT                   /old_locus_tag="AO070333000220"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXZ8"
FT                   /protein_id="BAE65875.1"
FT                   /translation="METKHPRPRPPMEDIVSPTLEDLIHLALRRMRYLVAPDLDNNHPP
FT                   PLLFPLAESMRGNPFTVDDWDTYGNLESEYGRLTYLISVYPERGAPFACEEVLLDLLQR
FT                   PSLLTEWPNFLPTLIAHAQATVHGVVQRMVSSSSNRTRSAKSDYVAIPVDYKATSSART
FT                   IALQLWKRSLGEMASQLGRGHFDGALAFLQIHAFLKDPIYGLSRPFSLQQFFFSHLLGK
FT                   CMAATRVDILHAKDLERLAAQAAQEASYLANPLLQRLTLVHFNAHHQLPYVNVPLDRLA
FT                   RAEFSVPMHVLEVVEEMLGAVAMSDGQACPLVPILVATYPRYAHDDQWLIPIIDGNHRA
FT                   TATLLLRFLATLTLPVDRQAMLEGLRGYCTAHHLGRKWQIDLCDVVTELHSPTNRKMYD
FT                   QITSQAALVRKFAWVRYIPALVVQEDDFYTICKQRSAGKHKPVLLHPYHQALFNDDDIP
FT                   IALPQKAGQTHGRPEPFRLMSLTPFGGEHSGGVDVGVARICQAKVRPSMNGLAQEPQPH
FT                   EKVQQHRAWSCVVS"
FT   exon            1142891..1144486
FT                   /number=1
FT   CDS_pept        1145141..1146424
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000448"
FT                   /old_locus_tag="AO070333000221"
FT                   /note="selenocysteine lyase"
FT                   /db_xref="GOA:Q2TXZ7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXZ7"
FT                   /protein_id="BAE65876.1"
FT                   /translation="MTALDDLDLLPEDFPQPSPFMSEWPLRRDVVHMDHGSSGACPTKV
FT                   LEHQNALRWELDRGSPEFFLSRWSPRHRAAKEALARFVHANYDELLLTPGSTLGLNIVT
FT                   QSQQFQPGDELLTTNHAYSSVTMLLRHVANRDGAKVVIAQVPFPVASEEEIVQSILACV
FT                   TERTRFAIIDHIVSRSGLVFPIKRIVQELADRGVDTLVDGAHGPGQVPVDLHDIGAAYY
FT                   TTSCHKWMCAPRGVGFLYARRDRIRRLKPLIIARSGHWRDSDGAAYSWLEHTFEWNGCH
FT                   DPSGVHSMPKIIEFLETALPGGHAAMVKRNHELAVDARRKVLGILGIDLPCPDDMIANM
FT                   VVFPLPDSVLPETQGILPLCKTLWENDRAEIQCYHWPAYPKRIFRFSVQLHNSMEQYVW
FT                   LAGKIKAALDEETRIAQAHAAEVNGLGT"
FT   exon            1145141..1146424
FT                   /number=1
FT   CDS_pept        complement(join(1147536..1147673,1147732..1148199))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000449"
FT                   /old_locus_tag="AO070333000222"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXZ6"
FT                   /protein_id="BAE65877.1"
FT                   /translation="MDSLQNHTAIPNPTVFPLDILSGFHYTFLIRNPRQSIPSLYQCSI
FT                   PPKSHITGWNGFKATDAGYAELRILFDYLVQVQIIGPGTGNDICIVDADDLLADPEGIV
FT                   EEYCCSVGIPYDPRSLHWGAEKDQQRARDIFQNWIPFHDAALKSTSLNPQPPRVTTLED
FT                   DIAEWTEKFGAEAAMLIHQNVEDNMEDYLYLKQFAIKT"
FT   exon            complement(1147536..1147673)
FT                   /number=1
FT   exon            complement(1147732..1148199)
FT                   /number=2
FT   CDS_pept        join(1149705..1149952,1150000..1150066,1150117..1150576,
FT                   1150616..1150758)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000450"
FT                   /old_locus_tag="AO070333000223"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXZ5"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXZ5"
FT                   /protein_id="BAE65878.1"
FT                   /translation="MDKTDIAHLEVLSFAKLASKDQTELNKLLDACRKQGFFYLDLAGS
FT                   NVSHGLHQRLKALSLMKDWFDRPNEEKMKLHKDSVTNGYKPPGTLSGVVKHMKDGFENI
FT                   KLPRDNFLGTGDSLPEVFKNDKEVFRDDLEISHGVTLTILSCLSDLLQPPVRLEDYHQE
FT                   NMSSQSTMMYFRYAKQCADKSSGVGHNMHTDLGTLTLLYCEQWGLQVYAQATNSWKYVQ
FT                   PRPGLYVVNVGDALRFLSGNDLLSALHRVVPVPGHERNETEFRTSENTVVSALNWHDQK
FT                   YNVFKAAHVEQEKNTILTGGIGAF"
FT   exon            1149705..1149952
FT                   /number=1
FT   exon            1150000..1150066
FT                   /number=2
FT   exon            1150117..1150576
FT                   /number=3
FT   exon            1150616..1150758
FT                   /number=4
FT   CDS_pept        complement(join(1151311..1153156,1153280..1153314))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000451"
FT                   /old_locus_tag="AO070333000224"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXZ4"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXZ4"
FT                   /protein_id="BAE65879.1"
FT                   /translation="MGKAPAAIVIARHGARLDAADKNWHLTSPTPYDPPLSYGGWLQSR
FT                   ALGARIGNVLKSLDNDILPEQTDGETLPSFRPHPSKRKRRIVIHSSPYLRCLQTSIAVG
FT                   SGISQHYPDSTGPGPGWSQPNGFLSAPVMSPAQEPTTGAITSAPAAPGDQRSLLRVDAF
FT                   LGEWLCPDYFEEITPPPKSERLIAAAKAELLRRDSIVPEADTKPATGFFPGGWGSLGNK
FT                   PLSPPIEEEDRKVYSVYTSNERREGQRNRAGSCDTLRSADTPRTRRLLSKINTNLPPIP
FT                   DGAYMPPTPSYAISPSDPIPTGYVTHARDACVRIDYPWDSMRDPPNWGNGGEYGEEWST
FT                   MHTRFHTGLERMVRWYQEHDASLPSGRRRRHSQLSVSESAEESKIPDDEDEPTDTILVI
FT                   VTHGAGCNALIGAITGEPALVDINTASLTLAVPKDRVAVTEKADTIGGPVAPYRPGNDQ
FT                   VELRDYKLQLVASTDHLRPVTNLSTSVLSSPSSLSSPSSAYRPRFSTRPSLPQGGFVIG
FT                   PSAVSGPGTGSWTFSRPSTAPRGPSGLWGSNSISAGDTADDIIPNFGDPWSGSNGTSNN
FT                   DHHSGKKSEESSDWTPQLPQRTLSQRGLWGSRPSKEPHVKRRWTVTERRV"
FT   exon            complement(1151311..1153156)
FT                   /number=1
FT   exon            complement(1153280..1153314)
FT                   /number=2
FT   CDS_pept        join(1154826..1156111,1156167..1156458)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000452"
FT                   /old_locus_tag="AO070333000225"
FT                   /note="predicted transporter (major facilitator
FT                   superfamily)"
FT                   /db_xref="GOA:Q2TXZ3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXZ3"
FT                   /protein_id="BAE65880.1"
FT                   /translation="MESDMYDATPSPSASRSDVSRNELNGKLPDDPNDDPEALTRTDTT
FT                   LSAVVPPKELWREILFVVVVCMAQFMTQAGLCISIAPVYIIGRSFQTSTPGELSWFAAA
FT                   YSLTVGTFILVCGRLGDVLGHRLMFIIGFAWFGLWSLLAGFSVWSNQVFFDCCRALQGM
FT                   GPAMLLPNAIAILGRAYPPGLRKEMIFSFFGATAPSGFIIGGVFSSILAQMTWWPWAYW
FT                   VQGMVCFAFAVLGVLVIPHTSRPHFQKDLPIWVRLDLLGAAAGIIALVLINFAWNQAAL
FT                   VGWATPYTYVLLIVGFIIFGGFLWIERIAQCPLLPSAVFTGDLAWVLGCIAAGWSSFGI
FT                   IIYYFYQFMEEIKGNSPLLATAKWVAAAPSGAIAALLTGFLLGRLPPSVIMFCAMVFFT
FT                   AGLSVFATVPVDQTYWAQAFVASLITSWGMDMSFPSGTLILSNSMPHHHQGLAASLVTT
FT                   TVNYSISLGLGFAGTVESNVNDGGRNVLRGYRGALYLGIGFAGLGLVVSILFMFVSWRR
FT                   SQVSHKSG"
FT   exon            1154826..1156111
FT                   /number=1
FT   exon            1156167..1156458
FT                   /number=2
FT   CDS_pept        1156670..1158226
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000453"
FT                   /old_locus_tag="AO070333000226"
FT                   /note="FAD/FMN-containing dehydrogenases"
FT                   /db_xref="GOA:Q2TXZ2"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR040165"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXZ2"
FT                   /protein_id="BAE65881.1"
FT                   /translation="MEAHNIAVATIAAQVHQFHKNQQPFRIYHGSTNSTRQSQHSAANT
FT                   INTANLNHVLAVDTDRKTVLVEPNVPMDELVKATLPHGLIPLVVMEFPGITAGGGFSGT
FT                   SGESSSFRHGFFDATVNRIELVLANGDIRTASQKAPDEKELFWAAASSFGTLGVVTMLE
FT                   IQCREAKPYVELTYHSTSSMSQAMTVFREATASPKTEYLDGIIYAPDHIVVCAGRLVDL
FT                   PSNQTPIQRFVRAQDPWFYIHAQRQTRKIHRPNAEPPASVTYYAPIQDYLFRYDRGAFW
FT                   TGRYAFSYFVTPFNRITRYILDTFMHTRVMYHALHESGLSKQHIIQDVAVPYKATGEFL
FT                   TWLDNKETFGAYPIWLCPLHHSQGIMARGAEAGPHQSQKEEDPEDDGDCLMNFGLWAPS
FT                   PHASDTGAFIAQNRRLEHKVRELGGKKWLYAHAYYTEEFWSIYDRKRYDALREKYHAAH
FT                   LPDLYQKVRVNLSPKSDGATEGWIGWAKRMAWETWPVCGLYGVYKAWRGGDYYLIKSKK
FT                   D"
FT   exon            1156670..1158226
FT                   /number=1
FT   CDS_pept        complement(1158428..1159414)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000454"
FT                   /old_locus_tag="AO070333000227"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR040114"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXZ1"
FT                   /protein_id="BAE65882.1"
FT                   /translation="MGRFPSLELLQRPESEGLADKFVPICRLIVRGDYIAFREHLALDS
FT                   PATEWFAQKGILLALRNRCEIIVWRALARKVFIHGGFHGEPQGSAQRGPPPFLYLHKLE
FT                   TAVRWLQSQHAQSLHGSLGFDPSGQNRDAQAGQNEFGSQLVYKLPDHDFAGVDEVDGPE
FT                   SKPDPELLSKYEDFLTPDGCFDDMGQWQSNPPGVLVDGQPDADYSQYELDPYTHRVELD
FT                   SETEQGKPTPMMRELESILASLLTQGLMRGYLTHKNPRFAIPGARLRGALPTGFPNVWQ
FT                   TISARESEDDRVPGWVQPPPPVAGGSLAAAGGGRVVNLSGARPVGVQ"
FT   exon            complement(1158428..1159414)
FT                   /number=1
FT   CDS_pept        complement(join(1159594..1160020,1160189..1160526))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000455"
FT                   /old_locus_tag="AO070333000228"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR040114"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXZ0"
FT                   /protein_id="BAE65883.1"
FT                   /translation="MAMQGAPVLDKFLSGISEIIGNRDGSKLQDFLQIEPPLSDIYRQM
FT                   VEELRQQYPNGPKEADLLRRCEGLVPRTRNGSSWTAFPTFMKLYFTFLRDVNVDNLLET
FT                   YNLLKGLVNQYGVIVLPTVLYLSKVLAKLAMGLDRRPELIAHLLRMEGRSDQDESIEKV
FT                   TLVEKSANVVREAFIKCLTDRSGTPGVHGKPEGKRVGIYLMANLCLKLLFQVRSRLRPL
FT                   RPLLGTDADDSSAGNSEMQNRCFLVSAPSPRR"
FT   exon            complement(1159594..1160020)
FT                   /number=1
FT   exon            complement(1160189..1160526)
FT                   /number=2
FT   CDS_pept        join(1161614..1161904,1161960..1163225)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000456"
FT                   /old_locus_tag="AO070333000229"
FT                   /note="flavin-containing monooxygenase"
FT                   /db_xref="GOA:Q2TXY9"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXY9"
FT                   /protein_id="BAE65884.1"
FT                   /translation="MVQPGTSQSSWVDFIKHPFVGTFTFFYLLFQAVLNWFFAPAPPPP
FT                   ASLVNGLPKKRVAVIGAGLTGVSAAAHCVGHGFDVQIFEARSKAKGLGGIWSRVNSTSS
FT                   LQIHSIMYRFHPSVKYDNAYPTQGEIREQIVDVWKRYGLQKHTAFETPVTSVKQAKDGK
FT                   WIINDDEEKYGRFDGVVASVGVCGDPKMPPLPDQEQFKGNIYHSSELDGKDVEGKKVLI
FT                   IGGGASAIEALEFAVQSKAAEIDVLSRSDKWIIPRNVLVQSLLALNIFGMETSFSWIPE
FT                   WFLHKFFYRDLQDIAPSGGLFTTTPMANSELFDKIREGKARWLRGDIVSVKENGILFNR
FT                   RARKVPKGGPGHESVVTGDVIIMATGFKRPSLSFLPDDAFEEPYTPPSWYLQVFPPKYP
FT                   EICANNSTYVDAIGTVGNMHIGIYTRFLLMFLTDPLTQPTEGRMKTWIDFTRFVKQHSP
FT                   TNAFDFFTYSELIYWFVFVILVNPFRWKWAPFVLFGVGRALPMGVVRQEESFRKQLKQQ
FT                   R"
FT   exon            1161614..1161904
FT                   /number=1
FT   exon            1161960..1163225
FT                   /number=2
FT   CDS_pept        1169794..1170474
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000459"
FT                   /old_locus_tag="AO070333000232"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXY8"
FT                   /protein_id="BAE65885.1"
FT                   /translation="MGCASISGVIESRSCVMIQTSSSSPHTNTAISTGIHIAKMVYRSN
FT                   LNTVARRIPSLIAITSKPRVQPCVVATQGRLPKARAMTLMPQFHRGPSTIKRLLDDYDR
FT                   YLSGHTLDPHPRAYAPTFDMRESKDTYQLEGELPGVKQSDVDIEYVDAHTIVIKGHTEH
FT                   ASEVEEGSWWISERSTGDFRRSFSFPSAVDQENTRARLKDGVLLVTIPKVASTWDVKKV
FT                   KVDE"
FT   exon            1169794..1170474
FT                   /number=1
FT   CDS_pept        join(1177214..1177359,1177419..1177758,1177826..1177885,
FT                   1177976..1178584)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000463"
FT                   /old_locus_tag="AO070333000236"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXY7"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXY7"
FT                   /protein_id="BAE65886.1"
FT                   /translation="MHSSLLPMLAAMLLSPVSAAGVSGTAFGFAQGTTGGGNASPQTPS
FT                   SLDELKTWITDDVARVILIDREWDFTNTEGHTSGKCCSSDTTTKCPGGTSAGQAWIQDK
FT                   CDDGTWVSCTYDNAAKKPLDVGSNKSIVGVGNKGVLKGKGLRLTGGANNVIIQNIHITD
FT                   LNPQYVWGGDALTLDGTDNFSLIGRQMIVSGWNKGGHVTISNNEFDGVTEWSAGCNGKH
FT                   YWSLLLLGLEDWYTFSGNWLHDLSGRAPHMGTDHDDSKIYFHGVNNYFQDIDGHAFDVD
FT                   TNTWVLLEGNYFDNVKTPMTDTSLKSGAQLYTTSTVNAASGCVSPLGYICEWNRNGGST
FT                   GAWPDRTDASVLTGFSNLKEHLISHTGVADVPTNVKANAGVGKL"
FT   exon            1177214..1177359
FT                   /number=1
FT   exon            1177419..1177758
FT                   /number=2
FT   exon            1177826..1177885
FT                   /number=3
FT   exon            1177976..1178584
FT                   /number=4
FT   tRNA            1178797..1178884
FT                   /locus_tag="AO090103t00012"
FT                   /product="tRNA-Ser"
FT                   /note="tRNAscan-SE"
FT   CDS_pept        1179615..1180082
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000464"
FT                   /old_locus_tag="AO070333000237"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXY6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXY6"
FT                   /protein_id="BAE65887.1"
FT                   /translation="MKTHSVAWDLHQNNCSAGVGLDFIKVPSPTLALPLSAWASLLATW
FT                   NITTHSHTDYTGYPTSLTGEMQSFANRCSYSIHFSIRNECFKDFVRRTPQSPTKIQQDW
FT                   SVLWGNILPCGQKQASFDRAEAQPRWNCLGSLSSLSSHQLPSAPLSSPHDK"
FT   exon            1179615..1180082
FT                   /number=1
FT   CDS_pept        join(1180170..1180281,1180347..1180870)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000465"
FT                   /old_locus_tag="AO070333000238"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXY5"
FT                   /protein_id="BAE65888.1"
FT                   /translation="MSVEIAQLHSEVEALVEKFDVLSKIKEIQEAGDVRSSVPVTISVT
FT                   TDATISLLEDKSTIGESTEAPKSLSKGEKSSFNITQGDELKYTVTAGELTSDFKIVFDV
FT                   DKSAPKLKLSDELEDDNAPIGFETTKTETKTEIEIEREVEVEKEWTKGKKPERKTSKET
FT                   KHEAKAGAHSLQHEVETKFKQEKDKSETETETEIEISNKKVEVEYVIY"
FT   exon            1180170..1180281
FT                   /number=1
FT   exon            1180347..1180870
FT                   /number=2
FT   CDS_pept        1185834..1187258
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000466"
FT                   /old_locus_tag="AO070333000239"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXY4"
FT                   /protein_id="BAE65889.1"
FT                   /translation="MKTSTLCTIAFSATALAVPVSVTTSDHGLADPVPAHAPEGEDHAR
FT                   LQSRTFFPMGGLCPPCGEEGASLKARTFLPLIEGLIQHKMDKFGLCSPCDTSTNSNENS
FT                   NSNDNSNTNDNSNTNTNTNTNNNSNTNNNSNTNNNSNTVTNNINGGTPPGGTPPTGGTP
FT                   PTGGTPPTGGTPPTGGTPPTGGTPPSGGMPPTGGMPPTGDVPPTGGTPPTGSIPPSGSN
FT                   PPTGGTPPTGSTPPTGSTPPSGGTPPSGGTPPTGGTPPTGGTPPTGGTPPTGGTPPTGS
FT                   TPPSGGNPPIGGTPPSGGTPPTSGTPPTGSNTSCEEDDDTCTPTGGTPPTSGTPPTGGM
FT                   PPTGGTPPTGTNTACEEGDDSCTPTTGGTPPTGGMPPTGGMPPTSGTPPSGGTPPTGGN
FT                   PPTGMPPTSGTPPDGNNTGTNKGGNTSSGSSGSSSSSSSSSSSSSSSSSSSSSSTTGGT
FT                   PGCAECQAPPPEDCEE"
FT   exon            1185834..1187258
FT                   /number=1
FT   CDS_pept        join(1188222..1188424,1188489..1188728,1188782..1189718)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000467"
FT                   /old_locus_tag="AO070333000240"
FT                   /note="adenylosuccinate lyase"
FT                   /db_xref="GOA:Q2TXY3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXY3"
FT                   /protein_id="BAE65890.1"
FT                   /translation="MSISALDSRIFRNLFGTEEVREIFTDEAYAKFLVQTEAALARAES
FT                   KVNAIPADVGDAITSVLGNIELDFDRLSRETEIVGYPVLPLVMQLVENTPEDLAKYIHW
FT                   GATTQDVMDNASMLQIKRGLDLVKRDLNKLIDILQVMAEKYRDTPMAGRTHLQHALPCT
FT                   FGYKCAVYLSSILRHRDRLRQIERRCLLVQFGGAAGTLASLGSDRTGILVRAQLAKELE
FT                   LEDPMITWHVARDNIAEVLNFLALIGGTLGKIALDIIVMSSNELDEVAEPFVPHRGASS
FT                   TMPQKRNPISSEIILATSKLLRANASLGLDAMVVDFERASGPWHLEWVAIPESFTYAVG
FT                   ALYQTTFALSGLCVKEESMEKNLHSTRGLIVGEAVMMGLAPFVGRQRAHDVVYEACKSA
FT                   IEHDRVLLDVLKENTEVSEHFNEAKLTQLCDPLSYLGSGQLMVDDVLKRVAEGKAGLKA
FT                   M"
FT   exon            1188222..1188424
FT                   /number=1
FT   exon            1188489..1188728
FT                   /number=2
FT   exon            1188782..1189718
FT                   /number=3
FT   CDS_pept        join(1190244..1191517,1191568..1191688,1191744..1191895,
FT                   1192009..1192120)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000468"
FT                   /old_locus_tag="AO070333000241"
FT                   /note="predicted transporter (major facilitator
FT                   superfamily)"
FT                   /db_xref="GOA:Q2TXY2"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXY2"
FT                   /protein_id="BAE65891.1"
FT                   /translation="MRPSSFMGLCGSALNLAQLLLIVCPAFILFGYNQSNLGGLVSVTD
FT                   FTNHFPRIDTVHTEGEQKSSNATIQGVVVATFTLGALFGCLSCSYTSDRFGRRIVILAG
FT                   AILTVVGEVLEASSFQLAQLIIGRVILGAGVGMLSGTVPTWQSECSSSSNRGKHVVLDG
FT                   LFISIGYILQAWINLGFYQVKTGSASWRAPIAIPIFFSLLLSLAILAMPESPRWLSQQG
FT                   RMQEARSTLAALKGLSDDDASIIDELSAIERSLEQSGRTAASLGDMLKMGQDRLLYRFC
FT                   LCILLQFYQQMSGGNLISVYSTVIFQEGLRMDSETSRILSGGTLTWKLLSCFAGFFAID
FT                   RFGRRFVLMVSGTGMATCMMGLAVATSFPHSNFGAQVSSVFFIFLFNFFIPIGFLGANF
FT                   LYCTEVAPTKLRVAMSSISTANHWLWNFAVTMITPVAINTIGYQYYIVFTCIGFCIPIS
FT                   VYFFYPETMGRSLEEIDLIFRNSPSVFSTVRYARENPHLALEHVLEHEKGEIRHEENVE
FT                   ESLGRSIPNLGQVIQCGLRREAMDAWVHHKTPTPE"
FT   exon            1190244..1191517
FT                   /number=1
FT   exon            1191568..1191688
FT                   /number=2
FT   exon            1191744..1191895
FT                   /number=3
FT   exon            1192009..1192120
FT                   /number=4
FT   CDS_pept        join(1192241..1192269,1192636..1193582,1193692..1193844,
FT                   1193911..1193921)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000469"
FT                   /old_locus_tag="AO070333000242"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXY1"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXY1"
FT                   /protein_id="BAE65892.1"
FT                   /translation="MAERRPAQVWYIEPTEELIQQLRQELESARAQLQLFSAREKGLQE
FT                   TIVSQNKEIEHLRELLTASRPGGYTQHGGERAGNGSVVAHLGRLVLGDGNSEFFAGSTT
FT                   GVHFVLSAQQLYQTTFSSQEHFPECLFRLHILRHKELPVALEQNISIASCLENGQLTSS
FT                   NIFEPLRNHLRNVGVVAVRKAFDKYQQCWGILYPVLLSKQFLDTFDATINDVWTTPLEP
FT                   HLRIPFLLQVYALMALDNVDSSTAATEIVPLPYHLDTILSNLLGQMPCRGDISSLQGLI
FT                   LYLLYLQMTSQHSLAIRTCGMIVRLAQSLGLHRHTRRFKHTPGENNQASYMVYPETYKQ
FT                   QTQIPISLPIPTMMTCIAISCRIRYLEKLPISNHFSKVE"
FT   exon            1192241..1192269
FT                   /number=1
FT   exon            1192636..1193582
FT                   /number=2
FT   exon            1193692..1193844
FT                   /number=3
FT   exon            1193911..1193921
FT                   /number=4
FT   CDS_pept        join(1194119..1194518,1194566..1194738)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000470"
FT                   /old_locus_tag="AO070333000243"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXY0"
FT                   /protein_id="BAE65893.1"
FT                   /translation="MLIHRPALTFGQQEPQFADSLRACKEATTHLILAFELASDASFVP
FT                   GIWPSGHHLIFQSGLMLLYDRWFQNPIQSPGISSEPDTLPKFIHIAITLLSRSAAYLDE
FT                   RVGSGRPRSPSTTDTIESLRQTSSYLHYLSQWRPHGKPNTSGYSNNRRQSFISWTSATD
FT                   TTSRLLFLPMGAIVYRGDQSNEDIRAY"
FT   exon            1194119..1194518
FT                   /number=1
FT   exon            1194566..1194738
FT                   /number=2
FT   CDS_pept        join(1196677..1196803,1196862..1197030,1197083..1197170,
FT                   1197226..1197291,1197392..1197421)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000471"
FT                   /old_locus_tag="AO070333000244"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXX9"
FT                   /protein_id="BAE65894.1"
FT                   /translation="MAGLFKGIHGVVQDKTGVAAGDVQEAVTAVGEIPKGILDIIANDK
FT                   KEPQLILHVYSYSRESRLIKEKCCLPFKNVKDEEMQLTDIRKLLIGENILEPRLVWSSF
FT                   CNQRGAVVQDITNFKAYLQILNEKSSEVAVSSTIPLIRISAMCSWLRSKGHYRRM"
FT   exon            1196677..1196803
FT                   /number=1
FT   exon            1196862..1197030
FT                   /number=2
FT   exon            1197083..1197170
FT                   /number=3
FT   exon            1197226..1197291
FT                   /number=4
FT   exon            1197392..1197421
FT                   /number=5
FT   CDS_pept        join(1197637..1197751,1197884..1198073,1198128..1198278)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000472"
FT                   /old_locus_tag="AO070333000245"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXX8"
FT                   /protein_id="BAE65895.1"
FT                   /translation="MSEKQWSVVIRNNSLLNPYRVVDLGSKGGKFVERSIHSARRYVHS
FT                   LKLSYTNNLLTGIQQLLRIPFFRIEDDSYVEQFEETKSVSRAVAASSMSQFDASLAIEG
FT                   GAFGFSASASASYGDTSSSSDSSSSNEENKVMNITYNVSITFDHQCT"
FT   exon            1197637..1197751
FT                   /number=1
FT   exon            1197884..1198073
FT                   /number=2
FT   exon            1198128..1198278
FT                   /number=3
FT   CDS_pept        1199277..1199804
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000474"
FT                   /old_locus_tag="AO070333000247"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXX7"
FT                   /protein_id="BAE65896.1"
FT                   /translation="MPLNYSLRTRRTPHLKSSTLMSNPLMIPQRLRQVLAPIYFYVGSR
FT                   RIGLADCIGSQLKYNYPYKIYGKDGNEDKLWLFSNQTMPGFMSTAFVWAAKEKGATSFR
FT                   FLLPSNLDNSPSRDIEDGEEASVQLFDKHDHEINLATRFDRRGDKVGTVVDLDDFAKLA
FT                   NELDTTWEVHYL"
FT   exon            1199277..1199804
FT                   /number=1
FT   CDS_pept        1202635..1203195
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000477"
FT                   /old_locus_tag="AO070333000250"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXX6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXX6"
FT                   /protein_id="BAE65897.1"
FT                   /translation="MTLPIKPQTWTKDAFIISTDKTLLSVSAINTAFDNDFMYWTKSYP
FT                   ENILKQIIDGSFCFGVYKAKQNITGQNGDSNSIPSHGPTKLIEGVDQIGFARLITDNVT
FT                   FAYLTDLYILPEYQGHGLGGWLIDCVDEVLRPLPHLRWFMLRTSAEKSKQAYEKRLGMH
FT                   VLDTSCVSEGGIMMGRKGKANMA"
FT   exon            1202635..1203195
FT                   /number=1
FT   CDS_pept        1204211..1206154
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000478"
FT                   /old_locus_tag="AO070333000251"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXX5"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXX5"
FT                   /protein_id="BAE65898.1"
FT                   /translation="MRWLISTIWALAVGSSFATARKAMHFAMEQNLDMLPRTHSARGLP
FT                   APGKKGVMLMNRIGPSSSELYVANIDGSNERKLLGNNSRFDYHASFSPDGQWITFTSER
FT                   NGDGNSDLYRCRADGSGLEKLVATSSVEDAGVLSPDASKVAWVSTANGYTTNVWVMDLK
FT                   TGEQRNLTSLEGVKGDPTKPNGYFRPSWSPDGEWIAFSSDRNTEWRGHGNGTGWEHTQE
FT                   LSVYVIRPDGTDFRKIASREGWSLGSPRWSPDGSRIIFYEITTENTWDAHRPESVASAT
FT                   SQIVSVDFATGLDRIQHTNGTGVKVSPQYVTADNIGYLIKGGSSEGIHYTAESSTGTVI
FT                   NGTMRSPSWSPDGKSVVYEKSEFEARPMEKKLYSWDPEWEYRFTDVFPDLSQQGRLAIT
FT                   QKQLGNSSIVTMRPDGLDQKLVFDPLTQSNISSSEVGQGLAGAFQPSWSPDGEWIAFGI
FT                   GAWFQSRATGKGYIARAKADGSYHEILTNGTINAGFPSYSLDGRYLVYRVWGTEFGLRI
FT                   MDLTDKSVRVLTTTRDNLPFYSPDGQRIVFTRRTSYTNFDVCTIRPDGSDLKVLTSSGA
FT                   NDAHATWTADGRILYASGMYGFRDEAAIYDNTFQPYGQIFVMNADGSNKTILTDSIWED
FT                   SMALYLPNEVLE"
FT   exon            1204211..1206154
FT                   /number=1
FT   CDS_pept        complement(1206598..1208979)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000479"
FT                   /old_locus_tag="AO070333000252"
FT                   /note="sexual differentiation process protein ISP4"
FT                   /db_xref="GOA:Q2TXX4"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXX4"
FT                   /protein_id="BAE65899.1"
FT                   /translation="MVLSAVSRKFSRATEDPLDTPSPVTDNDSDRISNVDKKLASVDER
FT                   SSSDEEHVKKPSETYAIEQETEEDPEIAALPREVRQLVSLTDDPTLPTITFRYFLLSII
FT                   FIVPGAFLSQMSHFRTTQAPYSIFFVQIATHYVGNFFARVFPAWEIRVPFTKWSFNLNP
FT                   APWSAKEHVLVTLTAASGATYNLGYTPIALAELFYGEKLNPAVAIFFMFAIVWVGYAFA
FT                   AIARQLLLYDPTYVWPQALMQTTLFETFRKQDVSSPLARRQLKIFFLSLVGMTLWQFLP
FT                   EYVFPFTSSLAFLCWVAPHNPVANFIGSGLGGMGFLNLTFDWSNINWNGSSILLTPWWT
FT                   QVILFLAYVVSCWVLLPAAKWGNLGSYKHGLMSNSLFMANGTKYPVLDVLTPDFRLNQT
FT                   AYEEHGLMYMGLHNAWATFFDYAKVTAAVTWIATFGFYQVKSNLKKAIASRRKSEKAKG
FT                   QNINYQYHDRLNVLQRQYKEVPLWWYVALFMAGFIILLVATACGYLWIPVWTLFVGLAT
FT                   AGVFVLPFGWLYAISNYQLAVGTFNEMLYGYMVHTKAGASHRHPCGPSTYGAIAGDAWY
FT                   RAQYMLQDQKIGHYMHIPPRTVFFSQIFGTVLGIPVNYGVIRWVLNTKGNILKGVEKDP
FT                   LNQWTGQSIIGSNTLGVQYAVIGPQKMFENPELRILPYSFLVGAVIPPILYILHRCFPR
FT                   LRVDLWNVTIFFSGLSVFYGNISTGYTSAIIGGYVVMYWAYRRRFETWKRYSYMVAAAF
FT                   DAGFNLNMLLIFLFFGSGKQIKMPNWWGNNADSVERCFAL"
FT   exon            complement(1206598..1208979)
FT                   /number=1
FT   CDS_pept        complement(join(1211083..1211258,1211310..1211847,
FT                   1212045..1212740,1212793..1212869,1212950..1213334))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000481"
FT                   /old_locus_tag="AO070333000254"
FT                   /note="predicted transporter (major facilitator
FT                   superfamily)"
FT                   /db_xref="GOA:Q2TXX3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXX3"
FT                   /protein_id="BAE65900.1"
FT                   /translation="MKDELGPDAGHQKKSDGMDEVSPTAEHSEKPRRSSIYDIEGRPAN
FT                   KLSAVFKNPLEGIPRQQLMEDVDRFCAQYGLETHKELFRKGALISQNPQDAHNMPELTE
FT                   DERAAIRREHTHKWSQPWQLYFMASMCSLAAAVQGMDETVNNGAQAIYLKELTIKSEYI
FT                   TGLVVGAPYLACAVIGCWLTEPMNRYLARRGTIWVSCFIAAVASVWEGVCNSWVNLFIA
FT                   RFVLGLGIGSKSSTVPVYAAECSPAPIRGALVMMWQMWTAFGIMLGNIMGVAFMGLPDN
FT                   LSWRLMLGSTVVLPLIVCAQVYLCPESPRWLIEHNKINKAYEAFRILRPSDLQAARDLY
FT                   YAYVGVQLEREVNKGKNFFTMFLELFTIPRNARATLATWIVMFLQQFCGVNVIAYYSTT
FT                   IFTESGYSIQEALLASMGTGILNWVFALPAFFTIDTWGRRNLLLFTFPFLAICLFWAGF
FT                   SFWIEEGIKYSKKRVAMVTTGMYLFEVFYSPGEGPVPFTYSAEAFPLHVREVGMSWATA
FT                   TTWCFNFILSFTWPSLLRAFQPQGAFGWYAAWCLVGWVLVLLFVPETKSLTLEELDQVF
FT                   SVPTRKHAMYQLRNTVWHFRVWVLRQKLEPLPKLYEGAEHLSEAGEK"
FT   exon            complement(1211083..1211258)
FT                   /number=1
FT   exon            complement(1211310..1211847)
FT                   /number=2
FT   exon            complement(1212045..1212740)
FT                   /number=3
FT   exon            complement(1212793..1212869)
FT                   /number=4
FT   exon            complement(1212950..1213334)
FT                   /number=5
FT   CDS_pept        join(1218124..1218381,1218456..1218845)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000482"
FT                   /old_locus_tag="AO070333000255"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXX2"
FT                   /protein_id="BAE65901.1"
FT                   /translation="MANDKSEAIIIVTSIFLALSLLAVSLRCYVRLHLIRAFGADDYMM
FT                   VLAMAFNLAFAICGIAGGSTGLGKKMNYFADKPTDLRDSLRFWWLGQVFYALTGTAGRT
FT                   SIAISLLRITIVRAHLIIIYATIALSIAVGLLFFFATLVECRPIHYVWDYGMKSPHCVS
FT                   KDFLLDIVYTHSVIAALCDLTLGILPLFMIWKLQINRRAKFSLGAILGLGCL"
FT   exon            1218124..1218381
FT                   /number=1
FT   exon            1218456..1218845
FT                   /number=2
FT   CDS_pept        1221289..1222827
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000483"
FT                   /old_locus_tag="AO070333000256"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXX1"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXX1"
FT                   /protein_id="BAE65902.1"
FT                   /translation="MKTSFLLAAIGFLYRLPCSAAQTLNIVAHQDDDLLFLSPDLLHEI
FT                   QGGRRVRTVFLTAGDAGEVSSGYWEQRQAGSQAAYAQMADVSDIWTQSDAGIDGKNIPT
FT                   FTLDGNPDISLVFLQLPDGNGYGNGFPSTGSVSLQQLWQSEISSIQTVNGSTSYTSDEL
FT                   LDTLATLMSDFNPDRINTQDYAHAYGDNDHSDHHTTAYYVQKAAERYSTTHTLTGYTGY
FT                   SIASMAQNVFGDDLNAKQSAFFTYAAHDSKVCHDSASCGNGNEAQWLQRQYAVTGEPVA
FT                   NARLLNSRRTVGLGENVVLDGTQSRDPNGASLTYQWTQTSGADVVLSNATAARPSFTSP
FT                   KSSETLGFSLVVGNGNTRSTPAKVTVVATNLENVARNATATASSQNSDGGQTAEKALDG
FT                   IIDGYPGTATTEWATVGGKAGSTLRLTWAQPQSISEVYLYDRPNVDDQVTGGILQFDNG
FT                   SNITVHVLDNYGRPNRIQFEAKTTRSLLFIVTSVSPSTRNVGLAEIEVYGASSG"
FT   exon            1221289..1222827
FT                   /number=1
FT   CDS_pept        join(1224047..1224199,1224276..1224830)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000485"
FT                   /old_locus_tag="AO070333000258"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXX0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXX0"
FT                   /protein_id="BAE65903.1"
FT                   /translation="MTTPKITLYTNHRCPWAHRAHIALKELGLNYEEVIIDLTKPREPW
FT                   YLDINPRGLVPSITYGEHIITESAVVAQFLADAHPSHLLPPSNSENGALQRARIAFFVD
FT                   TFFSKVQPHFQTSLRASTTEERDAAAEALVAAIKSELEPQLPEGSDGKGPFFGGSEKLT
FT                   LAEVLTGSFLLRILSFHRHGLLSEKLPSLLEDTPRFKRWAEATVQQDSVNYIWDEKVSA
FT                   DAIKAKLAALAKK"
FT   exon            1224047..1224199
FT                   /number=1
FT   exon            1224276..1224830
FT                   /number=2
FT   CDS_pept        join(1225871..1226009,1226114..1226276,1226334..1226680,
FT                   1226735..1226985)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000486"
FT                   /old_locus_tag="AO070333000259"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXW9"
FT                   /protein_id="BAE65904.1"
FT                   /translation="MRIIAVAGGTGSVGQTIVEALVAHGKHTVLILTRKVSRHTMGYGR
FT                   RAKALETANVDTVICAFGMESDAISEAQVNLIRAADMSGSTKRFVVSGYDMLFKEEHIP
FT                   MVPTAKWALAASHAVEESSLEYTRVVNGLFLDYYGLPHWRSHLKPWVNAVNVEGKWAVL
FT                   PGDRASKVNFITSQDMARFVARLMDLSEWSPVSFIAGQTASFKDILRLAEEARGERFSV
FT                   KNESLEDLRNGRISFPEFEETGLESTGRSTEYIFALFHYISGTGGYTISRDGTLDAQFP
FT                   DIKITTAAEVIESSWRNP"
FT   exon            1225871..1226009
FT                   /number=1
FT   exon            1226114..1226276
FT                   /number=2
FT   exon            1226334..1226680
FT                   /number=3
FT   exon            1226735..1226985
FT                   /number=4
FT   CDS_pept        1228328..1229059
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000487"
FT                   /old_locus_tag="AO070333000260"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXW8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXW8"
FT                   /protein_id="BAE65905.1"
FT                   /translation="MTRYLSFLFLLILFGNSVFTAVIPKSYGSDDHEVTAEREDEPGND
FT                   LVLDDMWSLEDGSGSLNTRATDAADSSDEAALLDERQPLAPEDPSASKRDDTSSTDLPL
FT                   SDTIVARAPEECRRALGTGVDSCKKSVQSGVANCKKKIQDDIAKCKVDAKGEIDRCKKK
FT                   AKDPFSKARCESRRPKLMAQCESRRAKIPLCEKARPKVLLCCERMRPQFQALCAIPSFP
FT                   VSVVRSRLQDAQQQCMKGFII"
FT   exon            1228328..1229059
FT                   /number=1
FT   CDS_pept        join(1235464..1235721,1235771..1235829,1235885..1236050)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000490"
FT                   /old_locus_tag="AO070333000263"
FT                   /note="predicted protein"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXW7"
FT                   /protein_id="BAE65906.1"
FT                   /translation="MENLFPHPRRIVTGHDNDGKAIVVADSLIPCEPTRINCNFAVLYE
FT                   THQFPEVNDQWIDPTRTRTPDLANQKGVVLRVVDFPPRTKTMFHRTESLDFGILHAGEI
FT                   TCHLDGDERIDMKPGDVCVQRGTIHGWTNYSDAPARVFFVLTGTFCILLFRPDQMD"
FT   exon            1235464..1235721
FT                   /number=1
FT   exon            1235771..1235829
FT                   /number=2
FT   exon            1235885..1236050
FT                   /number=3
FT   CDS_pept        1236464..1237036
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000491"
FT                   /old_locus_tag="AO070333000264"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXW6"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR039344"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXW6"
FT                   /protein_id="BAE65907.1"
FT                   /translation="MQKLSFDTTPNATFLCGTGTLAIMKEDGYWSDNKKSEYDEKIWDP
FT                   KRSELPIKELPASTACSSLPQKVKGGKFGIFEKALDFFGDGSFFLVDSPGHLAGNISAL
FT                   FRTRSRDGEPRWIFLAGDCFHPHHFVHYPEAPFGDILIAPSGCIHVDPEAARETIRKIS
FT                   ALRESDPSVRVWAAHAGSLEGYWEFSS"
FT   exon            1236464..1237036
FT                   /number=1
FT   CDS_pept        1237559..1238554
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000492"
FT                   /old_locus_tag="AO070333000265"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXW5"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXW5"
FT                   /protein_id="BAE65908.1"
FT                   /translation="MLGNKLAISSLSLGQHPSHLLDHKVEVAASHGFAGIEIVFSDIEV
FT                   YAREKSLSLSEAASEIQKICETHGIEVVSLAPFENFEGHNSPVEERLQLAAKWIDIAKI
FT                   LKAAYLQVPAQYSSDCTGEEAVIVMELQQLADLARAQQPIIAIAYEPMSWSTHCSTWQS
FT                   ALHIIQRVDRPNFGLCLDTFHELTRLWASPFDPSGKLPNADQNLRESLCDFQDHCPLDK
FT                   IFYVQLSDGERFDPPFSMSHPWYLEGEAPQFTWSRHARPFPLEAEMGGYMPIPEVARSW
FT                   IADKGFNGWVSLEIFDRRMREPAFQPETAARRGSYSWRKLQDALSITSHI"
FT   exon            1237559..1238554
FT                   /number=1
FT   CDS_pept        join(1240007..1240313,1240488..1241518)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000493"
FT                   /old_locus_tag="AO070333000266"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXW4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXW4"
FT                   /protein_id="BAE65909.1"
FT                   /translation="MRGIVALSFLSVALGVTADLTESNLHKYPKALALENSFNPIKEAY
FT                   WTGYPHHRRTPFSVSPDGKSAYVAYLDASETDIHVQQVDVDTFQSTGTSVTVSGGKEDG
FT                   KQTWKTWLGGPGVHEADGLSASPDLNGDLVYSEQAGLYGAYFVVTDYSGDAAGHYGDSI
FT                   QYVADNGTLVTITGASSSWGCSHNTGIAFESADEPPFASICAEDQGAIWLNSKTLGMSN
FT                   DGVKISNENTTNGASGEPMGGMSGSYSALARFAESTRYIFAWVSRGAMDLTENTWMGSG
FT                   YTHALNRTNNRNVAISLFSDKYTIVGEQATSEVGAEDGDKQINWLTEGANDCSNAHAAT
FT                   FGNNSALVTWEEISDPICDFVAMGCRGQFAGTFFQQVDSTGKRVGSPLKSMDTFVAGDM
FT                   VTMPDGRICWPYVSMDWDLSQAVYALTSSTTTTMSFACIDLTGDSS"
FT   exon            1240007..1240313
FT                   /number=1
FT   exon            1240488..1241518
FT                   /number=2
FT   CDS_pept        complement(join(1241748..1242405,1242473..1243237,
FT                   1243283..1243311))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000494"
FT                   /old_locus_tag="AO070333000267"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXW3"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXW3"
FT                   /protein_id="BAE65910.1"
FT                   /translation="MGRSRSTDWRNSSALFARAKKEFRHKLCALRIAGQDMVMVTTAAQ
FT                   IAAIDKDSPTFAFEPFVDLVYDEIATVSRESKPLLWRTPAEGYKSLFPSAKQMTAAHTG
FT                   IHLLHKQLTQPDAMHRFMTNSLVHVNNTLQWDSFYNTSVLAATADVKVVSLECLCRDVI
FT                   IDAQLTSFFGPRILEIEPDIRSFLKAWDSISWKVSYRLPSFLAKHATQLRDHLIEVLVK
FT                   YYAFPAEERPGSVSFVNDVYDDYKQAGIPDRDIAGIVFTILWGLNSNVNAISYWMIAHL
FT                   MNNPTVVNEIREEIAPMMRALDSSPTIDGTILADVSKDPLLNSCPIMNSTFNETLRFTA
FT                   TGSSFRETTRDTTMDGRRIPKGTKNIIPQRTQMMHSAAFGPDPETFDCYRFYRNKSLLR
FT                   KVEFRGFGGGTTLCSGRVVGRHQVLAYLALLFWRYDLEVIGPDQEVLGVRGKGFPRLDE
FT                   AKPSLGPGKPIDGDDQILRLTRRNV"
FT   exon            complement(1241748..1242405)
FT                   /number=1
FT   exon            complement(1242473..1243237)
FT                   /number=2
FT   exon            complement(1243283..1243311)
FT                   /number=3
FT   CDS_pept        join(1244215..1244596,1244662..1245434,1245493..1245996)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000495"
FT                   /old_locus_tag="AO070333000268"
FT                   /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
FT                   /db_xref="GOA:Q2TXW2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXW2"
FT                   /protein_id="BAE65911.1"
FT                   /translation="MLLLLLETLALAYVAWSLVAMEINYRRACAMKIPLVRLCIDPQNL
FT                   LWVILEPHLWPWLDRLPINWGNFGRYSRRGWYFADRGESHRRYGPIWALVTPKEIYINV
FT                   ADSEAIHDIFQRRTDFIRPVEQYTVLEVYGPCISTANTTDWPRHRKVLATPFNESVMSF
FT                   VWDESVEQTRQMIDIWASPDLDKISSVAKDTRTLSLNVLAAIGFRKSYPFRSGNGNSHR
FT                   EQSDSVSYRDALQTVLDNAILLMIMPRRLLSLSFAPESWQQLAKAATDFKQHMVRMLDE
FT                   EVQALNEGKAGSGGLMTSFVRAMNLKQEDARSKGLTTDEIFGNIFVINFAGHDTTANTL
FT                   SFGLLLLAAYPEVQDWVAEELLLLTNTKGQYADLFPKLNRCRAVMLETLRLYPPIPSLP
FT                   KWTNDQAQPLKVGDRTIMIPPKVGINPSLLTMHIDPQHWEDPLEWKPSRWITPTKLVRA
FT                   ISIEDEQLITPVRCTYFPWSDGPQNCPGNKFSQVEFVAVIASLFRHHRISPVANAGETF
FT                   QQTRERVLATTRDVDLQLLLRMKDAERVHLKCRRV"
FT   exon            1244215..1244596
FT                   /number=1
FT   exon            1244662..1245434
FT                   /number=2
FT   exon            1245493..1245996
FT                   /number=3
FT   CDS_pept        complement(join(1247567..1247612,1247998..1248437))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000496"
FT                   /old_locus_tag="AO070333000269"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXW1"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXW1"
FT                   /protein_id="BAE65912.1"
FT                   /translation="MRFSHLHPSYHLSHLLDNYDFGTGECTIVDIGGSHGEVSTEIASR
FT                   YPQIRCIVQDLPETIADWTTRVPTSLQDRVTCMAHDFLTPQPVHGADVYLLRWILHDWS
FT                   DKYCVRILRNLVPALKKGARVVVNDICIPEPGELGPKADRDLRSDIHPTVSVTDPVC"
FT   exon            complement(1247567..1247612)
FT                   /number=1
FT   exon            complement(1247998..1248437)
FT                   /number=2
FT   CDS_pept        complement(1248935..1249333)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000497"
FT                   /old_locus_tag="AO070333000270"
FT                   /note="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXW0"
FT                   /protein_id="BAE65913.1"
FT                   /translation="MANFHVPVRAFSVRIASRSLCRRPLGQIQARFSSQSAATGSITQL
FT                   LDRVHNTTKVYLDFVKSLNLPEPSYQYGDGLDPRQPLPQEVADARESAIEATYELHHLL
FT                   LGPLGLLFSCPGEVSSLHQPWQHLFSPV"
FT   exon            complement(1248935..1249333)
FT                   /number=1
FT   CDS_pept        complement(join(1251719..1252321,1252381..1252413))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000498"
FT                   /old_locus_tag="AO070333000271"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXV9"
FT                   /protein_id="BAE65914.1"
FT                   /translation="MHAKISKHAFLGVLWAFTATDTVFVLFRIFVRIASFRRLFVDDIF
FT                   VLLAWAIMLTNAIIWQIQGQVLYNLYAISTGQESYTPAVLPMFESFMRYIAPMTIMFYS
FT                   GLWAIKFSFMSFFFRLNSKVKSHRIWWYVVMLVVGGVYIACVADVDYKCSLGGMEYIIS
FT                   ENFDDLVQPRRQRLTWGYNQPNAATSIMSIIRTAHSGQTVPGILSLIF"
FT   exon            complement(1251719..1252321)
FT                   /number=1
FT   exon            complement(1252381..1252413)
FT                   /number=2
FT   CDS_pept        join(1252988..1253187,1253244..1254017,1254078..1254607,
FT                   1254676..1254866,1255315..1255620)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000499"
FT                   /old_locus_tag="AO070333000272"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXV8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXV8"
FT                   /protein_id="BAE65915.1"
FT                   /translation="MPAISLSLIGIGVVAVGTVWALWALTRKLQVPNNYPNAPRSLPYS
FT                   IPFLKSTIPFVLDGLNLFRQASLYCQDRWPLRVDLLNGEVYIVQGAKNIASIFSTPGLT
FT                   VTQAYGIALKHCFGMEQKAVDAYLADTSGSWHRPIPGSQTPWHGRVSYHTHENLVRGLL
FT                   GAGLDPTTERIERLLLASLEGAVSRTSEWTYGMDLTEFFETHLGSAILQALYGPLLVTK
FT                   NSDFNRNLWRYDKQIMRLAKRLSSWLIPEAYRLRDELLGAIMRWHQQATLLSETIPSCE
FT                   RTSGGEADPYWGSAMMRERNKMLLSIEGQDAKSVASTDLGFIWASVTNVVPSTMTLCTH
FT                   MYRDHSLVENIRLAALNCIRPGATLRFDLNKLGKQPLLLSMYAETLRFGVQIHIPRCSP
FT                   HQPLSVAGVTIPPDKMIFINTSLAHTDESVWNTRNGEHPLDTFWAQRFLIDPKDEGSGP
FT                   TRKECSQPLESTPRGEYKRMDGQGSSSGQFTLEGLDGSWIPYGGGQHACPGRILAKRII
FT                   LLASSMMATMFDIELLAPNSLQFGSPRFGFGVRKPSAQVPFRIRRRKSAEIFTPAVRQE
FT                   SDLDRKSNVTGGFLHGAVLISLLQYLPLLYQAVQLETAILSAISLLPIVIIGVVIAAAS
FT                   MLMVPLFGGYVWVLRVGLDHTHPGNRLAGPV"
FT   exon            1252988..1253187
FT                   /number=1
FT   exon            1253244..1254017
FT                   /number=2
FT   exon            1254078..1254607
FT                   /number=3
FT   exon            1254676..1254866
FT                   /number=4
FT   exon            1255315..1255620
FT                   /number=5
FT   CDS_pept        complement(join(1259381..1259396,1259463..1259678,
FT                   1259746..1259957))
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000502"
FT                   /old_locus_tag="AO070333000275"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXV7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXV7"
FT                   /protein_id="BAE65916.1"
FT                   /translation="MSTATTTITASVAAAAPAPENVRMRIDGSDPKFGDFRDDLARDGF
FT                   AVVKGAIPRERALKYADEMFSWLENFNLGFDRHDPSSVHKDNLPVINEKGMCLQYAVTH
FT                   EKFVWDVRSEPGVVETFEKVYNDKDLIVSFDAVNFGFPKSSCE"
FT   exon            complement(1259381..1259396)
FT                   /number=1
FT   exon            complement(1259463..1259678)
FT                   /number=2
FT   exon            complement(1259746..1259957)
FT                   /number=3
FT   CDS_pept        1260118..1260783
