(data stored in ACNUC7421 zone)

EMBL: AP008226

ID   AP008226; SV 1; circular; genomic DNA; STD; PRO; 1849742 BP.
XX
AC   AP008226;
XX
PR   Project:PRJNA13202;
XX
DT   16-NOV-2004 (Rel. 81, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 5)
XX
DE   Thermus thermophilus HB8 genomic DNA, complete genome.
XX
KW   .
XX
OS   Thermus thermophilus HB8
OC   Bacteria; Deinococcus-Thermus; Deinococci; Thermales; Thermaceae; Thermus.
XX
RN   [1]
RP   1-1849742
RA   Masui R., Kurokawa K., Nakagawa N., Tokunaga F., Koyama Y., Shibata T.,
RA   Oshima T., Yokoyama S., Yasunaga T., Kuramitsu S.;
RT   ;
RL   Submitted (11-NOV-2004) to the INSDC.
RL   Contact:Ken Kurokawa Nara Institute of Science and Technology, Graduate
RL   School of Information Science; 8916-5, Takayamacho, Ikoma, Nara 630-0192,
RL   Japan URL    :http://www.naist.jp/
XX
RN   [2]
RA   Masui R., Kurokawa K., Nakagawa N., Tokunaga F., Koyama Y., Shibata T.,
RA   Oshima T., Yokoyama S., Yasunaga T., Kuramitsu S.;
RT   "Complete genome sequence of Thermus thermophilus HB8";
RL   Unpublished.
XX
DR   MD5; 6d289b9f3404f2f75b96fc620888e43b.
DR   BioSample; SAMD00061070.
DR   EnsemblGenomes-Gn; EBG00000035244.
DR   EnsemblGenomes-Gn; EBG00000035245.
DR   EnsemblGenomes-Gn; EBG00000035246.
DR   EnsemblGenomes-Gn; EBG00000035247.
DR   EnsemblGenomes-Gn; EBG00000035248.
DR   EnsemblGenomes-Gn; EBG00000035249.
DR   EnsemblGenomes-Gn; EBG00000035250.
DR   EnsemblGenomes-Gn; EBG00000035251.
DR   EnsemblGenomes-Gn; EBG00000035252.
DR   EnsemblGenomes-Gn; EBG00000035253.
DR   EnsemblGenomes-Gn; EBG00000035254.
DR   EnsemblGenomes-Gn; EBG00000035255.
DR   EnsemblGenomes-Gn; EBG00000035256.
DR   EnsemblGenomes-Gn; EBG00000035257.
DR   EnsemblGenomes-Gn; EBG00000035258.
DR   EnsemblGenomes-Gn; EBG00000035259.
DR   EnsemblGenomes-Gn; EBG00000035260.
DR   EnsemblGenomes-Gn; EBG00000035261.
DR   EnsemblGenomes-Gn; EBG00000035262.
DR   EnsemblGenomes-Gn; EBG00000035263.
DR   EnsemblGenomes-Gn; EBG00000035264.
DR   EnsemblGenomes-Gn; EBG00000035265.
DR   EnsemblGenomes-Gn; EBG00000035266.
DR   EnsemblGenomes-Gn; EBG00000035267.
DR   EnsemblGenomes-Gn; EBG00000035268.
DR   EnsemblGenomes-Gn; EBG00000035269.
DR   EnsemblGenomes-Gn; EBG00000035270.
DR   EnsemblGenomes-Gn; EBG00000035271.
DR   EnsemblGenomes-Gn; EBG00000035272.
DR   EnsemblGenomes-Gn; EBG00000035273.
DR   EnsemblGenomes-Gn; EBG00000035274.
DR   EnsemblGenomes-Gn; EBG00000035275.
DR   EnsemblGenomes-Gn; EBG00000035276.
DR   EnsemblGenomes-Gn; EBG00000035277.
DR   EnsemblGenomes-Gn; EBG00000035278.
DR   EnsemblGenomes-Gn; EBG00000035279.
DR   EnsemblGenomes-Gn; EBG00000035280.
DR   EnsemblGenomes-Gn; EBG00000035281.
DR   EnsemblGenomes-Gn; EBG00000035282.
DR   EnsemblGenomes-Gn; EBG00000035283.
DR   EnsemblGenomes-Gn; EBG00000035284.
DR   EnsemblGenomes-Gn; EBG00000035285.
DR   EnsemblGenomes-Gn; EBG00000035286.
DR   EnsemblGenomes-Gn; EBG00000035287.
DR   EnsemblGenomes-Gn; EBG00000035288.
DR   EnsemblGenomes-Gn; EBG00000035289.
DR   EnsemblGenomes-Gn; EBG00000035290.
DR   EnsemblGenomes-Gn; EBG00000035291.
DR   EnsemblGenomes-Gn; EBG00000035292.