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000503"
FT                   /old_locus_tag="AO070333000276"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXV6"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXV6"
FT                   /protein_id="BAE65917.1"
FT                   /translation="MPIQLVYGKWESRVEKWTSRGFHELGETEKIFFMRRCDSDLMSFL
FT                   FFLSQLIMTTTSTPFQIVIVGGGIAGLTAAIALRGPSRKIIVLEQSRLNKEIGAMISLQ
FT                   PNATKIVYKTWGLGKELSTSRAMVDQGFRVYSTEGELVNEVPLTTKTEYGASRVLWHRK
FT                   DLHDALKRAVLSPSTVAGGLVEIRVSSRVVRCDPWGGVVTLESGEEIRGDIIIGADGM"
FT   exon            1260118..1260783
FT                   /number=1
FT   CDS_pept        join(1260831..1260901,1260947..1260992,1261010..1261169,
FT                   1261226..1261337,1261444..1261498)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000504"
FT                   /old_locus_tag="AO070333000277"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXV5"
FT                   /protein_id="BAE65918.1"
FT                   /translation="MQSQQLTQGGRGRWSYPNANRAFCLSAHGKGTRLVFWGQIPSNVL
FT                   ETEEKEFCDKIDPRAPFTSMVVAHDCRLIMGPGREGDVFGIVALVPDERMNEDPNATQS
FT                   WVSEGKLDKLMETFSEFPRWITDIFKYPSRASTTSLSMMSDQC"
FT   exon            1260831..1260901
FT                   /number=1
FT   exon            1260947..1260992
FT                   /number=2
FT   exon            1261010..1261169
FT                   /number=3
FT   exon            1261226..1261337
FT                   /number=4
FT   exon            1261444..1261498
FT                   /number=5
FT   CDS_pept        join(1262801..1262987,1263055..1263189,1263250..1263423,
FT                   1263448..1264592)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000506"
FT                   /old_locus_tag="AO070333000279"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXV4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXV4"
FT                   /protein_id="BAE65919.1"
FT                   /translation="MDDKPAIELAECVEAGTKSRGNILVDADGQVQRLPVPSKDPNDPL
FT                   NYSTWEKTAIIVSCCWFSTMSLSCIGGLGAILNVFFQLYLPQGYTTNQVVWLSTFPSLF
FT                   VGIGNFLILPLGLLYGRRIATIISTVVLLGATIGCAVCNTWEQHLALRIIQGLAAGATE
FT                   SVGSSRKLIIHPNQVLPLILAEVTFVHQHGMVYGLYWAAQNAITGCLTLAASYEVASLG
FT                   WRWFYWVFAIAVAIGLVLVVFGGFETGYKRRSQFVNGRMVITDRFGVTRMLTEDETREV
FT                   LESQGHPSSGEEIPEELRPKKTYWQMLKPWSHPTESALTFIPQILFQIVEALLCPGILY
FT                   ATLLSSVVLASSIGMSLSYNTVLEYNYHWAPESIGLINLGGVFGGFGGMLYAGFLGDKF
FT                   IVWKATRNGGAFAPEHRLILLIFPGVLGVAALLLYGFTADGGATWGGPYMGWTLFQITF
FT                   VSVLILSTSFAAESWERNPGPALVAVVGMKNIVAFGLSYGINPMVEKYSYPTAMGILAA
FT                   VTGGVFLLGIPVYILNPRVSTNVGIYHTF"
FT   exon            1262801..1262987
FT                   /number=1
FT   exon            1263055..1263189
FT                   /number=2
FT   exon            1263250..1263423
FT                   /number=3
FT   exon            1263448..1264592
FT                   /number=4
FT   CDS_pept        join(1265694..1265849,1265902..1266458,1266523..1266952,
FT                   1267021..1267099,1267144..1267289)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000507"
FT                   /old_locus_tag="AO070333000280"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXV3"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXV3"
FT                   /protein_id="BAE65920.1"
FT                   /translation="MTRDVLQRHQAVHEKDEARGKASLRWTKERAIEACEACATAKLSC
FT                   DNERPCKRCHSKRINCVPRPKGRRLSRERLSYSLSLPPYSPQVGESPPGLSTLTPAPES
FT                   GLSDSFPGNVHERYDADVAQTSELVLETVIPYTDAQAYLPMNGFPAFFEQVMLPVVDAD
FT                   DAVHDTQQPRVFDFMQDTDFTFLDTDIFGTNFIPDLDKALDVPMAFTEFENPPQSPLDD
FT                   QESASQRAAAFGRSLWLWVPEKNQHAFSEERQIPLRDTDRIPSSYQNRLDAVKIPGKLS
FT                   YQARDDILKLVIRTGGSRLSVTTFPSPDYLDTLIKIGIGKRTETDAWIHPYTFYDSDYQ
FT                   QLRPELLMALIGAGCVCCGMPSINKTGIILQEITRVSLAQLVEDDNSVLRDLQYLQASM
FT                   MWLDIGIFSALHSALDTLTITKPRAHSTRRCVVAQPLTGQPTQLLLHTHSVLTTNR"
FT   exon            1265694..1265849
FT                   /number=1
FT   exon            1265902..1266458
FT                   /number=2
FT   exon            1266523..1266952
FT                   /number=3
FT   exon            1267021..1267099
FT                   /number=4
FT   exon            1267144..1267289
FT                   /number=5
FT   CDS_pept        join(1267433..1267773,1267832..1268449,1268535..1268538)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000508"
FT                   /old_locus_tag="AO070333000281"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2TXV2"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TXV2"
FT                   /protein_id="BAE65921.1"
FT                   /translation="MNRPAIISYTELTLPFPSTRGLWFAPSAEAWRDIWIAYQLTGCSE
FT                   LNLRDLLSDPSLMTQLAPELDIEVARSALLQGLALQVWEFRQQMLLSQTSLSGPRATTQ
FT                   LWLQSRQEDLYTTLRAVQQDSLSVPPVTTLMSEFVMMYLHIDIDAIQRFVGRMGELDAR
FT                   RAYPGLRDWSRTKEARFAIWHAGQMFRAARNVAAYQFRGFESLAIYHATLVLWVYGLIQ
FT                   CGETKRLEVTTPMSEADLTAPVPLDEPENQVTKSFLSHGVGRPGLMMLQYRGKNEGDVK
FT                   VFYELAKPRAVTAVAQQVFEGNCRLPFSDVSLPPIIQNL"
FT   exon            1267433..1267773
FT                   /number=1
FT   exon            1267832..1268449
FT                   /number=2
FT   exon            1268535..1268538
FT                   /number=3
FT   CDS_pept        1273414..1274028
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /locus_tag="AO090103000509"
FT                   /old_locus_tag="AO080606000002"
FT                   /note="predicted protein"
FT                   /db_xref="GOA:Q2UHZ6"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:Q2UHZ6"
FT                   /protein_id="BAE65922.1"
FT                   /translation="MKDFLYTFVDPEADRHRNVAYRLINEKQNGRNMREWCARSLEVWQ
FT                   AFPNNSLTAQTWIQTLDQEVQREITRAARQPQTLGEAHDMAIQYWSMLHRERSLRDSEG
FT                   SGRKRADGGNQGPAGFNRGRKRPRENETPATRPRGSRSSPGQPPFKARRWNDGTQAAHE
FT                   RKRDWQKKEGRCFRCNEMGHRIWECPKAADGAPGKDASREQ"
FT   exon            1273414..1274028
FT                   /number=1
FT   repeat_region   1282674..1282697
FT                   /rpt_family="Telomeric Region"
FT                   /note="VIII left telomeric region"
XX
SQ   Sequence 1282697 BP; 331781 A; 308926 C; 309588 G; 332402 T; 0 other;
     aatctatatt aattttggat tattttttgc tttaagattt ttttttatct agactaatta        60
     tattaagact tttttttata aataaaatat tataaatttt ttttaaaatt aatattattt       120
     tattaatttt ttattttttt taattattta taaaaataaa attataaaat cttaattttt       180
     tattattatt tattttattt tttaataaaa tattaatatt atttttattt ataaatagaa       240
     aatatgtata ataaaataat aataattctt tatttatttt ctttaaattt ttatttaaat       300
     tttttaaata aatatttaaa attaaaaata aatttaaaaa tattttttaa ataactcaat       360
     aatctttttt aattaaaaat atagagttaa aatattaata attaaataat attttttagt       420
     tattaatcta atttttgaat tatttaataa ttttttttaa ttattataga atctaactta       480
     tattttttat ggaaaattat aaaaaaaaat actaaaaaat attatagtaa aaaatctatt       540
     atataaacta aataatctat taattaaata aaaaaaatag aaaataaaat ataaagctct       600
     attattaatt aaataataga gtaaatataa aaataaatta atttttattt tttttatatt       660
     tttagtaata tttaaatagc ataaaaattc ttttcttttt agaaactttt ttttagaatc       720
     ttaattaaat agttaataaa tctctatata tatagattaa ataggaatta aaagacctag       780
     agattctgta taccctatgg accgattcta catcggctcc gtgatataat ctctattttt       840
     taaaaattat aacctaataa taatagaaat taaaaaataa ctttaagtta ataatcctta       900
     gaacatggtc tactaactga tcttaaattc aataataaag ccttaggcgt aatattataa       960
     agtataatta attaataggt tttaaaaata tagtattaac agactaaaga ttatttaaaa      1020
     ttatatcata gtttttctat ctaatataat aaataaatta tttaaaaata tttatatatt      1080
     atataagccg gcggcctact agcagctcgc ttgtagtaga atatagttgc ctgagacaac      1140
     cgttgttata aagactttat aaatttagaa atagtataag tctttttata ctatttatct      1200
     ttagtaatct atctagtata attgatactg ttcgataatt atatctgatt taacctggtc      1260
     cgcttgtttg ttgaacaagg ttattatttg acgaggccgt tcgcgctcct acaaagggga      1320
     tcgaaatcat attataactt gtaatgtatt ctatataact ggttattata aatatcttta      1380
     gagtatagta tatctctatc ttaaatagct atcttagaag aataacttca tttaaggtaa      1440
     tggcttacca tctacctttt gtaataggtg cagtaactac ttattcttta tatatactct      1500
     tggcgtctaa aagcacaagt cagcctagac ctgtaataag tctaaagaaa tcaactactt      1560
     tcctttgtat gaaccttata tttgctaata taaatgatat aatatatcca ccaaatagag      1620
     acacagagac atagagccgt gtagcatgtt gtcacgactc actattgaga tgctattagt      1680
     tagggtatat atctagtaag ccagccggcc ttcctgcgat aatcgggtac aatagctttg      1740
     tctgggcact accaaccaat ctagaaatac caatcaatcg agctggaacc tttggtgaga      1800
     tactagggta tgactcccgg tacaagttgt tatgtacaac atccgattgt tataggtaat      1860
     ttcccttact gaaccgagaa ccaaagtcag cggccctatt aatcatctcc cgacgctggg      1920
     agttggttat cttagaggag atagccatat ccttctcttt atcaaagggg cgactgctag      1980
     catcgtcctc ctcgaaattt ttacattcct cgagaggttg taacatattt ccagctgcat      2040
     tttctttccg ttttgcatcc tggggttgat aagcactcat tagatcagca atatgctata      2100
     gtgcttgtca taactcacat tgtacttttg gattctgtcc tgcatggcct gtgatactct      2160
     ggcaggtcga gttacttgat ctttgtttgc accaaatatg ctaacaccca tgactttatc      2220
     ttgtaaacgt ttcatttttt gctctggcgt ttccgtccaa gacgaatcta cctcccctga      2280
     ttgggaattt gatgctgatc ttccactttg aaactttcta ctcctcagtt tggttggatc      2340
     cacccttgca gtccttccac ttgaccctgg tggctgtaac atccactcat ctcgatgact      2400
     tcgatcttcg ccagcatgac cttgctcagt caatgggtca tatggagtgt cgccatgtgt      2460
     cttggcatca actaatttgg tctccatagg tcccgagggt ggtaaacacg gaccgatgtc      2520
     atcgtcgtca ctgctttcat tttcgccatt agagtctagt gtgtcatcgt ctgcaggatt      2580
     tgataaaggc aatgttggtc cgactaccct ccgtcgtttg tcagtattgt caagaccata      2640
     ttcgggatat ggtgtcggtt gctcgaactt tcgtttctca ctttgatcca ttgcataaaa      2700
     acaatgtgga tggttaagag ggaaggaaat aatacccatt ctcctcgtgc ttatggttac      2760
     atataattat ataatcacct agagcataac gtaattggta aacgagcggg tcacgcaaac      2820
     gagcgggtca acacgcccat ttttctacac atatattttt ttaagactat ttaactacca      2880
     gctatattac taaaaatgcc taaattatta aaatcttaga tagaatagaa agatagaatt      2940
     ttattagcta tattaactat taaaaaaaat tactaatatt tatatagtag tttatatttt      3000
     taatatatct tttataatac tttaaagata tttattaaat aatatatttt aattaaatat      3060
     atatataaat aattataaaa taatttttag taaagagaaa ttgcttaaat aatagattct      3120
     attattaaat aaatatagag tattttctta atctatacat atataaaaaa tagttaatat      3180
     tttattttta aagtataata ctatctcttt ttttactact atagaaaaaa aatagatata      3240
     taattttatt aaatatatat ctaaatttaa aatttatttt atatatcact ataattatta      3300
     atatattaaa ataaagaatt ttaaaatttt aaatatttaa tttaaataaa taaataaaac      3360
     tatttaaaaa tatagtataa ttttaaataa tatatgtcag ctgccctaat cctaaagcgg      3420
     aatagtctta gggctagcta ggatgaatag aaaagttgaa tagaatgaat gaattgaatg      3480
     actaaatcac ataggaaagc tagggttgac tgagtagtaa ccctaggtca ggcaggcagg      3540
     tagggcttag gcaatctaag ccctagatta gataataaag gtaggcaact agggctaagg      3600
     cagtcaaagc cctaggtcag gtatgaatag aagagatcaa aagaataaat cgatatctgg      3660
     tagtcagata gttggatgat gatctgcttg aaaaaattga ttcaatttag caggggattg      3720
     agtggctttt tatattgaat tgggctcgct tagacttact aaattaggaa ttcgcttaat      3780
     atttcctaat ttagtactcg cctaatattt cctaattagg acgtagtcgc ttaatattgc      3840
     ctagttagga ttttttcgtc taatttctcc tagataggta atattctaga aggattctag      3900
     aatattcaag aaaatttcct aaataggaaa tatatctctg acaatatata taattttaat      3960
     aaaatagaat ttataataga tctaatagct atagctaaaa ttattattaa atctaatata      4020
     ttaaaaaaat tatttttatt ataattaaaa aattagaaat agattattac tataaaatat      4080
     attaatttta ataaataaac ttaatttttt atattattat taaaaataaa atatatataa      4140
     agatctagta taaaaaaaat aatttttttt ttaatagcta aataaataat aagattaatc      4200
     tatattaatt ataaaattat tttatatttt atattattag ctaatctata gaaaaatact      4260
     atttatttat tttaaatagt tataataatt atttaatatt ttaatttgat taaatctata      4320
     taaaaaataa tattatacta atctatatat ctatatatat tttttataaa ttttaattat      4380
     ttaatattat tattttctta ttactaaaaa ttttatatag agatctaatt aaatctaaaa      4440
     tatactataa atttaattat atttttgaag atctatttta aaatctatat aaagattttt      4500
     actaataata atatatataa tatttttaaa gctattagtc taatttctct attttttaaa      4560
     tatatttttt ttaattaata atttaattta aaatctctat atctctagat aatagattta      4620
     atagttagaa tagtttaata tttaaaatat tttatataat taaataatta aaaaaattaa      4680
     aatctatatt taaaaaacta tttaaaaatt aattttataa ttttaattta tttattaaaa      4740
     ttaatttaaa ttaattaatt aaagatatta aataaactat aaataatata ataatattaa      4800
     aatattaatt aaaataatat taaactacat ataaaaaata gcttaaaaaa taaaaatatt      4860
     ttattaaata aattattttt aaaaaagata tattaatatc taaagtctaa atttttatta      4920
     aatactaaaa ttaaataaat aaagctatat agatagatag atttctattt attaaattaa      4980
     tttttaaata tactctattt aaatatttta actatagtat ataaagttat aaaattatat      5040
     actatctaaa ttaatagaac tacttatttt tatatagaaa tctaaattta tagtatttta      5100
     attattttaa tttttaatat agcagcgcgt tgatccgctc gtttgcgtga cccgcttatt      5160
     taccgattac gttagttagt tagttagtta gttagttaac cgcacacctt tgactcttaa      5220
     cactagccgg acaactaatt agtttatatc cgcgtgatta ggtatacaac tgtagtacta      5280
     ttatcataca gcagtacata tacgagtact caggcaagga tctataataa agtcttggat      5340
     agctatatgt ctctcttata cggttgactc tatctagtga aagatatgct ttgtatttaa      5400
     aatactagta ctatcaaacg ttagttgttt aatgcagggc tgttgggata aagtcatcgg      5460
     cagataacat ctattcttgg tgaagaagtt taagccaagt tacacttacc tgaatgctga      5520
     gcacaatcat tgcgccatcc tgtaagatac ggagatatca ttatattgac actatccctt      5580
     atgaatgtct tatggcaaaa tgtgcatcaa aatacgcgga acatccatta ccctggcatc      5640
     ccgacaattg aaatatatag agaacccttc gagcatttag tttattgata aatcccgcct      5700
     gtatccgtat aaagtctttt aaccttcaca cagctgccat gatttgcgac aaggttatgt      5760
     tggctcaaag ggaagaggac gagatctttc actgtatcta tgccacatag agtagccgcg      5820
     cgagttcaaa cttatgatgg cccaattaga ctgtctaggg atgaattgag aaggctcaga      5880
     actccctata tcccagcatc tatctccatt tcatcctccc gatgaagggt attgtttgaa      5940
     ttaccaggat ctgcgaccgt tcccgggtgt aaagtgctat ttgtggacgg gtctcgccca      6000
     cattgattta ttctagcccg ctcccttgtc tcaatcaagg ccttacgcac agtgtctctt      6060
     tccttcggta ccgttagtga cgctggttct ctatagagga ccagctcatt gcatattggc      6120
     tttgcttctg tgacgacgaa tctcgggatt gctcgcaagt tctccccgat cccaggcaga      6180
     aacgtgatag aatcactggg aagctcagtt tctgctatct cacgttcaag gtcatgaatg      6240
     taaaccgtat gttttgtgtc gtccaatatc atcatgtcat ctaaagctga gaaaacatgc      6300
     tgaccaactt cgagattttc tcgaatttct ctaggagtat tgctggttgc tcgaggacct      6360
     gaagttgtgg tgttagagga tacgttgaag gacgggaaag caaagcacag gaaaaaagac      6420
     aaaacaaaaa agaaataaca aaaagaagag acagagacag aggtaaggta tttgaaagaa      6480
     agggcagcaa taagagagac agagagatag aaggagccaa ggccatgcat ggtaagacat      6540
     accaatatgc aagcaaccaa acttttttgc tagaggctga tctccatcag ggtcactctc      6600
     cgcgggacgc ttttttccgt gataaactcc cacatcagta tgctgcgcca tccgaaccac      6660
     aaacagccgg gtaacgaatt gagaactttt ctgcggagta ataggacgag tttaataatc      6720
     taccatctgc tatcctgagc acgcgcgaag tcaacctggt gcaactggat gcatcgctga      6780
     gtgggtagct tgatgcgagc ccctaagctt ttgagggatg ggcaactggc tttgactcat      6840
     ctgctgtcgc cccctaggtc aaaccccaga acattctacc atcttcacac ttcccctccc      6900
     cctcccccac ttcgaagtgc gttatctgca aacaccatct cagcaccatt aagaatgaat      6960
     tcaaatatac aaagtagtcc agagtggact gcaaaatctg ttcgggatgc atttattcaa      7020
     tatttccaaa aaaatggaca tactttcggt ataccatata ctgcatatta tattctcagt      7080
     ccttcaacga gctaacaccg gaccgtacga ctagttgcat cggctcctgt ggttcctcac      7140
     tcggatccaa ccttgctttt tacgaatgcc ggaatgaatc agttcaagtc gattttctta      7200
     ggcaccgtgg atccacaatc tgattttgcg aacctgaaga gcgcggtcaa tacacaaaag      7260
     gttactacat gaaaattatt gtccccttta aaagttgcac aactaagtca ttcttatagt      7320
     gcatccgtgc cggtggtaag cataatgtaa gtggcaaaga gaagacaatc tctttactgt      7380
     ttctgaaaag actaaccgca gcgataatag gatctggacg atgtgggaaa ggacagctat      7440
     catcatgtga ggcgatattc aatctcgtgc atattattat tacacgtact gatagtaggg      7500
     gacttacaac agaccttctt tgagatgctt ggtaactgga gttttggcga ctacttcaag      7560
     aaggaagcga tcaattactc ttgggaactc atgacaaaga tatacggatt ggatcctcaa      7620
     cggctatatg ttacctactt cgaggggagc aaggagggtg gcctctcacc cgacctggaa      7680
     gccaaggagc tatggaaagc agtgggtgtt ccggaagacc acattcttcc tgggaatatg      7740
     aaagacaatt tctgggaaat gggtgatcag ggcccctgtg gaccttgcag cgaaatccac      7800
     tatgacagga ttgggggccg caatgcctcc aacctcgtca atcaggatga tcccaatgtt      7860
     cttgagatct ggaataacgt tttcatccag tacaaccgtg agtcagaccg gtctttgaag      7920
     cccctcccga ataagcatgt cgacactggc atgggctttg agcgtttggt ctcggtactc      7980
     caaaataagt catcaaatta tgacaccgat gtgttttctc cgttattcca aaccattaag      8040
     gacatcactg gagcacggcc gtatcaggga cgatttggtg ttgaagatgc ggacggaatc      8100
     gacacggcct acagggttgt agcagatcat gttcgaaccc tgacatttgc catttcagat      8160
     ggcgtcgcac cgaataacga gggccgtggc tatgtgattc gtcgggttct tcgcagaggt      8220
     gcacggtatg ccagaaaata cttcagggtc gaaattggca atttcttttc caagatcgta      8280
     ccgacccttg tggatcagat gggtgacatg tttccagagg tcaagcggaa acagcaagac      8340
     gttatggaaa tacttgacga ggaagagatt tcgtttgcaa agactctgga tcgtggtgaa      8400
     aggcaattcg aacattatgc tcagcaagct aaggctaagg gagacgataa gctccacggt      8460
     gctgatgttt ggagattgta tgacactttt ggcttccctg tcgacttgac tcgtattatg      8520
     gcagaggaac gtggcctacg aattgacgat actgagttcg aggaggctcg ctcaagagct      8580
     aaggaagcaa gtaaaggaca gaaaaaagct gccgccgaca ccgtcaaact ggatgttcac      8640
     gatcttggaa aattggagaa aatgaatgac gttcccaaaa cgaacgactc ggccaaattc      8700
     gatagaggga acattactgc ccaggtcaag gcgatctacc atggaaaatc cttccatctt      8760
     tcaacggagc agatacccga gggtgaccaa cttgggctta tactcgatcg cacgaatttc      8820
     tatgccgagc aaggcggaca ggaaaatgac acaggtagaa ttgtcattga cggacaggct      8880
     gagcttgaag ttggcgatgt ccagctttat gctggttatg tccttcatac tggcttcatg      8940
     aagtatggtt ctctgtctgt tggtgatgaa gtcatttgtg aatacgacga acttcgtcgg      9000
     tggcccatca gaaataacca cacaggcacg catattctta atttcgcgct gaaagaggta      9060
     ctgggagatg gtgtggagca gaagggctca cttgttgctg ctgagaagct taggtttgat      9120
     ttttctcata aatctccggt cacagataaa gacctggaaa ggattgagga tatatcgacc      9180
     gagtatattc gccagaattg cgccgtctac tcgcaggagg ttcctctcgc aactgcccga      9240
     cagatctcag gagttagagc cgtgttcggt gagacctatc cagatcctgt tcgtgttgtg      9300
     tctgtaggcg tggagctgga ggagatcctc aagaatgtta aggaccctcg ttgggaaaaa      9360
     gttagtattg agttctgtgg cggaactcat gtgcaaaaga caggcgacat taaggagctc      9420
     gttattctgg aagagagcgg cattgccaaa ggcatccgca gaattattgc agttaccgga      9480
     gaggatgctc atgaagtgca gcgcgtcgct ctgggattcg agaagcgttt ggaccgtctt      9540
     gaagcaatgg ccctaggtcc tgagaaagaa caggatgcca agcaaattca agtcgacctt      9600
     agccagttat taatctcagc agttcaaaaa tcgaggttcc gtgaacgttt tgcacatatc      9660
     aacaagcaaa tcattgattc gcaaaaagcg cagcaaaagc ttgaatcgaa gaaggcgctc      9720
     gaggcaatta cttcatactt cgaaaaccct gagaacaaag acaagtcgtg gcttgttgct      9780
     aggcttccaa tttcagcaaa tgcaaaagct gttagcgaat ccctgaacca cgtgaagtcg      9840
     aagctacagg ataaaacggt ttacgtcttg gccgcggact ctaaccaagg tcgtgtcgtc      9900
     cacggctgct atatgtcaaa ggtaatatca tcgctagccc ggtacttctt gacccgcact      9960
     gacgattttt attttcacta ggcaataagc gatcagggag cttccgctag cgattgggcg     10020
     gctattgttt ctactgcggt tggtggaaag gctggtggca aagggcccac gtctattggc     10080
     aatggtacta acccagacaa aactgacgaa gctattgcct tggcttctga ttatcttagc     10140
     aagtttaagc tttaagccct cgacgcggtt ttcaagttgt gatactcctg gattgtaacg     10200
     accagggggg gagaaaagta tggcacgaaa aagagcgtat aggtgtatta agtgctatag     10260
     atagggatca ggaaactcac tacatgtaat ggctttttcg ttgcttggga atatgggaat     10320
     tgttcacttt ctctcttcat atatcctagg actcgaaacg accttttgat catgtatcac     10380
     atctccccgc actgaatgat ggtcacgtct tgattaggtt tatccctagt tgtacgagtg     10440
     ttttcaatca ttcgcacaac gtccattcct tccactactt gtccaaacac cacgtgttta     10500
     ttatttagga acggtgtcgc agtcgttgta atgaagaatt ggcaaccgtt tgtgttgggt     10560
     ccagaattct ggacatgtca gcatcaccgc ttccctaggc tttcgtactg ggacttactg     10620
     ccatgcttag tagccctggt tgatcatgct tcaaaatgaa attttcatct tgaaatcgtg     10680
     gagtgccata gatggtacga gaacctgtgc catcgccatt gacgaagtca ccaccctgta     10740
     tcatgaaatc cttgatcttt aatgcattag tcagccccag aaacattagt ctcgaggata     10800
     atgtattgta cacacaactc tatgaaattt gctattctta tatccttgtg gccgtccttg     10860
     gggacttttg ctttctcctg tgcagaactg gcgaaaattt tctgctgttc gtggcgttat     10920
     actggtgaag agttccatct tgatacgtcc cagtgactcc cctgtgagat aagtatgctc     10980
     agtctgttta gatcttattt gatgaggcag atttcccagc gccgtattct ataatcacat     11040
     atctttaatt gagttgtgct ggtgaaacga cgctggacat cttctgaagc cgtgggattt     11100
     ctgtctaagg ttgaattctc aatcttatct tccgtactta ccacctagag tgatgtcaaa     11160
     aaagacaaca gggttgggtg tcttagctga gctcgtaact tggctatcca tttgcaggtt     11220
     tgcgctatca ggaaatcaga tgtggttgga ggaacaacag tgtgacgata taaaacttgt     11280
     atggagaaac ttccgcaagt ggtaggcatc tacagagtag atagtactca atcttgaaga     11340
     gcctccccat atgactccat aagaccccac tttcaaatta gcttatctaa ttaagaaagc     11400
     cagcgaatac gtaacacctg tctttcacat acggagttct ctgtataccg cacacctcaa     11460
     tctttatatc gtgacaagat attccgtatg taccaaacta cggagtaatc ttatttccat     11520
     tctgttactg aagcattcta cctagagtat ggcttaaggt gtatactgca ttttaataat     11580
     tgtacgaagt aatgtgaaag gtatgatatg aaagtcactc agtagtcact taacacatac     11640
     ttagaagtac ctttatgcta tgtcggtaga ttgttgcaat gctctgctca ttgctacagg     11700
     tatggtaatg cgggacaaaa ccgaggtaca gtacatgtac ggagtacgga gtactgtaga     11760
     gtaataataa gccaccccgt gacctaacag ccattggcct cggtcacgca ttaccaccca     11820
     ccttacggag taatgtggag tatcgtcaac ggcattctag actcaaatgc gatatacgtc     11880
     cctggtttac aataagaacc attctttcag cagccccagg cgcagctgcc gccagtgatg     11940
     atccaccgcg ttcgcatttt ggtgtgtgcc ttgtatcgct accctgaagt agatgaatcg     12000
     ggttgctccc atcgcttttg cgtgttagag ccataacgtt gcttcaggga gttgttgatt     12060
     tctcgacgaa atctcatgtc aatattctcg gggattctag atatatcact ccttaacaac     12120
     cgagacggcc ggcaccgttt actacattca gcccctccag tatcatcacg actacgtttg     12180
     tcaagatggc atccactgca acaggtccac aaccaactgc caccagtact gatcacaacg     12240
     gagatgatag tagctcaagc cccacgagtt cgcccctctt attcttcgtt gcccttggtt     12300
     ttggtgttgt attcacgaac ctatggtacg cccaactttg cgttatgttt aaaatgtgcg     12360
     ctaatctaat cgaccatgtt taggattatt gtgggagtaa aatattgctt ccgatataac     12420
     cagcgaaacc gccaattacg caacgaggaa acgggcgagc cgatagattt agtaaccatg     12480
     cctcgaacac ataggagaag gagggaaaaa aagttgatga gtatggatga agttaacgaa     12540
     cggtttccac ttgttaaata caaagtgtgg agatcttcgc gcgcgaatga aggccttcca     12600
     accgcaggtg gaatatcggc accaaatagc agaccccaga gcttgaaagg tgaacataat     12660
     gttttatcta ccactgttgg ggcaccctct tacacaacaa attcggcaat aaaaggccac     12720
     cgtcgatgtg attcaaccac gtcgcagtta tctataccag ctgaacacgc acagacggcc     12780
     ttagtgcagc cgcaagagaa ggagaacgcc ggtcaagcat ttgctgtgct ggctgatggc     12840
     acccatggcc cagacgcaaa acagttacag aattgcaatt cccttgagga tgaagatgtt     12900
     aacaacccaa ttcgcaccgc agtaccagcg gaacttttac ccaatccagg cgattcgtgt     12960
     gcaatttgcc ttgatacaat cgaagatgac gatgacatac gtgggcttac atgtggtcat     13020
     gcttttcatg catcctgtgt cgacccgtgg ttaacgagtc gaagagcctg ttgtcctttg     13080
     tgcaaggccg attattatgt tccaaagcct cgctctgatc ccggcggact aacaactaac     13140
     ccagaacgct caggccgtcg caatacaaca cggttggccg ttcccacaca accacaatcg     13200
     gtatttatag gaggacgtgt taacccattt cggaatcccc tagctatatc agatcgacag     13260
     gatccatcga gaaatggaac ccagtcgtcc cggctaactg caccgcgttt ttggcgaata     13320
     caagctcacc actctcagcc tgctaataac ccgtcaagct cagctccaga gccttcggac     13380
     cggcgagatt ggaggactcg atttacgcct actaggtcgc tgaacctttc ttttctatcc     13440
     ttttccgctc ggaatcatta ttcaagggag agcatgccgc acccgacgga cactgcacgc     13500
     tctgcggccg atcggacacc tagccagctg gaagcccagt ccggcgcatg agcagactca     13560
     taaatcatgt ttcgcggata ccctatccag tccatgtcaa acgttgccct tcctcacttc     13620
     atggcatctg gaatgccact tggcaacggc acgattattt acagcgtgca agatcacgca     13680
     aatacataaa tatcattctg tataatacgt tgaagtacct cactattcga aagacagttt     13740
     ttgtcttgca taagaaggat gtgtgaagtt cttgtctagg cacctacatt tgttccaggc     13800
     tgttggctta gtagctcagg ccattatgaa agttattacc cgtggcgtgg cgttgatggc     13860
     gcaaaggttc tagggtattt aggattttcg ggttttaggc aaggttgttg gttgggtatt     13920
     tatcgaggaa gcgttgctgc aggtatggat ttctttaatc taagcctgct ctctctctcc     13980
     tctttctttt ccgtccccca ttgtttattc ctccttgttt taatgtacat cgtgatgatg     14040
     agaataccat atttccaatg catataccag gaacacaaag cttcgtatct tactataaca     14100
     tcaattatga accgtggtaa ccagaacatt gatttcgaga gttcccgtca agaggaattg     14160
     gaagaggtgt atataacatt gacatcactt ctgcgctttt gccgggccaa ccccagcgct     14220
     tataacacca ggcaactcat tttgtccaat gtgaaacaac atcccaacgg cagtacctgc     14280
     cgccatgacc accagtacac tgatacctgc aatcaagaag aaaggggagc tgatatctct     14340
     tttttcgcac gcaggccctc cccaccgaat tttttgaaca gtgccatctt ccttggtgac     14400
     gatggtcgac ttgcatttgc atgcgtagca gtcgctagcg gcctcatcgt tggctgaacc     14460
     ggacttttta tagcaaaacc catgtccaga gcagctatca gttgccaaat tgcacgagga     14520
     attcgaggtg aaacaaacag gatgtgtttg cctctgaagc gtcgtcataa ctgctgcgct     14580
     gctggatctg acagaagctt cctctttcac ggcttctcga ggatccacct tacgtttcaa     14640
     acctttacct tggttgattg taggcagaag aactgctgta acctgactga cttctgacga     14700
     aagagcacgt aggccatgaa gaacagacgt cagtgaatca actacagagc cagagcccac     14760
     atattcatca ggaacctgct gtatgttaat gttacttcac ttggcccact atgcattaga     14820
     cgcatacctg aaatgagatt ttcaagacag ctgtcaaact ctgctcgtcc acccacgttt     14880
     ctgccacctt cacaatgccg agaagctctt tgccaaacac gtgggctacc gcttcgaatg     14940
     cagagccctt aggaatgcaa ttttcaatcg tctatatata ggtgagaatt agctgaacca     15000
     aaagtcccat tgataggatt tctttcttac ttgaagaaca tcgaagctga ttccgcctcc     15060
     gctatcggat ttgcaatagt tctttgtggc cgtaacatag ccgtcagagt tagcctctga     15120
     tgttgagtcg aggaaaccat caattaggta gttagccgaa gggctaccaa tcatgaggtc     15180
     tccttgatac tcttgctgaa tggcagatcc ttgtaacagc tcgtcagctg tcttgaatag     15240
     cgacgattgt tttttaacat accaagccca gcacctatcc cttcaagaat cacaaggctc     15300
     ctagtgacgt ccttatagtc gatatcgccg ccaaacaacg aatgccgcgc gccgccatat     15360
     ctgtccaaaa gctcgactat gtcttggtcc cactttccaa gagccgaaac ggtaggtacg     15420
     ttcattcgga gctccaaaat atgccgagct acatcatcgg ttaccaccgg agtcttcata     15480
     ttctgccatg gtggagatgg gccgaaggtg aatatggaag catccaaagc tttggttccg     15540
     gatgcgattg ctaatgaaag actcaataag ctagtgagcc gatgcatgct aggcgaacga     15600
     actagcaatt aactcgctct gatagtaaat gccttgccgg aataattgac tgacaaacct     15660
     gtagtctttc agcgtagact ctttagtcag gaactagcat ttgagcgtta agtagacgaa     15720
     gcacccgcgc ctctgtacgg gtagatagca gcaactatgg tacatcagct ctcactaacc     15780
     ccaaaatata ctagttatct catgactgag ctagctcgta tcacgtgctt actatcgggg     15840
     gctgtcccac ttggctaagg actgatacgt cgggagttca atgattaggc tgcttcaagt     15900
     ctcgtctgta ttcaatctct atagtagtgt acatacctct tcagaacacc tgagttttat     15960
     taatcttttt ctatttctct ttcttttcct atttcctttg tttggcttat cggtatcact     16020
     ttcgtacgat cttgattcta cctgaacctt gaggacaagt ttttactcat ctttccatat     16080
     tgctcttcaa gtatactagg ggcatgtcaa tttcaggact ctaagaaacg ggtcaaagat     16140
     atgccttctt gttgaacagc tgcgcccaca catgcgatct ctcaatgttt cgactcaggc     16200
     gaatacttcc aaactctaca ttttttcgaa ttagcccacc attgtctcag acctcgaagc     16260
     tcaacaatgt gcgccatgtc aaattcaagc ggccgtggat taggtaggta taaatcttcg     16320
     atgcactata gatattccac tctctgacat atgcctcagg agattattta ccacattctt     16380
     aatttatggt accgcatttc atttgtggag ttcgttcatt ctccttcagt ttgatgatac     16440
     actagacgat gccgatgaca tacaggaagc cccctctgga aagataggtg tgggcaaaaa     16500
     tcgaaaaaat gatacggagg ggcaccttga gaaccctgcg agcgtaacga tagatactga     16560
     tcctgttttc ataccattgg gctggccacg attacgcaaa ggtgaactat atgcagcatc     16620
     ggacccggag tggcaagaat ttgtcaagac ctcgcgggac cgagaaaagc ttcaatacct     16680
     gagaggtatg gctgactcgg ttgtatttta gtccttggct aaacattgta tgcgcagatg     16740
     agctggcatc catcgttcag aaagatgcct cccagtctga tttactgtcg cgcgtgctag     16800
     ggggtcccct tagcgtgaca gggttttggc tagtgcatca tttcccatct cgcgcccccc     16860
     ctgattatag gcgctcaggg tatgtgcatt catgaccgga ctacccttgg gatttgctta     16920
     tgatgcgtag gttagaattc accgacagtg ggatatcgtg ggtttcaaaa cctatgtctc     16980
     tggaggatgg cgaccgtctt cggaggtgtg tacagccttt gtctgtggca cttgctataa     17040
     aggatgccta tatgatcttg gtgaaaagac agctttcccg gcttaatatc acaggcttgg     17100
     agcaagaaca agccccaggt acttcaagtc taccgtccca taaggcgcta tcgtccgagc     17160
     ttcaacccct ggacagattg caccccgtgc atcagtctca agcacagttg actccgccta     17220
     ctggttctca gggaggcaca ttgcgagata aaggcggtgt cgaccttcat ccttctctaa     17280
     ttatctcgac actacagcga ttacctttac caaagtttgg tcccgggtct gatctgtacg     17340
     ccgcatcgtt agctttcaag atacggctga agaactgttt ggcccgagaa ctgcaccgtc     17400
     ctcggcgtgg cgcgttctac tttatcggcc ctgtcggctt gaaaggcccc agagggtttt     17460
     gcagggttga agtgaaaggt gaatacgatc cagcaacggc cagttggtcc ttgatttcga     17520
     tgcagcttaa ggatgtgagc atattcaacc aaaaagcgct tgggggccct taacaccggc     17580
     tgcctatcct tccatctttt acaaagtgca ttctgctgta gctaaagata cgggacctac     17640
     tctatgttat gaggtctctt ttaatctatt ttaatgcctg ggcattgatc aaactgagct     17700
     ttcccctcca tgctatagcc tttcagaaat ccggcaccta ggatctcgaa cgaaatagtt     17760
     atcgtagttg tcaatgcact ccagttgatg agatttagat ataagctata tagatatgca     17820
     caagtagcta tatggagtgt aggtggtaac taggctggta tgcttagtca agtgatcagc     17880
     aagtatcgga aaggccaatt catcaaaagg ctgtgcgact gttattacaa gggaatcata     17940
     tgagtagttt atggctagaa ctctgttggt tgtactatgc taggcgcggc agatatcaac     18000
     ttatctttca tacacgtatt ccgtaataac tattcatggt gagatgacgt aaggcgttga     18060
     ttaccccacc ccctccatag gtacatttaa tatacattta ttacctggcc accgcatctc     18120
     actcacatct gcagaacaac cagcattaca gagtacccat acctttcttg gtacaatcac     18180
     caatggctct tccccccaag tttgcgggtc acagattgcg ggctggtact gatcagctcc     18240
     cgcaacacac acttgaactt tgtatgttat gtcagagact ggattgacac atattggttg     18300
     ctgataatag tacaaattga gatcttgact atgcgtgtcc cgtgagtcca cactgtaggc     18360
     tctactatac ttttgcatgt acgctaaaac ttagcttaag ttctccgcaa agatgttcga     18420
     tacgttctac agctcagtca gacctacact tgcaagtcaa taccgaggcc agctgcaggt     18480
     catttttcgc caacatatcc aaccctggca cccatcatca acattaatgc atgaggcggg     18540
     cgcagctgtt ctgagagtag ctcccgagaa attctgggag ttcagtgccg ctttgttcaa     18600
     acaacagaaa gatttctttg atgtaagcgt ggttaatgag acacgcaaca gaacatatga     18660
     aagattggca aaggttgctg gacatattgg agtggaggag cgggaggtgc tcaagctttt     18720
     gactgttagc gacaaagcta gtgacaacgg ggaactgaat accggtaact ttgtcaccga     18780
     tgatatcaag aaaatggtca aagtaagata ttaagacacc ggtgatttgt gacatatcca     18840
     atctaacaca acaaattagg cagaccgtgc tgtgggagtc catgtttccc cgaccgtata     18900
     cttcaacgta tgccatgctt agttgcgcga atattataag cgacccgatg tactgacacc     18960
     atcatctagg gcatcgaaga accggggatc agtagcagct ttactgctac ccagtggggg     19020
     caatggttgg ccaagaacgt gatctgaaaa ccccttctag ataaagtatc ctgcaaatag     19080
     aatataggag tgggtgaagc acagtaaaac ggtcgttatg gtggcagtgc gtggtggctt     19140
     agtcgacaaa cgaggtatct tctagcagca ttaaattata ttccttgtcg aaacttcatg     19200
     caagaagcac ctgattgcct aacaatctca tttatgcata ctccgcacct tattttgcgg     19260
     acgtttgctc gtccaagaaa tgggaaatga gaagagaaag gctaaatatc gaccatcgaa     19320
     ttcgaggtgt atttactgtg acattggtgg ctggtagttg agggggcgcc tgacacaact     19380
     ctcagtacca gaaaagcgaa catgttcaaa ttaaggtact cacttgaata gcagaatgtg     19440
     tggttccggc tcatgaacct cgtagtgctc ccaacccaag ctctgaccgt cggtaaagtt     19500
     agacgactta tgacattaga atctgacagt ggtgatcggg cctgcacacc tgtgtaatcc     19560
     ccagggctct ccactcctct tcccaaagca gtttaagagt tcccttcgag ctgtcaaagt     19620
     agtcggccgg gatctttttg agcatgtttt tggggagctg aacatgacgg tattcaaatt     19680
     gatcatcaga gtatctatgt gtaagtcagc attcgcatcg atacagtcta cggtatagga     19740
     gtcaatgtac ctcgcggaat agtggataga atcgataaat tcatcgagcc tttctcgttc     19800
     agattccagc agaaggcggg gcttcttatt cctcctgctc atatcgatgt ccatctggaa     19860
     cggtgaggag cgtacaataa tgcgaataga acaactgcca gctatcttct aactgtgagc     19920
     gatctattta catagatatt ggccgcgctc ataggcaaga actatgggtg ttcttattat     19980
     atagatactt acggaacgaa aaccttcaat ggagtgactt gggcggaatg caactgacgc     20040
     acggcttttt tggcggcttt ttcgaagttg gtgtgcgtct ctggtcgcga gttggcgtaa     20100
     tttgaggttc accagcttga ggagcaagta ggaagcagat cggatcagaa ccgcaggaga     20160
     aaagacagaa atactctaat gaagataccc acatttgctt cttggtggag gtgtctagcc     20220
     gctttagtgc ctaaggctgc aaaaaaaaag agtattcacc attgtagcct ctatttgtcc     20280
     ctgttgcctc attattttaa gaatcactcc tggcataatg tccgagtctt cttgtgtatt     20340
     gctagtgaca ggaagactag ttaagcttgt cctagtttat tgcattgagg gacacctggg     20400
     tctgcatatt taacttcagt acgtattctc ttccttgatg aagcagtttg tgcgagaaac     20460
     aaagcttaat gtgctttgca tgctacagtc ttcgactctc gattgcatca taatatgtga     20520
     gatttatatc taatatgggg gattcccgtg cttgctgttt attatgtggg gtgatatagg     20580
     agaatggcgg ttttggggat gttcggttgt ttatatacct accaatttta ataatgcggc     20640
     actatcacaa tatgagagcg tcagtgctcg tgtcagagaa ggtgttatgt cactgcaacc     20700
     tcccttcctc tacttatgcc aatgacccaa actataatcc cacctgcaaa tacccctgac     20760
     tttgtcttca tgctacaact agagttgtgg tagaggcggc aatgtctcga tggaatagtt     20820
     tatagagtca tctgagtatg agagcttgat tcatatgtgt tcaaacggct cttaagttta     20880
     cacatagaat ttcttcataa gagagtggag cgatccacat ccgaacaaaa taaatttaac     20940
     caatctctta aagtgtacgg agtaaaatga cacctgatac ctatcatgtt ccgggatctt     21000
     agtgatgtgc ctcttataag gcacgttagt ctaagttttg agtaggaatt tagggatgta     21060
     taagcaatga gtaccagaat ctaatcttga ttatataatg tgcatatata tcaaactaat     21120
     acggaatgca cgccacaaat catggaatct atccgaggta attcttgtgt agtagaaagt     21180
     ctctacaata cagttatttg atactactag ttttgttgta aaattgtatg ttagtgctac     21240
     acagtacaag gtgatggatg ctcttcgtga tggaaattct ttttagttga acactggctt     21300
     atctaattag cttttaacca accatggatt agctctggcc gtttcatttg ctccccagcc     21360
     gagggaggaa aaagttgaaa aggcgaaggg gaaaaaaaaa agaaaaaaag aaagaaaaaa     21420
     atttcaaaaa aatcaaaagt gggtttcgtt ttgccctccc ctcagaactc tccaattttt     21480
     tttttttccc tttctgcttt cttctcaaca cttggagtga acttataatc ctcccccctc     21540
     aaaatctttc tttctttcat cccattcctc ccttctaccc ttgtctctat catcttccac     21600
     cctccccctt cttaccatgt ctgacgaagt ttacgaaggc gccattggta ttgaccttgg     21660
     tgagttgtat atccgattgc tcctgtcaaa cttcccaccc tttcagcatt tttttttaag     21720
     ggaaaaaaaa atcatttgct ttgaatgggc taaccagttc cctaggcaca acctactcct     21780
     gtgttgccaa ctatgaaggc accaatgttg aaatcagtat gtctacatga agcttcttgg     21840
     aaccgagctt gttggttaat catttatcac atttagttgc caacgagcag ggtagctaca     21900
     caaccccctc cttcgtctct ttcaccgaaa aggagcgctt gattggcgag gccgcaaaga     21960
     accaggctgc gatgaacccg aagaatacca tcttcgatat caagtgcgtt gctgcatgag     22020
     cgtcaaagat tctgtttctc gttttaacat actgtaggcg tcttatcggc cgtcgctatg     22080
     atgatcctat cgtcaagaag gatgttgaat cgtggccctt caaggtagtt gatcagggtg     22140
     gaagccctgc cgtcgaggtt gagtacctcg gagagacgaa gactttcact ccccaggaga     22200
     tctcctccat ggtcttgatg aaggtaacta aaccgttaac tcttattata gactacatga     22260
     ttgatagtat atcatagatg aaagaggttg cggaaaccaa gcttggtaag aaggttgaaa     22320
     aggcggttat cactgtgcca gcctacttca acgacaacca gcgtcaagcg actaaggatg     22380
     ccggagctat ctcgggtctt aacgtccttc gtatcatcaa cgaacccact gctgctgcca     22440
     tcgcctacgg tcttggttcc ggaaagtccg acaaggagcg caatgtcctc atctatgatc     22500
     tcggtggtgg taccttcgat gtgtccctgt tgaacatcca gggcggtgtg ttcactgtga     22560
     aggctaccgc tggtgatact caccttggtg gacaagattt cgataccaac ttgcttgagc     22620
     atttcaagaa ggagttccag cgtaagaccg gaaaggacct ttcgggtgat gccagagccc     22680
     tgcgccgact gagaacggcc tgtgagcgtg ccaagcgcac tttgtctaac gccacccaga     22740
     ccactgttga gattgattct ctgtttgatg gagaagattt caactcgtcc attactcgtg     22800
     ctcgtttcga ggacctgaat gccaagtctt tctctggtac tttggagcca gtgcagcaag     22860
     ttctcaagga ttctggtatc gagaagagca aggttgatga gatcgtgctt gttggtggtt     22920
     ccactcgtat tcctcgcatc cagaagcttc tcagcgactt cttcgacggc aagaagcttg     22980
     agaaggtgag tctttttttt tatctatcat ttttttcttt tctcggtcgc atattgtgaa     23040
     cgacattggc tgatatattc cttaagagca tcaaccccga tgaagctgtc gcctacggtg     23100
     ctgccgtcca ggctggcatc ctttcaggaa aggccacttc tgctgagacc caggaccttc     23160
     tgttgttgga cgttgttccg ttgtctcttg gtgttgccat ggagggtaat atctttgccc     23220
     ctgtggtgcc tcgtgggcag actgttccca ctatcaagaa gcgcactttc accactgttg     23280
     tagacaacca gacaactgtt cagttcccag tctaccaggg tgagcgtact aactgtgcgg     23340
     ataacacctc tcttggagag ttcaccttgg cccccattcc gcccatgaga gctggtgaag     23400
     ctgcccttga atgtgttttc gaggttgacg tcaacggtat ccttaaggtc actgcaactg     23460
     agaagtcttc cggtcgtagt gcgaacatta ccatctcgaa tgctgttggt aagctctcga     23520
     ccacagagat cgagcaaatg atcgacggtg agtgcccttg tctgatcagg ttaaccgaga     23580
     cactttcata actgacatcg tttagatgcc gccaagttca aatctagcga cgaggctttc     23640
     acaaagaagt ttgagtcccg ccagcagctg gagtcttaca tttcccgcgt cgaggagatc     23700
     atctccgatc ccaccatgtc gatgaagttg aagcgtggta acaaggagaa gatcgaatcc     23760
     gctctcagcg atgctatggc tcagctcgag atcgaagatt ccactcctga ggatctcaag     23820
     aagaaggagc ttgccctcaa aagactcatt actaaggcta tggccactcg gtaaatgaat     23880
     cttagttgga cttacggtga ctgccgcaag taaaaaatag taatcaaaaa acgaactgca     23940
     cgcgttattc acttagtatt atgaatagag gccaatctgc tgctttgcta cctatgcaac     24000
     atttttgaca cgagtttggt gtatatgtgc ggccttctgg actaggcgcg tgcttgtgtt     24060
     tcagggaaga ctgtttctat gatttttatg agccggtgaa tctatatact ttttctcatg     24120
     acacttcgcg ggtatcttat gttccaactt gcaatgcctc atgggcttag gcgcgtagac     24180
     tttgtaaaaa ccatacctct agtttattgc aataatttaa cgatttttct actctgtgcg     24240
     aacagcgaaa ggcacaagtg ccacgtcttt taagccgttg gggtcatggg cagaaaccta     24300
     gcgatctttc ttgaattggt tagtgggcat tgggatcggt gatctacgga gtgtttacgg     24360
     agtatggtgg ttcccgacgt tttgaagacg ctatctaata aatttgagta aaacgccctg     24420
     cctccttcaa ccttcttttt gcaacaactg atcaatcgac ttttactgtc tgtcagtggc     24480
     ggcggatatc aggaaggatg caacgtattc cagtattatc tagtcaaatc caacgtttat     24540
     catccacact tacaaatgcc agctccccag tcaaccttca acgggggcgc tgcctgcttc     24600
     aagagcgcag tctagcagtc ccaaatggga gagtgaggtt ttccacttcc cctttacttc     24660
     ttaagaaaaa agataaaacg aagaacattt ctagctcgag tccagatgca aggcccccta     24720
     aagctggtct tgtttctgag gatccatatg atctcgctca attacatgat ggcattgcgg     24780
     ccgcggtgtg ccgcctcaaa gatgaccttt ccaagctgcg cgtgggtgga agacttaaca     24840
     cagatgccat cgcaagcctt cgtgtccagc taagcaaagg aggcaaagaa accgtgaaac     24900
     taggagaatt agctcaagtc gttcctaagg gaggccgcat ggtaactata ctggctacgg     24960
     aagaagatgt aaggcttttt tgtcccttcg gaccgtaacc tggatcctcc ctttgctctc     25020
     gctattcttt aatagctctt tctgacacga ttgacagcac attaaaccca taacttcggc     25080
     ggttgtgtct tccgacctgt ccttgacacc ccagccagac gcgcataatt ctctgcaact     25140
     gaatatacca atcccaccgc cgacaaaaga atcacgggat cagacagtta gtgttgcgaa     25200
     agcggctatg gaaaaggcca cagcggcagt ccgcgactcc agaggctccg tacacaaacg     25260
     ccttcaggat atgcagaaga agaaaatagc tagaccggat gatgttcgga aagcacagga     25320
     acagatggaa aaggtaacgg agaaagggca aagggaggtg agggatcttt ttgaggcagc     25380
     aaagaaggcg atggagaggg cataacctga agcgttggcg agaaatgtgt tttgtgaatg     25440
     attgtaattg ttgggcatca aggttcgtgc caacgtcact acttgcgatg tgactccagt     25500
     acctgactta cagtatgaat tgctcggcat atgtaccaat atatggaatt gaacaataat     25560
     acactagtgc taatgtacaa tgacctctca ggagtgttta ggctcgcctc actgggcgag     25620
     ctgaagacag gagtgattcc acttttgcaa caaattgtga gctcttaccg gctgcttgat     25680
     aagactcgtt gtttctgaga ttcttcttca cttcactgag aataggcgag gcggcttttt     25740
     cagtactgag tttgggataa gctccttgga tgaaggattg cactaaagac ttcctgtcct     25800
     ccacactcag cggaataaaa ccgacgtcct cgggttctac taaatcgcct ttccgctgcg     25860
     agtaattgtc tgcacgctgt tgggagagtt tcttcgcctc tgctatagcc tgtgcctttt     25920
     cctcctcgtc gagaaactga acaaactgtc ccctgaagag ccgcatgccc agttcataag     25980
     gagtaacata accatttgga aagcggtcac ttagaaaaga taatttttca acaacctcgg     26040
     ctgtattcgc agtcgtaccc gtgggaaaag agggccaagt ttccttcagg ttagagaagt     26100
     caggagcctg gggttcgtag cggcttggcg ttggccttga tttctcagcg agttcgcgat     26160
     atacattctc aatctgagag ctatcgcttt cttccatatc cgtatttttc gaacgttgag     26220
     gtcgtccacc ttttcgtaat ttgggggctg acgactttgc tgggggtctc ggcctccgag     26280
     cgcgaatgga tggtcccttg cgggggcttc gcaacgaggt actcctaagg atgtttgtag     26340
     attggccatt ggctgaaggg gccgcgagag atcttgcgtc gaaaacgcgt cgaggacgag     26400
     gtttgtcaga atcggttttt ctagaattca aattggctgg tggaaggttg ctcttccttg     26460
     aaggagcgcg agaagatgag gcccccgagg gaagagatcg agctttagga gcatcgttgc     26520
     ctacaaaagt caggtggata tagacacaaa tgagatagcg atgatcttgc ggccttaccg     26580
     gattgactgg cgtctttcgc tcgtccttga atggacgaga actggcgaat cggataaaga     26640
     catccttcta ccagtcttac acgctcatgg cggataagtt tggtgcgaag ttgaaacatc     26700
     ttcaacgcca acaagctata tgggcgttgg actgaagtta gtacgattag tgtaacgaaa     26760
     atgttcgttg tcttcccgaa gtacaaaatt ggtcacgtgg agtccgtgtg cgtcaccggg     26820
     tgtggtttcc tccgcatgac ttaaggggct ttttgttcag cagttcgttt ctgtttctaa     26880
     actagaataa ctcgggcagt actcctgtct atatcgataa tgcttcgccg caagcctaca     26940
     gcaatagcta taacgtctga agacctcgcg acgtttgagg acacccgact tcgcaaattt     27000
     acccaagaga ataaagacta cgatcacgtc aagaacagtt tcaaatttga tcccagtgat     27060
     gagctgaagc ctttaccagg cgataaggca agaattgtcc ggtcgcggga ggagaggata     27120