DR   EnsemblGenomes-Gn; EBG00000035293.
DR   EnsemblGenomes-Gn; EBG00000035294.
DR   EnsemblGenomes-Gn; EBG00000035295.
DR   EnsemblGenomes-Gn; EBG00000035296.
DR   EnsemblGenomes-Gn; EBG00001177984.
DR   EnsemblGenomes-Gn; EBG00001177985.
DR   EnsemblGenomes-Gn; EBG00001177986.
DR   EnsemblGenomes-Gn; EBG00001177987.
DR   EnsemblGenomes-Gn; EBG00001177988.
DR   EnsemblGenomes-Gn; EBG00001177989.
DR   EnsemblGenomes-Gn; EBG00001177990.
DR   EnsemblGenomes-Gn; EBG00001177991.
DR   EnsemblGenomes-Gn; EBG00001177992.
DR   EnsemblGenomes-Gn; EBG00001177993.
DR   EnsemblGenomes-Gn; EBG00001177994.
DR   EnsemblGenomes-Gn; EBG00001177995.
DR   EnsemblGenomes-Gn; EBG00001177996.
DR   EnsemblGenomes-Gn; EBG00001177997.
DR   EnsemblGenomes-Gn; EBG00001177998.
DR   EnsemblGenomes-Gn; EBG00001177999.
DR   EnsemblGenomes-Gn; EBG00001178000.
DR   EnsemblGenomes-Gn; EBG00001178002.
DR   EnsemblGenomes-Gn; EBG00001178003.
DR   EnsemblGenomes-Gn; EBG00001178004.
DR   EnsemblGenomes-Gn; EBG00001178005.
DR   EnsemblGenomes-Gn; EBG00001178006.
DR   EnsemblGenomes-Gn; EBG00001178007.
DR   EnsemblGenomes-Gn; EBG00001178008.
DR   EnsemblGenomes-Gn; EBG00001178009.
DR   EnsemblGenomes-Gn; EBG00001178010.
DR   EnsemblGenomes-Gn; EBG00001178011.
DR   EnsemblGenomes-Gn; EBG00001178012.
DR   EnsemblGenomes-Gn; EBG00001178013.
DR   EnsemblGenomes-Gn; EBG00001178014.
DR   EnsemblGenomes-Gn; EBG00001178015.
DR   EnsemblGenomes-Gn; EBG00001178016.
DR   EnsemblGenomes-Gn; EBG00001178017.
DR   EnsemblGenomes-Gn; EBG00001178018.
DR   EnsemblGenomes-Gn; EBG00001178019.
DR   EnsemblGenomes-Gn; EBG00001178020.
DR   EnsemblGenomes-Gn; EBG00001178021.
DR   EnsemblGenomes-Gn; EBG00001178022.
DR   EnsemblGenomes-Gn; EBG00001178023.
DR   EnsemblGenomes-Gn; EBG00001178024.
DR   EnsemblGenomes-Gn; EBG00001178026.
DR   EnsemblGenomes-Gn; EBG00001178027.
DR   EnsemblGenomes-Gn; EBG00001178028.
DR   EnsemblGenomes-Gn; EBG00001178029.
DR   EnsemblGenomes-Gn; EBG00001178030.
DR   EnsemblGenomes-Gn; EBG00001178031.
DR   EnsemblGenomes-Gn; EBG00001178032.
DR   EnsemblGenomes-Gn; EBG00001178033.
DR   EnsemblGenomes-Gn; EBG00001178034.
DR   EnsemblGenomes-Gn; EBG00001178035.
DR   EnsemblGenomes-Gn; EBG00001178036.
DR   EnsemblGenomes-Gn; EBG00001178037.
DR   EnsemblGenomes-Gn; EBG00001178038.
DR   EnsemblGenomes-Gn; EBG00001178039.
DR   EnsemblGenomes-Gn; EBG00001178040.
DR   EnsemblGenomes-Gn; EBG00001178041.
DR   EnsemblGenomes-Gn; EBG00001178042.
DR   EnsemblGenomes-Gn; EBG00001178043.
DR   EnsemblGenomes-Gn; EBG00001178044.
DR   EnsemblGenomes-Gn; EBG00001178045.
DR   EnsemblGenomes-Gn; EBG00001178046.
DR   EnsemblGenomes-Gn; EBG00001178047.
DR   EnsemblGenomes-Gn; EBG00001178048.
DR   EnsemblGenomes-Gn; EBG00001178049.
DR   EnsemblGenomes-Gn; EBG00001178050.
DR   EnsemblGenomes-Gn; EBG00001178051.
DR   EnsemblGenomes-Gn; EBG00001178052.
DR   EnsemblGenomes-Gn; EBG00001178053.
DR   EnsemblGenomes-Gn; EBG00001178054.
DR   EnsemblGenomes-Gn; EBG00001178055.
DR   EnsemblGenomes-Gn; EBG00001178056.
DR   EnsemblGenomes-Gn; EBG00001178057.
DR   EnsemblGenomes-Gn; EBG00001178058.
DR   EnsemblGenomes-Gn; EBG00001178059.
DR   EnsemblGenomes-Gn; EBG00001178060.
DR   EnsemblGenomes-Gn; EBG00001178061.
DR   EnsemblGenomes-Gn; EBG00001178062.
DR   EnsemblGenomes-Gn; EBG00001178063.
DR   EnsemblGenomes-Gn; EBG00001178073.
DR   EnsemblGenomes-Gn; EBG00001178078.
DR   EnsemblGenomes-Gn; EBG00001178090.
DR   EnsemblGenomes-Gn; EBG00001178095.
DR   EnsemblGenomes-Gn; EBG00001178101.
DR   EnsemblGenomes-Gn; EBG00001178105.
DR   EnsemblGenomes-Gn; EBG00001178107.
DR   EnsemblGenomes-Tr; EBG00000035244-1.
DR   EnsemblGenomes-Tr; EBG00000035245-1.
DR   EnsemblGenomes-Tr; EBG00000035246-1.
DR   EnsemblGenomes-Tr; EBG00000035247-1.
DR   EnsemblGenomes-Tr; EBG00000035248-1.
DR   EnsemblGenomes-Tr; EBG00000035249-1.
DR   EnsemblGenomes-Tr; EBG00000035250-1.
DR   EnsemblGenomes-Tr; EBG00000035251-1.
DR   EnsemblGenomes-Tr; EBG00000035252-1.
DR   EnsemblGenomes-Tr; EBG00000035253-1.
DR   EnsemblGenomes-Tr; EBG00000035254-1.
DR   EnsemblGenomes-Tr; EBG00000035255-1.
DR   EnsemblGenomes-Tr; EBG00000035256-1.
DR   EnsemblGenomes-Tr; EBG00000035257-1.
DR   EnsemblGenomes-Tr; EBG00000035258-1.
DR   EnsemblGenomes-Tr; EBG00000035259-1.
DR   EnsemblGenomes-Tr; EBG00000035260-1.
DR   EnsemblGenomes-Tr; EBG00000035261-1.
DR   EnsemblGenomes-Tr; EBG00000035262-1.
DR   EnsemblGenomes-Tr; EBG00000035263-1.
DR   EnsemblGenomes-Tr; EBG00000035264-1.
DR   EnsemblGenomes-Tr; EBG00000035265-1.
DR   EnsemblGenomes-Tr; EBG00000035266-1.
DR   EnsemblGenomes-Tr; EBG00000035267-1.
DR   EnsemblGenomes-Tr; EBG00000035268-1.
DR   EnsemblGenomes-Tr; EBG00000035269-1.
DR   EnsemblGenomes-Tr; EBG00000035270-1.
DR   EnsemblGenomes-Tr; EBG00000035271-1.
DR   EnsemblGenomes-Tr; EBG00000035272-1.
DR   EnsemblGenomes-Tr; EBG00000035273-1.
DR   EnsemblGenomes-Tr; EBG00000035274-1.
DR   EnsemblGenomes-Tr; EBG00000035275-1.
DR   EnsemblGenomes-Tr; EBG00000035276-1.
DR   EnsemblGenomes-Tr; EBG00000035277-1.
DR   EnsemblGenomes-Tr; EBG00000035278-1.
DR   EnsemblGenomes-Tr; EBG00000035279-1.
DR   EnsemblGenomes-Tr; EBG00000035280-1.
DR   EnsemblGenomes-Tr; EBG00000035281-1.
DR   EnsemblGenomes-Tr; EBG00000035282-1.
DR   EnsemblGenomes-Tr; EBG00000035283-1.
DR   EnsemblGenomes-Tr; EBG00000035284-1.
DR   EnsemblGenomes-Tr; EBG00000035285-1.
DR   EnsemblGenomes-Tr; EBG00000035286-1.
DR   EnsemblGenomes-Tr; EBG00000035287-1.
DR   EnsemblGenomes-Tr; EBG00000035288-1.
DR   EnsemblGenomes-Tr; EBG00000035289-1.
DR   EnsemblGenomes-Tr; EBG00000035290-1.
DR   EnsemblGenomes-Tr; EBG00000035291-1.
DR   EnsemblGenomes-Tr; EBG00000035292-1.
DR   EnsemblGenomes-Tr; EBG00000035293-1.
DR   EnsemblGenomes-Tr; EBG00000035294-1.
DR   EnsemblGenomes-Tr; EBG00000035295-1.
DR   EnsemblGenomes-Tr; EBG00000035296-1.