     gggttaagtc gacgcacttg agatggcaag ttgttatggg tcatccaata acccaataac     27180
     ctaacaacag tcagattcgg gtcatggttt attgtcttct tttcgcatat ttttacgcat     27240
     cttgtctatc ggctatacag caatggtcaa gttgtcttcg ctctccacgg tcccaattaa     27300
     tgcatgcctc cgaatatttc gttattctag gatgtacgta tatttcactc gagtacatgg     27360
     atggatttct tatgatgaaa taacatagga gtggatttgg gcaatgatat ctacagctgt     27420
     tatacatgtc atttaccata taactgccat aacaggctct ggagggttcg caaatatatt     27480
     gtttcatctg taacccaggc tattcagagg tttaatttcc tggaattcca accgaatatc     27540
     tccatataag caagcaatga atgtttttgt gtataccact tctttagcag tgatatcttg     27600
     tgcagtgagg tgtgttttac ggtattaaat tctacgcaca agtctaccta tttatatagt     27660
     acttcatacc ctagcataaa agacaataga gaaaaattgc tgaatactgc atctatgata     27720
     gcaaccagag agtacattca tgagttcacg ctgcaggcgt tgaagatctc gttaacaagt     27780
     aaagacaagg ggtatattag aacgaagaga tctatatcac aagagtcatc catacagcca     27840
     ccttctccaa gtaaacaaca accgagttag tcctcagtgc ctattgcata tactgatatt     27900
     caacgtgcgc gcttctgagt gtgctctgta cctatatcga cggaataatt ccagcgtcgt     27960
     ttcaagccat taggatcata aacactggca acactctgtt gccagtcacg cgctgtaaag     28020
     agcacttgtt gtccattaaa ttgaggtggt gagatagcct gaggaggcgt gactggcgta     28080
     acctttgttg tttgtccata ctggacagtg tattgtcctg ccaaaggcgc ttgaactgaa     28140
     tgatccatag ccattggggg agagtttgta ttcactgtgg aaggcgccat ggaaaatgcc     28200
     atgtcccact gactagatag ggaacgtcag caagagtctg aaagaatgcc tctacatttt     28260
     cagtagtttg cttacgtaat tatacgggtg ggatcccagc tgttctcgtc aacgagaggc     28320
     gcgttcaatg attgactcga gacaggctgg ggcggcatca tccccagaga atggagctgg     28380
     gagcaatcgg actttgaatc ttcagtacta gctgatattg gtggggtgat cggataaggg     28440
     ttgtaaccca cccgaccccg gacgccgcca gaaacctgac ttacatgagg ttggtattgt     28500
     gagtcgagag gcggcgggct cggatggtat ggctctgaag gacttccata aggaaatgtg     28560
     ggcttaagct cgaagggtct attcacatcg gccgagaatg ctagccgcaa ggagtcgatc     28620
     tgtgcttgca tttctggcat cggccaagca gaagagcacc tctcgaggat gcgcatgtgt     28680
     cgagcaaaat aatcacgcgc atctgtgtgg aagttcgggt caggagaggt tatcgcgacc     28740
     tgagatttgc gttagctatt ttatcctagt ggataggaac acaaacgcac caaatgtaac     28800
     attgtgcaag tcataatgca gtaaatcgca aaatttatac ctctttgcat ggaaagtaga     28860
     cctgggaggc caaagcgctg taggatagct tcttgaagtc tacacagata tttagccgaa     28920
     gagtaacaca aagccatatg cattttccac cccccgcctg cggcaaagga tttagatgca     28980
     agcaactgag gtcggtgtag tagaataatg cctagatggc aatgggaatg catattagcc     29040
     acaaaatggg acggtatcca cgggggtgag ccgtcaggag ggtaggtaat ctgtagatct     29100
     gaaggaagac cttgaagcca atcggtaaag agaggattct tctcaacgaa ctttggattg     29160
     gcaccccagt ccttttgcct cttgattttg tggtatgtat cagtgatgat acgaatgtga     29220
     tgagcattct ggacaaagta ggcatattgt ctagatcgat cgatttcgaa ttggtcaaga     29280
     tctttaatat ccagcgcagg atccatacaa acggtgtcag gagttacacc gtagtccgat     29340
     cggcctttga acgttagtac taagagtatt gccaataata gcaacatacc ttgcggtgca     29400
     ccaatcatta cttcaacaac caggagggct tgccacactc ttgtctgtac caaacactct     29460
     atggggttga gatcgcagag tctatgctct gcatgcgtgt tgtagtgttc gtcaatttct     29520
     aaatctttag ccattgaaac aattgttttc acagtctgcc acgagcggta gtaatagccc     29580
     ttctttggca cggattctcg tgctttcaaa agtagaagca ttgcttggat tgtgctcagg     29640
     cggggtacat ccataaaact agactcgtgc cctaaatgta gcgcatagtt aaaaccagta     29700
     tattaaggca atacgacatc caaagccaag ggaaaggagc gcgcaggggt gaggagacct     29760
     actattcgct aatgcaagcc actgtgctcc ctgagctgga tcatctgatt gccttcccgc     29820
     gcatgcaaac aacgcctcca ggagaagtgg agaaatcgag ctccgatcat attgccactg     29880
     gtagtacaaa tgcgatcgat gcaccacagg gacgtaagga tgtatatcat caaaatagat     29940
     cttgaagtag ttcgtgacct cttcatcgga tggcataagc tccggaggaa tgcgaattgt     30000
     agagcctgct ccagtactga gaggaggcaa tggctcttct acttcatcct gtatagggat     30060
     ttccggttcg cccttctctt tcttttgctg tcttatatag ggagctatct gctgtgttag     30120
     cggacattcc tagatcagag attagacata aaccatacct ataccagtct catctatttt     30180
     gagttcacca aggacctcgc taagatcctc agctgtggac tgttcgtgat cgccatatac     30240
     cccactctca atagttccca agctctccgt ctgagaggga aaaatctgct gttgctggta     30300
     ggtctgatgt gagacagcta gggcaggtga ccctacttca tacattcccg tttggtggga     30360
     agcagaatga gtgaactggg ggaacattcc cataccgtcg ctatatggag gtataccacc     30420
     caccgtagct tggccactgt ctctgtaacc ctggggcatg gaaaaggacg agaacgattc     30480
     cgttgtattg gatgcaccaa tagcattcgt tggattggct tcaacaccct gcccagtggg     30540
     gaactcgctg tcctgcccaa cagtaggagg tacacatact agcttaagac gtgtgcaggc     30600
     cgagcaaggc catgtatttg ttgtagcagc gtcgcacttg attttacgct ttctgcagcc     30660
     attacacgct cgcatcacta gatgggacgt tttagtgaat aggaatttaa cattgagcat     30720
     aggagggtga catacccttg agtcttttat gtctgttgtg ttcgtcaacg aatacatagt     30780
     ctgttggtta aagcttatca gtgactggct ccaactgaat tttcgttgcg ctttagctat     30840
     atagaacaac attgatgcct tacttttgtg gccttctctt gggggccctg tcggcggtgt     30900
     gaatgaatag ccctgcattt ccaaatcgaa attatagaaa cgaagagcga tcctcaccac     30960
     aaagttcggg tgactcaaaa gggataataa taacgcttga agatttatct ccaaggcctg     31020
     ccttgtctag ataaatctga acaaacacac acacacacta aaaaaaagag atatagaaaa     31080
     agattgaagg gaggacaggt tgacgggttg attgacgggt tgacgagtta gcaggttgaa     31140
     gagagggcta aacgggcacg ttcaactggg gtaaggtata aggcaaggta tatgggggtt     31200
     tctgtctccc gatgtgtcgt cacttaataa agtgtttttg cttctcctcg aggccgaggc     31260
     aatcggtgtc ggcttgcaag ataaaagcaa taaggtgatg aaaacgcgcg aaaggaatac     31320
     ctagaagaga aaactagaca acaatggtcc gtgataatgg ttgttttcct tctcacaata     31380
     gtttgacgct ttggctccac tcttatattt ctgcaaaagc gacaaatgtt ctggtttgct     31440
     accgcaaata gagcagccaa gaagcgactt ttcgaagatt caaggggccg ggaaacttgc     31500
     gacgtgacaa tcgtgataag actgcttgcg gttttgatta ggcagaattg atgacaacaa     31560
     tccagtgtga gtttgaatgg acaatagtcg attcgtgaaa aaaagcgcaa gggtctgaga     31620
     agagaacctg gccttacact gcggaatgtc agtcgggcct tagaattatg gtgcggggat     31680
     aaggagggga ggcagtccat gagggggtga ataggaagtg aaataaagct tcaacgtgcc     31740
     cgcaagcgat gcgcacagcc tttgcttagc aacaaattga cgaaaggtct gccgataggt     31800
     agtgatatct agcgtggtag caatgaaacg agggaagacg gccgtccaag ttgagaatac     31860
     cttacaatag aaagactgga agcttaacca gcctgcatcg tgacttgaca ccgtcagtgt     31920
     attgagactc tctgttggga tttgttgtag aaaagcgatc tgagccggcg catcaccccc     31980
     cggtttgcag tcagcatttg aatgaaatgt gcggacctcg ggctgctgtg cgggaaacac     32040
     tagaaaaggc cacaaatgct accagaagct ggtggtccaa aacttgaccc tggaggacgc     32100
     gatacaatct agcatcaggg gaatcagaag cccaccaata cgatgaattt cgcatgccgc     32160
     gtcgccgacg ttacgtccct gattaactga tagatgcctg gcgtctcata gtagccagat     32220
     agtatgatat acacagttca aaagtatcga acaatgatga aaaagggcag tggcgaaacc     32280
     aaccacaata acagacgagt ggataaacac gattagccct caaagaagtg ggtgcgaata     32340
     aaagagtcaa ccggcctagg cgcaggtgag gagaggatcg cctcggatgt tgaggggccg     32400
     catgattgcc gctcctcagt acggagtact cactctagtt tggtagcggc caaaaagtgc     32460
     caagaacaat gatgatgctc tgccaagttt ccatgactcg tactccgtag atttattaaa     32520
     ttgtaggcta gtctagttat cactagccta atttatttga taatcacttt cgctcaacaa     32580
     ctgtatacta taatgatagt atagtattcc ggagcatgat gaatatctgc gggtgtatag     32640
     cgtagatgtg acttagataa ttggtaggac tctttttaag ttcgggagaa agttcctatc     32700
     tgtaaaccga agatatatcc catacttgag ttcttgatgc tatatactac cttgctttta     32760
     gtgcaatgtg cagctcttac tcgtctctag gctcccgatc gtccctcact ccatggcggg     32820
     ttgggggctt gggttattat gtgagctgtg ttagcaagat agggagggta caatacaact     32880
     ctgctacgat gtgcaagtcc ggatttttct tggccaggat catgatccca tatgagccat     32940
     attaatggct ggcgggaata atattactat aggtatctgc cggttacacc ggtggtgatc     33000
     ggtcaagcag gacctaggta cagtacatgc aacactacat ccagcaccaa ttcatacaag     33060
     tgaatttaaa agcaccctcc ttgatcttac actatagtga tataagcttc gcataatgta     33120
     tataccagat aagttgtcca ggtagttaac aacatcactc gcgctacttg tctaatttct     33180
     tgacgtaggg gctggaaagt ctctctcgac ctttgaaaga cgatgatctt acccctatca     33240
     gtaggaacaa gagcagtaaa agtaaaaaga tacgtattca acgcttctgc gcataaaggg     33300
     acgtcgaacg aatgtccatc ataaggagca atttttaatt ctatcggatg tttgggtttt     33360
     agatctttta tatcaaattc ttgagatgga ttcatagagt ttagacttta tcaagggaaa     33420
     ataattgttc cacatggccg ttctccatcc ccatagtaaa tttacccctc gtctagaaaa     33480
     catacaattg tgatttccta cccagcaatt aaagactgtc ggccacttct ttgcccacac     33540
     aatggcatcc gaaatgcaga actcgaatcc cacaatattg aatgctgctg atcttccaaa     33600
     acgcttgcga cctgcaccgt ctcgcaagcc cggtatcttt gggaatggtc tctttgcgtc     33660
     cgcgcttccc tttgtgtatg cgagtaaatt acccccagag ggctttacgt cgtcatcaga     33720
     gtcagaaagt gatgatgatg atctgttgga agaaccgata gatgaacaag aaatctacgg     33780
     taaggcacgg ctgcttgcca aaggaacgtc aaacaaaacc acttattaat ctctagatct     33840
     cgtatcgact atatctgacc cggagcatcc gatatcgttg ggagctctag cggttgtgtc     33900
     tcttcctgat atttctatta ccccaacact cccatatgta ccggcttcgc ctctacgaac     33960
     agttactgtc ctcatcaccc ctactatcac gcactgtagc ctcgccacgg tcataggtct     34020
     cggtgtacgt gttcggcttg agcaatctct tcctccccgg tttcgtgtgg atgtacgaat     34080
     caaagaaggg acacacagca ctgctgatga agtgaacaag cagctggcgg acaaagaacg     34140
     agtggccgct gctttggaaa acggaacact aatgggcgtt atcgcgaaga tgttagagac     34200
     atgccagtga actcgaacta tctggcaggc tgaaaagtag cgctcttgtc gcgcctataa     34260
     aatatcatca cttggcattg tcttcacaag gatattcggt cattttttat tccatcaaat     34320
     gatataacta catggaattt atggtatacc attggacccc agtgataaac aggtcatgag     34380
     tccaaaacgc cactctcctt caagcctctc cagagttccg gttccaaaaa cttgcttacg     34440
     gtgacatcct ccgctaagcc ctttcgtctt cttgtcttta gcacgaagtc tcgagcagtg     34500
     gccattgcag gggccatctc tagtggtttt atcttgacat cacgatctag cgggtcccct     34560
     ggcacgacgc tccatttgtc gaagacaaga ctaactgcag cttggccttg tgtgtgaata     34620
     cgaagatctg tctcgaatcc aaatgagtct atcactggaa tcaagccacg gactgaataa     34680
     agcggtgttc cggcgatggg cccatcagag aggacatgac ctctcctgcg cgcaaggaca     34740
     gtatacactg aagcgacggc atccgcaggc cctgtcatcg tgcaggagta aatgggttcc     34800
     atcaagcgag gagatgccat gagaaacgat gaataaattg cgcgtcgcgc agtgggaatg     34860
     atttgaccac cgcctctgta gatgacctgg tcggcaaggg agacgtctgt gagcctgaat     34920
     tttgtgtttc gaattgctat agccaattag cacaaaaggt tactggactt gatagatgta     34980
     tttcaagctc ggcgccgtgt tgcttcgggt taaataggat ttagagattg gtgaacttac     35040
     gctcttcaca aagtggacct tccctagtac cccagctaaa accttgggtg atagagtctc     35100
     tgacgcttcc aagaagcttc ttatcaacct gggatggcaa cgtatcatct tgtaatatgt     35160
     taggccctag ttcgtctggg ccgaaggccc aaatgcttct agctgcaagt ttatcccaat     35220
     cgtacttgtc ttcgaaaaaa cgtgccactt tgcgaattgg gtctttgatg ctgactttgc     35280
     cactctcgat gtcctctgcg attccgtcgt ccaaaggttc tgcaatcatg gttatcttgt     35340
     tctttttgtt tggtgtgata gaataacaca taatggctga agtctcaaca gcagtttcac     35400
     aaaagcgggt gacaggatct gagaccttaa tctccatctc agagaagagc cgtcgcaagt     35460
     catgaagcac gcagtccata tagagctcac cggttcccaa gatgacgtgc tccccagact     35520
     cctcaacttt ggttgagatc agaggatagc tcttgttgac tttccgaaga ccatcaagca     35580
     tttttggcaa ttcagacgga ttaacaggct caacagcgac cttaaaaaca gactcggtca     35640
     tatgtcgaat tggtttaaat atgtatgcgt cttcgtcatc ctcaagtttc agaggcacga     35700
     tagtcgctgt cttcacgatt gaattgtcca cgccacccaa gagaaccaag tttccggccg     35760
     gaacaccact ggtcatgatg ttatagccag tctcagcaat ccaagtgtcc gagatagtcg     35820
     cagtcaccat atcctcttcg tcttcaggag tataaccctc acccagcact cgaacttgtt     35880
     gtccaggctg tgcagttccg ctcatgattc ttccaaatgc attgaaactt gaagcgtctg     35940
     tgctcgtgaa gagtttcgtg atatggacaa cgagaggacc atcggcgtca cacgtagtca     36000
     tagcggctgc cactttcgaa tcgaggggtc cagtgtagta ccggtccagc ttcatctgcg     36060
     cgccctcaac tggagagggt acatgctgta ctatcatgtc tacaaatcct gtagcaggac     36120
     cgaagaactg tccgcaaacc aggttgagta gctccttcgc gtctgatttc agttgagatg     36180
     gtttcaagtg gatgccgaca cttgcgagtg ttcgtttcag gtcttctgaa ctctcactta     36240
     tggcatgaga atagagcttg tatattggtt caaggacaaa cttgacaaaa gttctcttag     36300
     aattttcttc aacccctttc cgcgtgaact tccggcttgt tgggttgaaa aagatatcgc     36360
     cccaaagacg cagagcaaaa tccgaggtct caatttgagg gtaagtctcg gcatacatcc     36420
     cagcaaatga ttgaagggtg aaacaccatc ccattgaagc gcacgcaaac gcgacgttgc     36480
     ccttttctgg gcttagtcgc catttttcgc cttgtccagg caagacactt tcaatgacag     36540
     tgttgacttc ttcaatcaca tgcttgagct tgaaataggc gtcgttgggt ggtatcttca     36600
     gttcgaggat cagccgatcc attttgttca caaccatggt caacggaagg ccctctagca     36660
     cagcgtgctt gatgatttgc tccgtattcg attgtactcc ttccacaata tcaacgacta     36720
     tcaccacgcc atcaaccagt cgtgatgagg cagctacttc atcaacaaaa ttcacatgcc     36780
     ccggggtatc aagaatgttg aacaaatgag acttcccctt agtgccctga agaactaggc     36840
     tcataggagc tgatttaata gaaaggcctc gctctctctc tagaaagtga atatcggtat     36900
     aacgaagctg tacttccttt cttttacctg ctcgcttctc tagccgttca gtcaaatcat     36960
     gcgtttgcat aacaagcata tccatgaacg cggtcttccc atgatgtaaa tgaccgacaa     37020
     gcgcaatgtt ccttatttgt tcaggaaaat tcagaagatc agtcatgaat tcccttgaaa     37080
     agtgaacccg ggggagctca gtctcttcaa tggcgaactt cttttgctgt acgggggcaa     37140
     cgataggctc ggagagaggc tgtgcgtctt cttcttgaac taatgtctct acctctgtcc     37200
     cgtagacctg ttgtgcgcta gggtagtatt gtttgtcttc gtgtagaatg acggcatttg     37260
     agggggcttc tgtaatgaga tatatcagca ccgactaaat ccaggggctt taagagagtg     37320
     cccaccgtcc acctccatag actgctgccc atataattct tcatcttctt cctccccaaa     37380
     cgcctcgttg aaggcgaaag cccgaggctt cacttcgtcg tgttggccgt cttcatctga     37440
     atctgcagcc tctccaatgt agttgccaaa cctgtgtggt cttgattaga atttgcacaa     37500
     ttagagcgtt agattggatg caacttactc atcgtagaga tcatccatcg tgcggtggga     37560
     aaggtggttc aagctgccaa aaacttgtca ccagtgagct gtcgcatctc tttttgtccc     37620
     aagctgctga agtccgtcta atggactcac cgagtggtcc gtgcgtcgac cctaccattt     37680
     tggtagcccc gccgcgcgga tgccacgtcc aggaggggtc cttaaatgac tttgatttct     37740
     caccacctct tctcgtgtca gagatacctc actgctatcg tcggctgaat aactcaactc     37800
     tttcttgttt cccttcttcc cccctttaat cccaccaatc ttctttatta ccggcaagtt     37860
     ctgtctacac gggtgccctt taccacacac cgaacccctt taaacgcttc acgctacaga     37920
     agcttttggt ttacgactct tctaatcagc tatcgtaggc cgccgatatg tcttctcttc     37980
     cgccggtcta tattgtttcc tctgcccgca ccccagtcgg ctctttcttg gggtgagatt     38040
     ggccttgtgc cttgtctata cgtacaatat tgacttacac tgactatccg cttccacagg     38100
     tcgctctcaa gtctcactgc cccgcagtta ggctctcatg ctattaaagg tatgacagct     38160
     ctcgagtggc ggtacgtgtt gatatactaa caaactcgaa attcagctgc gctcagcaaa     38220
     gcggatggaa tcaagccgtc tgatatccag gaggtcttct ttggcaatgt catctccgca     38280
     aagtgagtca acgtccaccc ttatacctta tagccaacat cgaaggcaca cttacattct     38340
     cgttctatgg atcagcgttg gacaaaatcc tgctagacag tgtgctctcg gcgctggtct     38400
     caatgaatca actgtctgta ctacggttaa taaggtgtgc gcgtctggct tgaaagcggt     38460
     tattctcggt gcacagacca tcatgactgg caatgcggat attgtcgtag caggcggtgc     38520
     tgaatccatg tctaacgccc ctcattacct tccaaacctt cgcgtcggtg cgaaatacgg     38580
     caaccagagt ctggtggacg gtattatgaa ggatggcttg acagacgcag gaaagcagga     38640
     actcatgggc ttgcaagccg aggagtgtgc tcaggatcat ggctttagca gggaacaaca     38700
     ggatgattat gccattcgca cttacgaaaa agcacaggcg gctcaaaagg ctggcctttt     38760
     tgacgaagaa attgcgccta ttgaacttcc tggctttagg ggcaagccag gtgtgactgt     38820
     gtcacaagac gaagaaccaa agaatgtgag gaagatatta ctttctacag attttttaag     38880
     tcgtcggcca ctgctaatat actcattgcg tagcttaacc cggataagct tcgagctatc     38940
     aagcctgcat ttatccccgg atccggcacg gtcacagccc cgaattcctc acctcttaac     39000
     gacggtgctg ctgctgttat cctcgtctca gaagctaaac tgaaagagct taacctaaag     39060
     cctgttgcaa agattcttgg ctggggagat gccgcccagc agccaagcaa attcacaact     39120
     gccccagctc tagcaattcc caaggccctc agccatgcag gtgtggctca ggatgctgtt     39180
     gatgcgttcg agattaacga agcgttcagc gtagttgctc tggccaatat gaaactcctg     39240
     gggttggctg aagataaagt caacatccat ggtggtgcag tggctatcgg tcatcctatc     39300
     ggcgccagcg gtgctcgtat cttgactaca ttgctcggtg tattgaaagc gagaaagggt     39360
     aagattggtt gtgccgggat ttgtaatgga ggaggtggtg ctagcgctat tgttgtcgaa     39420
     tctctcgtct gagtcatgcc gagtcgccct tgatcttggt atggaatata ggaatactca     39480
     gaccagtagc atctgaagga aaacctggag tacatagaca tcctttgatt gccacggtct     39540
     gctgtgtggg gcgaagcatc atcaatgtaa ataaaatgct ggaagttctg ttcaaaagca     39600
     atgaacttgt tctgtcaaag gacactgcgt ttagaggttg tataacaagc ttagtgatct     39660
     gtgtagagac tcttgtaagc ttacggttaa ggtaggttgt cttgtttaaa tgaatcatga     39720
     aacaccagaa ctactacctt atgtaagctg gagaagtggt agaacattgg tgaccactca     39780
     aaatgctgga atgcagtgga tatcgagtta tactgcttat ttcgagattc ctttaacgga     39840
     atggattgat tatttgccct gtgtataaaa attttctacg gtggatatac catgtttata     39900
     aaccacttaa ctctctatat atgatagtta caatggtagg cttgacattg aaacgatgat     39960
     aatgggtatg cccccaacct agacagatat tttgtctggt gaataggttc attcattctc     40020
     cataccactc taccacaacg ctcttcacct taatggagag agagggtcag aagaccgagc     40080
     gaaatataaa gatataacat taatcatata atgtatataa tatacacagg ttaagagcta     40140
     cagcgagcac ttgtagtcca tagacaagga aggttgcaag ggatatcata tagagcattg     40200
     agttacatgc aagctttcag gttttacact aacataacat gatgaaagca ggctgggatt     40260
     atgcatttcc taggcaaatg caccaaccaa cgccattaac aaagccccgc aggcaactgc     40320
     tatacatgct tcaacgcgct ttcgcccatg taaggttgcg tagcttgact cactcaaaaa     40380
     atcttcggcc aaaagttcaa ccagcccagc gaacagcaga agcccactgc ttatcgcatt     40440
     cgtaatacca accataagca aaccagcagt gctcgttgga tcatataggt tatgtaaaat     40500
     aagaccgata gcttgaccaa tgggcgttgt agtcccatat gcaagtgaca tgagccatgg     40560
     cttcatcgag gatggggcaa aaaggtccgg aatcagcgat gctatacgcg agccaagagc     40620
     gaaaccctca aaagtctgat gaaaacagat ggccacgagc agtacaatga atgacgtccc     40680
     tgttgcgaca ctaagggcca ttccaataaa aatactatga aagagaattc cggcttcgag     40740
     aagaagacac tggagcaact gacgttgcgg attctgtata gtcaacatag tgtccggatg     40800
     ttcacacgat atagccggcg aaggccgagc caactctgac tgtgagtaag ggtttcgatg     40860
     agcattcgta cgtgagccat cgtaagagtc tggtccctca agatcaacct ccacatcctc     40920
     tttgtgcgca accagatttg cggattgtga ttgactgccg tcgtctgtaa agtcactcag     40980
     caggtgacct gaggattgcg gcaggctact tgtacagctg ccgtccggca tgccctcaag     41040
     gtgaatattc tctgttgact cttgtaggta ttcgggcccc tcattccgat agacgcttgc     41100
     agtatcccca ccgacatcac caatcaaatg gtcgtactca ctcccatgaa catggcctgc     41160
     tcctttcatg gcaaaaaaca tctctaccac caccacaaca aagacggaaa ccatggcgac     41220
     aaaaccagcc atggcacggt atgattcact ccaaaatcga ggaagacatg gatctgtcag     41280
     ggacacaaac gccgtaggga gtaaatggac gaaggccgta gctatcaata cacctgtccc     41340
     aaaatgcctg gaaaggaaaa gaaaacgccg tggtattggg agacgtggga accgacgggc     41400
     aagtacaggg aatgaacaag cttcatgacg ttaagttaga gagcatccag tcgcagtcag     41460
     gttggtgatg agcataccta aagtactcag cagtagaatg aggaacagtg ccattacatg     41520
     tactggagtg ttgtaaacac ctcgatcctt cgagccacac gatggcttat cattgtcaga     41580
     gtctctgatc ccacttcttc ggtgtagttc cgcccgcaga actgcctctg gtatgtatgc     41640
     actcaattca acagcgcttt caatgtctat aagagtcctg gatcagtaaa ggtggttctt     41700
     caggtgaggc ttccaaccaa ggtggtaagc gcatttcgga tggttgttga ttgtgattct     41760
     ctgaaactca ctaaactttt ccaagtcatt ccgctgccac cttgtgagtt catccatttt     41820
     tgtgtagacc ttgtgtaatc ttggatggtg atcagatcca tgacctagga caagcttcga     41880
     gatttctggc tcaagcccga tttttgaagg gttgccgctc tccgactaac tatacagttt     41940
     gaaatactgg aactggatat taagcaacaa tgaggaatat ttgatgtctc gcggtaagtt     42000
     tgaagtatgt agcggttggt gccgttgacg gggctcccac gctggggaga aggacattta     42060
     taactcggag aggctgtgaa gataaaatga acacgcgtta aattagtttt aatattatct     42120
     tatcaatcaa ttttcattgc ttagtaacac tggagcgcat cgtcactagg taccattcaa     42180
     tccaagttat tccgatgtaa cttactcctc aagtacctaa aataccgtat gttcatagta     42240
     catctaaacg gggaaagata gaagcaaaaa gataaaaaat ccgtggagat tgtattgctg     42300
     gaaagcgata ccttactccg gagtatgcta gggacgaaga agtatggtat gtggcattac     42360
     tacctgtttc tcagcttagt ccaaccgctt gtccctttaa gccgattaga ctttacaggc     42420
     tcctttggag actctggctc agcacaattg ttttccgatg gctcaatgtt tgatatattt     42480
     aattcatcct tctcgtcttc ccgattggct gaggattcat gaacagattg tagtggcgcc     42540
     tcaggtatgt tatcccattc cttcttctcc aaaacctccc attccgcact ggccatttca     42600
     cctaataagc ttgactttaa tttgtctgca actttcgtcg gagttggaag cctccatgta     42660
     cgcgtgtact cggtaccctc tgaagcagcg aggaaagagt gcacagtacc atgggagtaa     42720
     tgacctagca ttgggaatga ctttgtccgc tggatgattg ttttgggagg gtctctcgta     42780
     atcttcacct ttgattgtac gtctcgaccg gcgaacgctc taacgagtgt tgatgtttgt     42840
     gccgggggtg caacaagtag ctgccacata tgctttccaa tgctacagat ctcttcccaa     42900
     gaatctgacg ttatatggag tccttgagtc cggcaaagcc aggaaatatt ccaagccaat     42960
     agcgtcgccc cctctataaa gagagcgtat gtaccgggat cttccctggc tagttttggg     43020
     agacttctgt caatggagag tggtcggggt cggggaaagc aagaccgcgg atccgctgtt     43080
     cgtgatggtg ttaaactaga aggcgagggc tgcaacgtac ttgatgcggg taacatttca     43140
     cgcaagagat aagacccaga gggtgcgtat atggtaggcg cagggtaatt ccggtgagga     43200
     agtgtgattt ctgcaggaag ccttagggac aagtaatgtg aaacaagtac taggagttga     43260
     gcaatatagg agaatgacgt tgaaatttgc gacggtgtag cacctgtttt tttccattaa     43320
     tatttgctta gtatccgacg aaatagagat cgtaactttc cattcatgtc cctaagatct     43380
     atgataggta tgccaccaat tgtatatgcc tctttaactt caccatctct ctttttgact     43440
     ttctgctgta gattataaag gtaggcggct tcacggcata aaaatatccg agcctcagcc     43500
     gtcttactgt gcaatgaatg ccacaggtgg tccgttcttt tggcattgtt atgaatgcca     43560
     gataagatag ctgcttcacg ttccgcaagt tgatactttg cagatccagc atccgagcga     43620
     cgttgcgcta gcgtaagctt gtgttctgat atgttgcgct ttttgttctt gatctctagc     43680
     cgtaagtttt ctgttcgact tttaagtagc tttatcctca aggaggatct ggttttctcg     43740
     ttggcgatga tttgaatggg ccaagctatg tggccctcat tcttgagact gagatgtcca     43800
     gagtcaggcc gttccgataa tgcttcaaga atacttgtag aggacactgt ctcattgatc     43860
     tgttgtccta aggactcatt ttctagaaga atcctggcat tttcgattcg gagctgatag     43920
     agctgattgc gggcacagga agggcaaaga tatttaagtc gtgatgttgg agcacgggag     43980
     catacgtgac agctcatccc aagagtacga gttttgatct gatattatgt gtgacgttgg     44040
     aagtatggaa ctgcagggcg ttgaaggcta tcggtgaggc ggccagatgc ggcagatttg     44100
     agtattatga cgcgatatca ttcccacttc ggcaatatta actagtggcc ccgggggccg     44160
     gaactactct ttgtattgtg cttaaatccc agcccccaaa tattaacaaa ggagaaaaaa     44220
     caaagctgct ggtagcgatg ataaaactta aaaaataact acatatgcta gttatcgtat     44280
     tctagttgtc tccgtgtcag cggcaatacg tatctacgta cggagtagta gtatgttctt     44340
     taattggtta cgactgtcca ctcccggccc tggggcattt gtcctctttc taagtttgaa     44400
     gtatctgttg tttacctacc gacaaatacc cgttagacta gcaatactcc tgagctctat     44460
     ccatgagctt ctgcattcac tttcggagat ttcttttaaa aaggagctcg aattcttcag     44520
     tcattgcact cactgctagg ggcggtaaat cggctcatat gtgagccctt ccacttaaca     44580
     tggatacggc ggataagaac gattccactc agtactcgcc acaaatgctt caaggaaagc     44640
     gaagcatcag tgtgtatgaa gtcccgggga atttgacccc gtcattcgaa ggtctcaaag     44700
     attacgactg ggggcgtctc caggagcatt atgccaacgc catggagaaa cacggaacag     44760
     ccgaagaaga cttgcgagct cagatttcga agctgctaga ggtttcttca tcgtatcccc     44820
     tccgcaaaga catactctaa aacttatgtc attgtcatag gtttttatgg cgtggtccca     44880
     aaccactgtt gttcgtgatg aagctagagc gctaaagagg ttcgattgaa agtacgaggc     44940
     tgtagtacga tgtgaggctt attaatcttg atagattcaa aacgcaaatg cagcacgtac     45000
     aaaattctga ggaggacttg gagaagaaac gaaaacactg tatgttatta acactttctt     45060
     acaaagtgac aatgctgttt cctctaactc tccagataga tgtcaatgtt gtaaaggcat     45120
     tcgaaagcgc ccttgcgctt ctgaatgacc gcgtaagacc ctgaaggctg tggttatcta     45180
     tgatagcttt atctccagtt ttcttttttg tattatagga tttgtaatag gtaacaccga     45240
     actcaatcac atagtagggt gcgatccctc ttattgtcac caaacatata caaacatgct     45300
     cacattcagc tggcaacctc atcacagtgg ggtaaaagga gacaagcatc gaggaagtag     45360
     agaaatccct acagaaacct aagctccggc tcggtcgact tcattctgcc ttctcagcct     45420
     actagtgatg tcctcccagg tagtttcagc ccgtcctcta gtgtttgcta gtaggctttc     45480
     ttcttcggcc tcttcagcat cctcatcgag ctgtcgctca tccaatttcg gagagtgtaa     45540
     gagagcggtg accattacaa gtagatagat accttgatcg catgtctagt tagagcctcc     45600
     agtcaaatca tatcagagag gtaaagaatc cctacctagg aaagcgaatt gggcccaaaa     45660
     gaaaatggca ccaaaaaagg gaaaattcat cgttacacgg ttaagaaatg tgctgacaac     45720
     gcttggagtg cagacttgct tggcagccaa actatctgcc acctcagagc atggcctaat     45780
     aagatgttta tcacgcgaac aatccggttg tttttcagaa aagctaagct ctcggtcaca     45840
     gaaagtttgc ggcccataag ttgcgtattg aggggcgagt atcatcgatg ttgagtagtt     45900
     caaagctagt atgatcaaca tcaacatagc cgttgccaac agaagagctt gaggcgatgt     45960
     gtggcctttc cggatttgga agattctgat ccagagaaaa cgaatcccaa ctgcagaaat     46020
     accgacgatg gagctgctga aaaggaataa gacaagcaag gtgaaaatga cgtagtccac     46080
     tgggaatatt ttggcggatt ggacaaagac ccagttgatg gggttgaaaa cattgatatg     46140
     tccaagaatg tatccgcatc gttgtttgca gaacgagttc ttggccttat cgatcgtcgt     46200
     caaaagcata gatatccata taataagcgc aagaagtgaa aaaataacac cggatagcag     46260
     ctgaaatgga cggaatatgg ctccaaattt cagccacaat tgcattaacc aattttgatg     46320
     tttgccgtga gcttcatccg ctaagcgttg tcgacgaata agcgttcgct cttccctaac     46380
     cagggtatcc agctctctac ggtcttttga agacaacagt cccgggtttc ctctgcagcg     46440
     accttctaac tggcgctgtc gttcccgatt agaacacagc tgcacagctg tagtcgcttt     46500
     caatgtcggg cttataactg acgggccttc cttgattaag gtaataggaa acagcgctag     46560
     acccgtggaa gtatataaaa catataagca caggcctatc gttatcagca aaccaagagc     46620
     aaatgtaagg gcacgttcgc cgcctgcggt aggagcctgt tagcaacagc attcgatggt     46680
     atacgatata ccggctgaag gaacaataat tcgaaggagc cccaagctta cggttttcag     46740
     tcagtaggtg tttgaaataa tccagaccgc caccatcccc atctttcgca acaggcacga     46800
     agaatccaac gagaaacagc acaaccacta tcgcaaggaa agagactgtg tatttaaaag     46860
     cagcccagaa ccgctgccca aatgactgtt gttctgtttc agatgccact tcgtcgtact     46920
     cctcgtacaa gaaatagatg aaagggatca caataaggca taggagggcg tccaaagagt     46980
     ataggaagta atacacgatt ttcaagcaca ataatatcct atctacttca ctctgagtag     47040
     cccagtcctg tcgccgaccc agagccggat taatcgtaga tgagaccaga gcaacatcga     47100
     ctggtaccaa aagaacagtt gcaagaaggg tggtgacagc aacgatacaa gtcaatatca     47160
     ccgatggaca gcgatcccga ggggtttggt aagtataaat aaatacagag gccactgcag     47220
     ccagtatagc taccacaatt gcatatacag cccaaataag ggacgtttgt aggagcgcca     47280
     tgttgttgga ttttggatct cacatggaag aggactccgt tcgagggttg aagctaagaa     47340
     gcgattacaa ggaactgcca aggatccatg agtacctaac gagcaatatg caaaatactc     47400
     aaggaatacc aaacatttgc cataacatac caaaaattga gatgatcata tcaagagacc     47460
     atcattgacg gtatcgcgaa gaagttctaa acgcgtctta cgtcatcgta tggtggagct     47520
     tgtgttgatc acgtgctact cccgtagctc caggttggcg tgtgatgtct ctaatgtcaa     47580
     tggatagcac taagcagctt cccttgttgt tgagagactc ttggaataaa tttatttgca     47640
     gcacatgact tagatgctcc cagatttgtt attctgcttc tccattattt atgcaatggt     47700
     ttttcttgca taaaggcagt tgaaaagaca gatacatcag cggggaggaa caagagggaa     47760
     gttcgaacat ctctcagtta attttgataa ccaaatgcag tgttatactg agctcttgcc     47820
     tcctactggg gtcactcact cgttggcact tccttttatc tctgaatcag cgaacaactt     47880
     ggtggttgct agaacttctc gtcttcagat attttctttg cttgatgttg gccctcgacc     47940
     tggaggcatc gaagaacaag gcgtcccaaa gctggtcttg gaaagggaat atgctctccc     48000
     aggtacggta acagatctat gtcgagtcaa actcttgaat accaagagtg gcggcgaagc     48060
     cattttgctt gccttccgaa atgcgaaact tgcattgatc gaatgggacc cggggcggta     48120
     tggcatctgc acaatatcca ttcactatta tgaacgggat gattcgacta gtagtccgtg     48180
     ggtacctgat ttgagcagct gcggcagcat ccttagtgtg gacccaagca gtagatgtgc     48240
     ggttttcaac ttcgggatcc ggaatctcgc catccttcct tttcaccaac cgggcgatga     48300
     cctggtgatg gatgattatg gcgaacttga cgatgagaga cttggcagcc atggattaga     48360
     aagtggcacc gattgtgata tgactaaaga aagcattgcg cacagggcgc catactcgtc     48420
     ttcttttgtg ctccctttgg cagctttgga tccatcaata ctgcacccca taagtctcgc     48480
     ttttttatat gaatacaggg agccgacatt tggtattttg tattcgcagg ttgctacatc     48540
     taatgcgctt cttcatgaaa gaaaagatgt tgttttctat accgttttca cactggactt     48600
     agagcagcga gcatcaacga ctctactttc cgtgtctaga ttgcctagtg atttgtttaa     48660
     agtggtagcc cttcctcctc ctgttggagg tgccctactc attgggtcta acgagcttgt     48720
     tcacgttgat caggcaggga aaaccaacgc agtgggtgtt aatgagttct ctaggcaggt     48780
     ttcgtctttc tcaatgacgg atcaatcgga cctagcactt cgccttgaag gctgtatcgt     48840
     cgagcgtctt tctgaaacca atggagactt acttttggta cccaccaccg gagaaatagt     48900
     ccttgtcaaa ttcaggctag acggcaggtc ggtatcgggc atctcagttc accccatacc     48960
     tccccatgcc ggcggagaca tcgtgaaatc cgctgcttcg tcttcggctt ttcttggcga     49020
     taagagggtt ttcttaggaa gtgaagacgc cgattcaata cttctgggct ggtcagttcc     49080
     atcctcgggc actaagaagc cccgacctca agcacggcac acggaagagg attctggagg     49140
     attttctgat gaagaccaga gtgaagatga tgtttatgaa gatgatctct atgctacggt     49200
     gccagaagtt gtggtagacg gtcgtcgccc ctctgcagag tcgttcggct ctagcctgta     49260
     caattttcgg gagtacgaca gacttttgaa tattgggcct ctgaaagata ttgctttcgg     49320
     aaggtctttc acaagccttg gtggggaaga aaatgccggc aatgactcgg gcctggaatt     49380
     ggtagcctcc caagggtggg atagaagtgg tggcctggct gttatgaagc gtggacttga     49440
     gcttcaagtg ctcaattcta tgagaacaga cttggccagt tgtgtctgga cagcatctgt     49500
     agcgcatatg gaagaagccg tatctaagac caccacgcaa gctgaaaacc gagaatgtca     49560
     tcaatatgtt gttgtctcaa aagcaacgag tgccgagagg gaacaatctg aagttttcag     49620
     ggtggaagga caggaactga ggccattccg agccccggaa ttcaatccaa acgaggatgt     49680
     aaccattgat attgggacgt taataggcaa aaacagagtg gttcagatat taagaagtga     49740
     agtacgaagc tatgatggcg gtgagtttac tctcctgatg atgcctacat gaaggtaatc     49800
     taatgtaata gacctgggct tggctcagat ctatcctgta tgggacgaag atactagcga     49860
     agaacggatg gccatcagct ccagccttgt ggatccgtac gtagcgatac ttcgcgatga     49920
     ctcaacatta ttgcttctcc aagcagatga tagcggagat ctcgatgaag tcgaattgaa     49980
     tgaacagata gcaaattcaa aatggacctc gtgctgcttg tatttcgaca aaactgggat     50040
     tttttcctcc atcagtgcaa cctcagacga gttggctcaa aatagcatga cccttttcct     50100
     aatgacccag gattgtcgtt tatttgtgag ttacggaatg gtttcgagca aatgaagtta     50160
     tatcgttttg cttctagtct gggcacatct aatacttaca acacgtatag atatatcggc     50220
     ttcctgatca gaaactatta gcgataatcg aaggagtcga ttgtttgccg cccgttctgt     50280
     caagtgaacc tccgaagcgg tccactacgc gcgaggtctt aaccgaaatt gttgttgctg     50340
     acctcggaga ctcctggagc agctttcctt acttaattgt acgaacttga cgtatccctt     50400
     gctgaagcat ctttctgatt tacaaggcta acggaaccga tatagatacg cagcagacat     50460
     gatgaccttg ccgtatacag accgtttatc tccattacaa agtctgtagg cgaaccccac     50520
     gctgacttaa atttcctaaa agagacaaat ttggttttgc caaggataac ctccggtgtt     50580
     gaagatcagt cgtcaactga ggaggtaata aaaagcgtac cactgcgcat agtatccaac     50640
     atttcaggat tcagcgcaat attcaggcca ggtgtttcac caggctttat agtcagaact     50700
     tcgacaagct ctccacattt tctgggcctt aaaggaggat atgcgcagag tcttagcaag     50760
     tttcaaactt ccgaatgtgg tgaaggcttt attctcctgg attcaaaggt gctttgcttc     50820
     atacttctct gtttaacata ctgcatactg agtttccata cagggtgtca ttcatgtgtg     50880
     tcaaatgcca cttggtgttc agctagacta tccgtggaca atacagcaga tacctattgg     50940
     agagcaagtt gaccacctag cctactcttc gtcatctggg atgtacgtca taggaacttc     51000
     tcataggact gaatttaagt tacctgaaga tgatgagtta catcctgagt ggcgtaatga     51060
     aagtatgtct cacctgttga catctgtgca gtatgctcac aatattacag tgacctcgtt     51120
     ctttccggaa gtacagcgaa gctctctaaa ggtcgtgagc ccgaaaacgt ggaccgtcat     51180
     cgataggtat gaagctattg cgaaaagtcc aataagagtt actattacta acattgcgtt     51240
     tttctctacc tggaagctat ctattgagcc ccgccgagca tgtgatggcg gtaaaaaaca     51300
     tgagtcttga gatctctgag aacacacatg agcgtaagga tatgatcgtt gtgggaacgg     51360
     catttgcaag aggtgaagac attgcgtcgc gtggctgtgt gtacgtcttt gaagtcatca     51420
     aggtcgtccc tgatcctaag aggccggaga tggaccgtaa attgagactc gtaggcaaag     51480
     agccggttaa aggagcagta accgccttgt ctgaaatcgg tggccagggc tttctgatag     51540
     tcgcacaggg acagaaatgc attgtcagag gcctgaaaga agatggtagc cttctccctg     51600
     ttgctttcat ggacgtacag tgccatgtta gcgtggtaaa agagctaaag ggcacaggaa     51660
     tgtgcatcat cgctgatgct gtgaaagggc tctggtttgc gggctactcg gtaagttctt     51720
     agttctcaaa agacgtgagc caagggaaca atatatctga caatattgcg cttccaggaa     51780
     gagccttata aaatgagcct ttttgcaaag gatctggatt atctcgaggt cttagcagca     51840
     gattttcttc cagatggcaa caagttattc attctcgttg ctgacagtga ctgcaacctt     51900
     catgtgctcc aatatgaccc tgaaggtgtg tcaatttttc tttcctcaaa atagcaagca     51960
     gtccactgat aaggaataga tccaaaatcg tccaacggcg acagactgct gagtcgtagc     52020
     aaattccata caggcaactt catctcgacg ttgacgctct tgccgcgtac ttcagtctct     52080
     tccgagcaaa tgatctccga cgttgatgcg atggacgttg acatcaaaat accacgtcat     52140
     cagatgctca ttacgtccca gaacggatct gttggcctcg tcacatgcgt ttccgaagag     52200
     tcctatcgtc gattatccgc tttgcagtct cagctgacaa ataccattga gcatccatgt     52260
     ggtctcaacc ctcgagcttt tcgggcagtg gaaagtgacg gcactgcagg cagaggaatg     52320
     ctcgatggaa agcttctctt ccagtggctg gacatgagca aacaacgcaa ggtggaaata     52380
     gccagtcgtg ttggagcaaa tgaatgggag atcaaagcag attttgaggc tattagcggt     52440
     gaagggcttg ggtatttgta acggtaggca gcctaagtct gtaagagctt cggaatacct     52500
     accatggaat atcgatatgg aagacagcaa aattttgggc aagaaatata tgatatattc     52560
     gtaatcgctg tatgcttata tctttttgaa atgttcgaga gttttgacgt tcttttctca     52620
     gttaaatatt gagttatgat ttcgaagact aaatgcgcga cttgaagacc aagtactatc     52680
     ctattgtctt cacatttcag tgctatgtaa gacttagtgt cgctccacgg ctattgtcga     52740
     acagagagat acctatcaac cagcaggcag gatcacacaa ggcatctgta tgaaagtaga     52800
     aaattgaacc ctggctgagc cgatggtaac ggaatctttt ggcatacacg cccacaaaca     52860
     taagaataaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaga taatatagaa aagaaaagaa     52920
     aagtaaagta aaaaagaaag atagcttcag acggccagcc gattgtcgaa tttcccttgt     52980
     ggttccttag cccaaggtac cctgatcctt ccacataaca tcatgacgcc agtatatata     53040
     tgtattacac caaataaaga taaagaataa agaacaaaac aaaaagttat tgggagccag     53100
     aaatcagtaa agacgaagag aagaggcccg gatatcaaat ttagactccg tcacgccaca     53160
     acaaccccac agctcgtggt ccttccatat ctgtacatct cgaagaagga acaaaacaaa     53220
     acgaaaaaaa aaggggaggc gggggggggg ggggggggaa gatggtaggc tttaacagag     53280
     atttcatcca aatggagcgt tgagatccaa atctgggacc cgcctaaggt cgacgccttc     53340
     aaaagtggca tgtttccagt attcggcagc tcttggaaga agttggactc tcacctagct     53400
     acaagatcat gcacaactaa accgcctcaa tgctagaaaa cgtcttctgc agcgaagtat     53460
     cgcttacttc tacctcgtgt agcaacgaac ttcatctcag gcatattggt atgatgtacc     53520
     acatgtggtc gatatactgc atccacggga gcttgccagt catccaagcc caatggaaaa     53580
     tattcatata ataaatcggc gctctcgttg ggaaaaggaa gagtcgatgc aaaaggttgc     53640
     tgcatatttg tagtgttcag caagggcaac gatgatgacg tgctcctggc cggtggctgt     53700
     gggattccgt gagaaagttt tcgcatttta gccggcggcg ccgagccttc cgtattgata     53760
     atcttctgcg gagtctcact ggcgtacgag gaagtcggtc gggcagagtc attcaaacgg     53820
     gaaggatcgc caccaccgtc atcatcaaga agtgacaaat ttatcggggc tgctatagca     53880
     ctagcacgtc gttgctgagt ttctgctgtc cgcgagtatt ctggactgga ctgtgaatat     53940
     atagacgagc gaggtagagc tgcagatgga agtgcacctc ctgtagactg ggggatctgt     54000
     gtccagtcag gggaagcccg ttgagcagtg acgccggtct gagaagccga ggtctccggg     54060
     gagctgctct tccctgtagt cttaaacttt gatggaggct gaccagagcg tggagcagtt     54120
     tcactggtgg gcgtacggtt gatactggct gagtgggaag cttgcgcatt ctttctcgac     54180
     gccgcagcac taccgctcag gggcaagtcc ttgcgagatt gaaagttgcg tggactgcgg     54240
     ccccggacaa ttacgggtcc cgagtgtacc tcacagatgg ggattttagt gccggtagac     54300
     aaagttgcga cgacctttag ccgaacaaca aagtgttgtt ggagctcctt tcggcgccca     54360
     ttgttggcag ttgccacacg aaactggagt cgcttccatg ctatcgggaa ggtggcatag     54420
     tctgtatcta gatcctgacc ggccatgata tctaagggaa tcgcgggtgg ttctttttca     54480
     accttgggat tatttgggtt gttcgtcgcg gtagggtggc cgctgtcttc ggttgaagga     54540
     ttcgcgttcg cagcaggggt tttccagggc acagagatga ttttgacaga attgccttcc     54600
     acagactcag ttgccgaaac agtgagctcc tgtgcaagaa tcggtatacg gtcgccttgt     54660
     tctgtcataa tatagcgcaa gctccgcggg agggtaactg agcccgtgat ctgaaacaag     54720
     ttacgacggt aacacgttag ctccgcacct tgctggggcg gagcattctc cgcgggggat     54780
     gttgtccaag gcgactccgc aaggaaaaac attccatgca actgagctga gagtgacagt     54840
     gaagtccgcc gtagcgagta atcaagcagg gtaaaattat ataccggcat cgaaaagctc     54900
     agtagtttat tattatggtc gatggacgag tctgagtgtt gttgttctgc aggcgcggga     54960
     tcaaaaggcg ccaccatgtc agagaaaggg tcatcatatc ccgaatggaa tcgttttagc     55020
     ggtgcggata gaccagtctg ggggaaggct atatcatctc cactaattcg aaaggcaatg     55080
     ttagggctct gcccacaaca gtaatcatcc gtaggacaac gagctactca cctaacaaat     55140
     gtctccgact caaagttgga gcgctgatca ggaagatcca tgccaggcat agagttgagg     55200
     tagtcggcgc cctgaatatt gctgagcgat agcgggctgg ccaagtacgg catggccatg     55260
     gtatcgaagc cctccatggc gagggttaaa cccaattaag atttgcaaga tcagcaagac     55320
     gagagaaacg attgcctgtc tctttcacaa ataacaggga agcgaatcaa accaggaaag     55380
     gagatgttga gggagatagg tagttggaac aatcaactct gggtgaagag cgtaatcgca     55440
     atgactgcgg agaacgcgtt aggagctaag gaggagatct cataaagggt tcgaagtcca     55500
     tgtgatgaag tacacgatag taataagaaa aataagtagt agtgatagta gtagtaatag     55560
     gtaacaaaga actaaaggaa acagaaggta attgagagga ggggaagaag gtagatcgag     55620
     ggaaagcaat cacttgtagt aaatagtgat aggtgctatg aaggagttgt tgagtggatc     55680
     agactgcccg aggtcagtac agagtagtct gtggagcttg ccgtgatgtc tttttctcag     55740
     aaaaaagaaa agggaaaaaa aaaaaagttg gtccggaggc agtcaatcta agtcaataaa     55800
     gatagataac agaagactaa agacggaccc ggcgacgggg cggcagcagt agccggtgaa     55860
     gaggggcgga agagagggaa aagtgcaaga tgttcaagga ctttggttca ctaacgccca     55920
     cttttctcct ggttcaaggt tggtaactta gtttaaacct ggacaagtca aactaaggta     55980
     ccaacgaatg aaggatgaac tgatgggttc agcgagtgtg gatcacaaaa gcagactagc     56040
     agaccactag aaaggtggag gagaagagac gaggtggagg ggagatgata taccgagcgg     56100
     attcttgaat atcacttgtg gagactggag agtggccaaa gacgaagtat gaaaagaaaa     56160
     aataaaaatt aaaatagaga taaaaatgaa aatgagaaag agaaagaaag acaagagaaa     56220
     agaaaaggta aaacagggaa aagaagagca gcaaacccga ccggagacgt acccagattt     56280
     aaagatggaa agaaaagagt agaaacaccg ttttcccttc atgctcaaag ctctctattc     56340
     aagaatggat gagatctccg tgatttgtct agccctcaac ctcttctctt cacttttagc     56400
     tatttcatga aaaattcaaa attttctaga acaggggaaa tccaccaaca acttgtagcg     56460
     tccacaagga ggaattatgc tttagtctct gcggcttatc cgttgtgctc caggttggtg     56520
     gtttggtcat ctgagattgg tttgtctggt ctgtatttgt attgtacgta cgtacattac     56580
     ctacggtacg tttctcgatg catatgtctg agctttggat tcttgtccta tccttatttc     56640
     taaattccct tttcttttca taggtcaacg tttgcagcta ttaatttcat tgaccatgag     56700
     ccgcaagagt tgaacgtccc ggttgttacg gttcttgggt cgatattggt caaccatgga     56760
     aggcggaagg cctggtactt gtcgaaagat taccccagtt tggcagttaa ggacctgccg     56820
     gattaggaga cgctgctttg ggaagcatag tactagtcta atttaggaat gaccccaccg     56880
     aaacccgggg gaatctgcct ttatccttcc ctttttatgt tattcttttt tcttttataa     56940
     ttttttttct ttcttttctt tttttatttt ctcaaatctc tcatgtaaat taatagcttt     57000
     gggttaccaa ggctagacta gggatgaatc atccttttat tttctcatta gacttaaaag     57060
     ttccgcggtt aacctcggtt ttattttcaa ctaggttgtt cagaggagtt aatataaaga     57120
     ggtattgtac gcagttttca gtagtatttg ctgatagatg ttattactgg ccttcagcca     57180
     atgaatttgg gcagaaacaa cttacaatgt aattaattgg acaatagaac cataagtaaa     57240
     tactaaggat aggtcctgtc agcttgtcgc tctgttctga tcaccctttg agtgctccat     57300
     aacacgagcc aaactaaggt agggtctctc acctgcaagc taaaccggag gatctcaagg     57360
     ctgacagtgg aggtccagga tatatcgatg aatgcagatg ttgcgagttg acataaacag     57420
     taaggcgtag tggataccta cagtccatgg gtaaccgtgg gtggtacact agtacagcac     57480
     gatactatga tacaacttaa gtacccatca gtgtacaata atgagaccaa tagaaataat     57540
     catagtaata gcaattggca acacttgagt aaaatcgtga ccatggcctc attataccct     57600
     ccttgagctg ctttgacaac tgacgatctg catgtggatt ggagactctc ccaggaaaag     57660
     ggaaaaaaaa aatttttaca ccaaaaaaag ggatcagtat aatcataaac cagagtttgg     57720
     tctccgcctg atcactcgct gttgcacacg ctgtattcca tacttgagga gagatcgatc     57780
     aatattgatc tcttacatgc agccgagaca cttaattccc ttttctttta ttttcttttc     57840
     ttttcatctc gtcttttctt ttgccttctt tcttcgattc atatccttgt ctcagccttt     57900
     tctgcttgta tctttagtgg ggaaatgtta gggaccccgg catgatcgac tcatcgacta     57960
     ctcttactgc gccttgttat ctctgtccgc cgaataaacc tctatcgtag aagcagtatc     58020
     agaatggtat ctatttacag aaagaccaca ttcgggaaag gtggttcggc atgaggattt     58080
     gcgattggtc cgcagtcaaa gcttaccttg agcggtgttt caaatttcgt tccatgctta     58140
     atatttatcc aacttagaag aatatacttg gtggcatgca tttgttggat gcgggaatag     58200
     ttggtggtaa gattggacat agcagagttt tggcctaggg gaacctgaga aattcttggc     58260
     ttacacagag caacgaggaa tgacagcctg ttaacagatt taatcatccg agaactccgt     58320
     atacccacag gtcaagatct ctccgtcagt ggaatggccg gggagcgtag gctatggcct     58380
     caccacacta ctgtagctta tacattagct ccaaccctag ttgattggta tctactgtat     58440
     agttcggagc tggccatgag atcttaggac taggtgccaa gagaagaagc cacagcatta     58500
     aacgatattc taatgcacgc acatgttagg caccatgtcc tctctagcta ccctatcagg     58560
     ccattgaaca tctgggtcgc ttccagggtc taacacgcga gaccgaaaac agctagcacc     58620
     tcaatttcag tatttacttt cccagctctt tctgacctac agcctctcac gatgggggcc     58680
     aaatcgatag gctgaggctg tgattgggca agactaaaga tgtatgtctc agactaagcc     58740
     gacgaggccg gatcagccgc gcccttaatt cggccatggc cgccttagtg aaccaaggga     58800
     ccactcatgg ccgaagctga tttgcgagtg accacagtcc agttataagt cgtagtaagt     58860
     agtaccatag taggacttcc gtagtaggta gttaccacct gtgccccctt cacattcttg     58920
     cttctttaca gcttctgtat cgactcgtag gtacttttac gaaataacgc tctccacagc     58980