DR   EnsemblGenomes-Tr; EBT00001756336.
DR   EnsemblGenomes-Tr; EBT00001756337.
DR   EnsemblGenomes-Tr; EBT00001756338.
DR   EnsemblGenomes-Tr; EBT00001756339.
DR   EnsemblGenomes-Tr; EBT00001756341.
DR   EnsemblGenomes-Tr; EBT00001756342.
DR   EnsemblGenomes-Tr; EBT00001756343.
DR   EnsemblGenomes-Tr; EBT00001756344.
DR   EnsemblGenomes-Tr; EBT00001756345.
DR   EnsemblGenomes-Tr; EBT00001756346.
DR   EnsemblGenomes-Tr; EBT00001756347.
DR   EnsemblGenomes-Tr; EBT00001756348.
DR   EnsemblGenomes-Tr; EBT00001756349.
DR   EnsemblGenomes-Tr; EBT00001756350.
DR   EnsemblGenomes-Tr; EBT00001756351.
DR   EnsemblGenomes-Tr; EBT00001756352.
DR   EnsemblGenomes-Tr; EBT00001756353.
DR   EnsemblGenomes-Tr; EBT00001756354.
DR   EnsemblGenomes-Tr; EBT00001756355.
DR   EnsemblGenomes-Tr; EBT00001756356.
DR   EnsemblGenomes-Tr; EBT00001756357.
DR   EnsemblGenomes-Tr; EBT00001756358.
DR   EnsemblGenomes-Tr; EBT00001756359.
DR   EnsemblGenomes-Tr; EBT00001756360.
DR   EnsemblGenomes-Tr; EBT00001756361.
DR   EnsemblGenomes-Tr; EBT00001756362.
DR   EnsemblGenomes-Tr; EBT00001756363.
DR   EnsemblGenomes-Tr; EBT00001756364.
DR   EnsemblGenomes-Tr; EBT00001756365.
DR   EnsemblGenomes-Tr; EBT00001756366.
DR   EnsemblGenomes-Tr; EBT00001756367.
DR   EnsemblGenomes-Tr; EBT00001756368.
DR   EnsemblGenomes-Tr; EBT00001756369.
DR   EnsemblGenomes-Tr; EBT00001756371.
DR   EnsemblGenomes-Tr; EBT00001756372.
DR   EnsemblGenomes-Tr; EBT00001756373.
DR   EnsemblGenomes-Tr; EBT00001756374.
DR   EnsemblGenomes-Tr; EBT00001756375.
DR   EnsemblGenomes-Tr; EBT00001756376.
DR   EnsemblGenomes-Tr; EBT00001756377.
DR   EnsemblGenomes-Tr; EBT00001756378.
DR   EnsemblGenomes-Tr; EBT00001756379.
DR   EnsemblGenomes-Tr; EBT00001756380.
DR   EnsemblGenomes-Tr; EBT00001756381.
DR   EnsemblGenomes-Tr; EBT00001756382.
DR   EnsemblGenomes-Tr; EBT00001756383.
DR   EnsemblGenomes-Tr; EBT00001756384.
DR   EnsemblGenomes-Tr; EBT00001756385.
DR   EnsemblGenomes-Tr; EBT00001756386.
DR   EnsemblGenomes-Tr; EBT00001756387.
DR   EnsemblGenomes-Tr; EBT00001756388.
DR   EnsemblGenomes-Tr; EBT00001756389.
DR   EnsemblGenomes-Tr; EBT00001756390.
DR   EnsemblGenomes-Tr; EBT00001756391.
DR   EnsemblGenomes-Tr; EBT00001756392.
DR   EnsemblGenomes-Tr; EBT00001756393.
DR   EnsemblGenomes-Tr; EBT00001756394.
DR   EnsemblGenomes-Tr; EBT00001756395.
DR   EnsemblGenomes-Tr; EBT00001756396.
DR   EnsemblGenomes-Tr; EBT00001756397.
DR   EnsemblGenomes-Tr; EBT00001756398.
DR   EnsemblGenomes-Tr; EBT00001756399.
DR   EnsemblGenomes-Tr; EBT00001756400.
DR   EnsemblGenomes-Tr; EBT00001756401.
DR   EnsemblGenomes-Tr; EBT00001756402.
DR   EnsemblGenomes-Tr; EBT00001756403.
DR   EnsemblGenomes-Tr; EBT00001756404.
DR   EnsemblGenomes-Tr; EBT00001756405.
DR   EnsemblGenomes-Tr; EBT00001756406.
DR   EnsemblGenomes-Tr; EBT00001756407.
DR   EnsemblGenomes-Tr; EBT00001756408.
DR   EnsemblGenomes-Tr; EBT00001756409.
DR   EnsemblGenomes-Tr; EBT00001756410.
DR   EnsemblGenomes-Tr; EBT00001756411.
DR   EnsemblGenomes-Tr; EBT00001756412.
DR   EnsemblGenomes-Tr; EBT00001756413.
DR   EnsemblGenomes-Tr; EBT00001756414.
DR   EnsemblGenomes-Tr; EBT00001756415.
DR   EnsemblGenomes-Tr; EBT00001756416.
DR   EnsemblGenomes-Tr; EBT00001756417.
DR   EnsemblGenomes-Tr; EBT00001756418.
DR   EnsemblGenomes-Tr; EBT00001756419.
DR   EnsemblGenomes-Tr; EBT00001756420.
DR   EnsemblGenomes-Tr; EBT00001756421.
DR   EnsemblGenomes-Tr; EBT00001756422.
DR   EuropePMC; PMC1636220; 17015650.
DR   EuropePMC; PMC2603143; 16287167.
DR   EuropePMC; PMC2665245; 19264806.
DR   EuropePMC; PMC2675196; 19233950.
DR   EuropePMC; PMC2679894; 19285505.
DR   EuropePMC; PMC2743062; 19622680.
DR   EuropePMC; PMC3028747; 21115698.
DR   EuropePMC; PMC3109143; 21634034.
DR   EuropePMC; PMC3434741; 22689228.
DR   EuropePMC; PMC3438285; 22779429.
DR   EuropePMC; PMC3554691; 23365690.
DR   EuropePMC; PMC3643509; 19016874.
DR   EuropePMC; PMC4159656; 24938286.
DR   EuropePMC; PMC4718643; 26171785.
DR   EuropePMC; PMC5529391; 28798737.
DR   GOA; P21234.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01346; CRISPR-DR36.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AP008226.
DR   SILVA-SSU; AP008226.
DR   StrainInfo; 120272; 1.
DR   UniProtKB/Swiss-Prot; P21234; LPL_THET8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1849742
FT                   /organism="Thermus thermophilus HB8"
FT                   /chromosome="1"
FT                   /strain="HB8"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:300852"
FT   CDS_pept        55..1182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0001"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="similar to GB:AAS81951.1 percent identity 99 in 375
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69824"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69824"
FT                   /db_xref="GOA:Q5SME2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SME2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69824.1"
FT                   /translation="MNITVPKKLLSDQLSLLERIVPSRSANPLYTYLGLYAEEGALILF
FT                   GTNGEVDLEVRLPAEAQSLPRVLVPAQPFFQLVRSLPGDLVALGLASEPGQGGQLELSS
FT                   GRFRTRLSLAPAEGYPELLVPEGEDKGAFPLRTRMPSGELVKALTHVRYAASNEEYRAI
FT                   FRGVQLEFSPQGFRAVASDGYRLALYDLPLPQGFQAKAVVPARSVDEMVRVLKGADGAE
FT                   ADLALGEGVLALALEGGSGVRMALRLMEGEFPDYQRVIPQEFALKVQVEGEALREAVRR
FT                   VSVLSDRQNHRVDLLLEEGRILLSAEGDYGKGQEEVPAQVEGPGMAVAYNARYLLEALA
FT                   PVGDRAHLGISGPTSPSLIWGDGEGYRAVVVPLRV"
FT   CDS_pept        1235..2503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0002"
FT                   /product="enolase (2-phosphoglycerate dehydratase)"
FT                   /note="similar to GB:AAS81952.1 percent identity 100 in 422
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69825"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69825"
FT                   /db_xref="GOA:Q5SME1"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SME1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69825.1"
FT                   /translation="MTTIVGVRAREVLDSRGFPTVEAEVELEGGARGRAMVPSGASTGT
FT                   HEALELRDGGKRYLGKGVRRAVENVNERIAPELVGMDALDQEGVDRAMLELDGTPNKAN
FT                   LGANAVLAVSLAVARAAAEALGLPLYRYLGGVQGVTLPVPLMNVINGGKHADNRVDFQE
FT                   FMLVPAGAGSFAEALRIGAEVFHTLKAVLKEKGYSTNVGDEGGFAPDLRSNEEAVELLL
FT                   LAIERAGYTPGQEVSLALDPATSELYRDGKYHLEGEGKVLSSEEMVAFWEAWVEKYPIR
FT                   SIEDGLAEDDWEGWRLLTERLGGKVQLVGDDLFVTNPERLRAGIERGVANAILVKVNQI
FT                   GTLSETLEAIRLAQRSGYRAVISHRSGETEDSFIADLAVAVNAGQIKTGSLSRSDRLAK
FT                   YNQLLRIEEELGRAARFLGYAAF"
FT   CDS_pept        2490..3914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0003"
FT                   /product="pyruvate kinase"
FT                   /note="similar to GB:AAS81953.1 percent identity 99 in 474
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69826"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69826"
FT                   /db_xref="GOA:Q5SME0"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SME0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69826.1"
FT                   /translation="MPPFKRTKIVATLGPATDDKEVIRALAEAGADVFRLNFSHGAPED
FT                   HRRRVGWVREVAEELGRTLAVLQDLQGPKIRVGRFREGQVLLRPGQRFVLTAEPVEGDE
FT                   HRVSVSYKGLPEDVSPGQILLLDDGRIRLKVLEVRSPEILTEVEVGGVLSNNKGINIPG