     ccgggcttcc tcatcgatag gtatctcttt ttaagcaagg aaccctgtgt gctggctcta     59040
     gtgctcagaa aacgacaagg ctttgtccat gattaatttc ctcctacact atcatgctcc     59100
     gtatgttcag gattaccaga aagaaagttt atcaattcta gcatgcttct agaacctctc     59160
     ctgccttact gaagggtggc ttctcttcac tagaacttta ttcatgtgac cgccccttct     59220
     tgccacagac tttcttggtt tgaaaccacc gagctgcatg ggtctcgcaa gtatctcatg     59280
     ataggaagcg acggtgaggt tgtggcacca agtggcgacc aagtggtgtt tcctttcgct     59340
     tcaaattctt tagggtgtat aaagaccatt catcatggct actaactagt ataacttcca     59400
     tacatatgcg gacatgctcg attgtgatga gtgataaaca tggaccgaag tattattagt     59460
     agagctctct atctattcag gagagtctga ggcaagctaa acactcggct tatatcacca     59520
     tcctgtatgc cacgctaaat ccggattttg gtggcaaata gttatgaaca ttgcgtcaag     59580
     agatgtgcag ttcagcgaca gatcgttcct aaggggtaag aaaaaataag attgtatggt     59640
     acatcaaggc tcttggttga ctatgggggg agttcttcaa aggctcgttt gagatccttg     59700
     acaaccggta aataacgcac cgttgggatg gtggattctc tcgacactta gtgtctaatg     59760
     aagtacactg gatagatacg ggcaacacca ctgctggggg gcacggaggg gccttacttg     59820
     ttaagtatgt acacagtagt atgggcttgt acacccagca actctgtatt atactgtatt     59880
     gcacagcttc tatctcagct ccatccttgc cagcacgact acaaggaatt tggtataact     59940
     tgctgtgtcg tcatctttgc cgttctttca gtatcgaaat ctggtccctg aatatcctgt     60000
     attgtgtgat tcagcccgtc cattgggcca ttgacaaagt ccgaggcatg accctcttta     60060
     ttgcagcatt gtagcattcc tcaattcttg aaggggaaaa ggagaaaata caataaaata     60120
     acgttcagga ccctcttctc ctgttctctc tcttttttcc ttcattcttt tctcactttc     60180
     ttcgttccca aaaaataaaa taataagaat agaattggat ctataaaaat agatttcaga     60240
     aaaaaataca taacgacgtg tagaacacaa gtaattatca ttagatattc tttttttatt     60300
     ttgatttcta agagaaccaa agaagaggaa gagggaataa cactacggag tagtgttgat     60360
     ccacttgtcc cgtactatcg caaatccgca aacggtccat gcctacggtc ttgagcaccc     60420
     gacattggcc agtgacttga ctccgcatca cctaaattaa actaacccac cgtagaatta     60480
     gtggctcggt agaaagtatg tccacgggct agactcgcac cagtcggctt gaacggactc     60540
     aaattaggct ccgaggccct gaaaacaatc gctcatcgtt ttaggacaga accacctcgt     60600
     caatgaaagt aggaaggaat aattgtttgc ctcaaaccgt atgaaaaaag tgagtccttg     60660
     actatggatc tccatgaaac atggttgttc ctcatgtctg atgctatatc tacctgtact     60720
     ataattcttc atgttgataa cgtctatagt agccctttga aaattaggta aggcaaaaga     60780
     gtatctgtcg ctatcaggat catcgcaaaa ctgtcaatcg gtcaacccgg ctctagacgt     60840
     tcagtaattg gtcgtctccc caaagtcgga tcttggcgcc ttttacttcc gaggtcaaat     60900
     tctaagttat caggaatact tttgctaaga gaaacttttg tttattttat tattatcatc     60960
     tttcaagggt aaagaaataa ataagaaata aaaagatagg gaaaaaagac cctctaatta     61020
     actcgctctc cacctactaa tcagggcccc cattcgtgtt cctgcgccaa taccagacag     61080
     cgcgtggatc atccgaaatc cgatctgctt cgctctctag gcacccatca aactccatcg     61140
     caaaattccc ttgtatccct tggactgccg aaacctgggc ttgaaacaac cattggacat     61200
     gtgctcgtat atgaggaccc atcgtaccat ccttctagca ctgaaacaaa tctccgaaga     61260
     gcatgggatc ttccaaaata tatagagtta attagataaa catatactaa aaagtaatag     61320
     ttcccaaaag ctacaggatg gtggaaacct aagaaagctt ctagtaacag aaaccagtac     61380
     atagtggata tcatgtggcc tcaaactgcc tcaaactgcc caaacaataa gaaaagtgga     61440
     agtcaggggg gagaaagaca gaagaagaac gtaaaaaaaa cagaagataa cgagagacgt     61500
     atcgaaatgg ggaatattct aagacgcggt catcattgtc caggtcgcag cgtcacagtt     61560
     aacttcctca aagctgtgta gcgtactaaa gcccattatt ccggatagac tgtcaaaatt     61620
     gctgtcaccg tcaacctgtt acaagtgtca gtataaaggc taccaaatgg tttaggagag     61680
     gcgctatact tacgcaatcc ataatgacgc tatcagcacc ctgtttacgg tgttgtttga     61740
     ttcccatgaa aatcagtccc tgcattactg tggcatactc acccacagag ggtgatataa     61800
     ctggggaaga aatacccccc gtggacgaat gcatggcttt cagggcaggc atatgctctg     61860
     ccaacgtggc tcgtccgttg taagtgacca cgctacctag gattgcccca tcaccaggcc     61920
     gcgtagcccg gataatcccg caattgggcg ctcctccaag ggctacttta tagatgtcta     61980
     tgacgccttg tctagagtta gttttaatgt ggtcaaggat tgtgtccgca taatcccatc     62040
     catatacgag gtcgtagacc acatccgcat tctgcagtcc ttggatgagt ccatttggcg     62100
     gcttccaaga tgacaagcta cgcaacacca cactacaaac gggccgcgag agggctgtgt     62160
     tccagcctaa atttgcaaac cattgccgca gcctctttct ctcaacaggg tttgcagacg     62220
     gaatacctag gtatatcccg ggcaagcgag agccgagctg gaacctcttg accccttttc     62280
     gctggacgag tgttcgaata gcgcggttgt ggagggaagc cccaattgat agcttccgtc     62340
     gtgccgggtc gacaatcaag gccccaatga cgccggtgcc tgttgatcga aagaagtatg     62400
     tcgagcagaa cccgtacagg gcttgggtgc tgctgtttcg tacaacaaaa tgtgcttcat     62460
     caatttcctc tctccgcaga aggaagctgc aagatgtcac acccagcagc tccgagcgtt     62520
     gcgtctgagt acagtcctct ctcaccgcat ctaagaggga atccaaagca tgtgagtccc     62580
     gttcttcgtt ccaattctcc accagccagt gctgtcttgc ttggtggagc ttctggctgc     62640
     gattaatgga tcccggcaat gagcccatgg ggattatctc cccgtaaaga atcttaacca     62700
     gtgcctctag agccgtttcc gtaaaatcat aggtgcaaat ataagtcccg atcgagggat     62760
     ccattgcgaa atcgtatggt gagctggcag caataacgac cacgggcttc tcacgagatt     62820
     caccggacgg cgtgaactgt gaccgacaaa tcatagatac atgcttggta aagccatatt     62880
     ggtattggtt tctgttagca tctgcagtga ctacgataac tgcgctggcc cggtctatca     62940
     agttttcgtg gatcgggcgg acgccattgg ctgtgtagga ggtatgcaaa acacgcccat     63000
     ttctttgccg tgatagtgac ctccctagtt ccctgaagac actctcacca ctcaacacag     63060
     aggaagtccg gtcccaggtc atgggctcaa tagataaatt cgggtgctca gtgactgaac     63120
     gagacactgc agaagcgggt aatggcttga ccaatggggt cagaagcagc aattcctcac     63180
     tgggctcaat aatgttggac aggggtaaaa gagttttctt atctcgaacg acagtgatag     63240
     agctgttgta cgctctcgta gagagagtgg tatgggaagg ttgcatctgg gtgagtgagg     63300
     aaagacccgg aggattgaga gcctgttccc aggaggtgca tttcgccttc aagctcaaaa     63360
     ctctgcgtaa tgactgttct atacgagctc tgccaatgat accgttctcc acgccaagtt     63420
     ttaacccggt gatcgcctcc tgctgcaccg ggaatgacct gcagagaaga atgatgtcgc     63480
     agcccgcctt ctttgccatg actgtcccgc cacccacccc gatattatga gtgagagctt     63540
     ccatctccag gcattctgaa actaccacac cgtcaaattt catcttcttg cgcaacagat     63600
     catcgacaac ctgctcactc aggcaagcat gcatcacgtg aaacccagca gacgacatgg     63660
     agacacctcc caccatcatg gaatcaattc catggagtat ggcatttcga aatggaacta     63720
     gtgcgctcaa gctgagttgt tctagcgact cggtgatgat agggacgtct gactgggatc     63780
     caagaaattc aaggttacca tatgatggga aatgtttgcc acatgtcacc aaccctgctt     63840
     ccttataccc tttcatgaat tctactccgt attgcgatac ctcttgggga tcatcgcccg     63900
     tggtacgaac ccccaagggt tggcttcgca cattggtcaa gacatctaac acggggccca     63960
     gaatccagtt aattcctaca gccttcagtt cctgggcagt tgcaacagcg acatcatggg     64020
     cgagagcttt cgagcccgtc gcagcgatac ccattgcgct gggaaattgt cggatgtata     64080
     tttcatcgta gagactgttc acacctccat tttcctggtc caaggcgatg agtaatggca     64140
     ccggatgacc ggcatcccga gcgattgtct ggagttcgag gactagtcgc gtggcatctt     64200
     ctgcagctag aagtaaatta gtggttatcg tgtatgtgat gcggccgtag gacggtaaga     64260
     tagacactag agaaaaatga acggtgagag aggaaggcag agatacattt caaattcttg     64320
     gcagtcagta ggattgagcc caggtgataa ttctcaatga gagagcgaat ctgaggatca     64380
     acggacgttc catcaaagcc catcataaag agctgcccca tctgcctgtc aggaaagcca     64440
     ttgtactcaa atcgttagcg aggatcattt gtccggtgaa aggaaattga gttcaatgta     64500
     gcagataaag aatcaaactc tagcaaaaca gagacgaaag aaaaaggaga aggaacaata     64560
     aaaaataaaa aaacaaataa taaaaaaaaa aaacaagagg gaaaagaaaa gaaaaaggga     64620
     aaaaagacaa ggacggactg caaaggcaaa aggtgaatag ctgcaagtcg cgaccactcc     64680
     gcaagcggtg gtgcacagtc cacgatggag aaccgcgtgc cagacggaat tgctgcatac     64740
     ctgtctagat catcccagcc agggggcagc atgtcctctc ttggggccat gagggccctg     64800
     aataaggaat gccagcttag tatctaacac aacgaaatgg gcaaaagtga tatggcccac     64860
     acagtgacca tcggattcaa agatcgatat cgggtgggca aaagattagg ttgggacaca     64920
     cgccgcaaac gatgtcggag aatacggcaa gggctaaaac cggtagttgg atactacaaa     64980
     tcagctcatc cgagcatgac caggggcaaa ggactggact gtgcaaggct gcaagctatg     65040
     aacagcaact tcaaagggtg gtggtcagtg cttgacgaat gataatgcat ggaaggtgtg     65100
     gggtcgagaa ggagaaagat ctcaagcaag aacagtatag tatcaaaggg gtactggatt     65160
     tggtagaaaa aatttggact tttgttccag gagagtagct attggtgcaa tgaccatact     65220
     gacactccca gaaaataatt tttcccctca caatactcgg agtactccta ggttgttaca     65280
     tccttggcag taatggatcc cgaaatccgt tgagggcgtt gatactgaag gaaagcccga     65340
     tgggttcacc tggttagatc acgtgtagat tttgtcttcc ttgataccgg taattcttgt     65400
     cgaaccatac cagactgtca taacagcttt aattactagt caatacgtgt gtattatcct     65460
     aagattacac aaaaatcccg cttacccaga gagtcccgtc aatcgatacg acgccacagc     65520
     agataagaga gggttgcatg ggggctccga tcccttcccc cggtttcccg atcctaccga     65580
     atgcaacggc actgtcaagc aattcggact gtgatttgcc attccactct aggcttagcg     65640
     gctccgtgca gcttcagttg atatctgtac tatgccaccc cctcgtgcaa cattacgtcg     65700
     aatcttcgct gtttcctggg tagctagggt acgacccatg acaaaagctg ttcatttcct     65760
     gacgcggata ctactggttg attggatact ctaccatagc cagtgggaag tgtatgcgtc     65820
     atcagttcac tgcaacgatg ctactctttc ctcagcaaca atggtattga acatgcagga     65880
     aggcgaagag atggggtctt agttcctggc agagtatgat accccgttgt atatcgttgt     65940
     ctattattca tttggaggta ctgtatgtgg attactatta ctctttccgg cacgggcctc     66000
     cagttgcttt gtggtggaag aggcatgggt caagtaacat tcattactca tggttagagg     66060
     aggggaatga aaatcaaact gtgataacaa cagtggaaaa ggcagtatca tgccgtcaca     66120
     ctccacagtc gatcctaggg cctgacaggt aactgtaacg ggctcattag tggatggggc     66180
     agatggccac ctcgactttc tcccatatta cttgcctcct tgtcccacaa tcctcttctc     66240
     ttcttgcagt tcataattcc ttctgctcca agatctcttt ggttttcttt tccgtaccaa     66300
     gcatctttga ctgcctggca tatatatcct tcatccttaa cttcaaaaaa gaaaaagtcc     66360
     caggtttatc cgaagactct cagctctgcc gcactgcgtt atcggtgacg tagtcttgtt     66420
     catcatgtat ggcagtatct gttgtccctt aagctgggtt gaactaggct caaagctaac     66480
     cacgttcctt ctatgtactc aggagagtga tcatcagaga aaccgccttg gaggcttcag     66540
     agtatatcgc cgattatatc atcagtatgt cgttgcctca gttggaatgc ttgggttttt     66600
     tctaactcca caccctcaca ggtcgtatca aagcctttaa gcccacagag gatcaacctt     66660
     ttgttcttgg ccttccgacg ggtagtagtc ccgaagttat ctacaagacc ctcgtgcaac     66720
     gtcacagagc aggagagatt tcctttagga atgtcgtgac cttcaatatg gtaggttcct     66780
     ttcatatttg ctaaaatcat accctctatc aatgaaatca agtcgtgtgc taaacatcgc     66840
     aggatgaata tgtcgggcta ccccgcgacc accctcaatc ataccacagc ttcatgtata     66900
     aacatttctt ctcccatatt gacatctcgc cccagaatat caatatcctt gatgggaacg     66960
     cctctgacct cgctgctgaa tgcgcctctt ttgaggcaaa gatcgcccgc tgcggcggta     67020
     tcgagctctt cctgggtggt gttggccctg acggacacat cgcattcaac gagccaggat     67080
     catccctcag cagtcgcacc cgagttaaga ccctggctta cgacacgatt ctggcaaact     67140
     ctcggttctt tggcggagac gtggacaagg taccccgaat gtccttgacc gttggtatcc     67200
     aaactatcat ggaagctcgg gaggttgtta ttgtggccac tggcgctcac aaggcactgg     67260
     cggtggaaaa gggcctcgaa ggtggtgtca atcatatgtg gaccctttca gccctccagt     67320
     tgcatcagca tccgctgatc gtatgtgatc gtgatgcgac actggaactc aaagtcaaga     67380
     cagtccgcta ttttgaggcg attgaacaat ccggtactga tgcgcgtact caagggccgc     67440
     ctcttgttta ccggccgagg acctatgttc ctgctcctat gggggcgagc aaaacgaatc     67500
     agcaacccac cccagcgtca acaccgccga gggttcccaa ggacctgaga atcaatactc     67560
     agctcaacca gacgttagat gacgaggagt tgacgcctga tagcatgtct tcccgaatgg     67620
     tcgactcagc catcagtgga ctcgactcga ccttgaaggg ggatctgatg ttcgatcgca     67680
     tgggcactcg agttatctct cactgaccaa acacggcacg gacccacggt cttataagac     67740
     gtgcactgat ggctgggcga aagcgttgcg agctggtacg ctgctctcga caaagcacgt     67800
     gtgccataag taaatttgcc ggtaaagcac tatcttgtct catttgtttg gagtagggta     67860
     cagtttttga tttgatagcc tggatggacc taccgggaaa cttggttctt gatttatttt     67920
     ttatttgtta ttttttattc tctgcttttt ctttaccaat attcatagac ggtctggttc     67980
     taggtgtttc tatccttact taacgaactt tttcatgaag aatagattag acaatattgt     68040
     gatgagtttg tgcttgtata aaactttgta acaattttgt cattgatgtc gtaaagtgtg     68100
     ctttgcattt atggttcatt tgtcgagtca tttatatacc acggggcgct tcgaaaagta     68160
     atagacataa gtgatgaccc caactatttt tgaaacatct atgggccagt cattggccta     68220
     gagcttagca aatacagttg cgacagcacc gttcatgtcg acaagggtgc tcttgttctt     68280
     cacccaagct tcaatacccc tacggccgtt ctcaacgcca agaccactct tcttccatcc     68340
     acccacagcc atttcggccg ggctttctcc ccaggtattc acccatgtga tacccgcctg     68400
     gagttggtcg ataatgcgat gggccaagtt gacgtctttg gtgaagacac ctgctgctag     68460
     accaagctcg gtagtgttgg cccgtcggac agcttcttca atggtctcgt agtacaaaat     68520
     cgacattact gggccaaata tctcttcctt gacaataagc atgtcatcct tgcaatcagt     68580
     gaaaattgtg ggccggaccc agaatccgtt ctctaactcc tttgaaactt gaggcttgcc     68640
     aagcccgcca taaaggaggg tggccttgtc cgtctcaata ccatgacgaa tataggaaat     68700
     caccttctca agatggatgg cggagctcaa gggaccgaag ttggtagctt catcaaacaa     68760
     ggggccgggg cgaatgtact gcatcttttc gagcaggcgg ttctcaaaag ctgccttcat     68820
     gctagaaggc acaaacacgc gggtgccatt ggtacagacc tgaccggtac tatagaagtt     68880
     ggccatcata gctccatcga cggcgttttc aagctctgca tcagggagga taaccagagg     68940
     gcttttccct ccaagttcca tggtaacgta tttcatgttg ccagcggcgg aaccggcgac     69000
     cttcattcca gtggccacct ggccagtgaa ggaaaccttg gcaattgtag ggtgggaggt     69060
     caagtaagca ccaacatcac cggcgccata aacaatgttg aacacaccat caggaagtcc     69120
     agcttccttg taaatctctg ccagagtctg cgcatgaagc ggtgtgaact cactgggctt     69180
     gtagaccatg gtgtttccag cagcaataca aggggcagat ttccagagcg cactgtttca     69240
     gttagtcacg attcaaattg tggcgcgggt aaaagttgcg ctggcaatac ccaattggat     69300
     gtcatacatt tggataggat aattccatgc accgattcct gcgcagactc ccaaaggagc     69360
     cttcttagtg aatacccaag cgtcttctct cagctgagtg gtctccccgt tcagaccacc     69420
     ccccccaaca aggttcgcat agtactctag aacatcggca cctgtgacaa catccactgt     69480
     actggtctct gtgaaagcct tcccggaatc taaagattcg acccgagcga tttcgtcatt     69540
     tcgttcacgg agtatcagag acgccttctg gaggatacgt gcgcgagcaa taggaggggt     69600
     ttgtgaccag gagggaaata cccggtcagc agcagctata gctgcatcaa tatcagaatg     69660
     agaggcaact tgaatttcgg caagcggggt ggcgtcggag ggattgacgg attgaaaagt     69720
     cttgccggac gaggcagact gaactttgcc gtcatagaag agttggcgtg gggggagagg     69780
     aaggtaggac attgtatgcg ccataaattg gactggtata atattagttt tctaagaggg     69840
     aggaggtgag gagaagagga gagagttcgt atgtaagacc tccagttgtg ctaatttata     69900
     tcatactacg gactatggta tctgcacaga gtgacggagg agggaaaaaa aaaatgttgt     69960
     caggaatgaa gaccttaagc tttacgtatt ccagaccgcc aaagctgtga ttcgctaccc     70020
     ctcacctgta tctgggtact acttacatta aggcggcagg cgatcggcgg cggcaaactg     70080
     aagagcaaaa ataacttttt tgttctcttt tttttccttt ttctcttctt ttcccgcctt     70140
     cttcctcttc ctcctcggga acccccaaaa ccaggggcaa caactatcaa acatccccga     70200
     cttgtgaatg gaagaaaggc aatggattct tctacttatt tcggaattct tacgaatctt     70260
     cccaaggcga tcattcatcc aagggcagtg ctatctcaga attcaattgt ggatattctc     70320
     cgttgagctg ccttgttggg ttaacggttg gcccgtgcat tagttcgtgg cgtgttttag     70380
     cgcgaaacct cgtgtggggt ttgacgtagt gaagcggaag agaagtttcg tagaactgca     70440
     tatggaaggg acgttttaat cgcaatatag cgagtcgtgc ctttgctatc agctgatagt     70500
     agctccagtg gatatagaaa gagcagcagg gacttaagag caccttttcc gatttatcgg     70560
     gtgcttcatc gtcgaattct cttttgtatc ggaaattcat ccagatggtt ggatactgat     70620
     caaagattcc cgatgcatat tccctattaa ctaatctgta gtggcggctc cactttcaag     70680
     gcttcctttc accgccattg gctaactcat tctttccagg tgacccgccg aagggatcca     70740
     aaagtaggta aagattggaa tcaataaaaa aaagagagag aaaaaaagag tctatctgta     70800
     agaaagaagt ggtggcctga tggccgacgg ccgacggcct ccatcaccgc atcttcgtcc     70860
     tctaatttaa aagtcgaggt tatctcctct cttttttctc ttcttttttc cctcaaacca     70920
     catctcctct tctctcaacc ttctcccctc ttacctatat tttattgtgt ctttctttta     70980
     acatggctac cacaaatgat tttcccgcta gcgatgtcaa cagctatgac tatatcatcg     71040
     ttggaggtgg cacggcaggc tgtgtcattg ccagccgtct ggcgcagtac ttgcccaaca     71100
     agcgtgtcct tgtcatcgag ggtggcccca gcgacttcaa cgatgaccgg gttctcaatt     71160
     tgagagagtg gctcaattta ctgggaggag aattggacta cgactatccc actaccgagc     71220
     agcccatggg tatgttgcac cccgctatct tttctttcct ttgtgtgtgt gtatgctttg     71280
     aacctattgg agcggacaca actttttgag gagatttgga aagaagaagt ctcagttgtt     71340
     aactttcttg acacacaggc aacagccata tccgtcattc gcgcgctaag gtcctgggcg     71400
     gttgctccag ccacaatacc ctcatctctt tccgtccttt tgaatatgac tgccagaggt     71460
     gggaacagca aggttgcaag ggctggtcct ttgagacctt cacccgcgtt ttggacaacc     71520
     tccgcaatac cgttcagccc gttcacgctc gtcaccgcaa ccagctctgc aaggactggg     71580
     ttgaggcttg ctccaccgct atgaacatcc ccatcattcc tgacttcaac aaggagatcc     71640
     gtcagaatgg taagcttact gagggcgttg gattcttcaa cgtttcttac aatccggacg     71700
     acggccgccg cagcagcgcc agcgtcgctt atattcatcc catcctacgt ggcgaggaga     71760
     agcgtcctaa cctgactatc ctaaccaatg cctgggtatc ccgcgtgaac gttgaaggag     71820
     acgctgtcac cggtgtcaat ctgactttgc agtcgggcgt caagcacacc ctgagagcca     71880
     agaaggagac catcctgtgt gccggtgctg tagacactcc tcgcctaatg ctgctctctg     71940
     gattgggtcc tcagaaccag ctcagctcct tgggaattga ggtggttaag gacatccctg     72000
     gtgtcggtga aaacctcctg gaccacccgg agagtatcat tatgtgggag ctcaaccgcc     72060
     ccgtgcctcc caaccagacc accatggact ccgatgctgg catcttcttg cgtcgcgaga     72120
     ttcctaacgc cgccggttct gatggccgta gcgccgatat tatgatgcac tgctaccaga     72180
     tccccttcga tcttaacact agtcgcctcg gttacgacgc tcctattaac gctttctgca     72240
     tgacaccaaa cattcctcgg ccccgctctc gtggtcgtat ctacctgacc tcagctgacc     72300
     ccaacgtgaa gccggctttg gatttccgtt acttcactga ccctgagggt tatgatgctg     72360
     ccaccatcgt tgccggtctt aaggcggcac gtgagattgc ccagcaggct ccctttaagg     72420
     attggatcaa gcgtgaagtt gcccccggtc ccaagatcca gactgatgag gagctgtccg     72480
     aatatggtcg ccgtgtggcc cacactgtct accaccctgc tggaactaca aagatgggtg     72540
     atgtctatcg tgatcctctg gcagtcgttg accctcagtt gaaggtccgt ggcctgaaga     72600
     atgtccgtat tgctgacgcc ggtgttttcc ctgagatgcc cagcatcaac ccaatgttga     72660
     ccgtattggc cattggagag cgtgctgcgg agttgattgc tgaagaggct ggatggaagc     72720
     gtgagcagcc ccgtctgtaa acgcttcacg cttctttttg tccttaaccg agatacctcg     72780
     ctgtttgcga aggcgagtat gtaggaaggg gggttatatg agcggcattg aatttattca     72840
     gatgtcgcac gattgatgac ttatgtccac aacatcaaac tgagaagacg aaagacgcaa     72900
     aaaagaaggg gttgggttct gcatcgccac atattgcact gttggcatgt agagatgtgc     72960
     ttaaatggat aaggtaattg tattgcctat ccatatcttg tatccctgta cttgttccta     73020
     tggtttttga gcgatcccat tgttagcccc tgtatgtagc gccatcatac tccaagataa     73080
     aatatataaa agatttcaaa ctgagtgtcc gtctacataa tcgcttaatt ggtagtaaga     73140
     gcatgtcgaa gtttaaaaga caaagactca catgataaag tggtcaccac tggtaccggt     73200
     tattctccaa tctgtatttt gtttcgtcta gattgtatga aggcttctat agtcttggtt     73260
     ctatcgtgaa ttgctcccca aagtacaaga atgacggcta caaggtataa atgaaagtaa     73320
     tgaacgacac caaaaaaaaa cacagatcat cacgctgttc gatagccctc aaaacaaaga     73380
     gacactcgaa aataggaggt agccatagaa gaagaatagg ataagtatgg taatccaacg     73440
     ggcaattagg agggatagca taatcacaag ctggcatagc atagcatgtg tataggactc     73500
     tgaaagtgtt aaaccctact gttggtagct tctttctcag catcataaat tttgacgccg     73560
     cgtttccaga cttgatcgat tgtcaaggtt ggtccggaat aaggatctgg tgcgtcagtt     73620
     agaacgacca gatctgcatc tgcatcacag tccaatgttc ccttgacacc ttcaagtccc     73680
     aggagacgtg cgggtgtggc agtagccgca ttcagggcct ccgcagttga cgcacccgac     73740
     catcggcgga agttgttcac acattcaatg agagtggcag agctgcctgc aatcttatcg     73800
     gagccttcaa gtgtcaaccg tgccccggtc ttgacaatgc gctctccgtt ggtccaatcg     73860
     tagacaccat ccgggagacc gcacagcttc atagcgtcag tcacgaggat cagaccgttc     73920
     ggatgggcgt tgtacgcaat gcgaattgag gtggggtgga gatggatgcc atcggcgatg     73980
     acaccataga aaggtcggcg gtgttcattt tgacccagaa gaccgaacac gccagggttg     74040
     cgatggtaga agggccgcat ggcgttgaaa agatgggtaa tcatggtcgc gccttgtttg     74100
     gtggcgctca tggcttgctc atatgttgca tcggaatgtc caattgaata gatgatatct     74160
     tgggcggtca ggttgggaat attgttgacc atgctgccca cctcgggggc agccgtgatc     74220
     attcttacag tttttgacgg tccgaacatg ttttccttgc catagcagcc aacaacatct     74280
     tcaaaactct tcgcggcacg caaaacatca gtcttgtgga tgccattgcg gccggggcta     74340
     ataaatggac cctctacatg ggcacccagc gactctgcac catcttctgc tcgatgcttg     74400
     gctccagaag gacctaacga tgggaggacc tagagaatat gttagaagtt ttgatattta     74460
     tcttagtatt tgcatatatc ccctatcgaa gggcaataag aggctagcag ctttaaagaa     74520
     agttcggaca tactttccaa tatacctctg gtgttgaact aacgacggtt gggagatatg     74580
     atgtcacacc ggttttggcg aggcccttgt tgaccatgcg caacccttca tcatattcct     74640
     cttttgaaga ttttgggaca gaaaagtcaa atccctgggc accgtttaac tgcacgtcga     74700
     taagacctgg agcgaggatt cggccaccaa gatcgagaac ctcgtcggga gacatgtgca     74760
     attcataaaa ggcctcctga tctcgaagaa tctttccaga tagagagtca atccagacat     74820
     cttgttcaac gagttgattg ccgcgaataa tccggcagtt agtaaatttt gttatgcgtg     74880
     gcggggtagc tgtcttgcca ggcatggtga gaagtaaccg ctcgtgagag gcgatgatgt     74940
     agataaaaag aaatgtcttg gcagttgctg acaagaaagc aatagaccat acagaagaat     75000
     aagaggagga gcggaggaga aaggggggaa actatgtata tgaataggga gtaaatgaag     75060
     accactcgaa tcatagacag aatgtgaaag gctacatcat ggatagatag tagcatccat     75120
     tacggcgggc agatacacgc aaatggaaca gggaaagtca cccagaaaac gtgtgaagag     75180
     gatcgacatc cagtggcttc atgaggcgtc tattgtctct tgacgttgcc tcccatgggg     75240
     aagaagtccc actgagtgag aatgtgacat cgacaggaac aagagagaat gtgacgtcta     75300
     tggcctgatg gggcatgata gaaaaggaaa ttagggactg ggttccatgg aaaggacgag     75360
     gagttctttc cattgtgatg tatcatcaga tactgttttt gtcttctaaa cgggcaaaaa     75420
     gagaaaagga aaaaaaagtt tgaatgcgat tcatacgtcc atcaattgca atgtccttgt     75480
     agtgaataca actggagttg agtggttagg tcggtagtat ggtagtgcat tagtcatagc     75540
     atttcagtac atacttgcaa ttggttacat accaatacca ctcatgatac caatacatac     75600
     tgccttcata cggaacgaga ctatacaacc catttaccat acaggggagt gtctgtgtag     75660
     gccattgcag aaaggagccg tatccaccta aggtgcatat aggactatac accaaaaaaa     75720
     aaaattagca gtacatacaa gtattaaaga ccgcgcatat aattaattag tagggattct     75780
     tctgcaagaa ctaggtagat gagcttattc aagcattgca ttgattaatt tttttcgttt     75840
     aagtctgtct gctcaacaat gatttgatta tggtataaat ggactgctag tttctttttc     75900
     tctactctgt agggagagac ttggaagaga aatctagagg atgtacatag tatgtatgta     75960
     catacactgc agtcactaac tgtacagttt caccaaggcc ccaccaatac tacgctacaa     76020
     ctactgtacc agcggaaact cgatttgcct ccccgcattc ggcatcgact cggacgggtg     76080
     aaggttgcaa acagtcgatg ttaccgtctc ctttggcttt tcgttgcgtt cccatgaaac     76140
     ggttctggtt ggacagtggg taagcctaga gataatcaac cactttggga aaaacctcgt     76200
     ggatcgcgtt ttgcaagcga ctactacgta ctatcatggg taaaaataat gagtaaaaaa     76260
     gtaataagaa taaaaaaggg aaagaaagaa agaagcctta caagacctaa tagagatatt     76320
     ttattcatgt ttcaggatgt cttctccctt catcactctt gtatatctcg gcaatgaatt     76380
     cattctcttt atcagagata gcaccgaata catatatata taataataaa aaaaaaaaga     76440
     gactaggcta tgaggctaaa tagtgctaaa aaagatcaat gaatgaacac gcgactcagt     76500
     gactgagaca taactatttt ccccctaaaa ttttcattct tcttaatctt gaaatgcttt     76560
     ttcaattttt tttttttttt aaaaaacctc tcttttcctg ttactcaatc atttccattt     76620
     ccatttcgac ctcatctttg ttttagggct agtttcttct tttgttattt accaaaattg     76680
     tttcgcgaat tcgggactct tatttcccga tcggcaatct cttcattcgc tgcagtttct     76740
     ccgcaatttc cactggagtc gtggagagca agagatcaga actgtggttg tcgattccta     76800
     ggcagttctt ggactgattc tccgctttac ccttccttct atagggttca ttctttcggt     76860
     tctccttctc ttttcctctt tttttttttt tttttttttt tgcttctttc cctccttatc     76920
     cttggattgc aacactcgtg gaaaggaaat ttccacgaca ttatcggtct tgtctgatat     76980
     cgtgcataaa cactgatacc gggtcaacgc aacattagat caaggtgcgt catgtcttcg     77040
     cttttcttcg agaattatga ctttgtctct cctccccact atcgagtcgt agatgtagta     77100
     ttgttgtcat ctatggtggt atccgccggt tatctacact acactacact acactccaca     77160
     actacacatc atttgaagtt cacaagcacc gactggatgc gactttgaag acccgagcct     77220
     aagatactcc gcgtaaaaca taagatatgg ggttgatcgg attctgctat taatattcca     77280
     tatttgtttc gtttttccct cttcttcctt accccagatt gagatccccc aacatcacaa     77340
     caaacattga acattccttc cattgttttg tctccgctcg tgttgtggtg tcattctgtg     77400
     ctacttgagt tcttccaaat tctttgtata atacttatat ttccaaacag gaaaaccacc     77460
     cgacctaatt ttcctcctcc tttttgccta cacattgatg atacccttcg atttgttcct     77520
     gccattcact tgcttccggt agcttccctt tttttttcat ttattttcat gtgtgtatcc     77580
     ttctccaagt tctccttccc tccctcttcc ttctgtttac cttgctccac ctatttgccc     77640
     ccccttttcc tcctcctaca ttcttcctca tccctcttcc tttcaagctt gaccaccacc     77700
     aaactctcct ccattcttgt ctctctttct cccctttcaa tatttctttg atccactatt     77760
     gtgcatttga ctgatcttga acattccatt ttcagatact gaccgctttg aagtgaacta     77820
     ctgctctccc aacaagctct tacccagctt cttatcacag cccttagaga ttcccgtctt     77880
     gcatcctcca agcaatgggt aactcaacag ttggcgatga taatcctgcg gagaaggagt     77940
     ttgctgccgc cacttcggat cccgaggctg gtcaggattc cgtcacaggg aagccatgga     78000
     tgtacaagcc ctggaagatt ggccctttaa cactgccctg gtttgcacac ccgatgaccc     78060
     agctcgttct ggtctccttt gtttgtttcc tttgccctgg catgttcaat gctgtgagtg     78120
     gtcttggggg tggtggccaa gtcgatgcaa ccgatgttaa caaggccaac accgcgctat     78180
     acagtacgtt tgccgtggta ggcttcttcg ctggttccat tgccaatcgt attggcctcc     78240
     gcctgactct ctcgcttggc gggtttggat acttcctcta tgtagcatcg cttctctcat     78300
     ataaccataa ctccaatgcc ggcttcctgg ttttttctgg cgcgctgctc ggtgtctgtg     78360
     ctgggttgtt gtggtgtgct cagggagccg tcatgatgag ctacccgcgt gaacacgaaa     78420
     agggcaaata catctgcatc ttttgggtga tctttaacct cggtggcgtg attggcagcc     78480
     tagtaggttc ctttgttccc gtatcctgct ctcatatttg gtaggagaac agacactaat     78540
     gatgccgttc gtgcgcatag gtacctctgg gccagaatct gcattctacc gctggtcggg     78600
     tcaatgatgg cacatacatt gctttcatgg tccttatggc agtcggtttc gttctcgcat     78660
     ggggtttatc ggattcaaag tacattatgc gctcggaccg ttcacgtgtc attgtcatga     78720
     agaatccctc ttggaaatca gaattcaaag gtcttcttga caccctgcgc agtgactact     78780
     acattgtcct aatgttccct ctgtttttgt cgagcaattg gttctacggt taccatttca     78840
     atagcgtcaa tggtgcctat ttcaatgttc ggactaggtc tctcaacagc tgcctctatt     78900
     ggctcatgca aatggtcggc gccttcgtct tcggctttac tttggacatg aagttctttt     78960
     ctcggtcaat gcgcgcaaag atcaacttcg tcctactttt ccttctcaca ttgggcgtgt     79020
     ggggtggtgg ttatgccttc cagaggcagt atactcgtgc cgacgccccg cttgatacgg     79080
     actggtcgga tagtggctat gttggtccta tgttccttta tatgttctat ggcttctacg     79140
     atgctgcctt ccaaacctgc gcttattggt tagttcaccg ccttttcttt gcctcgtcgc     79200
     ctacacacca cctgccccgt ttaaattttg ggagggggaa attgacgact aatctttgta     79260
     ttacaggttt atgggatcac taaccaacaa cgcccgcaag ctggcaaact tcgctggttt     79320
     ctataaggga attcagtccg ctggcgcagc gggaatgtgg gcgtaagtca tcatacaatt     79380
     gtgtcttccc aagtgaatgc ctcaaaccta tactaacgac tcccttccac agcctggacc     79440
     ttgataaggc accgttcatg accgagcttg cctcttgttg gggtcttctc ctcggaagtc     79500
     ttctggttgc atccccaatc atctttttca agattaagga tcatgtagat atcgaagaag     79560
     atctcaaatt ctccgacgaa acagctcatg acgtcatggg taacatccct atggaagaac     79620
     agacatctgg aaaaaaggag gagaaacggg agtctgtcgc ttaattttgc cttgtgtcca     79680
     tcgcttgctg cttattcgaa tgcattttgc ttttacacta aggtcaacag ttgatatccg     79740
     tgatgacacg ttgggtagcc ttagtggaaa cttctctatt ttaccccgag gtacattcag     79800
     gtttacagtt tgcgatgtac cattgaatta atgttcaaat atgtatttaa tcacacccag     79860
     ttgtcataaa tggtttaata taagaatgtc tgacgtaaac tgagaaagcc gagatggact     79920
     gttattgttc cggccaacaa agataatccg caacagatat acgcgcccat accacaggtt     79980
     ctcatggcac gtctcgaagt gacaaaagaa tgatgggtgg ctactatgtc tttccacaca     80040
     aactccggtc tatgcgtatg tatatataca tgtgcattga cgtgaatatt acattcttac     80100
     atttatgcat catgcatcgt gacgtcatat tgtttcaacc gtctcgtcat gtgggctatg     80160
     ccataccaac actggacatg ctggtagccg taggcagcgg cacggacgac tgtgtatgcg     80220
     tagctgtagc cgttccattc gtcttgtagc tgggccagat cttcttctgg ccctctgcga     80280
     tatcccaacc gaagatagtc cggttaaaca attgcaggga ggcgatgggc tggtagtatg     80340
     ggacttcatg gcctgcctca tagacgcgag tgaaggagaa attaccatac tcgcgagttt     80400
     ccccatactc gacgccgttg actttcaggg gcgtgtaccc tgcgcttcgg aactgggcgg     80460
     cttgggagta gttcgcagcg agggaaacgg cctgaccgcc gaaccagttg cagatgtaat     80520
     cggcgtcgcc atagatgagg gagacacgca cggggagagc aaggatctcc tcgaggtctt     80580
     cgatgaagtt gggccagaca aagtcgcctg tttgctggaa agcgtagtag acgtcattat     80640
     tggactgggt gtagttgatg ttgacgccga tagcgtccat gacagagtcc tttgccagaa     80700
     atttgttgta ataacttggc ggagtcgggt cctaatacca tattaggggg atcttattcg     80760
     atcaacaatg aaccatgcat ttgcatgcgg tgtgtaaata gaagtaaaag ctctacttac     80820
     atcatatgga tgccgaatat catacacacc acgaccagca aaggcgtagt atggcccctc     80880
     tatttttcgt gttattgtcc gcactatttt gaatcatata ccttgtgttc caaggaggga     80940
     aaagaacgta ccaacattgt ccctgcacat gttggtggct tcggcgcaga gggcgtagtc     81000
     agctaatgcg gtgcggtttg tctgtttgca ggtggaaatc aaatcctggc aaccatttgg     81060
     catttggttg gcaaacttca tgtagttgta gacggtctcg ttgacctttt catggtgatg     81120
     agtatcagga gatataatct catgcgcata agggggaact tacagccttg ataccgtagg     81180
     tattgttcac agcgaattca gggtagtaag gggcctatgg gcatacgtta gcagctttgt     81240
     tcggaggatg ttctatgggc tgtttcgacg gtatacctgg atcgcctcgt cgatgatgcc     81300
     gttaataatt cccagagagt tgaaattaag ctgaacacca ttaacactac cgttggcaat     81360
     tctctcattc tgctcgtaaa aatgattgaa gaactacgtt cgttagtctt gccttctttg     81420
     acacatcgtc caggtagaac tcactgcagg accatagtgc cttttcgaac gaaaggaaac     81480
     ctatcagcgc aaccatcacg gccgtttaag gattcgcagg agggaaccac ctaccctcca     81540
     tagctctccg tccatagact gaagtcctta gactgcaccc tagagtccaa gctaggtagt     81600
     ccactaagga atccttgcag gatctcccaa gcggcctctg cggcaagatt ggtagtatct     81660
     gctatcgtat cagtaaatag aagcatgtgg accggaagaa accgttaccg atcagagtgg     81720
     catcaatggt tgggtaccgg ccctgaactc ctgcaaagct cgaattttcg acgaccccag     81780
     ttacagggtt aatggaccca tcaaccgtat cactatatga aaagcctacg ggaagcacct     81840
     cgtcaatatg ggaagaccgc agtaggggag ggtgcggcaa tccataccga ctcccaatgg     81900
     ctgggacagg aatagtaaat tggagacctc gttccacgag tgagggttga tgtagtcatc     81960
     aaaagtcgaa ttgacatggc aagggcccaa ctctaaccaa aggttaaccg agacctaaaa     82020
     gaagcatact tgtaacgagc gtcaagcaaa ccttcgaaga gaccgatcaa agaatcgctt     82080
     ccagggccac cattcaacca caatgtgata ggtgcagttt ctgggttatg tctggcttcg     82140
     aagaaccaga agaaggtatg ggactcggga gaggtgtcga catatccaga gtaggatttg     82200
     acacccgggg tagtctcgca gacgccctct gccccgggtt ccttgtaccg gatggtgaca     82260
     ttgtttgcgg ttgtaagagt cttgaccccg gtggggttct tgggtagctg tcttctaccg     82320
     acggacgccg gtgtacttcc tggaagggcc caactggctg caaccaaggg tagcactgag     82380
     agaaattcgt agccacgcat gtttacaagt gcagtccact tctggttcct cgcttggtct     82440
     atgtcctata cgtaggcaag gagagctgct atccagcgat aagcaacctt tatatgagcc     82500
     actcgcaacg tcgtcagtta ctgagcaggt cagcgatcag aggaatatcc tctgactttt     82560
     atacgtcaag gtagcagact tcgagcattg acaagtggcc cacatagtgg gagggggggc     82620
     ggcctgtatg cagccattag gcggccttga atgcaatgta caaacatttg gattgcgaga     82680
     tcgactagta acctatcctg gtagtattcg gggcacatgg catgacttgt ttggcatgaa     82740
     cggaacccac ggaatagtct ggacaagatt agcattgcag atcgctccat aatcggccgc     82800
     gtgcggtatc accttgcacg gcttattttc tctaggcagc ttcagggaat cctgctatat     82860
     ccgtcggcct tctcatcgct tatcgcagga tgagaacgga gcttcccaga atggagagga     82920
     tcggcaagat gaatcgattt gacatggcga cgtatttcct aagccccgca atcatcgcag     82980
     gtctgaggag tcagaaccaa tggcgatcat tcaaaagccg attcatgagc aaccgggaac     83040
     tgtgttagga taacaggaag agcaaaagag gaggtccata gtgggactgt agtaagagga     83100
     agtaaggttc actagatttt aactaaagta atgacctgcc agaagagggt taatgtatat     83160
     ctcttacccc tcaatttgtt cttacggagt acacacttcg gtctacgtac caatgtccat     83220
     gcgtacggta agcactgtac tatcttgatt gatgatgcag cgtaggtaat aaaacgaaat     83280
     tcttgaaagc ttccctcgtg ctatttctta gattcgacaa aaagcgaaaa gccaaaaact     83340
     ggtagccgcc agttgaaccc ttatggattg taacaatcca tttggtttta ctcgaggact     83400
     ctctacttat cgactacgat gcttccctta ctgggcgaaa tgaacaaatt tagatgaaca     83460
     gaatcatgag tcccagaact ctgtcgatcc tataccgaag ccgagattcc cacggcatac     83520
     taagcctcac aaaagatgat actacccact ggaggagttc gcccgcggct cggtcggctc     83580
     gatcggaatg ctgtacttct gctttcggtc cgactggagc gaagtgctgc agagggaatc     83640
     ggcacgtcaa ggaaaacaca cgcgaacaaa cgaatacaaa agaaagaaaa gaaagaaagg     83700
     aaaagagaaa accttcatat atcgatctgt catattcctc attatgtact tttcgagata     83760
     atctctatac aatatataaa cacagttatt ctcacgggga ggcgaaaccg acctcaatca     83820
     catcctagag tgccgttaca catgatgcgc catcctgtac ataccctttg cttttggaac     83880
     cgtccaactg aatataagat caagtcacac ccaaccctgt aaatacacgc gcaatcaccc     83940
     ggacaaaggg gaaggagatt gaggggaaaa aaaagaaaaa aaaaaagaga gaaaaagtcg     84000
     taacacatgg cttcctatag tcatagattc aatccaagtt cggcttcgag atcggcaatg     84060
     ccatcaagct cggtggcccg tggtgcctcg ttggcgccca gcgttgtcga ggtgcgatcc     84120
     tcatggagtt gcccattgcc taacccggtc aacccaactc ctttgctctc cgttccgaac     84180
     aagtccggca cgttgtccat tgtgccgata ttgaaaccat atccctggcc tttcgggttg     84240
     ccattgaggt caagaccatc atcggcagcg aacaattccg caccggtgtc atcaaagttg     84300
     atcaaggcgt cgaagtcgtt ctgagtcacc tccgcatcat ttgccaagtc cataagttcg     84360
     ctaatgctta ggtcggagtc tagattagga attgcaaaag cgtcctgatg gtagtgtggg     84420
     ttgatgttgt tggtgctgcc attttcactt ccgtctgagg gtggcggcgt agaggcgaat     84480
     ccggaggcct ctgcagcttc accagctagt cgggtgccgc tggttttggg gtatgtcaag     84540
     tcggggatct tctgtgctag ggaatccgga ggcggcgtca atgtattcaa tcgaacggag     84600
     tcaaatgtgc aattgtttcg tgattgtacg tcttgcggtg ctactgtgag ttgaataccg     84660
     gccttgcgga tcgcggcctc caagaatgac gtggcaaagt cggccgatgc gtagatctct     84720
     cgcaggcgct gaagaatacg catacattgg taaaaccgtt gaaggctaac catccggaca     84780
     ttggggtcac tggacttgat atcaagaaga tgaatgataa ctgcaggtag gagcacggtc     84840
     acaccggtcg tagggaaata gcgagttaaa tccaaggcgt gtaggtcttg agcgatgttt     84900
     gtgatctcga ccgcagcaaa tcgaacctta tttcgagaga tgtcttgtaa ctctgcgtcc     84960
     gtggagggaa aaggcatggc aggaagaact tgaggacggt gtaacgcgct tgacgtggtc     85020
     aagtagacca tctttaagag agctctatgg gaatgcagga cttcttgtgc ctcggttagc     85080
     ttcgctgggg ccataggagc gtattgaatc tccgacggaa gatgtgccag ccaatcttcc     85140
     aactcttgat cgcagcgccg aacctcaaat gtctctgccg ccgacttctt cggaaccaac     85200
     atcatagtcg tttccattgt accaccgaac ttatggctga gcacggaata ttgtgctgaa     85260
     aggacgtggc tgacacagag acatagcttc gccttctcaa tgaacatgag ggcgagctct     85320
     ttctgatggc tcacgttttg gagaacttcc gagttgccca ccatactgac aatctccggt     85380
     gaaaagggat ggaattcgaa atcgtctagg gttaacatgg gaacatcaca atcatcatcc     85440
     ttgacacgca tgggacgtct cattcccagg gcaattaggc gatcacgagt gtaggtgctc     85500
     caccatatac gcttccacat tcgctggcgt cgaacatcca tccgagaatt acccgggtca     85560
     cgatgcaaac cgatggtatg tgctagagac aagctgacac ccatccaatg ccaggtgtcc     85620
     ttctgatcat ctggggtttc gtaccagtag gtcatcaaca gcagggactg tacaagcgaa     85680
     atccgatcca cctcatagtc gaagtcgtac aaaagcctgg cgcgttgaaa gaatgatttt     85740
     cgggctgcct tccgacttga gtatccggcg gcttgaaggt gcttcaggtc aacgaaggca     85800
     gtaccggcaa acattacggc ctgaaataaa agaagactca tccggcgaat tccgtcattc     85860
     tgcgcgatag tctgcaggaa gtcctccaaa tctaagaggg gcatgtacgt gtggacataa     85920
     tgtatgtagg ctttgagcag ctcattccgc agtcccacat caggcaccgt caaggctcct     85980
     ttcattgcca gataatcgat gtcctccttc tgcaagcgag gtggcaatcc tcgaatataa     86040
     tcgggcaaaa tgatgcctcc agatctggcg ttggcgaaag aaggatccag tagttgctgg     86100
     atctgcgagg tgacgtgatg caaaggcatg gtggcaggca ctgcagggtt gggcgccatt     86160
     cttcttcgat atcgttcagg cccagcacca attctgctga cttggctctg atctatgtac     86220
     gtcgatcata tcagtataaa cgtgtataat ttacactcaa tgagtctcat tcctcaggga     86280
     cgcagggaaa tacgaacaga ggagatgtgg catatgttgc ccctggtcca gatctacgga     86340
     acgctgggaa ggcgacgctg gggcaacatc cgaaagcccg tggcattcac tgagtctccg     86400
     tagaagactt ccgtcttcgg gagcctccgc gggcgattga gagagctggt ggttggggtt     86460
     gtcaacctca acacgtgatt tcctggaaag tggcaaagta gcgcacttga tgttagcccg     86520
     cgattctgcg acgagtgagg caaacgggtc atgttttcgg catggacgaa ctttctcctc     86580
     ttgctctcgg tgacaatgca gtctacttga tccaggcgac aattcgtaca aggagagcca     86640
     ttttcaacca cgtcacaacg aactttccga gcgcggcagc aacagcatgc cttcgatgcc     86700
     ctccgtttta cgggccgggc attggcaggg aggcccgccg tcgaagcctt tcgcttcccc     86760
     ttggcctcgt tctcggccat gttactcgat gatggcgagg cagtgagatt agtcattgtg     86820
     aagtgtgcgg ttttagttaa cgccaaagat ccatcaactg gatagattat cgtgttaaag     86880
     gagccgcggg ggagtttcag ctcatataga gtaatgctat aagagaaagg accgatatgg     86940
     taagaagagg gaaaaaggat gatagtgaaa aagaaggaag agaacacaat tccaaaactg     87000
     ttaaaccgaa tcaaaagagt caagagtgga gaggaccttt cgtttaattt gttttttgtt     87060
     tttttttata aaattttatt tatatataag ttttggtaac tggggtacca cgatcaaacc     87120
     tttttcgtcc aaggggacga aaagaagagg cgagacctgg ggatggggaa aaggaatgtt     87180
     taagtagttg aaccaatatg caacacgtcc accaacaaat tggtcaggag gcgttggcgt     87240
     tggggttggc gatggatgcc cccagatcca cactgtgatt gtgttgcctc ccccagaccg     87300
     tgaccaacgg actccatcca tgaatccaga gggtttcaat actaatcggt catccatcca     87360
     ttttccaccg aaatgacgct agcctcaatt gtggataggt atttacctca cgcttgaact     87420
     aatgggatta gggcggccta aggtcggcgg ggtgggtgga aacggggggg gaagattcca     87480
     tcactggtta cggagtactg ctgaagagag cgcgcgcttt gagccagtgg tcggcaactg     87540
     cttactgtac cctccccaca tatccaccca atgacggtcc gaatgctact ccactcctcg     87600
     cagccgtttc cactcccgat ggtaagtcct ccggatacct acggtctatc catcctgcga     87660
     agtgaggatt catcgttctc cacttgtcta cgccttgcag cggcgccaac aagacccgaa     87720
     tagcgtccct cggcccggtc acgttactaa aacctcgcaa cattggtcca tggtcaaccg     87780
     gcacgctgat ttgccctgac tggtcctcct gcagtggcca actttgaagg ttgccaacta     87840
     aaaggtcaaa ggacaggtgc gtcatttggg tgaagtgctg tgcccggaaa aaattccgag     87900
     catcttgaaa atatctttta ataataatta ttcttttctc ttcttttaac tggtctcctt     87960
     aacaataata gcaatctgga ttccatttgg ttcccgtttg ttaaagttct ctgtccactc     88020
     tgcaggagca tcttacttga taaggaaata tgcttgttac taggataccc tcacctcgtt     88080
     cttgctttga ctggcagctc catgggattg agatatcact gaccagcaga gtagcttgga     88140
     tcacggaccg gttcaacgac aggatgattt acaggccggt ctaaggatgt atgctcccac     88200
     gggccgaggt ccgcgatgat tattccatca aacaaaaggt tgaccctggc tgggacaatc     88260
     tctggtcatt tggggatcca taataggctt tgagaatgta caactcacat gtttattcac     88320
     attattttgt ctctcataaa aactagaccc ctagaggaag ggaccttggc gtctggacac     88380
     tggacagtgg acaggcattg atggtactaa atggggacga tcatcgcttg gatatcccgc     88440
     aagaaaaccc gctagatatg gacgaccaaa ttaatttgcc gtgaaagtgg accggtacca     88500
     tctatcagga gaatggtcca tgaagatcat aggatttctc tttctatttg ctgtgcttta     88560
     ctgctcacgg tccccgtgat tttcacgagt ctacttagta acaactatag tacttggctt     88620
     ttgaggaggc caaacccggt agcagtacgt acatcctact ccgtatggtg aatggtccac     88680
     ccttgccagt tatggaacag caacgcgatc cagatcctaa caggaaaaac atttccagct     88740
     tgttgcagga ataatgagcc actcaagagg gataacccca cggctctgtg tacctatttg     88800
     ctttgtaaaa gaaaatgata attataatat ataacgtaat ccacgggcga gcggccatcc     88860
     cgggcgagcg gccaccacac cagaactcta cgcacctcct agaaatgaag ctattcaaaa     88920
     caccgaaaaa tgtgcatttc tataaaaaat ttaaatagtc tgacgattag gacactgagt     88980
     aattttatgt cctagtatat tacagccaga acaccttggt ggagcacgta cacgctggct     89040
     ttctaccgga gcgcctatat ctactgaggc agtagttata ggctctacag tagaatttct     89100
     gccttgtata agctcctgag cttcctgaac tgaagcgcct gattctatag gcagctgtct     89160
     agtagagcgc tttttctttt taagcattct ttcatgcgcg gcgcgtagtt ctctggcttc     89220
     ctgctttgca atagtagctt catttaaagc tcgttcatag cctttgaaaa gctgctttat     89280
     cacaatctta gtaggcgaat cagggctctt tgtacgagct ctaagcagct tcttcagtgt     89340
     agtttcctgt ttttgtagtt gctttagatt atgaggcgtt ttaggcactg aattagtaga     89400
     cctactacta ggtctactac ctggaggtgt tgcttctagc tgaatattca gctgagataa     89460
     tacacgctca ggattgaaag gaataagacc agtagctgag aaaccgctgc agatattact     89520
     agtagtatat atctgagctc tcgcctgagg aaaggcttca agaaagtcaa gtttatcgat     89580
     gtggttgaag cctaatctca tcttattctc aaccagctgt ccgtacgcgc gttttagggg     89640
     gccaaagcag cctacatcaa gcggctgaag taggtgagat gagtgcgcag gcatacagag     89700
     tggtataata tcgttttgac tgcatatatc gtcgaactga ggtgtcaaat gactaccgtg     89760
     accatcgagt attaaaagcc gatatcgacc aaccgtacgg ccagcagtaa aaggtataaa     89820
     tagctgctgc agccaacgta gacctatctc atcggtagtc cagccatttg cactcgtttc     89880
     tatacgccag tctgatggta gacccatctc gtaccagccc tcaatatgga ctttgccttt     89940
     gaagataagg caaggtggaa gaggccccct agagctaata cactcaatag aagtgaccca     90000
     ttcccggttc cctggctgta gaagaaaagg tctaccagct aactcagctc gagtaactac     90060
     tttagcagta gatatcaagc ccattgcaaa gccagtttca tcaaagttgt agatatcgtc     90120
     cggttgaatg ccatactgca ttatagtgat ttgtacgcgc tcaaaccact cacgtaaaag     90180
     cttaggatcc tcgcatttag cgcgctgata gttatagcgg cgagaaaatt gagtttttaa     90240
     ctcctcacgg cgtttaataa aagtatatac ccagttttca ccaacagtag taggagtatc     90300
     actaaaacca cgctttaaaa gtaagatatt ggccatttct cgtacatgag caggtcgagg     90360
     aggtgctcca cgctgatcta gcgatagaat ccagtgtacc agcgaattct cctcattttg     90420
     agtcaattta tggccattgg cgcgcgtttc ggctcgaaaa gtatggccat tcaggcgtct     90480
     ccgaagggta gtacgtggaa tattatagat acgtgctgct tcagctatag tgcgaatttc     90540
     ttgtttttta atagctgaaa ttgctagtag aattctacct tcttgttcaa tagaatcttt     90600
     tagctttctg gctgcttttg gtggcatagt tggtggttga aatatataga ttcttcaagc     90660
     gtggttgaaa ttggttgacg tggccgctcg cccgggatgg ccgctcgccc gtggattacg     90720
     ttatataata atgataataa taccagatat aatagtataa aaagcgcaaa tggacatcag     90780
     gacgcgggcc gctagaaggg ggcggcagct caagttctag acgttgaagt tgcatatcac     90840
     aacaaggaag aatttcacat tgcggatttg ctatgccttg tataatagta actattcaaa     90900
     gaatgtcttg tctcaaaagg atctctctct ctctctctct cttctttttt tttttctttt     90960
     tttttttttt cttttttttt tctttttttt tttttttctt ttaaaaaaaa ataagaagaa     91020
     aaaagaggta aatttttggt caccattttt tattattagg gattattttt gttttattct     91080
     ttataatgat tccagggatg tggggaataa gaactttgga acatcgaata gaatcccact     91140
     tcttctaatc ctctagggct aaaaacaagc ctcctcagct gcacgtgaga cttgatcgtt     91200
     ctggtaaatg gtgcgtggtc gatgtcaacc gttgtgccga cgaacggaat aatctcaggt     91260
     actcggagga aaaaaaaaca tggccccttt ccgtcggtat tcagtaacag tgaaggcagc     91320
     gttgattcca gagagccaat cacataccca gggaccttcg acgccagcag ttcagaaact     91380
     gagcaggtga catgcacagg aactagtgcc aatggttttt actccgtaag ttcagggtga     91440
     aagtaagatt agtcattatt agcgatactc ggaggaatct ttgatggtct ggatggaaga     91500
     gcaagagaag ggggcgcacg gtgtcgtcat cacatcattt gggaagctga tcaagtggcc     91560
     tatgcctatg caatgtacgg aatacatact acatacttac atgaagtcct acctagtgct     91620
     agggacgcat caaatgccgt cagtcagaga gctaaggact aattgttgac tgccgatacg     91680
     ttgcactttc tttttgacat gaatcactat caatggcagg tggaaggtca acttccttgg     91740
     ttatgcaact gaaacgggag caaaaatggt catcataaca atttccgagt gtcacgagcc     91800
     agactccata attcggaggt aaatacattg agtccacagt attcgcgggg gggcttcttt     91860
     aacgagggtt tttttttttt tttctttttt tttttcacta gaaccaagac caatcgatac     91920
     taccccagcg gataccaaag tgggactagg tgggcttaac catctctggt acggggagca     91980
     ccaatgacag tgactggatt atcccaggcg aacgtgggaa cgcgggctac cgactcttcg     92040
     ggaatagttt ctccaatgac cacctgaaag tgctcggaat aatggagcct ctccgaaagt     92100
     gttgtactac ttattaccat tatcatttta atgacattgt ccaggttcta atatcccctt     92160
     ctccaaaatt ttacttcccg cgccgaagtc gctagaaagg tggcacccag gcactggtct     92220
     aaaattttcc aactacccca ggctccccag gcgcggcccc gtaaagtgac taaaatttct     92280
     ttgatcccaa gccgggggaa accaagaacc aagatcacga tacttcccca gacagcgcca     92340
     agactcgaag atactatgta cgtaacgaat aacgtctgga ccacaggcaa caataacttg     92400
     aagtctacga tcggtcaatc caattgatta aattccctca tttcagttgc cctggatcct     92460
     tctttcgtcg cctctcactt cccttaaacc cccaatccta agagagcgag cgatgaacaa     92520
     cgaaccgaac aagatggatg agagaatatt gagcattgct caagccacca atatgtctga     92580
     ctgagtcaga gcaagcaggt cgacaatcaa acttaattct tagcgcatgt ccttgccggt     92640
     gctcctttta atccctcatc ccaacattct gtagctcact agtgtgtaac tgggtcacga     92700
     gtaaagtcgg acatcttccc gatgctgggc caggcggtcc gacgtaggta gctgccaccc     92760
     cacgttcgcg gtaacccgat cttcctggtc cttacctagt agcctataag gatgggttgt     92820
     cacgtatgaa gtcatccaca tacatagtgt ccttcgttga gatcgcgggg tatgcagtag     92880
     aagaggggga tcgtgtcatt aatgcccaaa ttgagagagg ggatattaac ggagtagttt     92940
     cgtacggcat ttaagcgtat aggatacata tccaatcaga tgctccaact tggtggtaat     93000
     tatgtatttc tctcatctag ggggccgtcg aactagttag aggttcacta tgtgtctacg     93060
     atatttggtc gctgtttata catagggcca gggatggcat tggctctaag atggtttata     93120
     tactagtata tatatatgta tatgtttgtt ttggagcgga aggggcatcc agcctgtcag     93180
     catgtcttac tgttcgacca atacgctaat ctgcgctcgt tatatagtat atacgaaaac     93240
     aactcagctc aatgagatga ccatctccat atagtaatac ctgcatagtc tgacaagata     93300
     agagcgtcaa cttcctgaag atcatataaa atcgggaagt tgctcgtggc tatgtatcaa     93360
     gaatcgattt tattcaccaa taggttgtta aacccatcgt aacaatgtcg aaaacaacaa     93420
     taagcacaga tttagcaaac agaggaccag ttcacacagt gcaccgcccg tggggaataa     93480
     agagacatga tcgtcatcaa agtaaagtcc ggagaagaac acatggaaga gaaaatatac     93540
     agaacagaaa ggaaaatcat caagacagag gtaaatagag aagactgcta ccagcaactc     93600
     tcaattctca cacaccaccg cgacccattc gctcaatcga acccatgata ccactgcgac     93660
     ctggggtgaa gacagcaata ccagactttc ctccactatt cccgcgggcc tgtcggcttc     93720
     ccggtgctgg aatccttggt atcttctttt cgccgttgct agaccccgtg cttgggggac     93780
     gtatgctgct tgaactgctg cggctaatgc tctgtctgaa gtcctccggt gcaacctcaa     93840
     ttggggttgg ctcgggcgaa ttatcttcct gtggtctcgg ggactgggga ccatcctgta     93900
     tagacggctg attctgctgg attgctaacc actcatccac agcggcgaca agctcgcctt     93960
     tctcagcccg ttcgattttc agctcatggt gcaaccgttc actgtcatct ttgagtgcac     94020
     ccagctcctg ttgtaatccc ttgatttgag cctctaggac acgtttctct gcttcatgct     94080
     cgtccttctc ccgcgtgatc atgctgatat caggctgaga gacttccgaa agagctgcat     94140
     cacgctcagc cttgagtcgc tcattgtctt tataagccgc ttttaatttg ttctcggctt     94200
     ctcgcagtcg tttatcccaa cgtgcctcat agcttttctt cagggcagct accttggtct     94260
     catgtttgct cttatacaac gtgtgaagct cacgagcaac cttctcaaca gcgtcttgaa     94320
     cctcctttgc cgtttcctca gcagtcttgc cgtattgcgc acttttagag gaacccatat     94380
     cgttcgacgc tggtttgcga gccgagctta attgtgtctc taattcaacc accctacttt     94440
     ctaacttctc cttgctcttc tccatttcct cagctcttct catcaatttt tctctctccc     94500
     gttcaccttc catcatttca gccttgacag attgcaagac atcttccatc tcctgacccc     94560
     ttctctgcca ctcagcctgt tcaatttcta gggtctccct ccgggcagct tcattccgaa     94620
     gctcctctga tgtctcccca acacgccgtt cggcgtctgc aacagcctgc ttaagactag     94680
     cgacttccgc ctctttgcca ctgagcgtag ctttgagaga agaaatctcc gaaagaaaac     94740
     cggacttcag ggactctagt tcccgtggtg tcactgaagg gatggaccgg ggggttggag     94800
     cagcaggaag atcaaagtcg agtaatgaca cttttgcagg agacctggtt ggttcccgga     94860
     cagtccttaa tggcgatcgc cgtgacggag agtatcgctc attttgcatg ctgtagcgtt     94920
     tgcgggggaa gaagctgggc tggtctgata agtcaagcaa gttgggagtc tcgcttggat     94980
     ttatgctaac ccttgcatct ctttttctcg gcgtgggtga gccaaaatca accaagccgc     95040
     ttattctggg ggattttcta gtagtggtag gagttcctgg ttcatccttt ccgtccagat     95100
     caccgtgtag cttactaggt tgaccggcct tgaacggaga gtcgccccga agatgtgcaa     95160
     atgttgtcat gtccacattg gtaacagcgg aaaacgtgct gagacaagtt tcatccatgg     95220
     agtcatttgt gtcgtcaatc atatcatcgt cttcttcgtg caagcttgta tcctccttgt     95280
     cgtttgaagt atcattgcta ttgttctcgt gaatcacagt gctcattcct tcgttgtgct     95340
     tttcttccat tagactgttt ccaatctctt gtccagcact ttctctgctg ctttgttcat     95400
     tgttgatgct aacatcctca tcggcataga cactgatatc gggcatatct cttcgagctg     95460
     tgcctttcct gtatctatcg tcaaacgcgt cgtcctcggg cacatgttcg taggaccgtt     95520
     tcctgggggt cgccgacaat tgttggctcc ggagcatttg gaagtcgact gtatcatccc     95580
     tagcctcata ctgaaatggc gagctaggtg gtaatatggg atcagtgtta tcgtaatcta     95640
     ggtcctgctc gttcggttgt tgcgtagcag tatagctctg acgcctttca gtatctgcgc     95700
     tcagatcatc caccaatttt ctcgggctcg aaaagccatt ctctagacta tctttcggcg     95760
     cgacaatatg atcaacgaca tcctcctgcg cgaccagacc gctaattcct ggggaaaagg     95820
     gctgtgaatt ctggcgcgag gatgttaagg gagacagagg tgtggacatg acaaaggggt     95880
     aatgggtcga agaagtgtaa tagcaggtag agtaactgtt ctggaagcca gaccagatta     95940
     aagcgcgata tacgagagcg gtatatgtgc aaggcgtaag aggcccatat gacacaacat     96000
     tgagaatgag agcaagtcca accccgagtt tattattttc gcctgttgcc gggatgtttg     96060
     taaacaaagc tattcccata taggtatagt atggttttcg ggagggcggt aaaaatttac     96120
     aaaattctca ccgccctagg gtaaacacct atgatattga ggttttatct tgagctggca     96180
     atatctacat ggggcctccc caccactcta acaacgatag tctccctgcg ccttatagga     96240
     ggattccaca accatgtatg tttgtcacaa ctgaggcaga atagtgtcga tctgcgttat     96300
     ttctttatca ctgaggctaa cctgcttact gtactccacc tctccaccta cgctactgtt     96360
     atggcgccct tatcacatag tcgattaaag taagctggct agcagccctt ctatctggct     96420
     accttctcga atcattggac cagttgtagg ctaatcttga tgatgcccca ttggaaccga     96480
     ggcaagcgcc gcattatcat caagccgtcc gggaatttgt tgacatgtta atgtacatat     96540
     ctcacccaac caagggtgta ggcgatatat gtgattctgt gatggactca cgcaaccaca     96600
     acgccattcc ccaatacctc agcggagacc ctattacaca tttagcgcaa ctgacaactt     96660
     actcactggt attactaaat ctcctaagct tacggagact tccagcaagt tcgacctcca     96720
     cgacgaggac tttagtatct ttgaaggagg cccattttat atacttgtcc gtgatgtcta     96780
     tctagtaggc taaacagaag aaggccttgc gcaccttggg tgtcccatca atttaaaggt     96840
     aatgataaat gtagacagga gctagtcaag gattaccttt ctttcttttt ctttttcttt     96900
     tttggattag ctctcgatcc ttatcggctt atcggcgaac ggacgttatg gaaaaatgac     96960
     attattcgga ctcatacgta aaacatagaa cgcccagaca ccatgcaaac aaacaaattc     97020
     cagaaatttt tgcccttcaa atatgatcac aagtctagga gagagacaat aaaagaaagt     97080
     gagaaaaagt atgtatgtac tgcttcaccg catgttgcat agagccagtc aattggttga     97140
     ggagttctcg gtgagtaccc ctcagcctta taatcatcca gtcgttgtct gcggcaccgt     97200
     ctgttcatcc cctatatcat taggcatccg gcgtgccaac atcagtacct gtaactatga     97260
     tatggacggc gtctctccga gggtgggcct catttggcag atagtggcag ggggcggctg     97320
     gctggattgt agcggacgag tgtttctttc gctccatgaa ccacagctgc acggcaccga     97380
     cgattgcggc tagagtgctt ccccaccatg cgagtgcagt acaatcaagt tccgcaccgg     97440
     tgctgtacaa ataaccagcg ataggcgggg cgatagtgcg agaagcagct ccagcggaag     97500
     cagcaaggcc attgatcttt cctaagacag agtcggaagg gctagcttgc ttaataagga     97560
     tcaacaagac ggggtaatca atgattgcaa ggatattgcg aacgactaaa catccataaa     97620
     tgccgaagaa caacagactg cgagggagaa aaatcaggaa tggaaccatg aaataagcca     97680
     ccggatgaag gatggtcaca atcacgaaaa gtctccacac ccccaaataa tgtgccaatg     97740
     cagggaaaat gacgctttga atgaagagag caatgatgcc gtcggtagac atgattaagc     97800
     cgactgttct ggttgagaga ccaacaccgc cggggaactt caatatcgag tttccaacag     97860
     taggaacgtc ccgtaaagtc ttgtcctgca aaaaaatagg caataaatgg tcataagtca     97920
     tagagtgata agtgaaaatc gctaatgcaa cgatgagcat cgtgactcgt ttcgtgaaga     97980
     tggtttgtct ttgtggaatt ttctcaggcc ttgaaccgtc tgcccgtacc aaccaatcct     98040
     cctcgtcgta taggtgtacc tggttgaaag tgccgtatga ttcggctcgt aggtccgctc     98100
     ctgcattggc ggtcgcccca gcagtcgcca aaagagggcg ttctgcggat ctgccgtcga     98160
     gattttcggt agcagtacaa ggctgcatat cgggatgagt ctcttgcagg aagagccagc     98220
     tgaagaagat actgagaagg agtaagacag aacaaacaag gttcggcagg agataaggga     98280
     atctgccaaa gagaccttca cgataaaaca aggaagggaa accttcagca ggctttgcaa     98340
     gtaaccctcc gatagctgcc atggtataca gtattaacat cttccgctat gttgtttagt     98400
     cgaccagtgc ccttaataca tacctggccc aataattgtg ccaattgacc aaacaaatgg     98460
     cataacagca taagctcgag ctacgcaatt gaccgtcagc taaggttcca gccatggaag     98520
     taatgtggta ggaaaaatca tacgttcatg ctcaggtctt ttgactagtt cgccgaccat     98580
     agtctggatg acaccgatat ttccgtttaa aatgcccccg agggcccgac caaagagagc     98640
     tacccaaaaa ttcgtcgcga agccgacaat gagaagggat gccatggttc cgacgcaacc     98700
     ggagagcagg acaggtttgc gaccgacacg atctgagagg cttccccaaa acataccggt     98760
     gagcgcttcg gctagtgaaa aggccgagac aagtatacca gcaaagaagg aagcatcgga     98820
     tccattagcc acattgaagt ccttgaccat cacccatgag tatgggaaga tggaagtcaa     98880
     ggcaataggc tccgcaacac gacatattgc tgtagtcaaa caagcatcag tacttgtaag     98940
     tcagaaaaga acatcgaagg taacaaatga aacgaagaga agaggagttt gaattgtttc     99000
     acatacctag gaggaatagc tgagtggttg gaaactggtc gtccgaggca ggttgtcttc     99060
     tctgttgtgt caataccatt atctttggaa acgtccaaga ctcttacggc tagccctcca     99120
     cagaacgaca ggtctcctac tgagacaatc ctttttctaa cctcctgtga actctgtaca     99180
     gagagtgata ccgcactttt cttcttctct tttccctgta tttcaatccc gacttggcaa     99240
     gcgcccgaga tacgggggat agagatatag agaggaaacg tatgattagg tgatggaagt     99300
     actagtatgg cgtatcacag tcggagagtg tgcacagtgt gaggaagaga cgggaggcag     99360
     ggaagaaaag tagtagagca cctatgaaat agagaggaaa aggtcaggtt tatctgcagg     99420
     tctgtaaatg gttccagggt actgccatgt aaaacagcgg aagcaattca tggaattacc     99480
     ggctcaacgg ctaccttgat tggagaccca gctcaatgac agtagactag ccccagaaac     99540
     ggaatagcaa ggctgcacat gatcatggat ccgagtcaaa gatttgaact aatggagatt     99600
     aaagtttgag ctgactcgga cttattcttc ttaaatttca gttcatcgtt aatggggaat     99660
     cacatactac cggatagcgt taatcggagt agatgggttg ataccccagt ggaagagctg     99720
     accaagtatt tgcaattaat tagtaggtag gcacagagta ttgctgtggt gctaaggaga     99780
     tgcgtaccat atactttatg taatatgaaa ggatcggtgg cggacactgg tcctgtttag     99840
     gtaacatttc tccctacatc ctgggcctgt ctacggtaca ccaagtgtag catggcaaaa     99900
     ttttccgaat cctgtgccgt gatgtccgag acccgctgtg taattggtag ctttgcccat     99960
     ctggtccagc tgtacaagcg aagagtgcct agagcgttca tcagggctac tttctaattc    100020
     gatagtgatt tctgaaacct cgcgtcatgc acttttagcc ttggatactg tagtacatac    100080
     tcatggcctt ggaagaattt agttgtctag attgtgggta ccaagtccgc aacctgttct    100140
     tgactggtgg agattatact caaataagac cactagacct gacccttacc tcgtagagcc    100200
     atctagtgct gggctcatcg caaaaaaatt tctcgtgtgc atgatggtga atgtgtcgga    100260
     gttggcagtt tacatctcat caatagaatg taccctagat tcatcaggta tctattccat    100320
     tcaagccgag cgacttccta tacagtacat tttccctcaa ggaacccctg ccatcggcac    100380
     cgttaagacc cgtacatttg caatgtttcc agcattttga aaagccgctg gtttgcaaaa    100440
     tagatgtatt gatatgactt agctggcgtt gtgccactaa tgtacattgg tagtggcgac    100500
     tgactctggg ttcaggataa ggaacttgct ctgaactact ctatcggcct atcttatcat    100560
     tcaaagcaga catttgagca tgcctgggtt ccagctcatc gtctgcatta cgcaaaaatg    100620
     tcatgacttc tgctgacaag acctgtcaat ttgtaggtgt cacacagaag ctactaccgt    100680
     agctatttta agtctttaga gcagctttgt aaggcgtttc cacaagcgta aatttcgtaa    100740
     ctatgagtgt aaaaatatac agtgagtctt gaagtgttcc gtagaaggta gctactatac    100800
     ccattatgga tatctagaag aggcttagta gcagggcaaa cattatcggt ccgcattttc    100860
     agacacaggg atgtatgacc gccgttccct tgctgcctat cgacgtatta gccttaatgc    100920
     aagctgggga tgtcagtgat ggccaggaca aggttatttg acatgcctcg agatacttct    100980
     gtacccatgg tttgaagaca gcccatgcaa gcagtccgct tgtagcaatt ataaaaatga    101040
     acacaatggc ctcgtctttc ctggagtccc tctctgcata cccgaacggt tggtcagcac    101100
     aagttgcaag acaagcaggg gtatgtcgta cggaaacatg tagtaaatac atcctcctct    101160
     ttcgcatctt tacacgttgg taagtcataa tcaaggcaaa actttcgatt gcaatcgttg    101220
     cagctcagcg agcgatattt gttggctcgt ctttcatttg tgttgtcgtg atcatcggtg    101280
     gagtcgctac ggccgaggat acggaaaagg tttgttagag tggtagtgtc tggtttcgca    101340
     ggatcgagtg ggatgatggt gctgttagag aaacaggtgc atttgcagaa tgaggcagga    101400
     gcttggataa ttagaattta gtcaagtcat agttgggttc gatcgcaaat ggtcactcac    101460
     aagatgccaa cgtgaaagtt gtcagtgaca aaaaagctac agaaagaaga acaatacgag    101520
     atacaatgtc ccggcaacga aacatgactg agaaaatggt aagaggtgga agggttcttt    101580
     ccctcctact gacgaacgaa tgtgttatca gtcgcggtga tataaagctt agcccacaca    101640
     ccggatcctt gtaatcacgt gatagatatg tatatcagtt ctacctgtgc atgcacattg    101700
     atttttgaaa tgctattttg ccggcaaata tctcgattga aatagctagg agatatccac    101760
     atgatactat agaaaacata tccaaggaca ttggccctat gatttccctt tcatgccttt    101820
     ccgcctattc tccctttgtc tctgttcttt ggcagcatca cgccgtctct tcttccaggc    101880
     tcggttgtta tctccgcgat gctcccagaa ccatttcgtg aactcagatt catccttgag    101940
     tgctgagccg aattttggaa caggtgtgtt gatgtatggc tcatcatcca catccataga    102000
     gtcatgttgc tctaggctat tccacttttt atttcgccca gccaacgctg tgtcaggtgt    102060
     gggagcagca ctcctcagct cacggctttg tatatccttc ttcgtaaacg gagtttgcgg    102120
     ctctgtgact tcctgtggtt cttcctcgga ttccatatct ccctgtccca agaaactaaa    102180
     ttgcgcactg gcatctggat caggcttgac atcggtagtg ccgggtgtgg gtttcttgaa    102240
     aagagcttcc aatggatgga cttcttgaga gtgtggctca tcacttttct ccgcttgagc    102300
     aacatcctgg tccgcctttg cttcagggcc gggaaccttt tcaacaccct ggggcgtcga    102360
     ctgtgccccc tgttcatgct ggtcattgga gatgtctgac gtatctgacg aaccggatgt    102420
     tacgcttgcc tcgctttctg aatcggtcgc actatcgtcg gatgacgttg ccccactaga    102480
     cgaggtccaa tcctccgatt cgtccgattc gtccgattct ttcagatcaa cacctcctct    102540
     aacggcacat gcatcatcaa ggctttggga gctcgcctta gccttgagcg aagacttgga    102600
     cttcggtctc tccttcgccc ctgcaatttt ccctggtgtg tattgatcac ttctgattcg    102660
     atcgctggcc tgttctttta tgttccctga accgtctatc cagcccttac cctcttcgaa    102720
     agtaaacgta ggtgctgctc cgtcactatc tgtccgtagg aaactcggtt gtgtaacggt    102780
     cttggaaaac tcatgtacaa cagactcctg tagagatttc ttctttttct tctttgactg    102840
     cttgtcttgc tccacctcag cagacgaggc tctgttagga gggattttgg ttcggaataa    102900
     acattctgcc ttctcggtat acttggattt cgcctgtgac tttccagttc tatcatcctt    102960
     cttcttgttt ctcttctcct ccttgcgcct ctcttttaag gagctcgtgg actctgtcca    103020
     gcctctcttt acttggcgat ctgtttgaag ctcatatccc tctaaaacgt taccgatatc    103080
     cttttgcttc tttgttttct tgcttgacgg cgatactttg ttgaaaactg ccttatcgct    103140
     ttcgtcttcg ttttcgtccc tctgtctttt ctgcggccga gctacatcca ctttgaactt    103200
     tcgacctttg aggattgacc cgttgagctt cttcttgatt ttatctgcct ccattgctgg    103260
     tagcgttacg tagccgtagt tattctccgg aaatgtcggg atactgtgga aggagatttc    103320
     agtggctaag ggccgaacgg acgaaggtaa tacggaggga agaagttctg cggtgaaagg    103380
     agtgatgtga aggcgtttat ttgctgaagg atcggtcgtc atttgttatg actgatgatg    103440
     gaccatatag cgatggccta tccaataggt aagaaaaggg gagaaggccg taaggtgcca    103500
     ataagaagca aaagcaaaaa aaaaaaatgt aaggtgacaa ctgcaaccac cgtaagctgt    103560
     gtgccgatag ctctaggtca gaaaaaatgg ctaagattct gtcgcattct atattgaaac    103620
     gaaataaaca gaccgaccct caattagtga gagaggcatg tgtaaaggat caattcggac    103680
     caactatagc attaaagtga taaataattc tgtagtagat gatggatttt ccacccgcta    103740
     atcctaaacc taaaagggac cgacctgtgg cgcagcagtc aacggtctta gccacatatg    103800
     atactcaatg ccaagtctac ggttttggga atagaggaca gtactgtacg taatgtacgt    103860
     actaattcca tattccatgc aatagttaat agttaggggg gacgattagt aatatcctag    103920
     actcaagtaa caagagatac atacaatatc aagaatccaa gaaaataacc gatgttctat    103980
     taaaaaaaag atttcgttct gtacagtagt ggaaggatcc cttccagtct agaaccatca    104040
     gagccaaggg gttcgcccct cttaccacca ccattaagca tccgacgagt tgatgtaata    104100
     caaaggcgtg gcgtcgcatt aggacctctc attcctaagg agatgtatca tattacaatt    104160
     acagcattct gtaccaatgc aatggtgtgt accacgtact attgaactca aagtcacgat    104220
     taagtcctgt ccatccatca tcactcttct cgaccatctt ctatttcttg ttatctttag    104280
     gtaccttgtc tcccggctta tgtatagttt ccaataccag tatccactac tgcaacttaa    104340
     gtatttatca ctgctttccc tttccaaagt gctctcttgt tactccccgt catatttcac    104400
     cccctgattc ggccccatcc acccgcggtt aatttggccc gcattctgat ctcatcgccg    104460
     cttcgagcag ccagctagct tctttgtcgc tcacatggcc acagcgactt tattatcacc    104520
     attctgttcc cctccccgct ccaataactg agggtctcac agcctaccgc tccactttga    104580
     cccttcttgt ttccacttgg gagtctcacc cggggtaact tcaaatctct aatttattct    104640
     cttactacta tctttcggtc acttcgcgtc gtctccgctt tcttatccgg cattccgcag    104700
     cctcccccag attcccagat tatcgactgt caaacttccc cattttgacc ttcctcatac    104760
     caattcccat tctcggtgga gatgggtaat tcacagacaa aagaggcccg gccacccttt    104820
     actccaaatc gccgaagcca tggcggtgga catggaagat caccgtatgg cgacagacat    104880
     cattcagagg gctccagatc aacacgaggc agtagaccag atctctccat tctcggaata    104940
     ggcggaagct cagaaagaga tgttgcgacc ctcgagcatc gccgagaaac gaagcaagag    105000
     cgagaggctc gccgtttgga gagggaacgg gtggctcgga ttaaggaacg ggagcgtagt    105060
     atgagggaag aacacgtcga tggaggttac ctagttacgc agggtgtcta tacgggaacg    105120
     gaagatttca acaaggctgt ggtgaggcag ttaatggtaa tatggaattc gcgccaactc    105180
     tttgatgcga tcaaggctaa ttcttcagcg tagatcgaac gacgacttgc gcccttctgg    105240
     agaggcctta acgatttctc tgattcttgg acggagcatc agctaatggc tgccgcgcga    105300
     ggcctgccca ttccaccgcc cgatgaaatc ccttcagagc tagagtataa gaatccaccg    105360
     aaaatcacag aaggggcaaa ggagtcgact gatacgaaag gaattcaaca tctgacggtt    105420
     ccgatcactt caaggtcaca atcctatggc tccgatgcgt cccaatcatc caccccagcc    105480
     cactccttac cctcccccac atcaccccta gcctcaggaa cttcgagttc gccattgttt    105540
     cgcactcggg caaagacact cgcctctctc actacatcta aacatggcac ccaagccgac    105600
     ccagcgcccc gggagataca gctccctcgc gacccatttg tcaatgggca gcccatcgag    105660
     gcataccttt ataaagacgc ggctgaatgc cccatctgct tcctctatta tcctccttac    105720
     ctaaaccgaa cgaggtgttg cgaccaacct atctgctctg aatgctttgt acagatcaaa    105780
     cgtcccgacc cgcatcctcc tgagcatgga gattccgatc caaatgcccc cgctgcagct    105840
     gccgagggtg atgctgccga caaccaggat agtcaacttg tctcggaacc tgcagcctgc    105900
     ccattttgcg tccagcctga atttggagtg acatatgcgc cgccaccctt ccgcagagga    105960
     ctcacatatg cttcagaccc tagtgcccgc ccaaatttca cttcccctgt atcgtctaca    106020
     tcttcacttt cttctggaaa tgttacagct gttacgggcc ggagacgcgc tgcatcattg    106080
     tctgcaaatg accctacggt aatcacgacc gataaggtcc gtccggattg ggctcaaaaa    106140
     ctggccaacg ctcgtgcgca tgctgcgcgg aggtctgcag cggcaaccgc tctccacact    106200
     gcagcatatc tgatgaactc gaacggcaat ggaggcgact ctcgaacttt caatattggg    106260
     cggagaggcg tcatgcggag agctggcggt tcggatcccc acagttcttc tagccgcaca    106320
     ggctccccgg cgctccaggc tcttgcattc ttaacggacc gacgcagtgc tacaaacgac    106380
     atggactctg ctgaggaagg gtctgggaat atagcgccgc cacgcaatac ttcccggcga    106440
     aaccgtattg acgatttgga ggagatgatg atgatggagg cgattaggct tagtttagcc    106500
     agcgaggagg agcgtcgtaa gagggaggag aaggaagcga aaaaagaagc aaaaaaaaga    106560
     gaaaaggagg ccaagaaggc ggaaaagact gcccgtaaga ccggccttta cagtaccaat    106620
     gcaagtggat ccgctttgga cgtacctaca gggctaggaa gggttgcgag cagctcttcc    106680
     tctgttatcg gcgaggaaag cacgcctgct ggcaagggta aagaagtgga tcgtgcatcc    106740
     ccggaagccc ccattgatgc tacgtctaca tgttccgtta ctgcgcccgc tagtatgaat    106800
     gctgtatacc cgcctatgaa ttcggcagat caacatcagt ctatgcaatc ttccgtccca    106860
     caaacctcac ccagggagct ttcgaaaccg tcacatttgc gacatgtctc aagtgcttct    106920
     tcatcgttct cttctcttgt tgaatcgatg tctggcgatc acactgggac cacagagggg    106980
     aatggctcgt ctacagaacc gctgttcaat tttcggagtc tagctgccgt tatcggcgat    107040
     gaagacaaaa gggaggaatc tgcagagcat gtagaaaata cgttatcaaa tccgcaagct    107100
     gaggggtctg cctcgcggtc cgtgcttcca gtggatcatg cgcatactga tgactcggtc    107160
     tttaatgctg atgcagccac gcccgctgga tcggacttcg cgctacaaga gagtcaagga    107220
     tatatgatac ctaaagagct tgaaacacgt tcagtcgaga tcaccgactc tacggggaat    107280
     ccccaggcca cgtcttgaag gtgtcagaag actacccctt tcgttgacat cattaccata    107340
     accctctttt tgatttacct tttttatatg accgtttggc tgtgggagaa gaaatgagag    107400
     attagtggtg cgaatttgtc ggcgcaggag gctttttaag tgaaaagcga tattgcattc    107460
     ctttttcagt cttttcccct tttctttcta cgtttgcttg aaactctcat gatatttgta    107520
     ttcgcatgac cggaccggac gtttctttct ttatatacat acattggcat agaacttgtg    107580
     ttacttgatt gacggttcgt tcatatgtgt cgggcgaggt aggcagccag attgcataca    107640
     tactactcga tagtgatggc taagttgtgc gtgctggcaa gggcattctg ctttgagcag    107700
     ggtacagatt gatttgtccc atgctagtag tcagtctgaa tagattttgg gagtgattta    107760
     tattgtgttt ttgtaaagag ggcgcatcga tatacacaag ggtgatagga ggacaagtgg    107820
     aaagagagtg agtggctggt ggggggggag agcagtcaag cgagtcaagt cagtaagaaa    107880
     aaaaaatcaa atcaaggaaa tgaatgaatg gatggcgggg tttagcaaaa aagaaaatta    107940
     taattccgat gcggggaatc gaaccccgag ctgctgtgtg agagacagcg atgttaacca    108000
     ttacaccaca tcggagtgga tatgctaata gttctaatat taataattca taagactact    108060
     aaggctaagg cctcagatct tattctaggt tttctttagc tgcgacctca cgccaccaca    108120
     acgatctaat tcatgtgaag agggaggaaa tgaaaaaata taagttacat cacatgaaca    108180
     ccggttcatg agtttttgaa tccaattttc atccatataa catgaatttt tatctttttt    108240
     ttttatcaga atagttggct gtaaggattt caattgtgtg gtcaatcatt taaattttct    108300
     tttacctgtt ggagcaattt catttgctgc tccaagatta gcacggaacg atgaatacca    108360
     acaaagtatg acgccagatc ttataaggat caacatatct gcatcgcttc tgaatggatc    108420
     ggccattgct ttttccaggt atgtatttcc attatcttgc caagtttggt cagctctacg    108480
     gagcactccg tatctgatat ccaatcgatc ttcgccgtaa ttccttcacc agtaatctat    108540
     actttcccat ccaccatgac cctgataatc tacttatcaa cgaatgacta ctggaaccaa    108600
     agattcatag agccataaag ggtcactatc ggtagactcg tcatgtaata acggcgctat    108660
     cttgaaatcc ctgtatttta tgttatttta tttttccttt ggttcaagac tgtaacggac    108720
     tatcatccga actaaaaggt agttcgatcc agtaaatcga tggatccatt ccacggttca    108780
     gcttggtctc tggtttgttc ctaactcgac ccagattaat caaagtgttt ttcttttccc    108840
     tctctgtgtt cctcctctaa ttttccttcc ttgtattcat taccactgtg tacattatct    108900
     gcatcgtctg atctcagtaa gtcgcaggct tgccgagtac tcatactctt ccgctgatac    108960
     caatcgcgca gtctctttgt tatcaattac ggagtgaatt gcgctgatac acaccgacgt    109020
     cagccggcat tggtgttttc ccgtccgttc ttaccattgc aatccacgaa gcgatcagaa    109080
     gaaggtacag aggaaggtga taaataagca aagagagaaa gaaaagaaaa gaaagaaaag    109140
     aaagaaaaaa aaagaagaag aagaagaaca ataatcatgg ctattctcga caaggaaagc    109200
     cgttcacgcg gtctccgaat gccatcactt tctgcaataa aatccagaaa gaaaaacgcc    109260
     gaatcaccac cacggagaga ttcaagttcc gatgaagtcg tgataccagc acgaatggac    109320
     tcggcaccgg gccgatttct tcactcgcaa gagaaggacc tgccgcccaa cccgctgcct    109380
     tctcctcccc cattcccctc tgccccagcc gactcattgt caaaccagtc gccgtaccat    109440
     cacatcaatc ctacccctaa atatgaagac cgcccgcttc ccaaatttcc tcgagttcca    109500
     gttcccaagc gggaggagcc gccggctccg gttcctgctc tggttcctgc tccagctccc    109560
     gtacaacaag taactcctcc gtccagtgaa gatcattacc ctatccacta tcaggaacac    109620
     attcagccga ttgaggaccc gctagagagc tttattcccg agccagagcc agagccagga    109680
     gtggatggta ccagtgcatc tgtcgaaccg gtttcgagcg aagagagtaa tggaccatgg    109740
     acaccaccag actacgagcc catcgccgca cctctaaatc aattacacta tgcctgctat    109800
     caggaacatc ggtcaatgcc cactgccaac aacctctggc atcctcttcc atgtatgacc    109860
     tgccagaagt atgatcgaga agttcgacac cgatgcgttt tctgttgcct gcgcatttgc    109920
     gccagttgtt atcagacgct acagaaatgc ccgaatcgct ccctggcgca gctgatgaaa    109980
     acgatacctt cccacgagta gctgctcact cctcactgat cgttgctcgg atctctgtcc    110040
     aggatatggg cataggtttt atggtttaat ttcttataca tactttcggg gtgataattt    110100
     atagtccaat ttcgttgttc tctcgttgcc agggcttgct atctgttcat gctatgatac    110160
     gttaaggaat ctttgcaggt attccgccgt tatttattgt acatacggtc acggggggcc    110220
     gtgttttagg tcaatgtata gttactagga gttcgcgtat acagtataga ttaattttga    110280
     tttgacattc cctttctaac atctatatat aagcatatga agtaacattg gatgtgattt    110340
     ttttaagtat tatatgatac aggtaagtca ttaatcatga tcctcctcgg tcacacctgg    110400
     acatccctcc atttctccgg tctcatagcg aaatttacac caaaagcagt aatggtgtgt    110460
     ctcgcgcaga tactgcacta tccgggccag tcgctcgctc ggctcgagtg cattaaactc    110520
     gtccagttct gggtcttctt cgtcaagctc ctgctcaagg atagttgaga tgtcaggttt    110580
     gttgtcgagc gccactttat cctcccgttc cagcgtcggg tcgtcgtcat accctggtaa    110640
     ccgcgggttg gggaagaatg acgatggcag ggacgtttgc aatagatgcc gagcctggat    110700
     ggaacgttct ttctcctccc gctcacggac gagcccgcga tataggatgt tgacttgcga    110760
     ggtcggtttg accttgacct tcggctgcgg gttatttgat ccactggtcg tatcttcaga    110820
     ttcctcttct tcatgttcag tcggggtctt tccacgcttc gtttggacgg tcttcccatc    110880
     tcctgtctct gcctccgcat ccagtcgttc ggcaaccttc tgcgcagcgt gaaattgagc    110940
     ttctgtacgt cgcgtctccc gctcaatgcg gacgcgatca cggtaatcac cctcttcctg    111000
     ctttactttc ttcactgcct cttcagcctc ttcccggaac ttgcgttttt tttcagtgtc    111060
     cagaccaata ccaccccggt cctccttgaa caccaaattg agtggctctg ctcggccgcc    111120
     gattttgcta tcggattttt gatttgatac tctctcacct tgggatttac ctaatgcttg    111180
     tcctggcttg aaccccaatt tggccatcat ttggaatccc ttgttggagg ggttaagcgt    111240
     gctggtggct aaggcggcat cacgacgttc ggcttcctgg gctgcacgtt ctgctttgga    111300
     tgggacttta gctcgagctt cggcctgggt agagaagagg aatatatcag tacatatgcg    111360
     cgccctggag atatgaggga aacagagaat aagggatgta tgggcatcag cacatgctac    111420
     ctacctctct ctgttgtcgg cgttttttct gggtaaacgt ttctttctgc tgcggctcct    111480
     caatcaccat agacatgtaa tcatcctcct cttcgtcccc tacatcaggt gcggggttct    111540
     gatgaggggc cattcccggc gaagacgcga cgcgaaacgg acacagaagt agacccggaa    111600
     atacggatga gagacaaacg atgcgggagt tagctcgaag attagatcat gtataagccc    111660
     ggcacggcaa tgttttcttc aagcggagaa tgtccgagta aaccaggtag tcttcttgtt    111720
     ggttgaatcc tttgggtttt caattgcggg gaagaaaata gattgcggtt tgttcaatgc    111780
     ggaggaagtt tgttctccat ttaatatctg attggtctat tttctcattc cggccccata    111840
     atgaagagta cccaggaata caccttgtgt agtatcactc ggctatatct attcttaatt    111900
     gaactgattc ggagcattgc ctctaaacgt cgatgcttta gcgtcaagca ctgtccaccc    111960
     aatcagctct ccacaaggtg tccaataaat ggggtcaacc agctcatttc ccctcctact    112020
     ccctaggcat tgccgattaa agtcggtacg cgcggtgaca ccattgatgg ccaatttttg    112080
     cctaacgatg gctcgagtcg gctactgaac ctttttctgt aactctggcc actggcgtcc    112140
     ttggtattga tcagttgtct catttagtgt atagttggag agcatgctag ctctcatgtg    112200
     tgccatacgg tggtgatcac tggccggtaa gccgtcaggc tagctaaggg cttgcagcgg    112260
     gaatgttaaa aagacaggca gagcctacca gtaactgtgt ttcctggatt taggctccct    112320
     attcacatat cagaagtggg cacggggtag agttgcaaat gctttcggaa tggcacgata    112380
     cattacattt gcccaattct tcctattgtt ctgcttagcg gctgctcaag aagtggtggt    112440
     agaccttgag tacgctcggt ataggggcaa agcgctctcg aacggtttag tacaatggct    112500
     gggaattcga tatgccgctc ctcctacagg accattacgc ttctctgccc cacagaatcc    112560
     aagcgtggta gctggaatcc agaatgcatt tgaggtagga ttgcttatcc ggtattacat    112620
     accgcacgag agctgatgct ctctcttaag cacggcccta cgtgtattcc cactagcgaa    112680
     tatccgattc ccgaagatac atcggaggac tgcctgtttc tagatgtgta ttccccttat    112740
     agagctggta accattcaaa gttgctgccg gtattcgttt ggatccaggg cgggggcttc    112800
     aatcagaatt cgaatccgaa ttataatggt accggcttga tacaagcgtc tggtatggga    112860
     atcgttgtgg ttactttcaa ttatcgtgtt ggcccgtatg gatttctctc agggagagag    112920
     attctacaag acggaagtgt gaacaacggc ctaaaggacc aaatcaaagt cttagagtgg    112980
     gttcagaaac atatacacaa ggttagagct tagatactgg cagcaacatg acaatgctaa    113040
     cgaatcctcc aaagtttggc ggcaacccca aacatgtggt tgtaggtggt gctagcgcag    113100
     gaggcgcctc catcaccctt cttctctcag cttatggtgg aagggacgat ggtctctttc    113160
     acgctgctgc tgcggagtcg caaagctttg ctaccatgct tagtttaaaa caaagtcaat    113220
     ttgcatacaa caacctagtc atccgcactg gctgtgcaag tgatgccgac acgctggaat    113280
     gcttgcgtgg tctggacgcg gagatccttc agcgtgaaaa catcaacaca cccttgcctc    113340
     atgcacaaca ggcgccccta tatctatacg gaccagtggt tgacggtgat cttgtttccg    113400
     attatacgta ccgtctgttc caccagggcc gttttatcaa ggttcctgtg atattcgggg    113460
     acgacacgaa tgaaggcacc atatttgttc ccaagaatgt ttccaacgtt ggggaagcag    113520
     atacgttcat ccagaatcaa ttcccaacca ttaaattgga gcaatttgct gcaatcaacg    113580
     cctggtacct ccatgagaac cagacgcgcc aatttcccga cgctgggcct tattggagac    113640
     ctgcaagcaa tgcatatggt gagatgcggt atatctgccc cggtattgac ctgtcgtcta    113700
     tctacgccag ggccgggatc aacagttgga actatcacta cgccgtacaa gacccagact    113760
     tgaaagaatc tggcctcggt gtagatcata cagtggaaat caacgctatt tggggcccaa    113820
     attatgtcac aggagaaccg ccctcatctt acttcactac caatgcgcca attatacccg    113880
     ttatgcaagg ttactggaca agcttcatca agacatttga tccaaatcct catcgttacc    113940
     ctgggagtcc acaatggtct acttggggta atgaagggta tcagcgcatc ttcatcagaa    114000
     caaacgaaac caggatggag gaagtaccgg tggatcagag ggaacgatgt gaatatttga    114060
     tcagcatcgg accagagctt cagcagtaat accaactgta cctatcttga ctgctactca    114120
     atctacataa ctcttgtaac caacataggc aattgggata tatttgacat aacggaaaga    114180
     gttcttttgt tcggcagcct tgacaaataa ataataaaga gtatatacac atgttcggca    114240
     tgcaaagtct aagcaccaac ataatgataa tgatacctga aacccaacca aaaccaacca    114300
     gaatgtcatg actagcgaca tgtttaccgc ttgccctggc gcaacctcct ctccctctcg    114360
     taagcattgg cctctctgcc ctcctggttc tgtacttcgg ccacaagtcg tttgtatttc    114420
     ttctcgtact cggcatcgcg ctccttcttt tcgcgcagct tctcgcgcgc aatgaagttg    114480
     gcatccttgc gtagttcccg catggcgccc ttgcgctcgc gcttgtactc ggccttgagc    114540
     cggttggctt ccgcacgctc gcggttgggg tcgtagtgct tgtccgggtt gaaagtatcc    114600
     tcgaatttgg gaatagcggt tttaatagcc agcgggcggt gatcatggag tagaagcggg    114660
     cggcgagtaa ggcgggcttt cgaggtgtgg ccatcgagtt tatcgagggt cgactgcagg    114720
     gtatcttgaa cgacggaggg aatcttaccc ttgcaggatc ggttcaggaa gcggagaact    114780
     ttctgagctt gatcgaagat ctcaaggaag gctgatatgt ctgaccacat atcggaggcg    114840
     gtgctgagga gagagatgaa tgtgtttatg agggaaagtt tgagctcttc ttgggccttc    114900
     gggctgtccg ggccagtaat gtcccagaat tgaagtttcc tcgacttcag cgacttggag    114960
     atcttcagtc gtagagattc ctccggacta cgagacggga agaggccgag gctgctcttt    115020
     ggctcctccg gggcaaggtt acacagggcg ttgaggacgt agttgatcaa ttcgggcatg    115080
     tagcgcttgg aaactaattg gtattggaga accaggcttg cggcatatgc acctgttgcg    115140
     aaatctgcga gaatgttcac ggcaccctga cctaggtacc gcgaaaggca caggtgtgcc    115200
     ggcgttgcga cggcgtggaa gtgatcagag gttgggaagg tagtggcaat tccggttaga    115260
     atgactaggt cactgggccg gagactaagt ggccggtctg ctgcgatttc acgtagacga    115320
     gccctgaact cctgagagac gctctcgggg tggctctttg ctagagagtg tacgtgacgg    115380
     aagatgttct caagaatggc aaaaggagga tgctcaggct gttcggccat gtaggcgaca    115440
     tgctggataa ggatgcggga aaattggcca agcttcttct tattgtccgg gtgcagacga    115500
     tgatggtgca gagctcggat tctctgaacg accaccggaa ggtccgccat gggcacatct    115560
     tgaatgacct ggaggaactc ttcatgattc ttcgggcaag ggtatgtata agccaaccct    115620
     tcattagctt ctggtgcatc agctgcagca ggggcttctc cggtgttatc ggtagggaga    115680
     gtaaagccgt tgataagctc gtcttcttcg tcctcttcca tttcctcttc agactcctct    115740
     gcagataata cctcctcatc actgtcacca attgataagc taacatctga tctcgtctcg    115800
     acaagatcat catcgattat aaaatcatcc tcgtcttcga cgctaagctc agggcgggta    115860
     ctgatctgac cagaagactg ttgcaaccca aaagccttcg cgtcatctgg gatggattcg    115920
     tcttcagaca tctcacttcc ttcctcctcc acctcttctt cttcgtcttc ctcttccgac    115980
     tcgcctactt cctcgccgcg cattctccga actcgctctt cttctagagc cttcagccgc    116040
     tctgcttcct ccgcggcctt ctcctcctct gtctttgtgc ggtccgttgg cttggatcgc    116100
     ttatcgaacg ttagttgctt taggcgctgg tcatactcct tttcggtatc tcctttagct    116160
     atgccctcca taagagcagc gcgatctggg ttcatagatg ccagatcact cttcggaggt    116220
     tctggctttg gcggtggctt cactcctctt agcatttcga aaagatcagg aagtcctttg    116280
     tcgagttctt cacggagatc gtcatcgtcc tccttagctt tttgccgctc atacttgtga    116340
     agtttcgact tggcaatgac ctccttcata acttcgtgtt tagatttctt tcgttcagga    116400
     tgttcttccc cgtcttctag atcctctggc ccatccatct cgccatcatc aaagaaaact    116460
     cgtttccttt tccgggctgc ttcggtatcc gaggcatcat cttccagccc gcccaagtca    116520
     ccctcttgaa aatcgtcttg gtcgatatcg ttcaaagact ggcctttgtg tgtgagttgg    116580
     aactcttctt cctcatcatc cccttccaga ttgaacattg attccttccg catcttgcgc    116640
     tgacttgctc tggcataacg ttcggcggct ctctcttcag gcgtcatagt cggatcatct    116700
     tcaccgaatc ggcgatctaa tataccaccg accttgtttc tcttctccat ttctcgtaat    116760
     agcgtttgac gtctctgtat gagtagaacc gttattaaat aatgtgaaac ataaagctgc    116820
     gatgaaactt actttttctt ctcccagtga cttggtaaca ccaggtcgcg cacgcgaagc    116880
     agctgtgcct gaatttccat ctcgagttgt cacatcaaat tttgtccgtg tgccccccgc    116940
     tttgatttcg aacggattga atcggtctcg aattgactgc aaagcggcat tgcgctggac    117000
     ccgattttgc gccgcagcgc cactcttcgc attctggcgt ttttgctttt tcgattgctg    117060
     tggccccaga actccactct cacggagaga ggccttgagc tgcttcaact gcgacggcgg    117120
     catatctgcg tgctgaagtt gacgcaaaag cgttctgttt ctccttcgaa atttttggcg    117180
     gcggcagtat gtccgaaaaa aagttatact caccgctttt atgtgctgaa ttctgccggt    117240
     ttgtctttag atcgtcatta ctctccgctt ttctacaata ccatgagtat agatcgttct    117300
     tgttctcata ccgaaccatg ccctctcata tgaacgatag gctgctatgg ctatgcctag    117360
     gtaaggttct cacgatttga ttatggcaag tgaatgggcc gctgaactca taggtgtttc    117420
     tcttttcttc gctgttcgcg gcatagtcac ggacctccgc cgagtgcgag atctgacgga    117480
     gattaagcat gtcgagaagg aagataagat gatcagtgaa ggcacggagg atggttggtt    117540
     acatcttttt ggaagtggtt tatccagtgg ctaattgacc aacagccctc aaactggaca    117600
     cattactcaa gctctctgag agcacaagtt acgacctccg ggcagcgtat ggcagctcca    117660
     gtgtacacag tccgcactat agacactaat gtactttata gtgctttgcg tatcatcgct    117720
     gaaagatcta caaagggaga aacgcgagat ttgcttctga gggaccttgc tagcacagac    117780
     acagagagac gaagcaaagc ccttagtgcg atgtactttt tagtatctaa tcgctcacgt    117840
     acggatcttg catattcagc ttcgtgatat ctcaagttga tgctgactgc tacgatttag    117900
     tttctcggac ttccgtatgt gctagactga aagatccgct tacatacaac gctcttgtcg    117960
     actgtctctg caatttcctc aacgaacata ccgaagagac ctccaccaca gtatcaccca    118020
     ttttacctaa aactagacct ctcggggaga agaaggcgct tggtatactg aatctggttc    118080
     ttccagaaaa tgtgcccgca gctctggagg ctggtatcgt cagtcgttgg ctgtcaaaat    118140
     atccgtttcc ctgcgcgctt tcggagccgt cgcgccggca agatgtagtg atactcatga    118200
     agacctggtg gtctgatgat actcttatga gttcaatatt tagcacactc tcttctcatt    118260
     cagatggcac gaagcaatta cgcaaatatg gtctgatggg tagcatgatt gaagaaaacg    118320
     accaggatga tgacgacagt gacatatgga tggtagatgg cgatgatact gcaggctcag    118380
     gtcgagtccc ggggaggcgc ttgcgggaac ggagtgctga ggagcaggct gtgaggagac    118440
     gaaggagaga ggctatggtg ttgagtgatg ggggacgacc acttggtcac gacgatatca    118500
     ttcaactgcc tatctccgaa tgattcacga cgggtttcct ttatattttc tccatcgtga    118560
     gaggaatgga cttcatctac tcgatggcta ctctatgtga ttattgtagc gattggttcc    118620
     ttttgcttta tgataccctt ttgtcctgat attacatagc gtgtttcatt aatgttctta    118680
     aatgtacaat taggatggta ttcatagtcc aatccatgct gatttggaag cgtgatccac    118740
     cttcttccga ctgcttttaa gcataccaag cgccttgagt tctgataccg cccgatagaa    118800
     caatgtcata gtcatccgtt catcgcaagc gtcaccttgt tcactctcaa acaccgcata    118860
     aaaagcttgc caaaggtcgt aaacgttcac cagtgccccg gactcgagat acagctgata    118920
     taggatagca gtggctggct gtcgcgcgga aatcctggcc tccgtcctat ccgacattga    118980
     cattaggtag tcgaaaggat tggctaaggc acgttcgatc gcgaaacgtg gcctagggga    119040
     gaagatctcc ttcaagggat ttttcatatc aagaagaaag gcttcatgca agaacaagtc    119100
     ttgtggtatc accaatgttt ccacaaaata cttttctgac agagcataaa cgcgatcgat    119160
     taccttggta tactcaatat tttgctgggg taatctggct ttgctcttac tgagcttcac    119220
     ccgctgttgg accacagttg ccgccacaat ggaattatgg ctgtcatact cactccggag    119280
     cggctccgta ccctggtatg tctgcacaag agcttcgaag tctttcttta tttcttggaa    119340
     atccggacag tcagtcaggt cttgaggcat aaacgccagg acttccttca gctttgagga    119400
     atccaacgtt ttcaggccct taagaaggtc atccatgtaa gttgaatctt gcaaatctcc    119460
     ggatagtgca cgaattgaca aatccggtat cgtaagcttt tttcttatat ccatgctctt    119520
     aaggcataga tagaccgtct tgacgacatg gaatatactt ctcatccgtt gctgtccgat    119580
     ttctatgtac tttaagcttt gctgaaacag aaactcgtcg ttttccaaca ggctgcgcac    119640
     ttgttcagta gaatcgtcat caagtagatg ctcgcaaaat ctggtagggt tagttaagaa    119700
     aaggctaagt tgaggtaata gatcaccttc ggaaagatgg gaggtttcta attgcttcgc    119760
     aaaccttccc ctgttgccta ttgacggaaa tctcttctga taggagcatt gccaatggat    119820
     tggcaaagaa gtgtgtcata tacgcatact atccccatta gaattgatcg gttcagtacg    119880
     cgtaatatgg taaatacctt aactgtccga ctgaaggcct ccggtgtttg gaaatagtca    119940
     ttcgatttct caaacaaaac ccctgtaata ttgcgtccta gccagaatcg tccgttttgg    120000
     tctgcttgta accgctcata catgcgatca acgcaattac ttgctccgtg aatctcaaag    120060
     tatctacctc taagaagggc tacgcttgac cgaggaagcc ttccttcgaa gagttcaaca    120120
     gatgttgaga taccaaacaa taaggtaaat ggtatccggt caagccagga actagaacaa    120180
     ttaacttaat agactagtaa ggatcgtgag ccttacctta agagggacag gagatcagtt    120240
     agaatgttcg gatcaaacgc ttcactgtca cggaatgcta cgaccagctt tttgatccct    120300
     ttccttttca cataatctcc aagtaaatcg agatcatacc caagaagtct gggtccctac    120360
     ggtcttctta gcacctcgcc catatagagt ttggacagcg taaacccacc tctcggtccg    120420
     tcaggaaatt ctgataccca ttgttacctt ccgtgtttgt gacggcagct cggataatat    120480
     tcttcagcgt tgccttcaga tttggcgcat caccagactc cagtatgacc actccgcctt    120540
     cctctgacgc agctaactgg tcattgagct tggataacag tctgccaagc gatgaaacat    120600
     tggatccgac tgttatcaat gctgtgggga tgcagccgtc atatctattg ttggttagtt    120660
     atttcgaagc gccttcgtgt ccaaataacg aactacctac gtcagatgcg aggtcgacct    120720
     gacgaaggat aaaacgttct caagaacttc ggaatccacg tcatctagaa tctcctgcct    120780
     gccgttagca cgacatacga taaccagcga acttgcaagc ttctattgtt tgcgaacctg    120840
     gatcttggtt tcctgagttg accacaatag ccggtaggca ttgtacctca attcgaccga    120900
     tgactcgttt tcttcgccgt ccagtaaagg aacaaagggg tgcgattcac ttttctgttc    120960
     cttaatctcg ggttgcacct ttcgtcgctt cgaaggccgc tctccgtgag ctttcgcgga    121020
     agttacaggt cgatagatgt acacacccta caaaagcatt agtgagtttg ggaccgattt    121080
     gagccataag cgcaggacag tacctgagtg tttgagccat ccttggctac accttgtgtt    121140
     tccgtatcca agtccataat aaataagcct cgagacagcc tgcgctctgt cgtctgggga    121200
     ggaatgaata tgtagaatga tttactgaaa ccgcggcgga gctcgcgttg acgctaaacc    121260
     aaaccgggtg gtattggttt tccgctgcgg agcttcatgc ggtaactctc cgcaaaactt    121320
     ctacttttgt tactgtcaca gcaattctcg ttcaccagtg ttcttttgtc agatgatcta    121380
     accgtctata cttcatgctg cgccaagctg ttcgaggagc tcggtggtat cagcatgtgg    121440
     cgctcagaac accgtcggct ccgtctcttc ctttgctgcg tacattctcc gtcgtagcgc    121500
     tacgctcctt ccagtatggc ggccccaatg acaaggttcg gttttacgag caagatactc    121560
     gtgggagcaa aaagagaagg caggtcaatc cagaagccga agaaaacgct gatcgggagg    121620
     aagtggaggg cgagctggct agacttgaga aggaactgca ggatctgaaa gaaggtcctt    121680
     acggccccaa cagtcagttc atcagagagc tacccgagaa ggaaagagcc attgcactag    121740
     aagctctgag aaaatatgag gcggagcatg gcaaggatga acccgaaatt ggcctggaac    121800
     aggtttttga taatgagctg gatgagatgt tgaaagagga attcgaaggt ttggccaaag    121860
     aagaggaaaa ctggcattcg acagggcagg ataactcacc aaaaaagcct gtacggcgcc    121920
     cctacgaggt tgccgtaacg actctggaac accattccta tatcgagaaa ttcaaccaat    121980
     gcctgacccg aatcgcaagc gatggatcaa acgaacgact cggggcagaa ctatggagat    122040
     ggtaccgtcg ttgcaaacag atgatcccag aattcctaga gtcaataccc gaagaagctc    122100
     tgacgttgtt atggcatgct caagttgggg actatacaag atcttcccgc acaagccata    122160
     ttcaaatact cgctgaagac gcaatatcag ttggaaaatc gctctcgacg ccacatctcc    122220
     tctcttacat tgagtcgctc cgaaagactg gcaaaacaaa ggaagcgcta gatcagtggg    122280
     aagcacatca aacggggctt tcgcaaaata agcaagacct tgaagcatat tggaaattgg    122340
     gtgtacgact ctttgctgct gaaaatgacc ctcagcgagc acaggacatc gccctcgcgt    122400
     ttctagcaaa tgacaaatca cgcgaacctc gcatcctcct tccagtcatt actgcttggg    122460
     ggcgacagcc tggcaaagaa gctgaggtca aggcctgggc tctatattta caactgaaaa    122520
     gctttcttga gaacacctta actatggacg attacgataa catcagcatt ggtcttctga    122580
     aagccggtag accgaatctt gctatcgcag tgttcaaaga tatgatggtg acagggcaag    122640
     acccagcaaa cgattcgacc tcactctata aagcagccgt cggtcttgtt ggtcatcttc    122700
     aggcatcgag tatttcggaa caggatgtga acaaggtatc gctttcgacg ctaacggtcc    122760