FT                   ADLSIPALSEKDIQDLALGAELGVDWVAVSFVRTRDDLLLARHYLSRYGSKARLMAKIE
FT                   KPSAVARFEEILEEADGIMVARGDLGVEMPLEEVPIVQKRLILRCIAAGKPVITATQML
FT                   ESMVQNPSPTRAEASDVANAIFDGTDAVMLSAETAAGAYPVEAVAMMARIAKAVESSPE
FT                   FLQKLNVLRPAPTPTTQDAIAQAADDVVEAVGARAIVVFTATGGSARRIARTRPQVPIL
FT                   ALTPNPEVRNQLALVWGVYPHLAPDPQDTDDMVRIALREVKALGLAQVGDRVVIAAGVP
FT                   FGVRGTTNLIRVERVG"
FT   CDS_pept        complement(3915..4895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0004"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS81954.1 percent identity 95 in 328
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69827"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69827"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69827.1"
FT                   /translation="MRKRLALLALGLSALAQEVAVYPGFAEVKEPVDLPPAAWVYLAGE
FT                   KLGRILPGSLRLLGVEETERVFQGSAVLFRYRGEGKATLRYLYTGLSGEVFYTLDGTTL
FT                   TAWARLKLEGEALRAERLTLFAGEVRAKVLPQAALRALEGTPGSPFGLFRYELPPRTLF
FT                   PGTTELPFLRQAVEPERLLRYQGPFRTQGVLPLERGLRFLAPFPLAPGPLEGVEEGRFL
FT                   GQALLPATPEGGVAEAWLGQDLRARLVREVALLSQGEKEATYRVETRLENPYPYPVRLL
FT                   LAETFPPGFRLDFPGAVLLPEGYRLEAVLDPMEARSFRYRLTLPR"
FT   CDS_pept        complement(4892..5506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0005"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="similar to GB:AAS81955.1 percent identity 97 in 204
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69828"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69828"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69828.1"
FT                   /translation="MNGPEVLRFAANLYRVPVEGGYFLVDAGLPWEARRLLSLLQEPPR
FT                   LLFLTHHHLDHAGGARALWERFRVPVLAHPQEWAYLTKRKPRPPLPLPLLGKALANWGP
FT                   AIPEEALAPAEEGMEVFGFRVVHLPGHTLGQVGLFREGVLLAGDALRGRGLPPRFINED
FT                   HALARRTVRKILELGVKRVYLGHGGPLSGEEVAAIARRLGV"
FT   CDS_pept        complement(5493..7340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0006"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /note="similar to GB:AAS81956.1 percent identity 99 in 615
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69829"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69829"
FT                   /db_xref="GOA:Q5SMD7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SMD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69829.1"
FT                   /translation="MILDKVNSPEDLKRLSLEELLLLAEEIRSEIIRVTAQNGGHLASS
FT                   LGAVELVLALHRVFDSPRDRILFDVGHQAYAHKLVTGRKDRFHTLRKEGGISGFTKVSE
FT                   SPHDAITAGHASTSLANALGMVLARDLMGEDYHVVAVIGDGALTGGMALAALNKIGELQ
FT                   KRMLIVLNDNEMSISENVGALNKYFKELQIRKWVQDAEKLGKNILERISPQLFGLVDRA
FT                   KEAAKFLLHQENPFYAWGIRYVGPVDGHDLKGLVHILEHLKALDGPTLLHVVTKKGKGY
FT                   KVAEADPIYWHGPPGFDPKKPEKVSKGYTWSQAFGDAVTELAHMEPRLFVLTPAMREGS
FT                   GLVRYSLEHPERYLDVGICEDVAVTTAAGLALRGMKPIVAIYSTFLQRAYDQVIHDVAI
FT                   ENLPVVFAIDRAGIVGADGATHHGVFDIAYLRTVPNLQIAAPKDALELRAMLKKALEVG
FT                   GPVAIRYPRDNVERAPEGVWPEIAWGKWEVLKEGTEAYILAFGKTLRYALEAAGDDPRV
FT                   GVVNARFLKPLDREMLRELSRYKLLTVEDHQKMGGFGSAVLEALNEMGLKPEVQILGLP
FT                   DRFFEHGAIPSLHRQAGIDAEGIRKALAAMGVALVHERA"
FT   CDS_pept        complement(7349..7993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS81957.1 percent identity 97 in 214
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69830"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69830"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69830.1"
FT                   /translation="MKRYLMALALLVAACAPQVTQAPEVRPELRVEAFYPAATGLEWSY
FT                   LPEGEPLSNPPYRVRVEGPAVFQGEEVLRFRSFGRGENRVYYRGVGPFGVRLFGFEDPS
FT                   ARVVFAPPIPEYPPEGLLAVGYRWGGESEVRATLLTPQGERPLASGRLAYTFEVLEEKE
FT                   VRVPAGVFRVFRIRQRYRDEKGEALYEVWFAPKVGEVRTREGRLLTDRNFR"
FT   CDS_pept        complement(8037..8699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0008"
FT                   /product="phage shock protein A"
FT                   /note="similar to GB:AAS81958.1 percent identity 99 in 220
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69831"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69831"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69831.1"