     tacctcggag gttccagaac cggttcttct atgccagctg gatgaagaag ctcattggaa    122820
     tgggtgaagt tgactctgcc gcactggtaa ttgagttgat gtacgaacga ggagtgaagc    122880
     cggattcaaa gcacctcaat ggattgatag ccgcttggtt acgtgatggc aatcccgacg    122940
     cgcgagagaa agccgaacga ctggggtggt ctatggttca acagcggatt gacagtattt    123000
     gggcgcggac caattcaaca ggaagctctc cgaaattgac cgtaagcccc gatccagata    123060
     gtcctcgcat acccaaatgg atgcaacgag agatcccatc cgcgaacatc gaaacatttt    123120
     ccattttact cctccattat acccgaagaa gcgacgatgg gatgatcaaa tacctagtta    123180
     aatgcctcgg cgatgctcag atcaagccaa actcctattt catgaaccac atcctatatg    123240
     ccgagctccg gaaacaggat atcggatctt tgtgggacaa gttccgaacc atgtctgcat    123300
     cgatccaacc ggatctggaa acttttgctt gcctatggga ctgcggcaaa cttcagtatg    123360
     atcgcggtcg cacgacgttt gttgcagact ttccgtctgc tcgcagcctt tatgcggaga    123420
     tgatgcagtg gcattctcat ctccctacac gaggccgagc cgctgcgcaa gaagagttct    123480
     caaaagaact ctataaccaa ataattcgtt gcttttgtct ctctaaagac ctccctggca    123540
     cactgattgc gctttactcg ttgagatcaa tattcgggtt ctcccccgac gacgtgaccg    123600
     ctcgtctcat aatcctgcaa gttgcacgga tggccggtgt cccgcctggc acacccaagc    123660
     gccggctccg tcgcctttca acgactccta agagcaaaga gaacatctct catgtcaaca    123720
     ggctggtaga gatcctgagc gagcgcaaag tgtctgcact ccaggcgcgc gggcttactc    123780
     tcgagactct cgagccgcag gagcgggagc agtatcagct cgatataatg actgaccttt    123840
     tacgtattat catgggccgg gctgctactg aatcgagcag agttgaagat cagattgcgt    123900
     ccgccgcaga agagatgaat gtcctggggg tcgatcttgg atcgtcgttg gaggataatg    123960
     accttttact gtaggtctat accagtctct ttatggaaat cgggaaaagt acatcatggt    124020
     gtttagcggc attgctttat gaaatagaag attgccacgc agcatacgga tcggcgttca    124080
     ggcggtggtg ctatgtatat aatcatggct cttgtgtact ataatagatt catcctctct    124140
     tgagctatct tggacacttg ggtcgtccta tgtttctgaa cttcagtggt taataataaa    124200
     tttgcgcctc ctttataatt atcatccaag ccggttgtgg tgatctttag aacttcataa    124260
     tcaccattca ttctgttcgc tgagaaatca caaccgaagc gtacagttag gtatataatc    124320
     agactccatc gtacctacat aactcagagc caactgccag gagggagata ccacatagac    124380
     acactcaatc ctctatcaga cgttctagat accccaaagg cttcgatcac gcaaggtgta    124440
     gacccatgga tcctctccga accgggcacc acctaccgca acagaagcct aaaagaccac    124500
     agaccaccca gcagcagaag atacaagggc gcggacgccg caatcaagga agcggcttca    124560
     ttgcggacat tgtatctggc aaagtgacac gtgctggatc cagcataatg gctcggatga    124620
     gcgtctctga tacactgggt catattgccg tccacccact gttcgatcgt tctattagac    124680
     acattgaggt agagcgtagg agggaagtaa cgctcaggaa cttcgcacca gtattggtgc    124740
     tcgttgtatc tatggatgac attcggcttg cagcaggttc gcagtgtgtc caagtcttct    124800
     ggctcgttcg gttgatcgcg aatgtaataa gaacatacat cttttgagtc cagttcgggt    124860
     ccgtgtaagc tttccagggt ctgcacgggc agctctgttg ttgccgtcgt tggcgtcggt    124920
     ttttctgttg tagacatgtt tctgatttcc ttgatctctt ggatatggat gatagaatca    124980
     ggtgaaacta gaatagtaag gtcatgcaga tctcacatgg ctcgaatatc tttcctccgc    125040
     aaactatgct gggtcatctt gtttcctacc ttatatgcct ggggggttat ggttttgctg    125100
     cttctgtccc tccgccaaaa cagaacaaaa ccatggaaag gcaaacggtc tttgttcaaa    125160
     gctctaaggc ggttacttac ccaatcagag agaaatgcat cgagcaaatt ggtttctctt    125220
     catgcggggg ggattgttga cagtccagca ctggtggaac cgacgttgaa cagcctccag    125280
     tgagttgcat agcatagcaa ggctaagacc agatcaaaca aagatacgat agcgatatga    125340
     aatctgatta gccaaattta cacatagtgt atcatagact ttcgtcgggc gtagtctttg    125400
     tctagttggt cttgctcaag tcgtacctga cctaactaca tgcagtaggg caagtgccct    125460
     actaatcgtc tgactctcat gagactactg gcactcgtcg gcatctgtta gattctttct    125520
     tgaattggtt acacgaatgg agatattaca ttccaagctt tatcggtatg ggtctgaccg    125580
     caagcctgca atttcaatgg tttttgacaa cccgcgctat ctctcgtctc tgccgcacat    125640
     gcactttact agtccacctc tcgttgattc cttaacataa ctcatgaggg gaagactggc    125700
     attctacttg gataaagttt aaggggtaac agcatggatg ggggtgaacg ttttgtatat    125760
     atagggaagt caggaactgt tgtatgttga accgtgcttt acgcaagata tccaagcctt    125820
     ccgagctttt acgaattgca agtcagaatg tgtgcaatat acctgagaat caccttcctt    125880
     ctctgcctta gcctgtccct agcacacgtc atttacatga atgacacaac aggcgcaaac    125940
     aacccattgg aagagagaca gctcatgggc caccagttta tgtgttgtat gggggactgc    126000
     agctatgagc tcgttgggga tggaaaccca catacggatt atctccacag gcaaatgacc    126060
     agtacaggag agtgtcgaga tggcccaggt gctaagggct gtggagttgg attctccacg    126120
     agtcatacat ttgggtacac tgtctcggcc ggagcgaata tcggatggtt cgctcctggt    126180
     ttctcagtga cagagtcatg gaccgtgggc gagaccaaga cctgtagtgc agatatcaat    126240
     gcaacggtct gtctctggta cgatatggca tatgtgagta gtactctatt tcgatcttgc    126300
     aagtcgtcca ttctaataca ccgtgacaga ccgcgtacac agtacaagtc gtcaataggc    126360
     gtctgtatag ctcggtgtgt tctaaccagc ccacaggacc gtgagtgatt gatgagctct    126420
     atcaccgttg ttctttcact gaccaggttg attaggctca tcatgaaggc gccaaacgtc    126480
     aacaatgccg gtggtggtca ttggtactgt gcatatggcg atgaatgccg tggggaaggt    126540
     gaagaatact ggtgtctgac ggaagattgc ccaccaaagg gaaagcctaa acctcaggat    126600
     taaatccaga cccgatgcat acatattatg tacctaacta gcctatgtgt gaggtacaca    126660
     gcaagcgtac attcaacggg gtatagagag ggcggtcttc tgcatgttga gaagtaggag    126720
     tcattgatta cttcaggccc agcgctacta catgtaatcc gatgctcttg aaatgaacca    126780
     gactgaacgt tcggcagagg caataggaca ctgtagatgt tgcaatcaca aatgaacttc    126840
     aagacaatgc actcactgta caagtgcata ttccaactcg ctcctacaac aggtagctcg    126900
     gtacaacaac cacacagtcc aaacaacaca tactgctcca gatggccatt aaatttcgtt    126960
     gactccccca atttacggag acataaaatg tcaactatcg cagacgcgtt aagtctctat    127020
     attccaatac ggccatggta gagggggaaa taacagttag ttccagtgta ggttgatcag    127080
     gataactcaa tagtacgcca tacacagatc tctgtgtaag caggaaaagg caatagctaa    127140
     ggttcctcct cactggaata taaacggtac tctgagttaa gatatcgtta acttaattca    127200
     acagttctac ccaaactaat ctccaaacct tcgctattcc agctaagcta tgattctttc    127260
     ccaagctcta taacattccc atccatcata cactcattaa catagaccaa cattacgtta    127320
     tttaccgggc cctatcaggg taggcatcgt acaagccatc ggacacactg atatcgctga    127380
     aagtgacttc tccctcgcca ttatggaaga agctaatctc ggttgagttg gcataccagg    127440
     tactgcactc gacattagca agtttcttgt aaattgaaaa acattcagac aggacttacc    127500
     gagcccaggt agaaagggca aatcgtgagt tagcataaac ttcaagaaca gcgttgtcaa    127560
     ccacaatagt gagatccaaa gtctcaatgt gcgactcatc ctctgcagca agcttgacat    127620
     tgtggcggtt tctgccatgt tctctatagg catccttttt cttcctctct tcttgtttat    127680
     catcatcgtc gctcttgttg caattcttat tgatgtcaaa caaccgcaga cgccctgact    127740
     cggtagtagt gttcaatttc agtggtggtc tggacggctg cgcttgtgtt actgcggcca    127800
     atgacgatag attcattcga gaattggtag tagatagttg tcgactcaag ctccgaagag    127860
     agaatcttga aaccagcttg aactccaggg tcacgagcgg acttggggaa tgagagctgg    127920
     gcattaagaa cgaagaactt ggtggtgggc gactgcttga agggaacagc accgtcttcg    127980
     caaaacgtgc gcttcggctc ggtgaaggac gttttatttg tcattgcctt atatgtctct    128040
     ctcgcaatct tgattcccat tgtttcaagc ttgagacagc tattctcgct atcttttacg    128100
     caccacgagc cagtctccga ggcaaggtca ttatcgacca cgttggaaat agtctgttta    128160
     tgtaatttac gggggagtag tagcgtattt tgccatccct gctgctcact tgggtatccg    128220
     gccacgcctc cgaagacgtc tccagtcagc cacacgtacg agataaagcg atcaggcgca    128280
     ccgctcttct cggaggcctg agacgtcgct ggtaggacct ttcctgccgc ggcatatgag    128340
     gatattcccc agtcaagaac acccgccatg gtaggctcaa aagtcacatt tccgccgtcc    128400
     ggtttcaaga tattaccgga cgcccacagc atgccatgca tcgaggtaac agattcggtg    128460
     attgggccat acgaaccctc cacgccgaga gtgataaaag tctcgccgtt gacattatag    128520
     ccttctttgt cgagactgaa cacattccca acttcgaaat tgtagcccca tgccttagcc    128580
     cagtcaccgt tgccacaggt cgagttaaca ggctcactcc accattttcc aaggtactcc    128640
     cagtcctcat aacccgatcc ctggttgcga tagaggaaca ccccgggccc gacatcgtgg    128700
     acaccgcccg agatagcagc ataccaagtg cccgagctac tgccaacagt gtcatctagg    128760
     tccttattct ggaaaacgta agggtcacgg aaggcagtga catcgatccc ctacaatggc    128820
     ataactgagc cattggctac aaaggctttt gttccttgga tagctcctct ttaaactttt    128880
     agcttcttcg tcggttttct gactcgaaac aagggcgcat accaaccaaa tgacagcgtc    128940
     aacttcctat ccatagcata aagagtcatt ggccagactt tcctccgatc ataagggatt    129000
     caacggtatt gtgatcttga gacctaattg agttctttcc ataccacaac tattccgtct    129060
     ctgcaaccac taaaattcgt tggtacaacg ttctaccata gcacaggtgc aacttggcaa    129120
     cgaaagaatg cgagggccag gaaagccttt ctgagtgaag caactacttc cgactttcaa    129180
     atgaatggat cgacacgccc agcgtatctc tctgttgatt gactcaatcc atataaagta    129240
     caacaaccac aaacaatcaa ctaagccaca catatgcctc accatgagta tgcttcctca    129300
     aaatactcaa tcccttcgta cccctttttc agtatacgat gcacactgcg tctaacctca    129360
     tctgacatat ggggtgaccc gcatgtgagt accgccattt tgtgcctggc aatctgcgct    129420
     tctgtagcgg ccccatggat gatattctca atattcgggc gtccacgctc aatacgcaat    129480
     tccccattct tgttatcagc agcgcagtgg ctattacagc ctttcgtaca atggaagcgc    129540
     ccagtaaatc cttcgatttc tagtgcacca gcaagttccc taccacaaag ctgctgcatg    129600
     aatacatggc cgcggcatgc ccagaccaga gtaaggttgg aagtctgggt ttttgtatcg    129660
     tcagataccc tagagcctgc cttcgacaat ctggaaacgt gatcatgaat gtaaggtact    129720
     gctgttgcta tgccggtccc accaacgatc atgaccacag tgccgtagtg atgcaacgga    129780
     agtgtatgac cgtaaggacc ctccaaggat ataggaatag aggtttgata atatccgttc    129840
     acagcactat catcagagga tgatgaacgt aaacactggt ctttcagtcg ctttgtccaa    129900
     ccgttataag gacgaatcca gaaaacaagg tttccaagag cagggtcagt ggtagaagat    129960
     tgggatccct gtgtaaatac ctctgtagga gttgaagtga atgggttctt ctcgttaagg    130020
     gctccagtca tatagtgggg tccttgttgt gcattagatg aagacgttaa tggcgacgtt    130080
     gggtttggtg ctgtgtaggc gccgactgta aaaggatggt tttcccagcc acgccaactg    130140
     aataattgat atagatggaa gtaatgccct ggcaaaggcc ggattgagcc atctgcttgg    130200
     acgtcaagtc ggacgacatc agcctcttca ctatacgtta ccattgctgt agttgtttgc    130260
     agatgcccag gggtagagac gcggatgttg caatatacga ggcgtacgag gcgcaagaac    130320
     cgatcacagc accatatggc aaccactggc cagaggtagg cgttatattt agttccgaaa    130380
     acggaagtat gtctgtttta tcttgtaagc cggtctcgca tctgccaaag tcatagacag    130440
     ggagggagca aagaaggacg cactggaaaa gcgcaacaag aaggatcact gcaaatagga    130500
     tgtgcccaac caaaaataac tcataacatt tagtacgaat gtagggaatg gagaggccgc    130560
     aaagtagccc catcatagtg gcaccctaaa tattaattaa tatattagcg gaaggaattt    130620
     gacgtggttt agcttagact cacaataata ccaaacttga accagagaac atgcaatcct    130680
     tcttcgtagt aaggtccttt gtgagccttg ttagttatat ggctacaaca gacagtgatc    130740
     aaggtccata ccatagatcg tatccagaac agtatatgat atcgcatgta caaaggcaaa    130800
     tatggctgtg agacgactca ggtgccggtg gaagacattg aaagtgctga agctccaacc    130860
     agtggcccaa atgaagatat tgttccgtcc agcgaataac cacacccatg gcaaacaggc    130920
     atatgcgaac atgctagtcc gttgagcaac gtacttccat gcctgccgcg aaatagttgg    130980
     catcctaatg agcatgttag tcgacacagt accacatggg taagagtgcc attatcctta    131040
     cgtgacattc ggaatgaaga tgtcatgaaa cccaaagttg aggataatac acatgatcca    131100
     aaaccagacc acaactagaa tctccgggcg attcgggatg ctacatccca ggagccggcg    131160
     ttgatggtac gatccgagag ctgcagggac ggcaatgtaa gccttccaat aaaagctaag    131220
     acgatcccgt attccagctt tgtctggtaa ctgttgttct cgcttgcgct ccacatctcc    131280
     tctaccactt cctccttgga catgccgcga taaagtccat aaacgatgca gtatgccggt    131340
     gagcaagatt ccgccccagt agcccattac actccaactc agccgcgttg atttcggtaa    131400
     tgcttgatct ttcgctagct gtgatacaga gtcagtggtg ttgaccaatt aacgaatcaa    131460
     gaatatgtgt ctcacataac tgtggagggc aacaagatag tatgaacgtg acagtaatac    131520
     aggtgatgtc aatatcattt tttgatattg actaggatca acatgcggaa gctccgctat    131580
     gtatgcactc gttgtattgt tcggcatcgc atcaaggtcc aagggactgt agagcccctg    131640
     gcagtaattt tcccacaagt ttaccccggc agacagttcc tcatccgagc agtatagctt    131700
     tacggatgta tagatggagc ttacctgcac agtgttgtta catgcagcat tttgtgagtg    131760
     ggggccagac catgttaggg ttgatagcga ttggtagatg gaatagaaac agtattcgtc    131820
     cagactggaa gcagagaggc ctccccaaca gtgaacaagg cccgtgaacg caactagtgt    131880
     aatgacatat agatgcattt tggacaagag accaacagcg gtaatgactg gcactcggag    131940
     agctctttct gaaggcacat acaccgttcg aaaaccttca tctggcttgc ttttatatga    132000
     tatttctacg taccccctcc cgttgttcgg tctctagact cagatgccag tggctgttcg    132060
     atcctattgt gaatatgagg aacctcatta ccattagaag agggaaatca taatgcgtgg    132120
     ggcccagggc cgcggtggat tgcacctagc gcttcagttc catctcgaaa ccagttcttg    132180
     gtaggggatg agtgaagtaa aagtgggcat cgttttcgta ttggatagca catcaataat    132240
     ccacgcagat cactttcctt tcacaagatt tatatcattc aatgacagtc tccgctttca    132300
     ttcctcgtgg agccatcgcc tatatcccag cccaccatgg agtataggcg atcgaatgag    132360
     catcactagc agtgctatta tgtaaaattt acttttcata aagtgcaaac acatgatagt    132420
     tatcaggtcg tcgatcagat tataactagc cccacatatg ctcggctggc aagtatatct    132480
     aaagtgcgtc gatcatccca tctgaagttt tagactggtt gataatcccg cagatctcac    132540
     ctgaatagcc agtccgttga gggtaattct gcgcgtgttg agaggcaaga tcaccctcaa    132600
     acaatatctt gattttaata ctaagtgtct aacatgcttt tacttgagca tgtgtacttt    132660
     tgaaacaggg gtcgaccact tttcaacgac ctcatcaagg aatggatatg cccaccatta    132720
     gaagtattta atcgtatgaa accacggtgc tagactcact gagcacggtg aaattatgat    132780
     caacaactac tacttgtcgt aactggctta agctttcctc catgcctaga aaagccaatt    132840
     ccagacaagc ttcggatcaa atgtttcatc ttagagctcg cccacgtacg gaagatgtca    132900
     catctatcta ctcgatagag tgggatacat tcgggtaccg aagaaatatc acaaatggct    132960
     ttcaggaata ccactcccct ggcgctctag tcgcacaaag gatactcaga tcagccgtct    133020
     agtgctgagc agacaacaca cctagctggc tatactctta cccctcacac tgttgtcgtg    133080
     gtatgaccct cagaagctaa cagcttcagc ttatctacgt attagtgcgg gatgatcaat    133140
     agttctccgt gcccctgaac cgatatgttt cagacagcac atccactgtg atatgcagta    133200
     actctccagt gtcagaaagt gcatgcaacg ctggtaacct taccactact gctgcacagt    133260
     accaataacc aagttacttt aaaaactact atccatgttc ctaactaccc ataataaaga    133320
     gtttcttaca gcatattctt atgctacggt accatagttg agtgcgtatc caaagacaga    133380
     gaccaggttt cttggcctac gtgatgtgtg atttcattga tatgtggtaa ttggaggcat    133440
     tagcattgct atgacacata agactaagct ttcgggctgg acttcaacca agcttccata    133500
     gtctagtggt taggacggcg gtctcatagc aatatgacaa ttcctatcta aaggagttgc    133560
     aatccgcaag cacgagttcg attctcgttg gaagcacttt ctttttctcc ctttttaaac    133620
     cattcttatc tttttcccat gtgcagatcc gtactctgta tgcttcatcc aaatagcctg    133680
     caaccagtgc tatcaaccag cttcacgtat tatctgcttt atcaaatagt ctcccgcagt    133740
     gcagatcctt gcctacaagt atagggtata taccggctga tcacagattg tgtgtgatat    133800
     tactaccccg agagtctgaa ctgcacttcc taaaccctgt aatagaccca agtaggagga    133860
     agggcaacac taaggaccgc tgtcgcggac caacatcaca cggtcgacgg ccatggtgaa    133920
     gatatgtatt cagccatcaa aacattcaag tacgctcatt ggtatcgtgg tgttccccgg    133980
     ttacccaagc tgattgaatg cttgatggcg acagggtaac aatccctctt ctaagcttgt    134040
     aggccgtgga ttcggcttca tggatacata cgcacagcct gccttcgcgg tgatccctcc    134100
     ttaaggaacg ggagaaatag gcccagtgta agcaaaatga aaacagcaaa aaagaatgct    134160
     tccaacgaga atcgaactcg tgcttgcgga ttgcaactcc tttagatagg aattgtcata    134220
     ttgctatgag accgccgtcc taaccactag actatggaaa cttgatatat tattctgtcg    134280
     taatattatg ctacatagtc ctaagattgg gtgaccttat aatccttgca cagctccata    134340
     tatttcattt tcttctgctt gtatacttct tctcttctat gttagttatg tggatattct    134400
     ttgaacgact ttatggatta agtcgtggtt atcttattgc tgaagttgtt cctttagcac    134460
     tccatgagta actcgtgtgc agtgttacct gcgtacatat atattctggg cccaccggta    134520
     tctgccgtgg tagtatggtg cgtatcttca tagtacatcg ccaaatatac tctcgccacc    134580
     tggactacac aggctgtcac aagcagagtg accaatcaat tgccagtcaa aatcatacac    134640
     cggtgataat aaatgcagca ctgccccttt actagacaca agaagctcga caaggatcac    134700
     acaagaacta cggaaccgag cgtcaaggtc aaacgcgctc ggaaaaggtg gcaatttgtc    134760
     ccagtatttg actttggtaa aaacagcaac gcggagacac cgacaagtca atccctccca    134820
     gagaccaaaa ctgcagcgag actcattact gacagtggca gacaccgcgt ggcaactaac    134880
     acaccaacaa ggtaagtctg ataactcctt ccagacacta agattgcagt gctggaaggc    134940
     ccacacgaag cctgacacgt taggacaagg aaaagccttt gaagctatac catctccaat    135000
     cgaaagattg ccgataccat ggtgccctac accaaccacc ctaccaggga caacatcacc    135060
     gcactcgtca tgcctcccct taaggttcga ccctaacgcc ctaaagatac cttaagtcag    135120
     tcggcagata gagaatgcat tccgcctggg tctgctgagc ttggccggta tgtcagcaaa    135180
     attatccctg gtaagaatgg ataattgggt tggcaatttg agttttaact tgcaacaagt    135240
     tacacccggt agatgtatcg aagtcattaa gctgtgtgtt gagtcagcat ctggactagc    135300
     accgagcgac atggccgttg gtgaattgtc ccgtgaaccc ggcgtaatat ataacgagat    135360
     gttccgtttg tcccctagac cgcacatact aggtactaca gcgctggctg gggtctagta    135420
     tagatactaa tcagtctgat acagtgaggc aagagccccg agaaggttga atacatcgat    135480
     cccctagtgg taagttggct tacccactct gaaattctgc agaatgaaga aacacgggac    135540
     aatgcactgt gggaatgggg gaaggtagaa cttgaccacg tagttcctcc atattttcta    135600
     tatcaccaac ctggctctgg cctcttaggg tgtgatacgg ttggccggag tcatcaactg    135660
     aaacctagcc tagccgtatg ctatagataa ctttctacac aagcaccagg tactttcctt    135720
     cggtctatat ccacaccatc cagacaatat tggacttcag ctcgagagtt ctgatcacat    135780
     ctgaatgtcc ttcaacacag attgcacaac caagttgaag taccaattac tcacgagcca    135840
     atctcgatag tcgactcaac gaatcctaaa aaaataacga ccgacctggg actcgaaccc    135900
     agaaccttca gttgtgatct attgaccaat caatggcctg ctaggagact gacgctctac    135960
     cattgagcca gccggccagg atctatttaa tcagggacca attttgacac tattggccta    136020
     ccgtgacact gggtaagaag tgtcattgtg tcggtggatt aaagtatatt atggtagata    136080
     tagcttggcg agctattttg gtggaagggc ggacatttcc agattaacac ctacgaaaca    136140
     tatgcgctgg tttgtgttat ggtaactggt tgtttcgccc agggtatctt aacccgacag    136200
     taaaatcact tcctcatcaa gaagagagaa atatcgtaca aatgtgacca gccaagaaac    136260
     atcattattg tctctcgtct aacatcaagt tatatagagc acacaacgta cacatacgtt    136320
     tgatgaaaaa agtgtaagag tatcttttca tgcataaacg aaacggaagc gaaagaaaca    136380
     cccgaacgtg caaccattat ttcttgccct tcttcttctt cttgcttggg gacgccggac    136440
     tcccaggctg ctcatcagcc tcgaccaaaa ctgcatcgtc atcgcttcca gttaccgagg    136500
     acggcgcacc agacgactcg ggggtcttta ttgcaggggt ggagctgctg gtcgtggtag    136560
     gggttgtgtc agctggagct tcggttttct gcggaggtgc ggttgaagta gagtcctcgg    136620
     cgtccaattc cttcatgaat ccttccttga tgctggctct cctcttctcc caccattgac    136680
     gctcctcgtc caacttggcc tgctgctcag cgatgcgctc gcgatagagg gtgttgttca    136740
     tcatttcatt ggcagattgg aaaatcgttt ggccccaacc gggtacatat gcgttggcct    136800
     aagttcgaac cattcagtca ccacatcctc aagatatgca gaagtaaagc acaaggagaa    136860
     aaataactaa cctcagaaac aacatcgcga acctcatcct ccatctcctt ctccgccctc    136920
     tggaaccgtt gccacaaatc atcacccaca ctaccacgct gaagtagcac acccaaagcc    136980
     tgtttctgac tgcgcagggc caaaacccgt ttgatatcct cctctgcacg tcttaagagc    137040
     gcagccttaa gcaccgactc gggtacagca ggcgccttct tctccttaga agaggtcgca    137100
     ggcgggtcaa tgtgaagaag ggagaaatag atatctcgtt ggaggtgagc ggggaaccat    137160
     ggttctagag agtatgcctt ttctatatgt ccgcgacggg ccttggttag tatactagat    137220
     gaacgtggct tctttgggaa aggcgctgaa catacgggct ttgcgcttgc ggtataatga    137280
     ggagaaggtt gctagggagc cgattagaac acctaggtag gcgaacggca cggcgagact    137340
     gagccagttt accatggcgt tgtataggac agatatggct gtcctggaat agcgatcgaa    137400
     cggagtttaa atgtcggcgg ggagtattca ggctggggtc ataatatcgt tgctggtttt    137460
     cgtgtgaaac cttcgcagcg ctgtctgcaa agaatgttga aaatagaaaa attgcgcgcg    137520
     acaccaagca gcacaatgtc ggagttgtat gagggaggga gagataatcg tagtgttcct    137580
     cgccgcagga aagggaaatt tggtgaggcg gtgatgatcg cgctccttcg ggaaaggaca    137640
     ggctggtgtc ttggccgcgt cacatgttca ctgccatacg agtatacgtt caattctcta    137700
     gggtttattg acacaactct agtcactgat gctttgttgt ctgatgcatt ttatctacaa    137760
     aattgtccac aaattttgaa ggaaatgaga tgtcttaaag catacatgca cgagctcacc    137820
     gttcgcgcga gagaaaacaa accggccctt aaaaacccgt agtaccaacc aaaaagaaac    137880
     acactcgcag gcttgcagaa tagccattcc gtagataata agcaagatag gaaatgtcaa    137940
     caagataggt ataatctgag agtagaagat aaaagaggat agaaaaaaag aaaaaaaaga    138000
     aagatcctag agccagcatc gacttcatta cacaagtcca ttgtcaaagt acacaaacac    138060
     ctctaattca accctatacc aagcgaagag gaaataatgg gtaggaaaga aaggaaacga    138120
     agaaagagag agggtgaggg agagagattg aggggtggag gcaagggaag aagagagaat    138180
     taagggttct cttgacgagg gctgcagcat agttacaggt gttcgaatga tgaacccaac    138240
     tgttccttcg tcctttgact gataggacca atttcctgca tcgcctgcat gtcttcgagg    138300
     atctcattga atgagtcccg aattccagcg gccactttgc tgcggttcca ttcaccacgc    138360
     gtgcgccaca ggtagtccat taggctagtg ttgatctgct caagctgctc caccgagcag    138420
     ccactggtcc gctgggtgag ctgctcgtgc agattctgga catactcaga gtccacgatt    138480
     agctttggtg agtggtcctc atcgttcagt atcgaatgga gattaactgg cggatgagat    138540
     gacggctttg tggattcatc gaaaagaggc acgggtggtt gtgttttcgg ttgcgactga    138600
     ctgccattca catggtgttc gggctgcgag tctgcgtttc cgggaagaga ctcgcgtggc    138660
     ctcggtgacg gctggctgct gtcacattgc tgcgtgtctg gtagatgctc ttctaatccc    138720
     acccggtctg ggtattgagt aaggtcaggg aaatcgtgcc ttattgcttg acccactatg    138780
     gggctttgtg tataatttgg acggagagat gattgatctg acgatttttg gcctgacgtt    138840
     gtttgtgtag tagaagcttc gttagcgtag tcgtgtggct gagatcccgg agccattgga    138900
     gtcatcggcc ccttctgcga gaagctcgaa agacctgatt cgcgtcgtat ctgctgggaa    138960
     ggcgctgtgt gggaatacgg tggttttggc tgcgccgatg gcccgaatga actgccttgc    139020
     gtgtctcttg tgcctgagtg gtcttctgaa ttggtcatgt agacatcacc gtccccatct    139080
     ggcctcgact catgtgaacc attgcttgtc ggtccacggg cgctcagatc attgagatct    139140
     gagcctccgc tttgatggta gccgttggtc aagaagcttg ccgttgattg tcgtgtcggc    139200
     gttaccggtc tggcctgctc cttgggagcg aggtcaggga atgtctcgcc tagcaccaca    139260
     gggccacttg aaggacccga ctcggtatta ccatgcggta cattatggtt cgccgtgtga    139320
     cccaaaaagc ctcccttttc tgcttcctcg accctcttgg ccttttcagc tgcggccttt    139380
     tcccttgcca gttcccgaat gtagacattc tcgcattctg cgacgagctg cggctcggcc    139440
     tgctcgatgg tggagatatc aacttcaacg ttagacagaa gctcgttggc tctcaagatc    139500
     ctctcttgat cgccagtctg tcgtgcatct ttggctagtc gctttatgtc cgccaggaag    139560
     tcactgggtc gtttatagta tccattggag aggcgctttt cgatggtaac gatttccata    139620
     ttgtagaaga atttacccga cacggtttcc cagagtcccg ggacgccgtg tttgtcataa    139680
     gccttctcga atggccggaa ggtggtccgc tgttcaatcg gtagatcgct tgtgacgatg    139740
     ttgggatcat cctcttccca gaggtaccgg atctgagact catcgatcac accggttctg    139800
     aaccgtttgt acttcttgat ctggtccatg ataggctgga tcctaatttt tagaagattc    139860
     agcgtttggt gatctttctt tttctgagct tttagctgct ccttggtgag tggcgttgtg    139920
     ggctttggcg gaggtggagg cgcaatctcc agggtctcga gttccctctt cttacggttc    139980
     tcgggatccg gaaaatgcgc tggcgaggtt ttgatgtact cgactacctt actgaaatac    140040
     tcgtaccgtg cttcatttcc tggcgctttc aggtcgtaaa agtttctctt cgaaaaccca    140100
     aacatctgcc gtagcagccc ggtgtcgatt tcttctcctg ttatctcctg gactccgaga    140160
     agcaagacag gatcagtggg aggtatcgac cgcagcaaac ccaagaaggt ggagagaacg    140220
     gcttgcccaa cggtttcgga ccaactttct atgttgggaa tgtatatcac acttggccta    140280
     tgtctcttga cctctgcaaa gagctgtatg acagctgctt ccggggaccg agtcgaatca    140340
     ctaaggagag taggcaaatc gaacgattgc acgtgcagtc cttcaaagta gtgcaaaatg    140400
     gcagccgcca gatactgttg gcccatgccc attagtccgc gaagcagcat cctgggcctg    140460
     aaaactcgcg acctgtcgaa ttcctgttgc atctgctcgc gttggaaact tccagcgccc    140520
     tcgggctcct caaattgtgc ttcttccaaa gcagtgagcc gttttctttg tggaagaatt    140580
     tcggagagca gggctctaat gtcggccaga ggatgacgta gtaacggttc gacttccttg    140640
     gggagcggcg aggcgccgga tgaagtggac ctctctgatg atgggaccat cttcttgatc    140700
     gcgagcataa agtccttcgg ggtgacatcg atgttcttcg gatcgataag aagcttcttg    140760
     tcggatttgt agatttgagg atatcttctt tgtactgcat taagagcggc ttctgtgcaa    140820
     agagcacgaa ggtcggctcc tccataaccc ttagtgatct cagccagctc atccttgata    140880
     tggcccggaa gaggtggatc ccagcccttg gtatggatgt cgagaatagc gcgccgacct    140940
     tcggcattcg gcagggggaa gtagaactct cgatcaaaac gacccggacg gcgtagagca    141000
     gggtcaatcg aatcaggtcg attggtggca ccaataacaa tgacttgacc acggccatcc    141060
     ataccatcca tcaacgctag cagagtagag acgatagacg catggatctg ttcctgtttg    141120
     cttgatctca ctggagccag acctagaggt agataagtca gtagtgttag ggctctttct    141180
     tcaggggttg ttcacttacc atcaatttcg tcgaaaaaga taatgctagg ctgtgtttta    141240
     cgagcttcct cgaatagtag tcgcagctgt ctttcagcct cacccaccca tttgcttagc    141300
     gcatcagctc cttttctcat gtagaatgtg actttacggc cttcggagct gacactgttc    141360
     gccaaggctc tggctaaaag ggttttaccc gttccaggag gaccatggaa gagaactcct    141420
     ctaggcggca cgatgtggaa acgctggaag atctccgggt atagcagagg aagagacacc    141480
     atttccttca actgatcaat atggccctgc aagcctccaa cgctatcgaa attgacactc    141540
     atatccacac ctaacgggtc tgcatccgca agcgcctgct tatccttgac tttgcccagg    141600
     tttgccggag tccctgagag accttgcgca gcgtcgtgtg tttgcgtctg gccggggaga    141660
     agaccagcgc cgtgtggccc aagagcagat cccacaccgg caacggagcc acgtgggtga    141720
     tgcaaccctt catcatcgct gctatcactg tcaacgcctc cagtcgcagc aggtgccccg    141780
     gggggagcca gaatcgcagc tgggccaccg cctccgaaag gtccataagt agggaatagg    141840
     gtgcgttgcc agctaccgcc gccgccaccc ccgcggccac cacggcgcga gggagattca    141900
     ttgacctcgt tctcggcttc ctcgatcggt agaattaggt ccggtcgtat gattcgataa    141960
     tccacatcct tgcggctgcg ccgaggtttt tcatacacaa tatccgtctg taatcttcta    142020
     cgaggtcggc cacccctcag atcctcaagt tcttcggcga gttcttctgc aatatcagcc    142080
     gccgcttcgg attgcccacg agatcgagac gccctcttgc gaagaccagg acgccgtccg    142140
     gcggcgctgt cctcttcatc atcgcgtgct tgactggctt tacggggaga tgcgttggat    142200
     tttccggtct gggatacctc atcatcatcg ttcgagtctt cctcttcggg ttcaaagtcg    142260
     ctctcctcat cattcaatcg ctttcgctga gaactcttcg gtttctttcg actggagcga    142320
     cgaggccctg acggttcctc ttcatctggc tgctcgggct cctcgatttg ctggcttctg    142380
     tttggacgag ttcttctccg ggttactggg ccttcgtctt cgtcttcatc ctcttcgtgt    142440
     tcagcatctt cgttctcaga ctcgggaaca aagccctcgt cggcttctgc cgctccttgc    142500
     tggtcatccc cagcggatat gggcccttct tcgaagctgg cctgcgcact ttccatgatc    142560
     tcaacctggg agcctttgac ttccgtggtg gtctcttcaa tatactcttc ctgcttctcc    142620
     tgagtctctt catcttcttc catgaccgta ggaacctgct tcgatgagcg agatccgcgg    142680
     cgatttggtc gaattacttc agcctctgga ctatgtgtac ctcgttcgac tgtttccaca    142740
     tggcgacctg agttggtgag cgcgtaaatg tcttccgacg cgcctcgtgt gcgtcgggtg    142800
     actcgtcggt ttccttggtc ctgctgtggc tgtcgcttca aagcatcacc caattttaac    142860
     gtgaccacgg cagttttgcg tttctttggt gaagtttgtt ctgattcacc gtcgtcatcc    142920
     tcgaagctac ttgaatcgcc ttcgttataa agtggacggt tcgtggccgc ccttcgcgcg    142980
     acgaggcctc ttgcattcct ctgagcgttg atatcaggtt cttcctccga ctcttcataa    143040
     gacaattcct catcctcact gaagaaatca tcatcgtcag acacaatgtc atcgttggaa    143100
     cggcgacgag gtctcttctt cgacggcttg gacttcttcc tcgacttgga acgcgagacg    143160
     gagcggcgag atgagcgggg gtggtcgctg tagtcgtcat cgtccgaatc ggacttgttg    143220
     gcgatttctt cgattgagcg cttcatacga gccatggtat cgtgccagaa aggcttgagc    143280
     gttggatctc ttttgatggt cgccatgtga gcaaaaacgg aatgattcga gacaaattgc    143340
     catgtgatag gtcattgaag acacgggaaa ttcgcgccca gggaggctga tggagatgta    143400
     gaaatatgga tggaactcac cagggactga gtgaacggaa aagtagaacg tattgtgacg    143460
     ttaaacaaaa agtaaacaga cccaaacaga tactgccatt cagcacaaga caatggtatt    143520
     gtttctcatg cagtcagaca aagacctaag ctcccctgca gacacgatac atcaacgttg    143580
     gggggacgac gtgccgcccg tggacaagag atggttatgt ataccacggg gctacggcga    143640
     agcgcaaagc gcagggcccc gggagagaga aatcgcagtg aatctcacga caaaggccgg    143700
     tacgggaagg ggagggccga tcgcatccag tgactgaaaa acacgagatg gcgcacaaga    143760
     atcagaaacg agcgaaaaac gaaacggtca aatgggccaa aatccacgct gccacacaag    143820
     taacaaacat cgaataaacg ggcgtgggac aagaagatcg aagggcggaa agactcgcgc    143880
     acgccttttg cctggcctgc tccagccaca gctggccgtc cggctagtcc tgccattccc    143940
     ggggcacgag ccacagaccc gcgccgcagc taggcctcct tcggggttag cgcgccggtg    144000
     cacgtgcctt catccgcgtc attttgccca tttttgctcc acggcggcag caaacactac    144060
     tccgtaccgt cgattttccg tcgtcgtgta aaaacacaac agctcaaccc tttcatcgtc    144120
     ctccctttgc cgcacccatc actccctctt ctcacccacg tagagttcac tagaaatcat    144180
     ctgtaaacct agtcacagta gagctccaag cttcgatgca gagattcggt caatatcgac    144240
     cgctctccga ccggatctcg acgtagtcca gggcgcaaac ccgaggtgcc aaaagatgga    144300
     agaaggaaga aataggtcgg tcaggaacct cgacctttcc ccaggtcctc gaagcttatc    144360
     gtccttaggc tcctccccgc ctgtccatca tgatttaatg cagagccgct tgcctaatgc    144420
     ggatatagcg actttcctgt catgtgattg ctgagtcatc aattcttctt tcatccacga    144480
     ctcagtttgg ctttgtatat aaatacatac atcccggaga acccaaatca attcattacc    144540
     tctaatccca gtacataaat ttgatcggat aatacctctt taccctctca atatgtttcg    144600
     ccgactgcca cttacacgcc cctcgccgcc ccgtttcctc ttcactgcat tttcttctcg    144660
     cagaccgttt agcaccaccg ggagaaactt gaacgccaac caatccagtt cgttcaaaga    144720
     aggggtaagt gcttcctaac tttggctttc gttcttgtcg taaattgcgc catggagcta    144780
     tataaggcaa ggtgtctata acaaagatat atccatatgt tcttcaagtt taggaggcca    144840
     aataaacatc ccccagaaaa aggctaactc atcccaggca tcccgttata aaatctttgc    144900
     aagtccgttt gccaaggtct tcttgggagc catcttcaca taccaagtga tttactggac    144960
     atggctgaaa cttgaaatgg atgagtcgaa atatattaaa aatcgtacgt gtttacggaa    145020
     ttcccctatt gttgcccctg gtcttttgcc tcccgcattg cttctaacag ttcatcacag    145080
     aagaagtggc agctttagag aagcaggcta gggagctgac gggcgcccaa aaataagggc    145140
     tttttatctt atcctgcgtg aacattgtat tgtatatacc ccggatgtca atgtaagaac    145200
     tgtcgttact ttcatatcat ttagagctag tttggtaggg tcaatatgta tgtacagcat    145260
     cctttaagag gattctatat atccattagg ccgaggctgg cgctcactcc cacaactgcc    145320
     acagaagcta tgagggcaat ataagcattg ggcggtataa gaccaagaaa acgaaccctg    145380
     cgtacactga cactgttctc gggttagcct atctttagtc tcacaaacca attgatccag    145440
     agtgacttac gcagtagaca aggttcccat aatgggattg gatcgcatca tctgtcttat    145500
     atcttttctc cattgccgga atatccgccc gagcatagta gtctagagac ggttgtgggg    145560
     cggagaattt gcgttttcgt aagttcgtct ggtcgggaag agagttaaac ataggaaaat    145620
     tgttttggaa atgagtgttc acttggcgaa gtgaaggatt ctgtacttgt tctggggctg    145680
     ccatcggggt ttcatcccgt tggttctcac cctcagagtt acagatactg ccgacagtct    145740
     catcgtcgct cacatcgtcc gctggaggct cgccatctcc atcttcgtgc gtgctgattc    145800
     gttcctttcc ttcatcgcgt tctgcgccct tggtcagatg ccccgaagga aggagccaat    145860
     cctcaatccg ctcgccattt ttgaagtgct cagaatctat atgattgaag cgctcattcc    145920
     acgcggcaag gccctggccc tttagtggga tgatgtcgcg acaaaagcca caccagaatt    145980
     gcgactgtcc gtgcggaccg atgctgttct tggcgagtgc agcttgtacc tctttatctt    146040
     ctgcatggtg atgcttcttc agatgacggg tatattctcc ttggttatag aataggcgag    146100
     cacaagatcg atccccttgc gtagcatcgg gaagggtgca gcgccaactc tgcaagggga    146160
     aatgctggga gttctcgtgt cgtttccagt cggctttgct accgaaggtc ttgctgcatt    146220
     tttcgaatgt gcaaccatac ggtcgctcat ggcgcttctt gtgtttcctt gaggttgaaa    146280
     tattaggact ttatttcaga tacaagcgac gtatgatcac ctacttcatt tcacagcgca    146340
     gacgcgtgcg cttcgtgcag aattcgcatt gtatccagcc ttttttgtcg gacttactgt    146400
     caggcaccgt ctgcgaatca gcctgactag gctctgggtt tccggacact tggtctagag    146460
     ctgcagataa aatcttctgc ataatctccc gcttctgatc ggacaatccg tcattccctc    146520
     caagtgtctc tactttgtcg cccatatggt ggctgtgtct gcgctggctg ttaccgttat    146580
     cgttgctact gctgttcatc attcttgcca tggcgttgac catgttagta gccatctcgg    146640
     ataccatatt ttccattctg tcaggttggg cgtgtcctag ccgagaagaa gtggaagaag    146700
     gatccaggtc cgtggtagag cccagattga gggtcgtcag ggccggtaga tcaaggcgct    146760
     gcgtagtatc tcttgcagga atgcttggtg tactatccaa ggtggaatat ctccgttgag    146820
     tctgggggtc ctcaactggt tgaaggcctg actgattaga tggcctaaag acaggcgtat    146880
     ctggagaccg caagctgtga aggtccggac cagaatctct tctcacatat tctgattcag    146940
     aagcagcaac cattgcctca tccgagaagc ggtcggcaaa agatgaaggc tcaacacgtg    147000
     gctttacata agactcatac caatcatgcg acctggatga gcttagtgct tgctttttct    147060
     gacgtattcg tagacaagct gacttacctt ttcagtaatt cactggtatc ctcgtcattg    147120
     tgcatccggg agagatgctg acggaagttg tccaaccggg gccattcctt acctcggcgt    147180
     ggacagttac gcccaaaaca catgtacagc actttggggc cgcgttctgg ttcctgtttg    147240
     tggacgcact ttttatgtcg tgcaagatca ttgatggtac cgaagccttc cttccgcgta    147300
     caaccgggct cgtcgcattt gaacagcttt ctatgtctcg cttcatgctt cctgctgcca    147360
     gtcaacttta tgattcttct gcagagtgaa ttttttaaaa catgctgaaa agagtaaaca    147420
     tacctcttat cggatggaca tttgcccgtc caagggcagt tggggtaatc acatgtaatc    147480
     acatcatgac acatcaaaga tggtgattcg actatctcca gcgcatcgac gactgtgtcg    147540
     ccacagtggg atgggccaag gtccaacatt gatgctcgat cttcttgttc atgttcatgc    147600
     ggcgccaaga atgggctgct gacggaatca actgcgtaag acgacgtggt gaccgaacgc    147660
     gtggtacagc tgcgactgca gtatcctgaa tccgaggggt ggaagccatt ataatgactg    147720
     tcactctcgg agattgcgct gtgctgcccc gtcgaatttt tgcggccacc cttgggcgtc    147780
     tgctggagct tattcgcgtt gggaaacccc catgtcgacg tgctcaccgg cacgcctgtc    147840
     acttgaagtg ggttccacgc atcttgattg ctcgttaacc gcgggtgatg gtactgagaa    147900
     acatccaggc tgggctgagg cggtggtgat gatgcttgct ggtgatgtgg tggccattgg    147960
     ttgagcatag atagatggct gtgcgggatt actgcggaat cgggaccgaa ttgcaggccc    148020
     agaaaagacg ctggatcgct tagagcatat tcagaggtta aaaacccatc cgacgagaac    148080
     tctaactgcg gtgatgttgg tgcgacctgc cggtccagca taccttggag gatatccccc    148140
     gagttgtccc aagccagtct tttggggtta ggctcctaaa gcaaataggc atagtcagtg    148200
     tactagtcca atatttcact gacggctgac gattgaggca ggactgaacg agaccggacg    148260
     acagtcacat acgctcatag ctgccaagtc agctgtctaa aatgaccttg ccgataatcg    148320
     tttccacgtc tcggatgtat tgacaggctc aagtagtgag gggcgggggg gatgtgtcag    148380
     gatagcgcgt gagctgagta gcggagtgat ttatatagat gtttaaagcg ctcacaggcc    148440
     atgagtctaa tataacttct tttaggcacc atccgcagtc aaaatggtct tcttgtagaa    148500
     atgatgatag ttgagaccag atcgaacata gtcaaaaagg gaagctgatg ggaaagtcgg    148560
     gcagtgaggc tgagtaagtt ctgagatgaa acatagactg ggatatgact atgaagaaga    148620
     tccgttttta aatagaacaa ggttaattaa cacactccct atatataatt aataaaagaa    148680
     acgacaaggg aagacgagcg taagcatcaa tgttcaacgg tggaaaagaa gggaaaggat    148740
     agacgatgtg atcgacgggc tggtggtgga cactaactca ctccatcgcc aaaccccacg    148800
     cgataacgtg ttcaaacttc agagagaaaa gggaagagaa gattcccaca ttgacaggag    148860
     aggagaaagg gggggacacc caaaagtacg tactgtctgt gcatccatac gaagggacca    148920
     ataagcggga gctgaactgc agagtctatg aaagctgagg aatggcaatt gaggatcttc    148980
     cagagaatga aagttgattg attccacact attcttgttt ggggttaaag gggagatgag    149040
     agagctgagg aggggaaatt aacgtgacta ctctcaaccc ttcattaaga tctgtcatac    149100
     atcaaccaca gaaaacagaa atttcctgat tcttttcttt tctttttttc cctttttcct    149160
     tttctgaatg catgcgttca tgttgcatgt atgtacatac atattacttt cattcagcta    149220
     ccatctcacc atcccctacc tttcttcccc gaccaattcc gtcagatatg actccaggta    149280
     cacaaaaaga gagagagaga gaggcagagc cgtatccatg atacaggtat gtatgtacat    149340
     acgtacaggt tcaggagctg attgcagaaa gagctttgtc gagctaccct tggatagtcg    149400
     gatcggacga gtagaatgta gatagattag atagagagga attacagcct cttgattccc    149460
     aaggtatgta tgtacctcta ggaccctatc tccatggagc atacaagttc attgtccaga    149520
     tgaggggggg gaagagcaaa gaccctcctc agctcccacc gtcaatctcc atatcgggaa    149580
     ttgaatcccc gggattcgtc agctgaaacg aatgaagttc atgactaatg gcaggtaagc    149640
     tacttaccta gtttggaatt ctctcatggg aacgaaggga tgtaaggggg gctccatggc    149700
     acgcgtggta tgtggtccgt gattggcaag tgaaggaaaa tgagaaggac tccatcagca    149760
     tcatgacaac cagcataaga accaatagca cacggacaac agcgtggctg tgcctgtaag    149820
     gattacaaaa gttcctcaaa aagactttat catgcgagaa aaagaatttt tgaatttttt    149880
     ttgataattt aattttatat tttgatttta atttttctct ctcggaaaag ggacattaac    149940
     accacatacc tactgcccac tagtactata acatgctaat ctaggctaag gtgcaaaagt    150000
     gcaaatctca ttattgctga ttattatgat tactcctgca catcactcca gctagtatca    150060
     cctaatctta tttactagcc gacggtctca ttggatccgc atttccaccc gatatcgtgg    150120
     aaatcgtacg ttatcagcct agaccctgaa tcccaaatgt acggcaattt gtccttgtga    150180
     ttggctgcct cggaaagcta gacagaattc attccactga ctgtctatcc ctggctgggt    150240
     tctgtaggag tatggatgag tatactataa tccaacgact cgaatctcac ccagataggc    150300
     aatgcctgag gagttgcgtt tgccatcccc tcatccagga cctccacctc actgtcaaag    150360
     ccaaaagcca accctgtcgt cttcccatcg cccagaaggt tggcgtcgag gtgaaaaacc    150420
     ttaccggacg aactccccca acgtatcccg tcaactgaaa actctcaacc cccatcccac    150480
     tttgtcgatc cccttcaaac tcgtgtttat cttattttat tttaagttcc actccctcct    150540
     cctgaattct ttttgtcgtt tgactcctca tccgcagtca tttattttat tttatttttt    150600
     attttatttt tttttctcta aacctccgcg gaagtcaaga tcatccatcg tgaaggtctc    150660
     ccacttctgc aatattacgg ttaccaatta ctatttataa tttaacaggg gatgtgccgc    150720
     tcgttaggta cttctgagtg catccggccg tgtgatgtct catttttttt ttcccctttc    150780
     aggctgacag attgccagtt gagattccct cgctggtcaa cctccctaga actctgcacc    150840
     tagtggccta gttccaggat tccccgttct tcgtgctttt ctctctgggc caggtgcatg    150900
     gccttcttgt ccaatcacca tccgttgagc aactgtccct ttcggacttt ccatcgagcg    150960
     tggactccta cttcctacta gtagtcctga ggtagggcgt acggagtaca tacagagaga    151020
     ccctccgttt ctcatacgag gtccctcttt cctaaatacc gcgtcgaaga aatcgttagt    151080
     cacttccacc gcgtcggtag ttttaacgtc tgtcatttgt gggcccaaaa tgtctgtaag    151140
     caccaaaaac aggcaaaaag tcaaaaatat tcgccaaggg gaagagggac tctagaaaaa    151200
     gaaaaaagag aaaggaaata aaaaaaaaag caaaagaaaa aaaaaaggcg attgacaaag    151260
     cccggcggct gaaaccagag cgtaaaaagt aagtgtcact tgacgcgcat gctaacctag    151320
     gccaagacat gaccatcgag taaatcatct attgttcatg ggtatatcaa tgcagatcaa    151380
     tcgtctccag agattcaaca agacaaccac ccatataatg tgcctgatac ccaggggtgc    151440
     cgacagaaag aaaaggtcat agtaaaaagt ataagaaaaa tataaaaccg tttcagatcc    151500
     gattgtagaa aatttcgttc acgatctgcc aaactagtgc gctagggtat catatacaaa    151560
     aagaatcaaa taaatgtgat ggggcagacg gttacggccc ggcccagtat agatcgagtg    151620
     gtaaaccggt ttactacagt tggtttgggt aggccccggg cgcagtgaat ggcatggtgg    151680
     gtgccacagt cccttggcag acatagctat tttcccccgt ggatgacatg tactgggggt    151740
     cataggtcgg ctgcatctcc gtgggagaca tggagaaatt atacgattct tgtaatacgc    151800
     tcatatcctg attggagacc cgagggcgtg gcccggcgtt gaaaggggga ggatatgtca    151860
     ctgagttctg gtgcataggc atgagccgcg actggtccat gggcccccct ggctgcagtc    151920
     ccacctgcac actatactca tcgtacgcgt ccatcggctc aggctcggcg gatatgaacg    151980
     cgcctgacat ggtggtaaag tggggaacgc cggtggagct gaaagggacc ccaagcccgt    152040
     cagattgccc aacgtcatga cctgggtatg ttgcctgcgt gtagcctatg gacatgtctg    152100
     ccctggcttg gaccccgttc agattgggcg caaaattggt ggtttcgcgc gagatcgatt    152160
     ctggctcggg gccaagatcg cccttgccag tagaacctgg tcccaggttg gacgatagat    152220
     cccgttcgtt gacgagagct aacacgggca tcgcgatctg ctccatgtgt ttggctaaat    152280
     gcaccgtaag ctttttccaa ctgctgcaga cgttaccaca gaaccggcac ggctcatcct    152340
     ttggcccctt cggattgtca tgtcgacatt gctccacaag gttccagagc tgctcaatct    152400
     cgcgctctcg ctggatctct gccagcactt cgggggaatt cggatctacc ggatgtttgg    152460
     ataatccttt ggctttcgtt ttctttacct tgggctctgg catcttgtgc tcgcggacaa    152520
     gatgctgcac aaagttatcc tttcggaaac aagtatggtt gcaatcgggc tccgaacagg    152580
     tccaccattc tagttgtcta tgccgttcgc tctcatgtcg gacccagtca gcctttcgtt    152640
     tgaatgattt gggttcgcta caatgagcaa aagtacaggt gaacggctgc acatcttcgt    152700
     ggacatgctt ggtccaatcc gatggctttt gaaacttctt cacctggaag catatcgggc    152760
     attcaaactc cgctgggagc cgtttgactg gcggcaaagg gacccccgga gggaactgtg    152820
     ctgcagtgac agcgctttcc ccgagggctg gagaatcatc gcctgcctca ccatgcccag    152880
     ggatttggaa ttgagtatgg ggggtttctg aatcctgcgg gcctgcacga ggcgtcaaca    152940
     gcagggcttc gccgccctgg gcaaagcaaa atttgcctga agcacagccc ttctcgctaa    153000
     ccgcacaggt atgagtgaat ttgttttcca ccaacttctt atagcggcga acttgctcgt    153060
     tggcaaagcg gtcaagtagt gccggttgaa gtcggggatt tagctgagcg atttgagtcc    153120
     tgaacccttc caatgtaggc acggggaggc gtgactgaac cgaaagatcc atcactaacc    153180
     ctctctcatc aggtacgtta tcgtcgttct catcaccgtc actggtgcca tgccctagtc    153240
     gactttggtt tggtggggcg ctgcgaggtt ctggctgtaa gtgtgaatat gcgatgttgg    153300
     caaccggtgg cccaccatgg cttgtcatta ggtcgatgag cccaggtgtt gacggtctgg    153360
     gtatttcact tctgctccgc ccacggacct tgagcgaagg ccaagggttg cttgtggagc    153420
     ttggggatgc cacccgaagg gtatcttttc caccaatggc ggccatttgc ccggctatgg    153480
     caataacggc accgccagtg ctcaaactgg gtgacctgga agatctaggc gatctaggtg    153540
     aaaggccaag gctcagttta cgatgcggga aactgttctt cctttgatgg gagcttttat    153600
     tttcgtcgcc cttgctgtgg tcatcagagc cgggtagcga gatagagaga tcagacagat    153660
     gccgcttgag attgttaggt ggtttgagat tgttggacga tttcctgtgc aacaacttgc    153720
     ggagactgct ccgccgctcg tgtttcctgc ttttgtcgtt gctgatagcc aaattttcga    153780
     aggaaccccc cccaccgagg agactgttga tatcgacgtc gcgggtgccc caggttgccg    153840
     cgcgcgaaac attatccaag tccctcacac gtctctcata ctcgaccatg gccgcagttg    153900
     agcttgcagg ctgcgtacgg gccatgtccg gagaagggac cggcgcgaga tctcgccacg    153960
     gaggtcgtcc caggaactga tgcggtgatg gttcttcacc ttcaggactg agttggattt    154020
     cctcttctcc cagaacccat ctcgcctcat tcacactggc ggccggggtt tccgagccag    154080
     ttccctcgat ttctgattca tgatcgctgt attcctcttc actgttctca gtgacgagta    154140
     cgcctggtcc agggatgaga gcaactttca agttgaagta atcttgctgg agcgaagggt    154200
     cgccagcgct cttcgctctg cgtcggttac ctgtgtgctt gcggcccctg tgtggggttg    154260
     ggtcatcgcc attctcacta ttcgctacac tgactgaggc cgaccaagat cgaatatctt    154320
     cattcttctc atccaactgt cgtcgcagct ccagctcatt cgggctcggc acgtaaacat    154380
     ttttccggga cgtggggtcc acaccagcgt ggccagtagc tgcgtttgga atccaggatc    154440
     catcatgtcc tcgcgagaca gactggacag atccaagata tttgctattg tccacacctg    154500
     cttcctcgtc ggattcgcta gatggcccgc cgggggaaag gtgtgttgac gaatgacttg    154560
     gtcgccgcat atctctgact ggcgaatcac cccgggaaaa actttcaatt ttgacaattg    154620