FT                   /translation="MTLWDRLSRLVRANLNDLLRRAEDPEKIIEQALLDMKQALREARE
FT                   QVAEALAEQKRLEREVESHEREAALWEEKAREALKAGREDLAREALRRKKRALDLAEGF
FT                   KAQLSEHKALTERLMTQLKALEAKIDEAEARKKLLLARKKGVEAAETVRRMESRLDQHP
FT                   ALEAFEEMEARILAMEDRHQALETLDQADLEKEFQALSAEKEVEEDLLRLKRELGQA"
FT   CDS_pept        8799..8969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0009"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80749.1 percent identity 84 in 39
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69832"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69832"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69832.1"
FT                   /translation="MGKRGFVRREASPKEVLEHCLRLAREVAPPTPRASGAAPGATTTP
FT                   ARRSPDGERVI"
FT   CDS_pept        9022..9114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0010"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS81959.1 percent identity 93 in 30
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69833"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69833"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69833.1"
FT                   /translation="MARALLELIAYGLRVLLSLLPPPPGHKAIY"
FT   rRNA            9241..12155
FT                   /gene="23Sa"
FT                   /product="23S ribosomal RNA"
FT   rRNA            12235..12356
FT                   /gene="5Sa"
FT                   /product="5S ribosomal RNA"
FT   tRNA            12366..12441
FT                   /gene="tRNA-Gly-1"
FT                   /product="tRNA-Gly"
FT                   /note="anticodon: GCC"
FT   CDS_pept        12493..13503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0011"
FT                   /product="molybdenum cofactor biosynthesis protein A
FT                   (MoaA)"
FT                   /note="similar to GB:AAS82330.1 percent identity 100 in 336
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69834"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69834"
FT                   /db_xref="GOA:Q5SMD2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69834.1"
FT                   /translation="MVLRWAAKGDKVKLLDNYGRVIKDLRISVTPRCNLHCLYCHPLGL
FT                   EMREPPGTLTVEEVDRFLEAASLLGLSSVRFTGGEPLVRKELPEMIARARAKEGVEDVA
FT                   ITTNGLLFARRAKELVEAGLNRVNISLDALTPEVFARITRGGKVERVLEAIEKALELGL
FT                   HPVKLNAVVIRGMNEEEVVPLAGLSLDRPLHVRFIEYMHLDNSDPEAYRRRFVPGKETR
FT                   ARIEAVYGPLEPVPHDPTSPARVFKIPGAQGTVGFINPVTEPFCTHCSRLRLTSDKKLR
FT                   PCLLTDLEMDIAWAFAAPEPVEALVDAILIATNRKPAFGNTLPTLRKRVMLGIGG"
FT   CDS_pept        complement(13481..14311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0012"
FT                   /product="conserved hypothetical protein, integral membrane
FT                   protein"
FT                   /note="similar to GB:AAS82329.1 percent identity 98 in 276
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69835"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69835"
FT                   /db_xref="GOA:Q5SMD1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69835.1"
FT                   /translation="MRGYVLGLLALNLLTLIWGTTFVVVKGAVEGMAPSLLILLRFGVA
FT                   ALFFLPWLFRLPAGAFGPGMELAFWLFVGYASQTLGLAHTSASRSAFITALSVVLVPLL
FT                   LRLAGREVGPAFLAAFLALAGVGLLSYDPYQPPFNVGDLWTFLTALAYALYIVRLEVHA
FT                   RAFPSLPLTAVQVLGTALFALPWVLAEGEAWGPVAWGAVLYLGVVATALTTWLQTWGQR
FT                   HVPAPQAAILYTLEPVWAAFFAYLALGERLSPSGLLGALLVLLATLLAIRRSPA"
FT   CDS_pept        14329..15321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0013"
FT                   /product="geranylgeranyl diphosphate synthetase"
FT                   /note="similar to DBJ:BAC77651.1 percent identity 100 in
FT                   330 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69836"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69836"
FT                   /db_xref="GOA:Q5SMD0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="PDB:1WMW"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69836.1"
FT                   /translation="MVPAPEAIRQALQERLLARLDHPDPLYRDLLQDYPRRGGKMLRGL
FT                   LTVYSALAHGAPLEAGLEAATALELFQNWVLVHDDIEDGSEERRGRPALHRLHPMPLAL
FT                   NAGDAMHAEMWGLLAEGLARGLFPPEVLLEFHEVVRRTAYGQHLDLLWTLGGTFDLRPE
FT                   DYFRMVAHKAAYYTAVAPLRLGALLAGKTPPAAYEEGGLRLGTAFQIVDDVLNLEGGEA
FT                   YGKERAGDLYEGKRTLILLRFLEEAPPEERARALALLALPREAKPEAEVGWLLERLLAS