     ggcttctggc cctgggcgag ccgaggtcgc cgggcacatc cagacattca tcggggggac    154680
     cagtgatcaa agtgagtgcc tgcggttggt tctgcaaggc aacaggacca gtctgatttt    154740
     tgatactggt tgtctcagaa gagaggcttg atttgttggt cagattcgga gtaagtagct    154800
     gagagggatc catgatcatc tgtgcagagt tcaactcgtt cgggtctaat gcagtgctgc    154860
     gcatccctgg atgtaaaccc ccgtcatact gccaactatt cgagtctggg gataggtctg    154920
     tactgaaggc tgccgacagg taatcggcgg ttggcgacgt atgaacgctc atctcactgg    154980
     agaggtcgtc cgtggggcta aggtattcag aataagaagc cggatgtgcc tcatcgcggg    155040
     gcgagtcact gtgcacatgg gaacctatag gggaagagga agcatcgcgc gagccatgat    155100
     cttcgccgct cacaggggtc aatctgattg cagatgatct gaaagatgct acctccggat    155160
     ctagctgggc cgagagataa gggtcgggaa aggaagcgtc attaagtttt gcgggattgg    155220
     gcgagtcgtt cgggacgaac tgaggcgata gcgttgacat ggttgtgggt aagccaaata    155280
     tctgatgcct cttttttcgc gtgaccggca caaaatcaaa ggtatgaggg atgttgcagt    155340
     cttgtcctct cttccagacg gctctgctaa cgtgcgcgcg cagttcctct ggctggtacg    155400
     gtagaacctc actgagatgg aaagcagagt tgaggacgca tgtctagaaa gccatcgatg    155460
     agcagagcgg cggtttatgc aatcacaaaa aaagtaagtc aataagatat attgagtata    155520
     tagaagtaac agaaaaagaa tccgtaaata gcagtcactt tcaattaggc caccgcagga    155580
     atcattctgc gggcgttctt gatcgcaatt cagcttgttc tcgaccaatg acgtatattg    155640
     aattgacctc cagaactgcc tttactggta acgggcaatg ggaaaaggcc aagaagatga    155700
     atgaggtcga gataaaatcg acgggaggga cagaaagaac cgtgggttca aagtttggga    155760
     ggagctaatg gcagtgggga acagaaatta aagagagaaa aaaaaagggg gggtggtttt    155820
     taagcgtaac ggcgccttgt agggcagatt gacgaaaagg ttggtggagg ataaatagca    155880
     aaagagtctt ggctacctat acagatacga cgcaaaaaga ggggtaagca cgagccaaat    155940
     cgaggagaga tagagtggga aatcccccgt ggtattgcgc aagattaaat ccgaaggaga    156000
     aaaggaggaa cgaagaggaa ggaggaagaa gaagaagaag aagaggaagg actgggaaaa    156060
     gatgccttgc ggctgaaatg aggactgagc cacaaatgaa cagggaaaca aacagtaaga    156120
     agggagagga gggcacgtca tgtgttcttt ttcaagagcc tcttgagcga ttgtaacgtg    156180
     attgcaaggc ggttttggtt gatgaggctc ctacacatca aacattacaa gcagaattga    156240
     tccccatata ataataactc attttgttat gctaatgggg aaggttacat tctttcatct    156300
     gctcaaggag agacatttaa ttcaactcag ccatttcagt tctcacgaaa ttaaatttac    156360
     aggatggagt tatccatgtt caacaggcgc cggtgttaag aaagtgtggg cgcgtggctg    156420
     gccagtgaga acgaagtggg gttctcatta gagagattac gtccattcag taagaggcag    156480
     gattatcctt atctgcacgg ctttctggtc cattttacct tggatttttg aagagagaga    156540
     gagaagggtg ggggagagca aaagagaaga agaaaaaaaa aaaaaaaaag aaaagaaacg    156600
     aacgtaactt ttcggttttc accacgaatc aacaaacagg ataccaccgt cagcaatgga    156660
     tcatcaataa tcaaaatgtt gacccgaatg gtgctgtggc tggatgggag gacaagagag    156720
     ggtcaaaccc ccggccccgt ttagtgttct atattcagta cccgtaggat gctgatcctt    156780
     gagcaaggtc attccgcaat ccagatacga aggaagaagg caatcgagag gtaatcttca    156840
     tcggtacctg atgtatggtc tgcccattta catccatgtc tgatgcgctt gcatcacact    156900
     catttgatcc tcctccctat gagaggagag aaaagccaaa acaaaaaaaa aaaaaaaaaa    156960
     ggtttggtgt aaaggtgttg gatatcatga accacagacc agtcggttat ggttccaaag    157020
     gtatcttttt ggtccactaa aaaaaatgct aaatctccac tcctgttgct ctgtttctcc    157080
     cccacaacac gggcggacag gaaccggaca atcgattcag gaacccttgt tcaatgaacg    157140
     gccctctgta aggttaacct gaatagagtg atgattattg ttgcagatat ttctagctgc    157200
     gaaacgactg cgccacgact gacttacctg aatgccacta ctagaagcat cttgaagggt    157260
     actgcaggac atcgatcatc gatccatatc gaccaattaa ttatgctcgg gcgcatcgtg    157320
     ttggttgggc gagccaagca atcagaaccg gcctgaggct gtgcacgatg tttcggtcca    157380
     gaccagactg ttgcgcgaga aaatgcgact tggaggtcgg aacaagcttt aaaaactaag    157440
     tcggatattt tctgctctcc atcctagcct agtcatgcgt ggctgtgctc ttcccccctt    157500
     tctgtagtcc atagcggtca gggcgatctc gacgccggag ggaactaaat gcacagtcag    157560
     tccaatatcg ctgaccatag acatcacggc aatatactct agtctcaatt aaaaatagat    157620
     acaaaggtca tcggaactga agaaagggac tgcagatcat tttcgtcaac tgacatcaca    157680
     tacattaggg agtgtcatca tcccgatgag catgaatcat aacaaataat acacatcatg    157740
     aaaaccgtca cactgcagga tgcagagggt aagttcaaaa gaagaagtag aagggaatga    157800
     aagaagggaa gaaggaaagg agtacaataa gaaataaaga aaatgacacg ctcaaactcc    157860
     caccaaatgc tatacggaaa aaaaaaaaaa aaaaaaaaga aagaaagaaa gaaagaaaag    157920
     gaaaggtaaa aagtgtgaaa caagaagagg gtaaacaaag agaattctaa aagaatggca    157980
     aaggcttttc tgttctcgag tttagttgcc ctataatgga aacagaagta tattgtcgca    158040
     aaggagtgaa caaaccaaaa caccgcgctt agatcactta acccactgaa ataatcaaga    158100
     caacctcttc ccagaaacgt aacacaagct tttcatgtac agccaacagc tggcaggtct    158160
     atgatgccta gccttcatac tttcagcagc tttcatgtct tccgatgtac cctaatcact    158220
     ctacagggta tcgaagcttg ctttacctcg cctgggggag ttgggtgtag agcctctcga    158280
     ctcgcttcga ggcctttctt ctccaccgac tagggagtcc atggaccgcc ttgccagctc    158340
     ttggcgtcga gccataacca caggggagtc ggagtacaaa acactgcctt gagtataagt    158400
     acaggagagg gctttctcct cgtcttctgc aaaatcttca tgtgctgcct cccgaattat    158460
     gcgagggaaa gtccggagaa tgacgtgacg agtggggtcc tccttggagc cgacacagcc    158520
     ttctttcggg gttccatatt cctcccaggt ctcattcgag gtgccttctg agtcgggcgc    158580
     ggggaaagag gccatgatga gttcccgttc gacacgagca agtctccacg tctcagcggc    158640
     caacttgaca atcttccgca cgcttgtatg aagggtatcc atgtgtttag ggtcggcgaa    158700
     gtgcttgagg tggtcgatga tctcgtcaac gatcacagcg gccacaacgt tgatcgactg    158760
     cttggcatcg gatgtcgtgt acgcagcttt cagcgtctgt tgcctccaga aggcttcacg    158820
     tctcacagac ttgcgtcgaa tgtccatcga gagcatctgg aagaaagtat ccgctttccc    158880
     gtatctcttg cccaaggtga aaaggaacgg atggaagatt cggtaagtca aagtcttcgt    158940
     gatgatatgt tgaacgtatg cggagcgcag ttcacgcgat gccggggtat tatcaaggaa    159000
     ggacggtagc tcctgaggta tcttggacag tacatccttg ggaggatcga ttggaaggta    159060
     cgcaaagtgc tccttagaca aggaaacaat aagacgagaa agctggccga agcagtccaa    159120
     actagattat agaattctta tcagagcagg tacaattgat agcattattg acatctcata    159180
     atcttcgtca ccatcgtgat cataattcta tagggaaaat cgaaaaggac aaaagaaaac    159240
     aaatgaacgt ggcacagttc tggccagaac ggtaaaaaag gcatcacaga agacagtctg    159300
     gaagattaag aagacaaaag gaaatttttt gaaagacagt caagtactaa aacacattct    159360
     caatgcacta ggtcacactt acaagaatgg atctcccttc gtgctcttga ggtcagtggc    159420
     ttctccaagg ctgtgaaggg tctttctcaa cctatcgcag tctttgccca aattatcaat    159480
     ggtgaggcgc atgccgtcag atgctgcctg tagttgttgc tccttgacga cattatcctc    159540
     ttccaccttt tgcttttcgc gctcacagtg ggcgagttca tcgcacttgt ccgtgatgcg    159600
     ctgctccagt tcgcccctct catcggccca gcgcctctcc atgtcagcca catggtccgc    159660
     atgggtgttg ttgaggagtt caacttcatt ggcatgttgc acacgagtct cctcgagctc    159720
     cttgtgcttg ttctcgagat cggtcttggt ggagtctaat tcgttcacct tgtcatcgaa    159780
     gttcgactgc aacgtgtcgt gtgcttcttg catctgtcgc ttctgatctt cgtaatcatt    159840
     cttcattgct tcttgctggt caagcaactc tttctcgcga gcagccaaag cttctgctgc    159900
     tgctttttca tcctcggcct tgatctcttc gaaagattcg gtcatttccc gtttctgagt    159960
     cgcaagagcg tccaccttct cttgttcgcg cctctcacat tccttctcat gagcctcttg    160020
     ggcttctttc atgctggtgt taagcgtcct gacttcctct tcgaggtcat gtttgttccg    160080
     cgtcagctcc tcgttcgacc tctcggattc ctccagcttc tcctcaaggt ccttccgctt    160140
     ctcgtcaaga tttccaagct ccatgcggag ctcgttgatc gtgttcttca gtttggtgga    160200
     ctcttccgcc gcctcattgg cagttttcct catttgcgtc tgaagagctt caatgtagaa    160260
     gtccttgtgc atcaaatcct gctcatgctg ggtcttcatc tgttgaaact cagcttcgcg    160320
     ggcttgcagc ttgcttttcg tattcctgta actgcccaac aagcggttga tgtctgggat    160380
     ggcatcttgg attctctgca gaagttcaat tggttcttcg acggggtgct ccggaggcga    160440
     catcattccc ttatggtgac cgttatggcc attgtgatgt ccgttctgag gggcgaagaa    160500
     tccattcccg ttggcataag tcagatcgcg caaatgctgg taggctgtcg cggtgctggg    160560
     ctccatagag ccccgggggg tgggttgcat gcccggggga tagaaggcat actggggcat    160620
     aaacccagca gtggtcatga cgggggaata agctgtagca tagctagcta cgctaggagc    160680
     agtactcgga ggaggcatat ggtgcatagg agccattgcc ggctgtactg gcggcgtagc    160740
     gtgtggcgta gcgtgcgggg atatcatcgg tgacatataa gcgtggcggg cgagggggct    160800
     ggtaactttt ggcgacgcgg atttctggac aggggaggca accttctgga atggcgatgc    160860
     tgcctttgat acaggagagg ccatcttctg gactggtgaa ggatgctgta gcgtggacgg    160920
     aggttcttga tatacagaag cgaccggcgg gggtgttggt gcgggtggaa tgacttccgc    160980
     aggaagctcg gcttcctgca tcgacgaaac agtttcagcc ataggtgggg ctgcctgagg    161040
     tacaggtgaa gcaggcttag gagctggtga agcggccttg ggtgtaggtg cagcgtccct    161100
     aggcgcaggt gaaacagccc taggtgtggg ggaagcgttc tttggcacag gagaagctgg    161160
     cttggacaca ggtggggtag tttggcgggt gggggaagta ggtgctgcct caactgcctc    161220
     aaaggagggg tcagatacag tagctgtgtg tgactcaatc tctggcgcgt cggtctttgt    161280
     gggagatgca aactcaacga attgagtctc cgtagcagat ggggtctcta cggatgccgt    161340
     ggttgggtcc gtcgagaaca atggggtctg tggtgctgtc actggggtgg gctccggtgg    161400
     ttcgacaact tgttccctcg atacgtcgat attctccgga gtcgtttcag tggccttctc    161460
     aactggatgt tctgctgctc ctagttcctc ttggtgtaat tcttgaggca cttcggggtc    161520
     ccgctggaca tcactcgcgt ctagctgctg acttgaggag aggtcggggg cagtcacttg    161580
     ggcagaacca tcctcttcag gattggtcgg tggttgaggt tgttgctcag gtgtaggggc    161640
     tgttgaaact tcctcagtag tgggctgtag ttgttcctgc tccacttctt gtgctggcgc    161700
     cagctctgtc tctgggattg actctgtggc aatttctggt acaacttcgg ctgcgacttc    161760
     aggtgcaact tctggtgctg acggtgactc aacttccact gggttttcca ctgggttttc    161820
     cactagggct tctactggag cttccactgg agcctctggt tgttggggct cggcttcgat    161880
     tgcttcttct ggctgtagtt gcagttgctg ttcctgttct tgcagctgtt gctctggctg    161940
     ttcctcttgc aactgtagat caggttgttg atcttgcagc tgttggtcaa ggggtggttg    162000
     atcttgcaac tgttggtcaa ggggcggctg gtcttgcagc tcttgctcaa gtggttgctc    162060
     ttgcagtggc tccgatgatg gatcttgcag tggctctgct tgctggtctg ggagctgttg    162120
     atctgcttgc tctgctgggg gttggtctag gggttgatct gttgtttgct cggagagttg    162180
     gtctattggt tgctcaggct gttgctctga ggtctgctct gtgggttggt caagttgttg    162240
     gtcagttatt tgctccactg cttgatcaga tggctgttcg ggttgttgtt gttcttgcag    162300
     ctgtgattca gctagctgtg gctcctgaga ttgttgttca acaggttgtt gttcaacagg    162360
     ttgttgttcc tgctgttgtt gttcctctga ttgtggttca ggaatagtaa catcaggtgc    162420
     agcaggtgga ggtgtttgaa tctctgactc ctcttgggcc tttgacttct tattattttt    162480
     tttgctaccg gacttgccct ttcctttctt ggctccggcc atggtgataa aaataatgcg    162540
     tgcccaagtt caagaaagga aaaaaaaaga cgtgttacca gtaggctaaa aaacctgtta    162600
     gcaaaaacgc aattgggtgg tggttggggt gtgaagcaat acatggaaac gcgctcagcg    162660
     gcgccaaaga tatattccga tctgatatgg agaaaagatg acaacttgca ccgggggcga    162720
     aggtcaaacg atcacacgac agatacaggg aagaaagtca ggacgaaaaa agtaatgcga    162780
     gaaagaaaat tcgccctaga gcagggaagc ctggaagtgg gcgcaaatgg ttgcaatcca    162840
     cgaagtcaag acgcccgatg gtaaatacct gcgttgaacg caagtagaca attctggcaa    162900
     gacaagaaaa gatgtcaact cgtcaaataa ataatttgga tttctgagga atcggaatta    162960
     attaaaccat taggcgaggt agtaaaaaaa acgcagctaa gaatctatcc taaaacacgc    163020
     ccaaaaaaag aaacttgctg cacactggag gcattgcttc cagcctcaag ggggctggta    163080
     aggcgaacaa acggaccgaa ccttagaaca gtaattgata cccattcaac atggaccacc    163140
     aaggcaggaa aggtaagagc atacatttct cgcgcgaaac ggggatacag aagtggaccg    163200
     atcatttcaa gatggagaga gagtatcacc caatgagtaa gcattgggca gcaatagcac    163260
     tgcttttttc agggtggcag gatgaatcat agcgtgcaga tgaggaaaaa aaaacgagaa    163320
     agaaaaaagg tattgcatac agtcataata ctatcatcta tgacaggacg gaggattcag    163380
     tcaaagtcgg tcgaggaggc aggtaacgag tgggtcgaaa gcgctaaaat cagatcgatg    163440
     acatgtcgcc tctgatagcc aaacgttcag acgcctgcat gttttgggag ggaccgcagc    163500
     ccaattgaca ccatgcgact ggggaacagt ggggagcgcc atctcggaat gaggcagtta    163560
     gtcgtgcatc agcaccacct ccaagtgcgg tgtaaagaaa aaccaccatt actgtcgaga    163620
     caacgcagcg acccgccgac ttgttgcagg aggcaacaag gtagtgtaga cccatgccac    163680
     taaggccatt tctccccaac gccggtttcg aatagatttc gttccacgct ccgggattcc    163740
     ctgtaaacta tccgagcgag gcgagactca cattcttttc ggagtccgca gcgttttggg    163800
     ctgtttgagc ggcatattcg tcgtcaccga ctaagaagat gtggactacg gaggactacg    163860
     agaaaggaaa ataatcatgc ttctcattgg caggtgacca gtgtccccgt gccaagaccc    163920
     gtgagggccc taaaccgcat ctagtaacca tcacgtgata tccgcctcga accgctcacc    163980
     agcttgcgtt cctcctccaa atggacggca tcatattcgt ttggccctgc caattgtctt    164040
     cctccacact atgttcttcg ctaggcgatc ggccacttcc gcgcggctac tgctgcgcaa    164100
     ccaaccccag cggcgattcg actcgcacgc ggctcaccac catgctgagc ctgtgaacga    164160
     gagcttcggt gtacgtttct tggacccctc tacaattcga tatcttcaat ggtagcagcg    164220
     gcctgctgcc cgccaattgg tagctataac taacatggat ctttgtgacc tgtacagcgt    164280
     agcttctacg tcaccgtcgg ctccttcgcc tctgcctacg tcctttaccg actgagcaag    164340
     tccaccgagg agtctggatc gcaatcgtgg atttccagcc tcatccaaaa gtggacccct    164400
     tcggagaagg tttttgaaga gagaaatgcc attcgcactg tcgtaatgga gaaggctgcc    164460
     catgaccgcc acttgttcca gagtcagggc cctagagccg ttttcgaatt gaagcagccc    164520
     gagtatgtct catataaccg cacctgttct tgcagaccaa gctaacataa ctcgtttctt    164580
     cccccctcca gggtcagctt caactccgcc ccgcctttca acgtccctgc cggctcggct    164640
     atggatatga gccatgttac cgcacactat gagcgccaaa atagggagct ggaagaggcc    164700
     cgtgttgccc ggatgcaaga tggcaaggtt gtctctatct atgattagac aaaattgatt    164760
     tcgttttcat gttccaagac gccggtagta ggcatgacag ggtcaaacat tatgtacata    164820
     taacaggaca gttcaaggtt tcgttgacag tttcagttgt tgattgtctt gtatttctga    164880
     ctctaccggg gaaagaaatg cccataagcc acaatatctc cggacaaggt tgacctttcc    164940
     atgcgatatc tttctatcta ccattattgg agacctttgg gcgcaatctc caggactatt    165000
     ctacccaccc cttctgactt aacatccatc cgctccttca catccagttc atcaccaccg    165060
     acagtattaa acacttccaa aaattcgtcc acaccaccac cgactccaaa gtaaactttc    165120
     ttcgcagcca acaaagctct acttctcccg cctgcccgaa taggacgacg gatcaaagcc    165180
     agcaaggttt ccgaaaacgc tctcaaagac gccggagagt atatcgtttc actagcaagg    165240
     accaacgttc catgtttggc tttctcacct gacgtgaaca ccagatcaac gaaagcagga    165300
     gaccaggcac cggagatgaa ttctatggag atgccccgtt ccgcaatgtc cttcttgaaa    165360
     gcctcaagaa gttccggagt gatatccaac tctagctcct cctcaacctg gtcttctgcc    165420
     ccagcaactg acaccgactt ctgacgcata acaatatagc tccaagtcag aagcaggtta    165480
     ggcaaagtca ccagtcgaag aactacagag ttgtagtccg caaacgtgaa acgaatattt    165540
     tgtgacgacc ccttagggtt ggacagcgat tgcgcaaaca gagcaagcga cggcactgcc    165600
     gttccggctc caagctagag atgtttcatc agtaagctgt ttgatagacg gggctaagat    165660
     taaatgccca aaaaaagtaa aaccaacctc gatgatatgt cgatcccccg catcagcgtt    165720
     agatagtatg ttttcattag caaccaactt cgcgagatct actgagcatt cccacgtctt    165780
     gaaaccgcct tcgtagatat tgggtgtgat atctcctttc tcgagtccgg agatcagctc    165840
     ttcattcgca taatcggcag tatcctccgc catcaattgc gtccggatat caaacacttc    165900
     gcgacgagcg agtgtaagtg tcttgacaga tgtttgatca tcttgagttg tgtttatgtt    165960
     gagtttgttg aatgaaacct gagacgggag acttgagagc tacaacatag tcagtcaatc    166020
     ctttgctcaa cctaatgcat tatataacaa atcgtattcg ttctcaactg tagcacaaga    166080
     gctagaaagc tctttggcac ccagagaagg ggctaaacct taatgccaat tagggcacat    166140
     cggtgttaag atgaacctac cagatcactt agttcatgcc tctgggctgc aactagttca    166200
     gggagtgtgc tgctactatc ttgcgtaacg gatgtatacc cctcatcaac agtgttcaat    166260
     tccgagtcat caatgtcaat atcatcccca gcgaagccga agctgaatgc ggacgccatt    166320
     ataaaagacc gcgttaatta tcacagccag atcctgctga gatatcacca aaagctattg    166380
     ggtgatatgc cgatataaaa tacagacgcg gggcacgtgt agatagtgtc gaaacggtta    166440
     tagtttgata aagccgtagg gtgtaagcca gattttgagg acacaagatc ctccgggaga    166500
     taccgtatga cccgtacgga tatgctaggg actttgattc caaatttgaa tgtttagtag    166560
     ctatagtctt gggagcttct tcatctttca actttgtttc aaattttttg cggtatggcc    166620
     atagatgact aagcatgttt atggtgatgc tgtggtacaa gtcatttatc tgactacttc    166680
     atgtttaaag tatctttgca ctatgtgaac taattggtgt attggcataa tctattaaat    166740
     ataggtcacg gaaagcaaat tcgtctgaag agtaatccgt gtcatcatta acttgatcta    166800
     tgaaaggttc taattctcta atatattaac ttaattaagc ggagccgttt tgttcgctgg    166860
     aggcgacagc cttcttaaga gcctggagaa cgtcggccag gagatcctct acatcctcaa    166920
     taccacagct catgcggacg aggtcgtcga agacaccagc agcctcacgc tggtccttgg    166980
     gaataccggc gtgagtcatg ctagcgggaa cctcgcaaag actctccaca ccacccaaac    167040
     tctcggccaa ggtgaagacc ttggtatact tgcagaaaag gtgagcagcc ttctcgccac    167100
     cctggatgcg gaaactgagc ataccaccgc ccatgccctg gcggtgctgc ttgacagcaa    167160
     tcgcacgctg agggtgagaa tcgatgccgg ggtagttgac ggagataaca tggggggaag    167220
     cctcaagggc cttggcgata gccgtggcgt tagtggtggc ctcgcgggca cgcaagtgga    167280
     gagtcttaag gccacggtga gcgagccagc agtcgaaggg agaaggaacg gcaccaatgg    167340
     cgttctggag gaatccaagg cgctctttca agctatcgga gctgaacgcg gcgacgccca    167400
     tcagaacatc ctatcttacg gttagaaaac aggccacctg agaagaacga ttctaccaaa    167460
     cgtagaaggg cgatgagcat accgaatggc cgttaatgta cttagtaacg gagtgcacga    167520
     cgatgtcggc accgtggtcc agagggttct ggacataggg gctcatgaat gtgttgtcaa    167580
     ccaccacaag gattccatgg cgatgcgcaa tggcagcaac cttctcaata tcgaccaatc    167640
     ctaaagtcgg gtttgagggg gtttcgatcc acacgagctt ggtctccgga cggatcaact    167700
     tctccacgtc cgactcgatg gtgggtgtga acgtcacatc cacaccatgg gcgttggcga    167760
     cctttgtgaa gtacctgtga gttccaccat agacatcgga aatcgagacg acatgcgagc    167820
     cggccgcgag ggactgaagg atcaccgcag tggttgcgga accagaggag aatgcgaggg    167880
     catatttagc gtgctcaaga gctgcaatgg cttcttcgaa gttatcgctg gctagtaatc    167940
     agcatgaaga tcaatcataa accaagctcc gttctgagtc gggtactcac cggttggggt    168000
     tggagctacg tgtgtattcg tagagaccta cagggctacc gacactggtc tgagcgaaag    168060
     tggtggagag ggagatcttc acgaccggtc agcatctcca aaacaattct atcgcataaa    168120
     tcatgcaaag tgtgagaacc tacgggagca ataacagcgc cagtcgttgg atcatggtga    168180
     gcgccggaat ggacagccaa agtgccgaag cgcttgtcct gagcaggggc tccgttggtc    168240
     gagttggtca ttgtcacggg actgcaaacg tgatcgcgtg gtgtatttct atataaaatc    168300
     gcaaaaaaag attcaagatc aaaaagaatc tgacaaagtc gactcgtaaa ggaagacggg    168360
     tagataagtc ttcacctttt tttttctgga agcccgatag aagcgcctat gaggtcacaa    168420
     gccgcgagaa ggaagatcta ataaatagta gtgcggtctt tgtactgtag tagtgacaaa    168480
     gtactgattt ataattgata cgagggcaaa ctgagtaaga tcggtgaagc cggtttttaa    168540
     aattaattag gatttattaa cgatgactct agaaccaatt ttacccccct tctctcctga    168600
     aacccgaggg aaaaattttc tgttgcttgg acatgggttt tttttacgtt gcacatccag    168660
     catgctgaag aacgataggg cagggactga tcgggccccg tgaggatttc cggcatagcg    168720
     ccgagcgcaa ctccaccgtg aaccgttgat tgtcccctcc cgtggcggtg tcaatgcaat    168780
     tttctttatc tccgccacta gccgaattcg attgataatg atcatagcct taatgtatgt    168840
     actctgcata caattagcta cgtctttctg atcatgaaga tctatttggc ggggaaatca    168900
     tcctgcatgg ccagatctcc cattcttcca tactcaagaa attccaccgg atgttgcctc    168960
     aactctccca tttccggcca aatgtcgtca tttggctgat ttgtgagcaa tcactgaaat    169020
     ctctatgtta agattgtttc gttattcgtg taaccatgga aatatacata gtccaaccat    169080
     tccatcagca aggtatctca tcacataagc acgggaagta agggagccaa gaagtttttc    169140
     ttgcttattc acgtcaagaa gcctgcacat gacccttccg aaacgttacc accaagatat    169200
     aggtcccagg ccagccattt gcattgatcc ctgaagtatc gttagtaagc aagtcagaca    169260
     cgggacagag agttcataca ataatggaat acggtggctt ccgttcgata gcggcggcat    169320
     ctcctagatc tggggcgttt ggtatttggt catgccactc ttctatttca acacggaatc    169380
     ggacaacttc tccaatatca aagtagaatg tggagccgtc ctcgttttcc cagatccaaa    169440
     cttgatcggc atagtcactg tagcatgtca gcatagatga ctaagaacac tggacatatc    169500
     aaggcagctc acaatctggc accgtctaag agaaggtttg gaggtacgag aatatcgttg    169560
     aaaaattcta caccaactgt gatgggtcag aactagcaac agcaaggtca gttgaaaatt    169620
     gccgtacttt taataccatg ttccgtagcg ctggagatct tgcccaacat aatttctcct    169680
     ttgaacggac gaaacacaat aaggcggaac ttgactgtct ttcaatcagt gcatagactc    169740
     ttgaaatgga ttcagcatcc tggatgtacc gttaacgttg actaaaccag tgccatggcc    169800
     gataagaccg tccgatgact ctaacaagtc gtagaatcca atgcacaggc caactttttg    169860
     aatgaccttt acaggactgc tgttagtaca tgctgcacaa gcgaacatgg catttcagat    169920
     aggaagccgt tcgtacttta tttgcgtact tctcattgat gttgtcctcg atggcgacag    169980
     aactatactt cgagaagtct tctggggaga tctgtatcag atcggagagg gtcgtctgta    170040
     taggttagtt agcttttggc ttggtagtga aaagacttta tgtaaagcaa gagaaaggtc    170100
     caatgcgact gacaagaatg aacatggtga atccaattag taggtactcg gcggtagata    170160
     aaaaaaaaaa gtcttctatt tcaatacgat ttggtcccac ggcggaaaga tagagcacga    170220
     agagtaaatt ccattatcag atcaagcatc aaaaatccgt cacgcaggca tcataactca    170280
     tgcttccata tttatgatag cagagaactt attataataa aaatagtcct ttgaaaaacc    170340
     acaaatcgat tccggccaat cgcagactgc ggatcacttt tgataatttt ttacccgacc    170400
     agatcatgac ccacgtgact actgcgcttt ccctttttgt gctcggaacg gaacaacagc    170460
     gctcagttgt ttgatctgat gagctcggca ctttttccag atgtctaggg tgctgtgagg    170520
     atggcgttga tgctaattct ctttggaggt ctactgaggt cctctcacga tgaactccca    170580
     gggcttctct tttccccctc ccccccctcc tcctcccact cagcagtcgc agtataacca    170640
     aaaccaacct gcgactttcc cctcacagta cggtccaggc catcatggcc agcgaggtgg    170700
     acgtggtggt catcatagag ggcggggtag gggatatgga aatcgaggag gtcgaggagg    170760
     gtcatacatg ccccatgcgg cgaattcttc aaatatgggc tacgctccga tgaattatcc    170820
     tggctatgct ggtcagccca tggccaaccc tcaacaaagt atcccgacgc cgcaattccc    170880
     accttcgcgg accaccaact accaagttcc ccaaagtacg acttcctttc cttcttcacg    170940
     accatttcca cagtctacac caacgcatgg acctccatac cagcatcaac ctggctactc    171000
     agcttacggt ccatctaccg ctcagcaggc tccgacgtat cactccgtta ctccaagcca    171060
     ccagaatgcc cctccatctg tgcaaccgtc gatgatgggc ccgcccatgc attggggata    171120
     caataatagc gcctctgggg gagggtatac tggccctccg cacgggaatc agcgaggtcc    171180
     ccgcccgtac aatgcttacg gcaaccaggc ttccagaggg ggtggtgcta tgccacatat    171240
     gaagcgcgat catacctcag catttggaaa gccacagaac attaccccac gggttcctgc    171300
     acctcctccg gttcctagct tcggcaatcc tttaccgtcc aagccacccc cgccggctga    171360
     cgctacgaga aaaccgaaga agaagaaacg gaagcataat caacttggct tgacaccgaa    171420
     gacggaggag cacgagtcca gcgaagaaga agatgatgtg gacgaagaat ctaggctagc    171480
     acagggtggt gcaagtgcag cagccgccgt gcagattaca ttcaaaggac gcactaccac    171540
     attgcagtct cccgcggaca ttgcagcatg gattgaagag cggaagaaac ggttcccaac    171600
     taaggagaag gtcgaggaga aaaagaaggc gatggaggag gcgaagaaag ctaaggaaga    171660
     agctcagcga caaaaagaat cgcgaaagca agaaatgaag aaagcgcaga aagaccatca    171720
     gcaagctcct gcagatccga tagacgcagc tgagaaagcg aagcggaagg ccgataagct    171780
     acgacggaag ctcatgaaag agcagaaaaa ggtcgaaaaa gcggaagcag atgccgagcg    171840
     ggctcggatg agagtcgagg aactgcaacg aggatcgacg gacgttaaca gagacgttac    171900
     ctctgcatca acacaagaag ctcaagctga gccaggcact gaagacagat ccaatactgc    171960
     tcctgatcag gagacgagat ctatagagac tcaaggtgtg ccgctcgctt cagggcatat    172020
     tccgggcgag gtttcccaac ccaacaatga tgtcgggcca tcatccgctt ctgaatccaa    172080
     atcgaacggg gagggtgtca tagaggacgt ccgggccgat gctgctgtgt cttcggatat    172140
     ttccgacagc agcgactgga cgtcatccag tggatcagac ctctcttctt cagactcgga    172200
     ggacagcgac agtgattccg cccccgagga ggcaacctct cgccgtgagg gccctgaacg    172260
     ggtagctccg cctccacggg aggcaaagaa gaagctatgc cgtcactttg cccgaaccgg    172320
     tcgttgtcag cgtggggata agtgcaaatt cctgcacgag acgccggatc gtggggctaa    172380
     gacgaaacct gtagagaaga aggggcgcaa aggcctttta caagcagtaa gttagacccc    172440
     tttccttctt ccctttttct ccttttaact cttatcacga actggactaa catacgaaat    172500
     cagcttctcg ctcgtcaaaa aggcgaagat gatcgaaaag ttatggaagc tatcgtatgg    172560
     ctcggtgaaa acggctttct tgacgaaaca aagtcctacg aagagcccct ggaaggtgcg    172620
     aatgagaact ctgcaacgga tgaggtaaaa ctatcccaag ggctcccaga agacccacca    172680
     ttatcagaag gcattgtgtc agtgcagaca ggcgatagcg caccgaccac tgcttagcac    172740
     acgcttgttc atattagcat gtatatatac ttatcaccaa tcaatcttaa tcagacctta    172800
     actgcctagg ctcaaggata agattgaatg atggatcagt ctgatgtact cttgtacaat    172860
     aggtgttatt cccgtctctc atcttaatgg ttcaaaatgc gcatgcacat atccttacgg    172920
     ggcaccccat catccactca agcaatctaa acttgagtca tgaccgactt ggctatacca    172980
     cccagatgag tcagaacaag atctagttgt ctaaaccgaa tctgagacgt agtaagttta    173040
     gttctagagc ttcgataaat ggccccatct cgagctgtag gatataccaa tataggtggc    173100
     actactctcc aaatctctaa atgcatagcc ataacatgcc tagaaatctc agtagcactg    173160
     acattggatt aatctaatgg tccatgcgcc ccaacactca aataagctta cacaggatct    173220
     acatgaccat cctcatcgac cgataaggct gagacagagc gcgcaattgc agatcaggct    173280
     cagatcaggt tcgaatggaa tctgtaatat acaatacagc taacatacct ctctatctat    173340
     ctatatccac gacatatcta ttctaactaa tcatacaccc atctctaatt taacaagtat    173400
     atacagtaca gacatggctc acataaccca aacgccaaac ccaaccagcc atgcatcctc    173460
     cagaacaccc ccccaaagaa aaccgagcat gaattctata atagtaatac aaaaagtaga    173520
     tgtacctaga taggaaattg ggaatgtcgc gtactaaccg acgatgtctt tgagtcgtta    173580
     accggggtta attctacgtc ggtgacaatg aattttttcg agttcgggtt gatgttcagg    173640
     tcgcttgtgg aggggagatg aatgaaaaga cgatcttcgt cgtcggggtt ttcttcttcg    173700
     ttgattgttt tgactcggat aattttgtag ggggatggga atcggatggc ggagtaggag    173760
     tccgtgccga ctatttccgt tatcagtata aagcaaaaga agggcacggg cgtagagaga    173820
     aaagcgagat acgtacacaa aagccagtag agatatttgc tgacgatagg agaccagata    173880
     gtcacggcga tgatttgacc gaaactccac gaatcaagtg agattgtcgg aagacttcgt    173940
     gctataacca tgaacgaata gaagaagttg gtgactagga gaagggtttc aatgattaca    174000
     ttcacggccc tagaaaggat cctgattcct cttgatacta gccacgggtg gacgcggtgg    174060
     taagttgcct gaaaccatgg cttctggccc agccatcgct tgggataagg ggcgagacgt    174120
     ttcaaaagga ggagtccgta gatcgcaatg cagacgaagt tcgcggtatt gtcggacagt    174180
     ccgaaggtca gattattcac aaggctgtag cttgacccta actcagaatc cgagcgacag    174240
     tatatgagag gaggtgggtg aaaaccacat ttatcaagac gatctgctgt cgcgatctcc    174300
     tgtagattgt ccgctcgagg ctccaccttg cacaggtgga gcgtgacgct agaagtcaca    174360
     attgtgatag cggaccacac ggagatatac catgaatgca agccaatcct gtggagtatc    174420
     cataagccgt acgtaatagg aaggataccc atgaatgcga cagctttggc catggaaata    174480
     ttcgactgta gctgcagcaa gctggttgcc tcgaaaactt gcgggccagc cgcgagagca    174540
     atcagggcag cgcactggaa ggagagcatg aagaagcatt gagcctcttg gaactccacc    174600
     agcatggact tcaggactga gaagtggtgc tggccgaact gaatcttagt cgtggatcgt    174660
     gctctcttcg tacaccgacg gatacatcgt gtgactgcgg ggatgagctt aagtatgaga    174720
     acagcgaaat ggacgtatag taggatgccg gactgcatcg cgaatgaaag caagacctgt    174780
     gattcactcg gaacgatagc tgttagcaag tcttgtgaat agtcaataga cagtacgctc    174840
     caggtagatg tacccccaca ccaccaatat cttgattcac gtcattatcg acgctcctac    174900
     aggttgtggt ctcaaattcc tggctagggc gagtgaatac gcgataataa tcgctcgggg    174960
     tgtaactctc tagatcacat ccttccagtt ctggatctgg tacttcacag tactgcctga    175020
     ggcagtctcc gacaagagtt ccgaaagtgc tattcacgtt cacacggtag ccatctttct    175080
     ctgtcgaagt aggccccgtg ctgtcggcat gttgggggag accaaagata ctaaagcacg    175140
     tggccaagtg gtcaaaggat tggaagacca cgaatgggtc catgcaggac gcacccgata    175200
     gatcggatgg tatccattcc atgaccggga acaagtgaga ccgatattaa ggtagattaa    175260
     agtacgtctg acattctgga aagggagaaa ccgttggttg tcaagtgaag tttaagtttt    175320
     ctttttcatt cggttttcca gggacccctg aaactaagtt gaaaacccga gaacatatta    175380
     atagtcgatc ttcacgggga tgatgcacag ccattgcgtt tcgtgttcac agattttatt    175440
     ctattggacg gatccgaggg aaaggatgag agtgagacat ccgtctggga actatgaccc    175500
     attcaagtgg tagctatgga agatcattaa ctgatcggta tgccgagtgg gtgtgcataa    175560
     gatctttgaa gctggtagaa ccgttaaaga cccggttgta tgaggtcatc acccatagaa    175620
     acgacagttc atctgtggca aagatgaggt tttccaaagg catatactac gtacgatatg    175680
     aatatcactt agtatacttg tcggtcggat atcaaccgag tccataccag atgcagccta    175740
     caaggtttaa gccctagttc ccaaaattgg tcaggagtaa cttttggatt tgtttctttt    175800
     ctttcttttt ttcaaggaaa attattaatt ccgacgttcg ccaagttcgc ctttctcggc    175860
     ttagtggcag tcaatccata ctacactttg actaagcggg aaccaatcga atgccgataa    175920
     gatactaggt agctcttctc cggatcgact gattaaccgt gaacagaaga accttagtta    175980
     ttagtaccgt gacatataac attcctgtac ggtacgtatt cgacggtacg tcgttgatta    176040
     gtaccgagta gaacaggtca cctactgtat ggatgctcga gtcggatcgg tcaatcaact    176100
     gctggattgc ctacttggga ttagtcaggt acataggtac atctttattt ctcgtacagg    176160
     gaaaaataca atgcacaacg ctagggacgg aatcggaggt atccgcagaa caactgctcg    176220
     gtggagcgta ggttgaaagg aaagtggatg atataattta aaaatcaaat ctcgagaaaa    176280
     attctggaaa ctgtttctca tgggaactcg gattcttttt cgccataatt attattagaa    176340
     caccatacat acagagtaca acaacttctg tcccaagttc caacccttcc ccctggatcc    176400
     taagacccta ggcccctagg catcgtcaat ggtcaaccgt actaacttat tttttacgga    176460
     ggaccgatgg caggtgatcc ctcgaccagt tttttattat tctcagtgat tccccccaat    176520
     gggaatgaag ggccgttctc caagccattg ctagttcagg actaatgaag ttaagagaag    176580
     gggacccgga ccggcctttt atcggcttag cctctcaatt ggggtgacac tgaattagtg    176640
     ccggtcttag cgcttggttt aatttgcccc ttccatgagg tattattgtg attattatta    176700
     tgacctgcac tgggctccag acctcgtggt ttcctgtcat tgaccccaag atgctactag    176760
     tactagtttc ctagtacata aggtagtcac gccgtcttgc gcttctttcc cctctttctt    176820
     ctctttccct tttttcgaat cgaacagcct tcattccttc cttttctggg tacccttgtt    176880
     cctgcgtata tatctacgca tcgtccttct ttttgactat cctactgagt tcactccttt    176940
     aaccatcaat cttacgacga aggctttccc gtctcgctgt atctcacttg cattgcatat    177000
     cgtatcaaca tcgaccttac ctcgacatct tcaattacct ttttcggatt atcaaatcgc    177060
     cttagaacaa tttcatcaaa atgcgttcca tcttctactt gactctcagc gccatggcgt    177120
     ctctcgctgc tgctgctacc aacagtgcca acccgttcaa catcccctct gagggttatt    177180
     cgttcgaggc tggtgagccg actacgctct cctggaagcc taccaccagc ggcaccgtct    177240
     ccctgaagct ccaatggggc gctgtgatga cttcgaacac gggtactacc attgcccgtg    177300
     agttcccctt ggatttccta tgagtagtga tgttctattt gcatgtatgc tgacggtgtc    177360
     ttcagagaac attcccaact cgggcagcta cacatggact cctcctgcca acctcgcggc    177420
     tcagcctgac tacaccattg agatcttcaa cgacgatgac accagtgagg tcaactatct    177480
     cccgcggttc accgtggccg gtgctactgc cgccgcgtct accaccgcgt ctgccaccac    177540
     taccgctgag actacctctg ccaccgagtc ttccacgact gagacgacca ctaacaccaa    177600
     gtccgccacc gagactcata ccacattgac taaggcgact gctagcactg cctcgagcac    177660
     ttcggctact gcctctggca ccagcaccga gtccactagc gcctccgcca gcgccaccgg    177720
     cacctcgacc ggcacctcta ctggttctgc ctcaacctcc actgaggctt ccagcaccac    177780
     ctccgccagt gcatcggcct cgaccactag cgttgtcaac gtcaatggcg gtatggttaa    177840
     ccgcgtctct ggcggcatgc tggcgatcgt tctgggtgcc attgccgtcc tgtgagcttc    177900
     ctccggactc tagtcggcga tctgaccata cttcattaat tagatagttc ttaactactc    177960
     ttctatcgct tctttggttt tctttttcct ctttttcttt tttcgttcac tgagcggacc    178020
     tgttttatac ccttgggtat tgaagttgtt tgtctcggac gtgagtaaag tcacgcttct    178080
     tatctcttct ttgcctgggc aatgttttgg cctaaatatt gttattacgt cgtgattacc    178140
     cggacggatt gcgccccggg gccttgtacg gtatgtacta gtatgtagat atgtgtatcc    178200
     tgtaatgaat gaccagtcca gcatgcgagc aatcgcatca agttttcctt tcatggacat    178260
     catccgatac gttttgactt gcgtatgtag tgtgtagtgg tgcaattagg gagataggtc    178320
     agaaccaaat ttcggtgata accacggagc aattatgggg gtttccataa aattgggcac    178380
     tggactagta ccgacttcga gccaggtacc aggtcgacag tgggacccat cagtaggttg    178440
     acaatccaac tacttgatag cagtagtgga ccgttgaaaa aggacccaaa agggtccacc    178500
     caccttacac caatgagaga ccctgtcccg ggaaattaac cctggcgcaa caccacggga    178560
     tcctgtccag aaaacaccga tgacaccgtg ttactaaatc ccccttaccg aggagaaaca    178620
     aaatacggtc tagccccgta gatataccta tccaaagcgt tgtttgtctt ttgcctcaag    178680
     ggacacgaga gtgtcagacc atccacgtag gaaccctgag acatggttgc gacaaacttg    178740
     aagtgcagtt tcaacctccg gcatcgggac agcaagggga tcacgatcgt ccgtcctgat    178800
     tgtgatagat tatcactcgc catgcagatt ggctgataaa aaccgatacc aagattgaag    178860
     cggagcctgg ttaatattac gatgaactgt cgatgagagg gggatcagca ctgttttacc    178920
     ggtcgacttt aaggctgttt ttacggccta cggaggcctc cgctcccgaa tagagagtgt    178980
     gaattacagt acgtataatt acggagagtg gtattttact cccaaaactg tcagaaggtg    179040
     atcatcgtct ggtttacttg attcatgagc tgtggacatt tggggaatac atgacccaat    179100
     acgtaagtag taaagtactg attgtacggt gctcactgct ccctgtgctg acagttttga    179160
     catatgcatg tcttccgtat ggaggaagtc agtctcaatg tttatccggt ggcttccgcc    179220
     atacatcctt ccttccttcc ttccttccat acgggtaccc tcgtacgaca tgtacataca    179280
     gtacctacta ctgtggaagt ggacaaggat tcatgacatt ttaccgaaag aggaagaaag    179340
     cgagagttta ggataggagg agcttggggc tgagttctcg gtggtacaag ctgaatgcaa    179400
     cactgtcaat aaactagcat aaacaatgaa aggatctcag ctcccaggcc gttattaacc    179460
     aggatgtaat taatccgata tccatccaaa tactcattca cctatcatcg atccggatta    179520
     gaacattaat ctaaccaagt aattaaccac aggcaacaag cttccctgcc taaatatctc    179580
     aacaatttaa tttaaccgtc agataagtat tacggagtac tgggtaggta ttcagaatga    179640
     ctccgtaata taaagcaaaa ggataaatat agccccagtg gccacttcaa gaaaaccaat    179700
     gtaaccagaa cgaacgtgag aaagtgagat gtggaggcga acaagctttg gtttgtgatg    179760
     gaccatgaat atagttcaat agtttcttgt tcgattactg ctttcacact aggcgtgggc    179820
     acgagtttct gtctggccct tggcggggat gtttctccgg aaccgaggtt tggttttcct    179880
     atttttgttt ttgaggctga atgtggatga tgttttaatt ttaattttaa ttctttttct    179940
     cgtctttttt ctccttaaac actaatacgt aggctagtta aagacatggg taaaggggaa    180000
     aaggactttg gaaatatgat ttgacataac gtgcatgtgg tttgttgaca ggacagaaag    180060
     gggattttta gtggtattat tggctggttt agtgagggtt cgttggatgg tctacttttg    180120
     gaggttagct gtacgggacc ctacagatga agacgatagt tggaggctgg ccgctggcat    180180
     gatcagaaga ttttgactaa tgtactccat actccagaat gccatacatt tgactcttga    180240
     cctcagtgtt ggagctgaac gcattgtcga aaccgcggcc tggagctttg aagggcacga    180300
     atgatatcca ttgagattca cctagtagcc tagcgattta tttaccttgt tgataagctc    180360
     ttttccttcc gcaatattct taagagtgcg agccaaaacc ttcagaactc gctcatggta    180420
     gtgatgacat tcttcgcctt ccacagtgga tgccccgcag gtaatggttc ggggtccgtg    180480
     acatcaaccg cagctcctct gatcttcccg ttattcaaag catccacgag gtcatcattg    180540
     ttcacgattg gaccctgtcc aacgttgctg acgaaggcat tccgcttccc gagagtttgg    180600
     aactgttcac gagcgatcat gctccaggtt agcgaggtaa ggggtagagt aatagccagt    180660
     agatcaagac cggcaaggaa ctcatttaac tgatcgcagc catggtacca tcgggatgga    180720
     atgtcgccgt tgggatcatc cattcccgcc tcaacgtacg aatgatcacc cttagactct    180780
     ggagtcggcc gttcgtgtag ggtaaaagca tgaacgtcca tcccgagcgc attcgctaag    180840
     cgtgcgcact gacgcccagt gcaccctata cacgataaga gaaccctatc tttcattccc    180900
     accgatgggt ggtgtacgca cattcgtaaa ccgacagcat cctccgtgtc ttcgtctgtt    180960
     tcaggtgtag cctacgtttc acgtttctga ttgtcccagt gttcgaatac tagttagttc    181020
     tcaaagatta attcgcactg attgcagagg aatccacgaa gcgattacaa tgatgttgga    181080
     aaccgagtaa agtagtaacg acccattcgg cgatttgtga actgcgcgtt gtcagcttgc    181140
     gtccagagag aacccaagca accacctgcg ggtgaacacc gttcgctgta ccgaatgata    181200
     catcgctgtc ctcaaaaaga gatgtgtctg cgatgtggtt gcaaccggca gtgtgaaatt    181260
     gtatgtatcg caaattggga atctgttctt ttcctgggag gtagttccgt gtgagacgaa    181320
     tagtgactga gttccaggtc tcctgagata tcgctcgggg cctctccatg tcctgcatgt    181380
     tacatttaaa ggtgattact cggattccgg gactaatcgt tggtagacgt tcgaggaagg    181440
     acactgagag atcccatgga gctatgatca gcagtacttc tggaggtttg accgagttct    181500
     gcattgtttt gacttgttga ccttcgggag tatctgttga gtaggacgag cagcgaactg    181560
     atgtcgaagc gatgagaatc ggaggttagc ggcatatttg ctttaaatat aatgaatttg    181620
     actggagctc gctattgtta gtccttgtat gtacgtctac cacgtggctc tctataaggt    181680
     tgaatgggaa cacggaagat tgtcatttcc tttgtggata cggagatgat agagagccat    181740
     tatgtgcgta tacggaacgt gatatccaaa caaactgcga tcaaccatga gtggagggtc    181800
     tcaattagta gatatactac ttgttggcag atcttcggat tgaatcctgg ggagtgtcac    181860
     ttgatatgcg gggaaggatc taaccagaat aggcaagttg aatgagagca cgtctgtcca    181920
     gctaagccca aaatggcaga ttggccagca actcgtggat cttgaatcaa gttcgccgac    181980
     ttcgttgtct ctttacgacc aacaaccgcg ccagatgcac agaaaaacca atcactatca    182040
     aatctagata agaatgacat tatctagcaa ctagtgacac cctacaggca agttccctcc    182100
     cacttgatga cattcgtgaa cgtgcaaacc tttggtcaag tgcgagttat ttaacgaatg    182160
     aaccagactt gaacttgagt aatcaatcac gaatatcgga gttaccccgc cattctcgat    182220
     aaggtcgctc cgtttctctt gctgcatatt aggcctacta gtagctttta cctgcctatc    182280
     taacctggct tattgtcaat gatgctttga ttcaatgttc ttattgttca atcaaaacgt    182340
     tcagacccaa gtgtcaatat gccccgtcaa aaacgtcggt acgttccgaa ggtaaaaggt    182400
     gcgcatagat ggaatcagac gttccagata tactgtggtt ctctgaccgg atatgtgcgc    182460
     aggctgctat gaatgctccc agcgccgaat ccattgcgac cgcgtccagc catgctgtgg    182520
     taaatgtgcg tccagaggca taccatgcag tgggcttggg gtccgctacc ggttccgcga    182580
     tgggggtagt caaggtaaga tagcctggca aggggaaaat tcacctcagg gtgggtatgt    182640
     ttttcctttg atgatggttt cgcctaaggt gaccatacta actgggcgtg cagcaaatgg    182700
     ctgggtgatc tcccgcagca taaatgctca ccgtcctttg tccgtggtgg ctcttccgag    182760
     gagcaattcg actggaccag caatgtcgca aatgtccccg cagaacccaa tgcactagcg    182820
     ggactgggcc ctgattcacc gaaaacatct agtactggta gccctgaagc aatggccacc    182880
     ctccctctaa gcgtcgacct agtggatcca agcaatggat ttctgttgac ttactgtaag    182940
     cctcatcgac acatccaatt gaagtttgta taggataata actcttcaag tctctcacaa    183000
     tattgcacct caaatggtgg ttatggatga caagtacaat ggatggcggt acttgattct    183060
     gtcttttgcg ttatccgaca aaatggttat ggatgcggtg ttggctgtat caacctttca    183120
     tctctctcac aagtccggag ggacactccc agtcagaccg gataagcttt atgcaaaggc    183180
     aatcttaggc ctacaaaata gaagctcttt ggatgagtac gacatgctca cgagacagtc    183240
     tatattcgtt gcgatcatta ccctgctggt aggggtcatg gtcaacggat catcagactt    183300
     tcctatcctg tttcacatgt tgcaatctgc tctcgatgcg gtcgggggag agggcgggct    183360
     tgggaacggt gacatggcta attttctgct gcgacaaata cgcaagtgag tatctaatgc    183420
     ctctaggagt tgctgagtac catcattaat cctggtaggt ttcgtgtcta tgctgcacca    183480
     ctgctgagtg aggaggccgg tgtacgtagc attatagccc atgcccaaga gagcttcgac    183540
     tgcctgcact acaacggcaa cctccaccct gaccatgcac tcaccttcta tctgaatgca    183600
     tatcttcgcc agcaagcata tgacatatac ctagagcgcg caacaatggg gcctcacggc    183660
     acattagacc ccaacaagat agagcaattc aaagaaacac tagtgatgtt cccggaggga    183720
     tcattagggg aacattccct tgtgtggccc acgttcattg ccgcatcaga gagcttgaag    183780
     gatgagcatc ggctatattt caaacagttc ttggaaaagc aatatcaccg taatgggttt    183840
     cttaatctac agcaagctct caaacttctt gacaagatat gggcgcgaag cagttataca    183900
     aattggcccg cacttctccc cgaaccacgg gtgtttatta tgtagcgatt ctattctaga    183960
     caaaagcagc attgtacgat cagagccctc ggcgaatgga ttacttcatc atccggatta    184020
     tatacataca ataccactaa tgcgatgttc cagttaactg acaaaaaaaa aaaaaaaagg    184080
     tcaagagtga atttacagtg gtaactgaaa tctgagctag agaatccata acaaaccgcc    184140
     acctctgtat agttcaccat cgcttacata cacgccttct tcaccactgc aaccttcaaa    184200
     tagtgaggaa aactggaatg attctgtgtt ctaagcaaaa aaatgctcca ttggaggtcg    184260
     ttttaaaatt atttaacagg cccgtgcgtg cctcagtgag agggaaaaaa gactgggtta    184320
     gatattcttc acagatcttg ctttcgatcg tcttctatac cctgaagcct ctctgacccc    184380
     accctagctc ctgacagtgg atagggaaat tggccatgaa gcattgtata cccaatgagc    184440
     cttatgaaga tctacggata ttttatcttt cctcgctcag cggtgctgaa gatagcgggc    184500
     ttttccgcaa acttctcgac cacactaagt acaagaggag aaagaaaaag tatgagaatg    184560
     ggaccctgga ctattctaac ctagtagatt gcatgttcta cctaccccgt ttcatcactt    184620
     cccaaatcca agcacagtcc ggcatgatag atgttggaat tgcaccagct gtggctccaa    184680
     accctcaaca ggacaagttc atgagccccg gaaacccctc tcacagtctc tcattgaagg    184740
     tgctcaggtc ccggaccgga caccattcga tgtagcaaag catgtcaatt ttcaattttc    184800
     tgacaggatc atcacacgat gaaggatatc ggactggaag gcgcaggcat cacgtccacg    184860
     gccatctcgg agccattcac actttttcac cgaagaggca ataggcagat gagagccggg    184920
     atattcagcc ggccagtact ggagaagtat caagttggtt cagacctggc aaccaatatg    184980
     attcgaggtt actgcccaga gtacgttgtt accttcgttc tctcctcaca aagtttacta    185040
     atgtacatat aagaagtcct catttattta cgatgcctgg aacagccctg cggtttcggg    185100
     agcactctct ctcgaatagc tggattcgag ctaatccctg ctatggatgt cgacattgga    185160
     catgtcaata tctcagttcg ggatgacgct gctgccgcca gggaacctga cagcgatgca    185220
     gataataagc cggcctttgg gtggcacatt gacagctacg cattcgtctg cgtcaccatg    185280
     ctatcagatt gcgccgggat gattggtggc gagacggtta ttcggacagg cacaggcgaa    185340
     gttttgaaat tccgtggacc tgccacggta agggatttta ttctgcttgg aaaggcccat    185400
     agctaatggc gcaatttagg gcacggctgt cattatgcaa ggccgttata ttgagcatca    185460
     agctctgaag gcctttggcg gccgggaacg tatcagcatg gtaacatctc taagacttaa    185520
     atcgcccttt attcgcgatg agacaattat cagacctctg ttgcctacaa ctcccaagag    185580
     tactctttac tatcagtatg cggagtatcg gctggagaac ttggaggagc gagtgcgtca    185640
     tcagttgaag gtgatgcggc agcataagaa ggcaaatcgt gactttgacg ttgcgtcaac    185700
     acgcaagttt ttgttaggag agagggagtt cattgatgct atgttagagg aactggaaga    185760
     tccgtaaact gtttaacagc ccaaatgatc aattcacggt tattatgata tacatttaca    185820
     tggcattcat tccaatgcta tttccgactt catttcaacc catatacctc tttgtgatac    185880
     aaactcagtc cagcagagtg tacgtcctcc aaagtcacca ttcaatcctc cgtgccccta    185940
     tagatgcctc acagccacag actagcaaga gtcttacaga taatgcctcg accctggaca    186000
     tgcaaataca tccattcatc tctgtgctct catgtacatt gcttttatag aaagtagagt    186060
     tcccagtcca tccacagctg aagtactttg aatttggacc tcatgagggg ccctatcaac    186120
     ataagggaca tacccatcag ttgagaactt gccaaactat gttgataaca taagcccatc    186180
     agacaaccca aagccgacga tatccgatcc cagacatccc tcctacaacg cgtcgacgtt    186240
     gcgatcagcc tccaattggc caatgcatga ggaagtggat tttggcgatg cgaaccaatt    186300
     caagacatct ttggcttttc attggtcttg cttacgatgt cagggccgga aaccgtgcta    186360
     caacatgggt tatgacaaga aaaacgacaa caacggggtt gtttcggcgc tcacatcttc    186420
     ttcctccgtt cattcctccg ttaaagctca gaaggagaag gagaatacga cctaggcgga    186480
     aaatcaatag ggaaaatctc cgccagaaga gatccaagaa gccatagttt ctgtctgggg    186540
     attttggatg tgttggggag ggagattgag gagtgtaggg gggaaggaaa atagagattc    186600
     cagatggtgg gctgggtctg atgttgtaac tatggctttg gtcctgtgga tgaggactaa    186660
     agcctgatag tcgttgtccg acgttggctc atgtactgcc ttcaaacagc ttattttgcg    186720
     aaacttgtgt ggccagagct ttgagaagtt cccgaatggt cacaggttgc tctcccaggg    186780
     ttgtccatgg tagaagaggt aaacatcgta agagccagac agcactgagt ttatggggaa    186840
     gtgagaacaa agttattgat ctccacgttt gacggtgccc tgatctgttc ggggtctccc    186900
     agcaaaatct atgacgcgtg tttatgaact ttgcctttgt gaaaggtagg acggtgtggt    186960
     tgctagagaa gttaatatct gttgccatta tgatgtaggt gattatactg aaagcttggt    187020
     gtggctggat tcaggttgag gcgttaatgg gtagaactag gtggacgaaa atcatttata    187080
     agacgccgta gcgtaaatgg atcatatcag atacgtagaa gtgtccagta taaacatact    187140
     ttgcatatta gaatgggaat tctatccaca gttgatgacg ctaataatac caagaaatca    187200
     acgcaaagca aaggggaatc actatttaaa gaaaaccacc atcatgctgt ccactgggga    187260
     ctgactctct tgataaactt catgaacttc cagaacccaa cggcatgttc aacattgccg    187320
     tagggatcga ccactcgttc cgggaatgcg attcctgctc catgcaaacc cgggacgaca    187380
     cggcctgtcg catcatggaa gccacctgac accgagtcaa attcaggatc gagaagacgg    187440
     ccattcactg acagctcggg aaggggatcc cgagtaaatc ctacagcttg caccaggtgg    187500
     gtgcacgacg gcagatgccg ctcatactgc gctgcttcct ggccgcctcc gcagtccacc    187560
     ttggtgatga accggccggc ttcggactga gggagtttgt cctcctccag ctgttgtcgt    187620
     gcaaagtcgg cggcggaacc cttcaggccg gtgttgtccc gcagaatcca gccatccatg    187680
     tactcggcat acctcagcgg atgccgagta aaccacttaa tgcggagctg agggtgggta    187740
     ctgcgggcca gatctaccag gttgaggagc gccagaatgg cactatggga agctccaaca    187800
     acccccacag tctggggctc attgcgggga agatacgaga cgaggtcact aggtttgagt    187860
     actacatcta gatccagcct ctcgatgtgc tgtccacaca ccgggatcgg cacctctgtc    187920
     ggcgacgatc ccgtacacaa gatgagtcta ggggtaatga cctcaacttc gtcgaggtgg    187980
     tccgcacgtt ggatccgaac ggtccaagac gaagtctaag agcgacaagg acaacgatta    188040
     gctacacagt gcacgagatc tcctgggatg gccctctata cgggacttta tactgacttt    188100
     ctctaccagg ttggcagccg tgacataccc ccgacacgca taaacctggt ccatcttagt    188160
     gatgccctct gtcaaggcac gaaccatgtc tgccgcatga tgcaggtggc aggtcttctc    188220
     ttgatcgagt ttggccatcg ttgagaatgg actagggata cgggtgctgt tgattacgga    188280
     gcggaagggc tggactgctg tggcatacgc ttggaacagg gcgactttgg tgttactgag    188340
     ccggcaccaa aacaagtcag ctgagcgctc ctcatccgac gcctttcatg aagtcaggct    188400
     gccagacaga aacactcacc taggcacttc gcggtacttg cgattcaccc gaccagcctg    188460
     aaagtatgga tcaatccagg cgatcttccc ccctagttgc ttctccaata gatttccaat    188520
     aacggcgaga ccggcggggc cggctcccac gacgaccgcg gcacatctct gtgaattcat    188580
     tttccgaggc cgtatatgtg gtgtgaattg tgttttttca aggatatcag gaacgaaata    188640
     gagcgttttg tggcatagaa ataatgcacg ttttgcgatg gtagaaccca gagaaagatt    188700
     gggtgagaaa acgctgggag aacgccaaaa tttatgggga gaatgcccag gggtggaatg    188760
     tatggaaaca ccggtgtaat tctcggcaaa acaagctagg gagcgtcgtc attgtgcctt    188820
     gggtctagac gagaggggaa ggcacatgga gaaaacgacc aagcggacgg gacagagcga    188880
     atgacagccg ccagaatcgg tcattcgtga ctggcacttt agggatcgtt tgtgtggaaa    188940
     cgcggcttca aggccgaaag gacggcgctc tcgggcgaga tgtacaactc ctcatcctca    189000
     gttgacgcag ctcccgtatc aggcggtgat accctcgtaa ccgtaggcta gtagtcgcca    189060
     attattctcc ctcaaataag ccaattgttg cgcgacctga cgaatcagcc ccactcgcag    189120
     gcaaatcctt gagcgctttc cgtcggaggt cacatgctgg tcgtgtcgtg tcttgggctg    189180
     gcgaaagagg cgaagacgaa gcaagattca aggggtgagg gtcgaagaag agatcaaagt    189240
     ctcagttcca tagcccgagt gactgccaag ttgtctcctt cgatcgcgaa aacagaggat    189300
     ccttttgaag cgtctggcga tggaggaagc gaggacctta tattcagatg agttagtggt    189360
     ggatcgtctc agtcttggcg caattgcgtg atttctcaaa ggaatgaggt tattgctggc    189420
     ggcctgattc gaaaggccgt caccctattc ctgaattgga tctctcatcc tatgactcgg    189480
     gatccgcatg accattggat attaattagt atgagactga gtatgtcctt tatgcattca    189540
     tccatcatag gaaagacata aaagataaag aacatctata tgcaattcat gagtaaccct    189600
     gttaatccaa ttatccaaca ttatctcaaa aggtcctgcc tttatatcta gttatttact    189660
     atcgtataca taatcacacc tgaatcagcg cagcattcct ctcaatgatg ctatgtatat    189720
     ctgtaccagt ccagccggga gacgcagggg acaacgaagc acccccagct ctacacagcc    189780
     caaaataccc gtaccgacaa ccgttccaca tggttcgacc acgccccgaa tcgcgctcga    189840
     ccccagacgg caatcgtatc gccaatttgc aaattacgga cttgacttcc atcgagcgtg    189900
     gctcgtcctc gaccttggtt atgctggatt tcctccgctt ccggtgaatc ggcgctgatg    189960
     ttatcgagat gatgccaggt gatatgataa tgctgggttc ccctcaccgc cgttcgattc    190020
     gcctggagtt tgtgggagct gggcaggaga agaggatgat cgggcccaaa ccggacccca    190080
     ttcgcatctt gttcaggaac agacgaatct ccaggcgtcg gcaacttctc gaaggggaca    190140
     acttcggtgt caaaccaagt ataggatccg tcaaacgtgc cacgcccact gttagcaaag    190200
     ccctggtcat gcgaggcgat ggagaagaca atcttccgac aaggatgaac agtccggtga    190260
     gggagcactt taggcgagtc acttcccaat gtctacgcga tgtcagcgat caaagctact    190320
     ggagagatat gccaggtcaa gaaggcctgg agagtatgca gtataccttt tcatcatagc    190380
     acagtggtgc tgtcctgacc aacacctgat ctctgtcctg gtgaataatt ctcttttggt    190440
     ccaatgtagc ctcgatggag ggccaatatt cggccgcatc cacgatcaga tccacaatct    190500
     caacgggtag cccttcaggg attatcttcc atcgcagcag ataccgaacc ttaagcacat    190560
     cgtagaattc ggggtagaag atctcagagt cagtcggccc atgactgtca tcagcggtac    190620
     tgttttggtt gcccatatta gatggaggct cgggctcgtc attagaggaa ttcgactgtc    190680
     tgcgtcggag tccacggaag cgaaagggga gcatcgtgta gaaagcaagt gggtctatac    190740
     accgtgttgt aatggtgcga taatgaagag taagtatatc gcaaaggcgg acaagatgaa    190800
     gttactggtg aagcacgttc tatataaatc atgtatcgtt atcagcgaat ggagtggacg    190860
     gctggtttga tgatttgctc taggtaatga tccaccctct aggcaccgag ctgaaagtga    190920
     agagttccac acagcctcaa ttaagtcaag ctgaagacaa taacgaaaac tggatcaaat    190980
     tacaagtcca ctgactcaag ccgtgcatac agattcgaca cagtgctttg gtggctctcg    191040
     cactcactca ctcacgctgc ctccttctgt tgctgatgag aaagagaaat gaatgtattt    191100
     acaccccgcg tcgggtgggg gaatctgggt tgagtggttt tcgatcgaca gctgtacact    191160
     tataacccgt cctgtgagat caagtgatcc gcctgtcaac agaaaaaaga gaaggatcga    191220
     gaatggcaat tgcggtaaga gtaaatacaa gatgaagtat tgttcttaag tactggtagc    191280
     acctgggact actaaataaa gtacgtatga ccgattggga ttagcccaaa agcccatgac    191340
     tggattgctg gatgacgtca gagggctttt atacatacac tagtaagcgt attgaagatt    191400
     gtccttcggc tactacacca tcctctaatt aatcgttaca ggtatgatag taccgtaggc    191460
     ccgtctttta aggttcattt cttttgtaaa atacatacat gaggaacaga acatgtaatc    191520
     agactacttc aaactctcag cttattcagt cttcctcttt ttccctcccg ctgccttata    191580
     cgcggcggct cgtttgctac tgcggttctt cggcttgcct ttgctgccac gactcttcgt    191640
     cttcacgcgg atgcgcgacg acccattatc cgtcgctcgg tggccttcga acactaacga    191700
     gttgttggag atgattttcg ttgcatctgc cctgaccttg gccgcacccg ccctgccaaa    191760
     aagcttgcca gcacgacctt gaagcgtctt gtccgcctcc cgcagcggtt tgccttgagt    191820
     gctgccgccg gcttcacgtt tcttcagctg tttcttagct cgcatgacac gtagtttccg    191880
     gggaagcaag ggcggaaact gctttccatt cagcagaagg gcctcctcca cacaattctg    191940
     atcgtagaat tggacatagg caaacccctt cgaaacacgg gtgacgctgt cgcgaacgac    192000
     ccgaacggac tcgacattgc cccgacgggt agcctgatct ttgggtttgc tggtgtgggc    192060
     attaaaggtc cgccaaagtc cttcttcgac atcggccgga gccttcttct tcttcggctt    192120
     ttcctcatca tcggcgttgc cttcctggtc cacgaagttg aggttgccga cgaaaacgca    192180
     ccgtttatta tcgaccgggg cgggatgtgc gacgctgtca acacggacgt gtctatccag    192240
     gacgacagtc ccgttcaggg caacaggagc ctttcgagcg gcctggacag tactataaac    192300
     gatataggcg ttggtactag gagtggtttc atccagaacc tcgcgcttgg caaaggcagc    192360
     ccgcttcggg atctttcccc cgctcgcgaa ggccgtagaa cggaaacgta tcgattccac    192420
     tttgtgaggt cccgtagatt cagggagtgt agaaaggaac gattcaaaat gtttcaaaag    192480
     ggtcttcttg gcggacttgg acttgatggc ctcattggag acattgctta ggaacaccgt    192540
     gcggttggac ttgtcaatat cagacgactg agcgtcaccg gtcacagttt cgtgtttggg    192600
     tatcgcaacc tcttcatctt cgtcggaact ttcatcctca ttctcgtcgt cggatttgtc    192660
     ggtagatgtc gcttcatcct cttcttcacc ctcgcctttt tgcctctttg ctttttccgc    192720
     gcggcgcttc tgttcttcct tctgttcttc ctttgctatg cgacgcatat aagattcttc    192780
     gagatcttct cccgcagccc tctttcgttt ccgactggga ggctctgaag ccgcctgagc    192840
     gggctcacca ccagcgtcgc tcgaggcttc ggatgcttcc tgcataacct gatcttcatc    192900
     ttcgggctcc gacacgtctt cactgctatc gtcacctgcg gcgggttttt caacggcgct    192960
     gctggttgtg ggcaacgacg gcgcttttac tgggcccgac taaaacatgt gacagacatt    193020
     agccgggttc tcaacaacca aaggcaaccc acttacactc gtctcaaaca aggacgccaa    193080
     cgttgggtca attccgacat ttccagctaa gaaaggaaga gacgtttctg ccttttcggt    193140
     ctgcggagct ttttccgact gggactttga tttctttccc atgatgatat taactgtgag    193200
     agtatcccgc ctctcaatgt atacggcttg tttcaactaa agaaaaaaaa aaagaaagaa    193260
     agaaagaggg agtgtaatgg cggggggcgt attttccctc tgttgctgtc cgtactccgc    193320
     gtaacttttt ttttctgttt tactctttct ggatcttggc aacggaagct gatatatcac    193380
     gtggggaatc tgataaatcg cgttagttcc tcactcgggc aattatagtg gaattttgga    193440
     aaatattagc agtatcagcc atctctctta ctgattcagt gtgatacttg tcaggtggaa    193500
     tctcgattta tcactttttt ctgtttggat cccctagttg gttggcacat cgcggcgtat    193560
     gagatagcca gaagcatatc atcatacccc ccaaaggcgg taagtaatgg cccgagaagg    193620
     aaaagcgaaa agacgggcag aaaaggactg gacgatacgg gcggcatacg gcagcgtgac    193680
     gctctctcag tctctcgctc cctcgctctc ggtcatgatc aatcattctt tctccctcca    193740
     ccagcagcca cttctctgcg ctaacgctct ggtggctccc atactcaatc gttgtcttaa    193800
     tcgctcgcta gggaattgct attttctctc tccaaaacct cgacatcaac ccacctctct    193860
     tctatgccgt tcattctccc gcagcgcttt acagtcgtat tgcccgcttc gtgaagtcga    193920
     cctccacctc cctcctcttc gtcgtccttc gccctccccc caccgagtgc ttgtttgcgc    193980
     cgatcctgca gtaaatcata tccttggtga catacataca acattatctg actatattgg    194040
     cgagaacctg tggccttgaa ccaccttctg taactgcggt tttggggaat cgtgctcggt    194100
     cgcggcagct ggggttacca caggtttcgc gattggcgca ttattgaacg gtacgttttc    194160
     tgctggtcta caaccccatt gatgacttga tctattctct ttgcgatgtc atcatggttt    194220
     ttggcatact gtggaaaccg agtatcgctg ttgctctggc gcacttccca gcgctcaaag    194280
     ccgagaacga atgcttgccc gtgagtctgg gggtgtgtga tcaaatctcc gcaccgcctt    194340
     cagacactgc cctctcaaca tacttttttc cattctcctt cctgttgatt ttggtcgttc    194400
     atgttgatgt agtgtgaacg tttccttggc atgtctataa tgcattttcc aagtctttct    194460
     aacattttct ctttgataca tttagcactt ggtccaactg caccctcttg accgctggct    194520
     tcctctccac aagcatactg aaaatcaact tccgtggacc tctcatttac ctgcctcctt    194580
     tcaccttttg aagccaccga agtctgtgca ccaccctcca taactaatgg aggtggccga    194640
     aagcagggaa tccgcttcgg tcggtccgtc cgccggggca gagtccacca tcaccaatgg    194700
     cgaacaccac cttctccttg ccgacgcgct tatagatgat gatgatgacg gacgatctag    194760
     tagtctaagt gaaattgacg atgtctccga gaatatggtg ttcgacctcg agtcgcctaa    194820
     acctgagaag gctatgacgg aaaacgattc ggaggcggaa accgagcgca ttgaagattc    194880
     tccgaataat attagattga gaagagacat tgttgtgagc gcaactaatc atggtccgag    194940
     ccccagcaag ctagctcaat caacgactta cgatgaagtt gacgacgagg agcatgtacc    195000
     agacgattcg cccagcaagc cccgctcaaa aaataaccag gtccctaacc ttggcgaaga    195060
     gacgccaggg cttgatgagt ccgcactttc agaaggcatc gggaagaaac gtaaacggct    195120
     caactcggct gatgagatgg gcaccgaact tgacgaagag gacgagcctc ctcagaaacg    195180
     tcgcggctct ctcaaaagcg aactgagtga tcctcccgca gaggatattg tactgacgcc    195240
     tgagcccatt gaggaggaac ccatggagga accttccaag cctaacgagg atgatacccc    195300
     agtcgatgat attcccgagt ccgacttgcc agcggctcct gctaagggaa gaaagagtag    195360
     gaaaggcaag cgaaaggggc ggaaagcgag agatgtcgat gaggatgctg acatggctct    195420
     cgaaactggc gcggaaggcg gtggggatga tgcacttggg gatgaggagg ctgccgaacg    195480
     cgaagaagca gatgatggtg aggctgccgc caaacttgaa gaagaatgta agttactatg    195540
     tcctctccaa ccatgtcgct ttttcttcgt gctaatgttc gagcgtagca gcgaaacggg    195600
     tatctgcgat ggaatcgctg gcagttttag agcgggagtt cgccgccctg cgagacaagt    195660
     aagtatccct gcacctcttg gtcaggcatg cattggttac tgactaagcc aacaggatct    195720
     atgatgaacg agtctctaaa cttaatcgcg aactcgaaat gctgaacggc ccgaatccta    195780
     cacatcccga attcctgcgg cagttggagt gtatacagcg gtatcgggac gccaagatta    195840
     aatacgaaca tacactgtat caataccgaa tcaaggccct attgaacaag agcctggccg    195900
     agcgtgcaca agcgcatagt acttacttcc agcgggctcg ggacgttcgt gaaaagcatt    195960
     cgagtgccat cagcaagcag ttctatgcca ttcagcatga tcgcttcaag acggatgaag    196020
     ttagtccgca gcattatatt ccgtttccca cacgccgttc gcaacagatt gccaaccaga    196080
     ctgcctacaa ccaagaagta tccattctgg ctggtgttgc aaagtatgtc ggtttcccag    196140
     ccgctccttc attgtctgct gcacgaccgg cggagcttga ggaggacatg gaaaagatgg    196200
     gcgtaagtgt attcgggatg ctctttaatc atcacgcttt ggtgctgacc taactggcgg    196260
     gcagatctcc attgaaacga gagttcctat ctcacatcat cactcaacgt tacaacgagg    196320
     cgccatgtcg tctatgtcgt cgaacgtctt ccgcgccgcg gcggaggaag cgttcttaga    196380
     acagacccct tgggccaacc cacagcatcc aatacatcat caacagcaga ttccgccaag    196440
     gccccagagt cgggtatttg agaacccgcg ggcaccggct tacaccacac cagcagctca    196500
     aaaacgagta gtggacattc atgctcctaa cgggtcggca tccaccattg ccgaaaattc    196560
     ctcggcaaac aacacaccct atgatcacga acagcccaca cagggtctcg ggccgtatgg    196620
     gaatcccgaa tacgacgcag accgacgatc cgggttccga tcattaagct cctccccgct    196680
     agatgtacgg aaaccccatc catcctcgta taacacactc gacaaccgat caccgcctca    196740
     ccggaatgcc ggttactcac cgcctcctgc ccgattaggg ctcttccagt cgaaacgtga    196800
     ttcatcacca ccgccgctgc cctccaaatc agcgaattcc atacatcatc acggatcaac    196860
     tggagtccta ggtggctccg gctcgaacca aatgacagcc cgctagaacc cagaacaccc    196920
     aaagaccttg ccatgataac ccccatcctc ctctctaccc cacatcataa cgtctcactt    196980
     attgtctcca tagcgttttg gatagtgtat agggttccac acggtgttgt agagttgctc    197040
     tattattctt ttttcttata atgtatgtac gggttagcat gtatgactgg aatcgaaata    197100
     gggatgaggc caacttcact tacagtaccc catttgcttg tttatctttt tgctttggtc    197160
     ttggcgcatt gtgaatacgg ggattatatg gatgcattgc ttgggcttgt ttctgtgttg    197220
     tgttaccttt gtatttgcac aatacctacc tacctatcta actgactata catgctctat    197280
     gatacacaaa ttggccctga gccttgttga ttctacttca tttgagtgct tgttccacgg    197340
     atatatatgt attaggatat aaggattaaa atataattga ctagaatcat gatcatgcat    197400
     tctcttaaca tgactgtata accctaccaa gtaatctaat aggacctggt gacggttcaa    197460
     taagtaatct atcgagacaa atggtattcc tagatggcaa aaggcgacac agaactaggc    197520
     aacctatact agactgatat tcagtacacg gatggaacca tagcagatgc attgcatttc    197580
     cgctgtaggt atgttcaaac atatagtctg tgtatacgag acagaattgg atctgtgtcc    197640
     aaactagaca tgacattatc tatcaatcct aataaaagta cggtcaaaat tctcgctcgc    197700
     ttcggtttat tttcaatagc agtctgacag gccttggggt gtagggatgc cgggggacga    197760
     ggtattgatg gtttggacta tgtttgtggc tgtggttgct gtctgcgcgc gttggttggg    197820
     atttggtgcc taagcaccgt ttgcgacggg agtgttgttc tctgattcaa ctgtgcggtt    197880
     caccaaggta gattgttgtt cgggttgtgc ttgctgtaca gctgtgctct gcggacgcca    197940
     tctggctagg actttaccag cggcgggtcg tgattcctcg tctggggtga aaaggttagc    198000
     agggagacgt ccatggggat tggtgtcagt agcttacatg tctgataaac atcctctacg    198060
     gcattgagac acatttcccg cgccgggggc cggaacataa tcagatacct aaccgatgtc    198120
     agttcatata gttctcggag tctcacagtg gatgaaatac gcacagcaac gattggatgc    198180
     agagattcac tctctcagga tcttttgcga gactggctac ccgttttgtg atgggaatgg    198240
     ttacctctgg aatctcgctg aggaaccgga taaagatctt ggtgtcccga gaatccagat    198300
     acggcaaaaa tccgtccaga agccgcagtg accactggtc gtagtgcaat ggcaccgacg    198360
     attcctcatc ttcctcacct cgttgggacg cggtaaattt catttgaatt cggtcattgt    198420
     accattcctc gttcaaccac atgattccaa catttactcg gcctctgaaa tcttcgagta    198480
     tatatcgata caatgtttcg cgtatagaat cggatatcgt cggtctcttc gacgacgggt    198540
     cttgatcgtt cttcttgtgg tctacctcta acccagcagg cgcccgcgtc gcgagtcggg    198600
     tgagtagtgt tacccaggcg tcccgatcaa aggtgctgcc agccagcctc gagaaaccta    198660
     ggtgttgctg gctctttcct tttccagtat ttggcgccac accgctcgat gcaagcatgt    198720
     caaacactct tcccacggca cttcggccga tctctgcagc ctcattttct gatagtgggg    198780
     gaggttgtgg gagcacaaaa ggaccgagtg acaccaagtc gggctgaaga tcggccggtt    198840
     cagccgacag tgcgtcttcc tgctctgccg cctgttcggg cacgtccatg ggttgatatt    198900
     cgggctcata gtcatcgtct tcttcttcac ccgttgccgg tggaggaggc tgcgcagctt    198960
     gctgcttctg gagcgtctga taccgcattc gtacacccta cttagaggtt aggacttgtc    199020
     ttctctccaa tgtaaaatgt ctccaactta catcaacggc ctgctgcagg gcagattggt    199080
     ctacacgagc taaaacagga accacaatct tgacaagaag ctcaaccggt agttgcttca    199140
     catcaaaaga ggagaggcca gcgtcttcag ttaacgtata gagctgtgag taactgactg    199200
     ggcccggagg cagcggtgac accttgatca gtggagggga ttcagcatct agttttgccc    199260
     gcttggaatt gtccagacca tctgttggct cggtcggtag gccacgcttc ttcgagctat    199320
     catcaacggt ttctatgcgc gactgcatca agcgctcgat atgctgctgc attttgcttg    199380
     ctaggggatg gctaggattt ctagaccgcc catcagctta tgacccgcaa cttggaacga    199440
     ccaatccttc tcacctcttc attatattga tcatgagggc cctagccgtg cgctccatcg    199500
     acttgacgcc aacacgaacc gcaggcgtca ccggggtgcg tgcttgtctt gcaggaacga    199560
     agcttaggat cgcgttgata atcttgttac cgatggactg tcgggttcga atcaggatcg    199620
     ctagactgtt caacgtcgca ttcactagga gggggtcgct aacgatgacg ggtccattag    199680
     tgggacatgg cacaattgac ttcagagacg gtatcattta taccttgcat cttcctgaaa    199740
     gaccgacagc aatctatcca gtaggcccga cgcctcggct tctaagtacg ggagggagag    199800
     gatggaatga tttctaggaa caatggccaa ggacgtttca ttctgctccg gccgctggga    199860
     atcatcaaca gtctttcctt tgggaacagc gggcatttct ttctttcctg tacgtactct    199920
     agggtccgtt agaccgtggg tctggacttg aaccacccgc tgtacaaact tgatacagca    199980
     tactttcacc gagaatgggg acgtatccca tctccggagt atatcgtcct taatagcggt    200040
     catattctcc caaactttgg agtcttcagg gtggttgatg ctgcaattat caagagtgtc    200100
     agttcccaca attccccagt gagccggctt aaattggttt cctgcgcact tctacgagac    200160
     ctctccccgg ggcgaaacag aagggagagc agtggtcacc tacatatgcc taaacaccag    200220
     gggatataaa ctggccgcag cttccactat atgtttcaaa gtcacagtat ccttttccgg    200280
     caactccaac gtctctcgta gtgtctgcaa agcaatggca gctagctgct ccttctgagc    200340
     tggagccagc gccgggctgg agaaggtctc cgctaagaat tctgcacccc atcgtcgtaa    200400
     ttccaatcgc gatcgcgcac caattatagg aagaacacca ttcacaattt gtgggtagaa    200460
     tgcggcatcg cccagaacga gggttcgggc agcgttgagc tgggcgatct ggtcgacaag    200520
     actaccagtc gactgagcca tgacggctct gttcaaccgg cccggaggga caattaaaga    200580
     ggggtctcgg cggttaagcg aatcttctac gataaataaa atctatagta ccatgaaaag    200640
     gaacagaacg gttcgggtta aaagacgcga cgaacagcct ggccacgaca ccgccgggcc    200700
     ggggaacagg gtcaccggtg gttatatggc gtcaattctg gagccaaaag gtcgattccg    200760
     ggatgaggag cgacaggaaa gaatattgca gtagatatgt agtgattgtt gaaagagaag    200820
     ttgaagtcgg gagatttcaa gatgacgccg atggactgga ttggggaagt aaagtcacct    200880
     gcagcgggcc ggcaattcgg ccgatcattt aatttgttag tgaagaaatg ccagggcctt    200940
     aagacaacaa cacaactcat tataccttac acaatgattc gcatcggggt atttatatat    201000
     gattcagaaa aaaaaaaaaa aaaaaggaaa attgcatgaa attccttcga cccatatacc    201060
     cctcagtctt tctcttcgat aaaattaaat acgtactgta ttgccgggcc attgacccct    201120
     gcacaaattt atatactatt cgtacacatc aagctaagca cagtaataaa gacccctaat    201180
     ctcgcaagca ttgccatttg actctcaact aaaccaccaa gattatgatg tgcaagcgag    201240
     acactgtcca cctttagtct atctctgact cagggcattt ggttagtaaa tggtattctc    201300
     gcctgtagac aatgaaagta gctcgaattg cctggagtta tgattgatca cagggtatgt    201360
     acctctgact gatataaaac cgctagcctg tatagaaaat gtttctttgt ctctttcata    201420
     ctacgtgctc ggtcatgctt cccctcttag tttcaatcgc gctgacaaga agcgcaacat    201480
     cttcatcgat tggcgtctca agacataact cgatccgtct tatatggtac ccgatataag    201540
     tgttgacagg cgaattcctt tcaactgact aggtgcgggg atttctatag caagatcttg    201600
     aaaagaaagt tcgttcaaca agtgcataga atggatcgtc aagaaatcgg tcctccatcc    201660
     acggtccagc tccacccttt cgagcagaat gtcaaatgtg ctaagtgggg ggtggctcgg    201720
     atgtcggcca gctttgctcg tcgacatagt ctatacaacg gcccatctac actttcgcct    201780
     cattgcattc ttctaggaat tcgccatcct cgtcgacgtt gtacacatac tccgggctaa    201840
     tgtgaaatgg agtgaggatg ggcgctggct cctatgtata ggtaggcttt tgagaggatg    201900
     ttgctgatgc tttgcaatgt agactcgtca ttcgaaggga gttttcattc atgaggagga    201960
     cataagaaat tgtatgattt gctaagattg ctgtcagtag tagagctgta tgtaagagaa    202020
     caatacgtat gttcggctct agcatcaaca ggtaaagttc aaaagccgcg ggtaataact    202080
     gtgcggcaat agtatgagtg ggagatttga agatttccag ctgaaggaga tgcaacttct    202140
     aaagttgtag gtgagatgtt gctgttgtcg agtaaactgt gccgtatgca cccaagtata    202200
     gtcctaaatc cgcgtgtcca cgttaactcc ggatcaaaac cgccaagact tttgatcgaa    202260
     agactcgcga taatcttccg acggtgtcga atcagtccgc acttgctcgc tgtacggtcc    202320
     ctcaccactt tctcaatttt cccaaataat agaaacatct ctttctcctt gatactcgca    202380
     ggaagatctc aaaagatggc ctccggaatg tacgtcttta ccgccacgca cacaatgcac    202440
     tcccctcttt aataccccca atacaagtga gcccatacta accctagaat cccagcttca    202500
     actccaccta ctacggcaaa gactaccgcg ctggtgctgc tcttctgcgc gcccgtcgtc    202560
     cctacctcgt caagaatgcc ttgaccggac tcggcctcgt cgcgttcact atcagcgtct    202620
     gtacgtttga ctccgatcat atcttctctc cggaatcaca aaccaggaat catactagac    202680
     ccaaggaatt aagtactaac caaccaacta tacaaaagac gcctacacca tccgtgcagt    202740
     cggccaggat gaattctccg atgtgaaggt ccccgagacg cccgcgaagc cccagcagaa    202800
     gcaatgagtg cgaatcgagc gttttactcg acctgttggt gtgtgacttc cgcttttgat    202860
     ttggttatga cggactctcg gttggtcagg gttagaattg cacaccaatg gtcaaggaca    202920
     atggttcgat tcgatcattg atcggataat gtatcgggta ccggagtaac gtggcgaatc    202980
     gtgtttcctt tgcttggcac tacatgcctg tgggcttcga atgggaagag gtttttcaat    203040
     gtgcgagaac ggtgggagat gtaggtttcc tattggaagt ctgcgaagtt ggaagtgatg    203100
     gtgagagcgg gagccgtgca ggacccagcg ccgcggcaat gctgcgcagt ggggatgtga    203160
     agaagcgagt cggttgggtg cccgcatgaa aaatacctct cagctcattc tgttgttatt    203220
     cctgtcctta ttagcattta tatctgtata ttatctgttt gaacagtcaa gataccaccc    203280
     tcttattgat tgcagacgtg aagcagtacc atcggagccc aagatttacg gaggctgggg    203340
     ttgattataa tgtacgacgt aaagccattt taatatggtg gcttatgttt aaatcacatg    203400
     cattttctaa tcgtctacat tgtcgctttg aaacggtgtt cagatacaaa aacatggaat    203460
     tgagaaacat gctaaacaga gagaaggatc cacctgtccc ttacgaggcc acaaaccaaa    203520
     gatgggcgga atcacagact ccacctttac tcggttcgca gaacacgggg tcctttcctc    203580
     ttggtagcgc gcttccgctt gtggccccgc tcaaaggctg tggcgctgtt atggtcacgg    203640
     cccaagttgt caaggtcctt gaccttgtag atacggatga tccagttctc gctggtaaac    203700
     gcttcttcga gggtggaaag ctgtggccct tcagcgggca gtcgagagcc tcggacgcgg    203760
     tccatggctt gaccctgctg gaagagagcg ttatagttgt agtaggacat tttgtacctg    203820
     ccgggtatca ttagcacatg ctctagaatg tatcgtttgc aagatttggg cggccttaca    203880
     ttaagctgtt gcgcatcgcg ggggtagcct catcatcaac acggtattcg ccccgtgccg    203940
     tgaagtagtc ccgctccttg acctcatcgg gccagatgcc ttcggcaatt ctaaccatcc    204000
     agagaaactt attgatgtca tcaccagagt aacccaacaa accgccgaac actaccagca    204060
     cataatcaac atcatgctgg cggaggatag gatagctaac ctcctcgcga gagctcatcg    204120
     cctttccaac agtggcgatg tgggtgttat tccaggtgtt gttgtcaaca agagtggggc    204180
     gatccgccat accaccaatc tggtatccat aatcccacca ggacatgatc ttggcgttat    204240
     cgggggtgtt ctggcgaagc cagtagtagg cttcacggta gtcgtcgatg atgaattggc    204300
     tgccatccgg catccgacta gccagaacaa ccgaagggga agagtaggca ttggatgtga    204360
     cccaagtgca gtgcgcaacg aacaggagca gataaatgac gacagaggat gtcacaacgg    204420
     ccttggaaat ataagaggaa attccaacaa ccgggttcct tgtggaacga agaccttctg    204480
     cggatgtctc atcttgggcc ttgctctgag gactcggccc acgagatgca aacacatacg    204540
     tatcaatgat ggtcgacaac gccagcgcag ccgccacgca gacaatcggg gtcaatgtca    204600
     gcatgagacg aaccatgaca ccggcgaagt agcttgccag gacggcgtag ataatgacga    204660
     agacgtgctc gtccttgaga tcacggaagc acatgtagac tccggcgggg aagagccaaa    204720
     tgaggaggtt caagtcaaag aagaaagctg gccaagcagt cggctggtgc tccgacaccg    204780
     atgcaatgat agggatatgg attttggcgt agccagtatc ccacagggag taaaagcgac    204840
     cgctccacgg ggcaattact ccggacacgg tcaaaagaac aagtccggca aaggcaacac    204900
     cgaagacgat gataaccatg gcagtgagaa gtctctggaa ctgtttaccg gggatgaagc    204960
     cgcggacaaa gtcagcaaat gccacgagtt gaatcagacc aaatacacct aggtagtcgt    205020
     tagtatgtct cctgttgact aactgagaac gcgcttaccc aaggcagaca tatggtcact    205080
     gttccgaatg gggaggaagc cgacgaatgg aatctgcatg cttgccaaag ttcccagcgc    205140
     ataccaggtg gtgtaactga tgtacagacg ggagctatat cttcccatac agagaagcac    205200
     aaagacatgc aagggaatca gattggtgat aaagacataa ccaccccaag ccgacaccat    205260
     gtaaccgtag aagagagcgg tcagcgctcc ccacatgatc gaaccatttt tgacagcctt    205320
     gatccacaag aagaaggtga atacaagaag gaagattgca atggcttcgt tatcatagct    205380
     acccgcaaca gatcgagaga tgtatcccgg ggtaataccc atgaaggcgg cagcaaggag    205440
     accagcggaa ggtgagatgg acatctcgca ggtcagcaga tacatcgcaa atgccgtgag    205500
     accagaaaat gccggtgcga gcaagacaca aatgttgcga atgtcgacgg gaatggttag    205560
     gaatcggagg atgtggtaga tcacgccgct ggtcaccatg agacctgggt ataacgtgcc    205620
     acccgtgaca cggcccagag ggtgccatgt tcctgtatag aattagccag ttagtaccat    205680
     aagcagatgg ttgtcgccgc ttggctgttc gatatagttg gtatcgcctg tcgaataatc    205740
     acttacggtc atcaaaccag tcccagaagc tttcgaagcc atgttgtacc aagtattttg    205800
     ttgcgcgaaa attaaaccaa ggatcgactg tagggtatga agtcagtgga ttccggagct    205860
     cttaacgaag agagacaata gtattgcata ttgatcgaag tcgggggccg tgggcaactt    205920
     gtcggagtat aggttggttg gtgctgaacg tacattcatg gataatgctt tcaaaaccta    205980
     gcgcataaca agtcagtgcc aattgactca atgagtaatt acaaatagat tatctgtcga    206040
     atgacatacg aatcacactg aacagtcgac tcgacactgc agcggcggcg attgtaacta    206100
     gaatgataat gcgcagcagg ccgcgcgtat tcctgccggt gttgcctttc aacaaggcat    206160
     caacaggtgt ttcggccata acggccagag aagaatgtaa aaagaaaaat caatggggaa    206220
     agcaaaagag agttggccct cgtcctgccc tggagctgaa gagaggagta gttggatgtt    206280
     tcgttgatcg aatggagaca gcttcgcaag gtggtcactt ccgaggcttg gcaccaggca    206340
     cgtttcatac atacaatacc gcgtcacatt gaactctccg cgcccccaca ccgcaccgcc    206400
     tttgatatca atcaaccgtc actatcgata ctactgagat tagcttcagc gtgctgccct    206460
     tggtctttgc atacgtcttt ctcttgtctt accgtctctg cgaataatcc actttcattt    206520
     atacatttat taaccaagat ggatttacct ccactctcca aggaacaact ttccgtagtg    206580
     ctcaaatcta gtcgttcacc aaccgagctc tacaatattt tggtggagta cgagggcgag    206640
     gcttatttaa tgtcaacatc tgatagcaat gtatcggagc tcctcagtct attctactcg    206700
     acctttttct ttgcgcatct tctgacagat caaatgtgag ttctacccac gcccaaagcc    206760
     tgcagagaag gctcctggtt atacaaccaa tggtaacatc ctggcgttga acagatatga    206820
     agctcgcgcg atgactcaac gaatgccaca agagctgtct caaaatgatc cgtcgctcca    206880
     gaattgtctg actctcttac gggctgtttg gcagaggaac tatgagtcaa tctacaaaat    206940
     cttaagagag ctaccctggc cagatttcct gcgtccggcg gtagaaagct acgagagtaa    207000
     gagaaacact tcccctttgt ttctgtcgct gtgacttgct gactattttc ccagcatatt    207060
     ttcaagagaa aacattgaaa gaagtcagcc atgcctacga agcgatacgg cctgcaacag    207120
     ctgcaaacta tctcggtctc gatactgctg cagcagaaca gggcgacccc gcagtgatac    207180
     agaaattcac tgcagttggg tgggtatggg atgaaagcac aagactatta caccctaaac    207240
     caatccccac cgcaccagaa aaggacactc ggttatacga tgaagtgagt caaattatgg    207300
     cgttgattgg gaagcacggg ggctagaggt ggacaattcg gacacaatat cgcattagaa    207360
     acccgggaga tccgactggt tgaacgaaga gctgagatgg ctacgcaaca atagacctcc    207420
     aggtccgttg aatggcggaa acgtctgatg agcaatgata agagtatcac cccacccaag    207480
     ggcgcacaca gtacaaggga tcagcaatga caccaaagcg aacaacagaa tctcttgctc    207540
     ttctggtcca actgtagtgt acagacgcac gacagcccag aatatgtaca atgactcgga    207600
     gaggatctct agtaacgtaa aagaaaaatc attcctttcg ctcgcaatga cacgactctg    207660
     ggaaattaga ccaaacaata atacataatc gggggttacc cgaacaacct ttattgtacc    207720
     ctagggggca cgaccgttgt accagaacag ctgtcactca tccttccgct ttgtacctcc    207780
     caatttctct agttctcccc ggccttcatc ttcaggtagg cctcaaggtc gaaccggctg    207840
     tcctcgggat ccgtgatgac tgcaggcaac cgttagcgcc gggtcaagta tagcattacc    207900
     ttcgtgggat agatcgaagg ggccgtatct cattcagggc ttagaaagct ggcaacatac    207960
     ttccgttgtt ctgtgtgtcc ttgggtgctg tcttcttctt ccattcggcc ttggcctgct    208020
     gaatcaggcg ttcctggcgg gcgtattcac ggtcggcttc ggcacgcttc gcgctggcgg    208080
     tgattgagga ttggtggtag gcaccgtaga agagaccggc tacgagagcc gagtagcgaa    208140
     ggacctgtaa tgcgggtatg atgctgtcag ttgcccaggg tccattatca gaacggggcc    208200
     cttgcggaca ctcacgttga caccttgtgc ggtagccatc tttaagatcc tggtctccgg    208260
     agcggaattc aaaaaaggac aaataaacac agggtaacaa ggccggattc cgagcgaccg    208320
     tttggagggt atcaattggc aatggctggc aatcgatagg atactcagaa gcttgttcaa    208380
     ggcgaagttc ctgtcgcgag tttttccgga ccgtcggggg cctgtgctta tgtcatccgc    208440
     cgacccggac tctgggcgcg ggacggggaa gtccaactaa cgcgcataac ataccttgag    208500
     acgggagtaa ataatcataa acttatagta cccgaactgg tttggtttgg atggtacgtc    208560
     agcccatcgg ctgtctcaat tcaccatgtc atcagccatg cagcagcgaa aggcagagat    208620
     tctcgccaaa agagcgaaac ttgccgaact aaaacgacaa agagagttgc gccagcagga    208680
     gttctcacag agtcgggcca acagcggtga tgcttccgag gtaggggaca ttcttcaaca    208740
     ctaccaatat tttacaggag agccatgtct ttttaactcc ccccaccaat tataggttgt    208800
     gtccccagtt cctagccgtg ccgatagcag agcggagctc gatgacctga tctcacgtct    208860
     ggtggaccgt cccgggtcgg cgtccataag ccacgcagat ggcccctcac gcaaagggag    208920
     caggccgaat tcagtgatta gcgctagcca agtgagcgga gaccatgccg aggcttttat    208980
     ccctgctgcg cgaccagttt cgcactcgat cgccgtccaa actgtcggtg cagagccata    209040
     tcctacagca ccagcccctg aaccaaaacc cgaaattgtt acatacagca aaggagtcca    209100
     gacggatgac tccaaacaac cacaaggtac tttatcggta gaatccgatg acgaagatgg    209160
     gcaggatcct acaggcacag gtaaacgcct aagcaagaag gagcgcgagc gcgacgaaga    209220
     gatccggaag aagctccgcg cagaaatcga ggaggaattg ctagctacgc aacagaaggc    209280
     agaacatgac gccgaggatg actcttcaaa actgcggtat ccattgcgca cactggatga    209340
     tgacgaactg aaggctgtga cttcttccga ggatttcctg gacttcgtcg aacgttccgc    209400
     aaaggttatt gagcgtgctc tcgatgagga atatgacgta ctagcggatt atgagcttgg    209460
     tggacttgat ggcgacgtgg aggaagatga cgaacatgga aagaaaagga gaggcatcag    209520
     agaggtttgc cagttttggg acgaacgatg gagcaagaag cgcatgatca gcgacgtgag    209580
     cttttctcca aaggtctgtc accatcgaaa ttatttttta ccttgttatg catcgctgac    209640
     tcgtcacata tagttcccag agcttgtttt agctgcatac accaaaaacc catctgctcc    209700
     ccatgaaccg gacggcctgg ttcagatttg gaaccaacac ctgcaatccc gccccgagta    209760
     tgtgttccat tctacatccg atatcttggc ggccaagttc tccccattcc accctaatct    209820
     tatcgtcggc ggttcatatt ccgggcaggt cctgctttgg gatactcggt catcgcgcgc    209880
     aggtggtggt gcaccggtac agaagacgcc tctgactggt tctgggcaca ctcatccagt    209940
     ttatagcatc tcaatcatcg gcacacaaaa tgctcataat atacttactg cgtctacgga    210000
     tggcgtagtt tgtggctgga ctgttgatat gctgtctcaa cctcaagaat atctcgaact    210060
     ttctactccc ccgccatcta aaaccgaaga cctcgccccc acgaccatgt cattcccaca    210120
     atccgatccg acattcttta tcgttggtac agaagaaggc gggatttacc cctgccatcg    210180
     ctacgaccga gccggtgcta aggccggaac cgaccaccgc ctcgcgtatc gtggccatgc    210240
     ggcccctatc atgtctactg ccttccaccc ggcacggggc cccgttgatc tgggagacct    210300
     gatgctaagc tctagtttgg attggagcgt gaagctatgg cgtgttcggc caccagcaac    210360
     cacagcaccg gccacctcgg ccatcgcggc gacacaggtt gtatctccga ttctggacat    210420
     taaccgtgaa gacgttgtct atgatgcccg gtggtctccc caccgccctg gagttttctc    210480
     ccttgtcgac ggtgctggaa acctcgaaat ttgggacctc tacacggata cggaagtacc    210540
     agttgtgcgg accacgccgt ccaagggccg tggtggcatt ttgacgagta gtctcaacaa    210600
     ggtggcctgg gaggaacgcg aaggaaggcg gattgccaca ggtggattag atggggttgt    210660
     caccgtattt gaggtaggga agggtcttag tggtactcct gaagatgtgc cagccgagga    210720
     atgggccgga gtgaagcgac tggttggggg actagagcaa aaggaccgga tcaactgacg    210780
     tgataattgg gtttgtgatt ggcatagatc gcttcgcctt ctaaactcca gtgagacggt    210840
     caatgtgatt tgactccaga ctttgtgcgg ggagtgttga tcccccgttg ccagaacgcc    210900
     gcaagatctt catgcgcagg ctaccgtcca gttgctacag catagtagct tcccctactt    210960
     tcccttgctc attttgtgtc agatttcctt gcatggcgtc tttatttagt ttttatcata    211020
     tacccctcgg gcagctgttg atgtatgtat gcatttgttg gaccaggaag gcgggttctc    211080
     tggatttata ctcgacctga cttagaaggg cattaaaatg taaatattct actttcgaga    211140
     tattttcggt atccagcaag acaagtaggg gtatccatgc catatgtgtc gccatattcc    211200
     tgtatgtctc aagccgacat gagctgccgt gttggacggt atcaaaaatg gctcatagcc    211260
     cgcagggatc tctcggcact acggttcccg atatggcccg catggacatg gatttgccca    211320
     tctaggatat gttacgtgat aggtaacact tgggcatctc gtagatgagt acggagtact    211380
     atcggaccac aactgccaga cgaaggagtt ggtcacaagt gacatggaca ctattttagt    211440
     gaaagtcact aatacagtga agtataattt caaaaggttg tctgatctcg ttgtatcgtt    211500
     tctggaatct gcgcgcatga cggagaggcc ccagccccat gatggtatta gggtccttgg    211560
     accataagtt ccatttcggg ccatttagag agggaaaatt gtgtctggca tgcatccagg    211620
     gctatattgg agggaatata ctttgccatg actgatcact caccgctaat cttctggtcc    211680
     gatcctttac ggcatatgcg gtttcagtgc ttagtcctca tggttaagct tcacaagtat    211740
     ttggagaaaa gtcaacacct gagggggtca aatgataaag tttccgtcga tggccagcaa    211800
     attctcctag agacgggaaa ctgaatgtaa ctagccggta gagtaaaaaa ggaaccagca    211860
     gaagagcaac gttccagttc gtcacatatc tatccgaggt ctgcaaaaat gacgcacgga    211920
     ttgcagacct gtcggaggat atccaggact ccaatccgac cgttcccaag cgaggtcatt    211980
     cattccgatc acagactcaa aagttggaga gtttgattgt catcagggga tcgacacggg    212040
     aacctgatgc cttgcatggc acatgcctga gaggaatcaa taattggaac gatggcggat    212100
     tagggcttgc aagtctgttg actctagacc gaatgagagg ggaagagtta agccccttgc    212160
     ggtatggagt tgccgtgatg ccgagtcttt ccccagccaa tccactgacc tcctccaacc    212220
     atgagaccgc atgccgacca ccaatggagc ctttgggcct gaggcttgcc ccacctgcaa    212280
     aagggtcctt atcgattgtc gaccccacgg caaactacac ctactactaa ctagtaacta    212340
     ctgtgtgata caaactcaca ttcaaccctc gtcgacttct gcaaggaagc taactgatag    212400
     caccactgca ttccatcatg caatggcaac caccttcggc cccacgtggc ccatcaaagc    212460
     ccgaattgca gccgatcctc aggcctgatc gggttataca ggaggatgga cttgctcata    212520
     taaaggcggg gacatggtca ccagaaacac cacgtcgtcc ctggctgcgc acgactctta    212580
     tcacggtgct gctgttcatc atgagcatca tttccttgct cgcgttcttc tccctggcgc    212640
     tgggtatcaa cggccttccc catgcccgtt cctcaagccc ttcgtacggc aagccggtaa    212700
     accctatcaa ggacactccg attaagaacg tggtatgttt cgcttgctgt catttactga    212760
     atggttagcc ttcccgacct tcagtactaa gtaacactat aggtggtatt ggtcgaggag    212820
     aacctgagtt ttgacgtgtt tgctggtggc ttgacataca acgccaaaat tgatgggttg    212880
     gtcaaccgcg agtactgcaa cccatcaaac gcttcagatc cattctcaga gaaggtttgc    212940
     gccaaaccga tcgcgaagaa tgtggccccc gatgatccgg accacagcat taccggtggt    213000
     aaccagcagg tgtatagcac ctatcacccc aacgcgaaga atgacatgcc tggcatgcag    213060
     ggcttcgtaa cagagcagat tgtctcttac gggctcggct ccgatttgag tcgcgctgcc    213120
     gaggtcatta actactacac gccggaccac gtgccggttt tcaatgccat ggccgagaac    213180
     tttgtgctct ttgaccgctg gttcgcagcg gttccggggc cgaccaaccc caaccgtgcg    213240
     tatctgactt cgggcacctc gcacggtcac ggtcaaaatg accacgactt cgatatctcc    213300
     aacttgcctc aggtgtctat cttcgaacag ctctcggccg ccggcattag ctggatcaac    213360
     tattccaaca ccactggttt tcttccagat tctttgttct accagtggac tgccaagagc    213420
     ggcaagggta ccaccaacgt gaagtctatt gaccagtttt tcaatgatgc taaggccggt    213480
     acgctgcctc aatttacctg gattaaccca gaatgctgtt cgtatatgtc cttccacccc    213540
     ccttctccaa tcaacatggg cgagggcttc attaagagca tctacgaggc gttgcgctct    213600
     tccccgcagt ggaacgagac gctgttcatc ctgacatttg atgagcacgg tggttttgcc    213660
     gaccatgtgt ctcctcctga gaatgtgccg gctggcgata acctgacgta taccgaaacg    213720
     gccaaggacg gccaagaggc taccttccat ttcgaccgtt tgggtatcag agtacctacc    213780
     gttctgatgt ctccatgggt gggcaaaggc gtggttcaga atagcccggc tgaccagcct    213840
     aacgaattca cccacacctc tattctcaaa tatgtggctg agctctggaa cctggacatt    213900
     ctcactcctc gcgtcgactg gtctcccagc ttccggggtc tgatcaccaa cactttccgt    213960
     gagacgccgg agaagctacc tgagccggct gatttttaaa gaaatgaatc tgtacagtct    214020
     agactcgatg tctagagccg catatgacca tgatgacgat ataattatga caataaccgt    214080
     ttcaattaaa tgagtctagg cagccacgaa ggttttgcct ttgtgtgaaa attctctatg    214140
     cccatctagg acgcattaca ctagaaaatt gtaaaattgg ctcagcctcc actgccttga    214200
     agtcttgtca gggggagccg ggtatatact cttccgtaac tctgagtata atgtttggta    214260
     ctcgtcaatt gtccctatcg ttcgttgttc aaatgttgat cgaccttcgt taacagtcca    214320
     taatcggttg ccctgttctg taaacgtatt tgggagccgc tcagcatttt ccgccttggt    214380
     ataggtcttc ttgttgtagg tatacaatgc tacgatgttg aggctgatgg tacctgatgc    214440
     tcggagataa aaaattaaac acaacacgtt aggtaacgtt tgatgcaatt tgcccctgat    214500
     caacgattgg aactggaggt gattggagac caaattcttc agcatcttat ctttgattgt    214560
     taactccgag ggctcgggaa tagttacccg tttcctctta gcggatgcaa tagagcaaga    214620
     aaacgtgcca aaatactcaa gaaagaccgc gtcagacaag atgagtgcca agagagagcc    214680
     aaatctcggt cattgtatct cccttgaatg ttgctgacat ggtggctcga tcatggatag    214740
     ctttgcacgc gcaagggtca gggctgcatg gagagatcag ataaggccgg atctcagccg    214800
     aaccggaaca tcagataaca aaaattcatc gtcggacgac cggagactac tactactact    214860
     agtatcaact ccgcgggtcg agcctcgagg aagacctttt gacttggcat cttgccacgc    214920
     aacccggtga cgacagcctg agtagaatta aggatggcaa agcgttgatc tgccgtttgg    214980
     tccacaagct tgttacgaat cccgaacctt atgatgccga agacggtggt ctctcagccc    215040
     tagccttgca ataaatagga cgatagtttc cctatggctc ctcctagata cgacctcatc    215100
     attcgtttat tcctttcgta tcctttgaac actccttgac ctctgccatt cttttggttc    215160
     gaaagatgcg ccaacactcg cgcatggccg ttgctgcttt ggcagcagga gcgaacgcag    215220
     cttcttttac cgatgtgtgc accgtgtcta acgtgaaggc tgcattgcct gccaacggaa    215280
     ctctgctcgg aatcagcatg cttccgtccg ccgtcacggc caaccctctc tacaaccagt    215340
     cggctggcat gggtagcacc actacctatg actactgcaa tgtgactgtc gcctacacgc    215400
     ataccggcaa gggtgataaa gtggtcatca agtacgcatt ccccaagccc tccgactacg    215460
     agaaccgttt ctacgttgct ggtggtggtg gcttttccct ctctagcgat gctaccggag    215520
     gtctcgccta tggcgctgtg ggaggtgcca ccgatgctgg atacgacgca ttcgataaca    215580
     gctacgacga ggtagtcctc tacggaaacg gaaccattaa ctgggacgcc acatacatgt    215640
     tcgcatacca ggcactggga gagatgaccc ggatcggaaa gtacatcacc aagggctttt    215700
     atggccagtc cagcgacagc aaggtctaca cctactacga gggttgctcc gatggaggac    215760
     gtgagggtat gagtcaagtc cagcgctggg gtgaggagta tgacggtgcg attactggtg    215820
     ccccggcttt ccgtttcgct cagcaacagg ttcaccatgt gttctcgtcc gaagtggagc    215880
     aaactctgga ctactacccg cctccatgtg agttgaagaa gatcgtgaac gccaccattg    215940
     ctgcttgcga cccgcttgat ggaagaaccg acggtgttgt gtcccggacg gatctttgca    216000
     agcttaactt caatttgacc tctatcatcg gtgagcctta ctactgtgct gcgggaacta    216060
     gcacttcgct tggtttcggc ttcagcaatg gcaagcgcag caatgtcaag cgtcaggccg    216120
     agggcagcac caccagctac cagcccgccc agaacggcac ggtcaccgca cgtggtgtag    216180
     ctgtcgccca ggccatctac gatggtctcc acaacagcaa gggcgagcgc gcgtacctct    216240
     cctggcagat tgcctctgag ctgagcgatg ctgagaccga gtacaactct gacactggca    216300
     agtgggagct caacatcccg tcgaccggtg gtgagtacgt caccaagttc attcagctcc    216360
     tgaacctcga caacctttcg gatctgaaca acgtgaccta cgacaccctg gtcgactgga    216420
     tgaacactgg tatggtgcgc tacatggaca gccttcagac cacccttccc gatctgactc    216480
     ccttccaatc gtccggcgga aagctgctgc actaccacgg tgaatctgac cccagtatcc    216540
     ccgctgcctc ctcggtccac tactggcagg cggttcgttc cgtcatgtac ggcgacaaga    216600
     cggaagagga ggccctggag gctctcgagg actggtacca gttctaccta atccccggtg    216660
     ccgcccactg cggaaccaac tctctccagc ccggacctta ccctgagaac aacatggaga    216720
     ttatgatcga ctgggtcgag aacggcaaca agccgtcccg tctcaatgcc actgtttctt    216780
     cgggtaccta cgccggcgag acccagatgc tctgccagtg gcccaagcgt cctctctggc    216840
     gcggcaactc cagcttcgac tgtgtcaacg acgagaagtc gattgacagc tggacctacg    216900
     agttcccagc cttcaaggtc cctgtatact agtgtgcttg tattattact tgcgaccatc    216960
     tcctatatgg agtgacgaga tttggggatc ccttagcttc ttagtgaagt taatcttccc    217020
     aacttttatt cttcatttca tgcttgctga gcaactggct cttttgtcta tacattttaa    217080
     gtattaaacc ttggttgagt gtaaatactc aaactggggt caaccgagac aaacttattt    217140
     ttcttctttc cacgaaacat tccatcgagc ttgtacatag ataatcgcat aagaccaata    217200
     tcacagtgaa gaccacttca ccataaccac acgcaaaagc ccaccaacag acagtaaccc    217260
     tcttcatctt aaaatattga ttacctattt ttaaacatta catactaatc aaccccttaa    217320
     acccgcatca aagccccaaa aaccccctct tcctcccctt agcagaccta gacctggacc    217380
     tggaccgtct cgagatggcc gaattcctcg tattaacacg atcgatatca tacggattag    217440
     cctcataacc cgcattcccg tcacgcatag tcgacagcga gctcctaccc ccagactcca    217500
     acctccccaa atcctgtcct ccatcagcac tccccctccc ctcagcctgg accctaacct    217560
     cctcatcaac agccttctcc tcctccccca gagagaccgt cttctccgcc aacctcctca    217620
     taaaatcatc cgcctcggcg gcatatttac acttcctccg tataacagcc ccatacttat    217680
     aaaaaacaaa gggaaaaggc acacaagcaa gagccagaaa agcaggaatg caggaagccc    217740
     aatggacgcc cagattgcga tacatgtaag tcgtgaagag ggggaatccg gcaccgaaac    217800
     aggatctgat aattgagttt gcggccagca cgctagcagc gtagatagta tatgcatcga    217860
     taagatagga catgatattg aggaagacaa gaaccatacc gaagccgaag ggggcggcgg    217920
     cgatgatact gactatccag tggacggggg gtgcgttagt ccaggcgaac cagaagaggc    217980
     cgatggggat ggcgatgcta ccgagcatgg tgggggggag acgggcttcg gggggcgcga    218040
     agccgtggtg ggctttgtgg attgcgacgt agcgtttgtt gtcgtacatg tttagagcga    218100
     cggcgagcat catgccgatc atgacgccga ggaaggggag agaaccgacg ccttcggacc    218160
     agccgcggag ctgttggaag acgattggga aggcgtcgaa gagcatgtag agggtgccgt    218220
     agatgatggc catgtaggtt gagagaagga ggacgatggg ttcggcgaag aggaggatcc    218280
     aggggcggag aagggcggcg ccgaaagcgc ttgtcatggt tactttaccg cgttcgagct    218340
     cgagtttgct tcggtggact ttgccggtta gggttgtgag gcgggcggcg cgtttgcgga    218400
     gga