FT                   RALAWAKAEAKRLQAEGLALLEAAFQDLPGKEALDHLRGLLAALVERRA"
FT   CDS_pept        15508..16104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0014"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82326.1 percent identity 99 in 198
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69837"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69837"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69837.1"
FT                   /translation="MEGVEAFLFFLALRGEAKREEVRARFPRLVPLLKALGEAVEVQGE
FT                   TFRLAKPLRLSWFAPLFRARYSPLLPEEERALALERLVEAAFRSAEAGEPLVDGEGLLK
FT                   AARLFQAGSQALLKGDHREALHRLGEALGLLEKEGLPFPAAALALLAQAQEGFRPGGKG
FT                   KATARKALRRAQTPFVREVAERILSPATDPEAPGP"
FT   CDS_pept        16106..17128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0015"
FT                   /product="LytB protein"
FT                   /note="similar to GB:AAS82325.1 percent identity 99 in 340
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69838"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69838"
FT                   /db_xref="GOA:Q5SMC8"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SMC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69838.1"
FT                   /translation="MGGMSGLRRVYLARPRGFCAGVVMAIEAVERWAEALKEKGELVVY
FT                   HEIVHNRVVVERLQAKGVHFVEDLAEVERLRRERRLADTVVFSAHGHPPAVRRQAAEMG
FT                   LTVLDATCPLVTKVHTEAKRYAKEGYWILLIGDSADHQEIKGTYGEAPERTILVAVHTH
FT                   VGKDPRLADPRTVEVPDPERVVVLTQTTLSVDDTLATIAILKKRFPKLVVPSRKDLCYA
FT                   TQNRQEAVKRIAPKVEAFLVLTSPHSSNGMRLLELAQSLVGRAYRLERPEELRPEWLEG
FT                   VESLGITSAASTPEDLVQGVVDRLKAQNPGLEVVEEGAWETIAFREPKPLSPEEVLKGA
FT                   "
FT   CDS_pept        17121..18149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0016"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /note="similar to GB:AAS82324.1 percent identity 98 in 342
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69839"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69839"
FT                   /db_xref="GOA:Q5SMC7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="PDB:3B0P"
FT                   /db_xref="PDB:3B0U"
FT                   /db_xref="PDB:3B0V"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SMC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69839.1"
FT                   /translation="MLDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRG
FT                   NRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYG
FT                   ACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVV
FT                   HARSALLALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGV
FT                   MLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLN
FT                   LFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEEVGEEGEKEKPGPRGQREAAPGPARE
FT                   GV"
FT   CDS_pept        complement(18045..18677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0017"
FT                   /product="probable tetratricopeptide repeat family protein"
FT                   /note="similar to GB:AAS82323.1 percent identity 99 in 210
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69840"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69840"
FT                   /db_xref="GOA:Q5SMC6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69840.1"
FT                   /translation="MEGVKDLEAEALSGDPKAQALLHFLRLLRRKDYAGARAYAEGFPE
FT                   GERERLLRGLSLLEEDPEALDDPFFAAEKEVVLGVKAVREGRREEAEAHFKRALALDPA
FT                   HHRALTNLGTLHLERGELEEALALYQEALKLAPEDPLLHENLAALYKRKGDLDKMVAHM
FT                   KRATRLKMAPPPSLDPLTGRPRRRFPLPPWAWLLLFALLAYLFLHKP"
FT   CDS_pept        complement(18679..20001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0018"
FT                   /product="glycogen synthase (Starch [bacterial glycogen]
FT                   synthase)"
FT                   /note="similar to GB:AAS82322.1 percent identity 99 in 440
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69841"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69841"
FT                   /db_xref="GOA:Q5SMC5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SMC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69841.1"
FT                   /translation="MGVMRVLHVAPEAYPLAKVGGLADVVGALPKALRPLGVEAHVLLP
FT                   WHGGLEARRVGEVAFAFFGREERAPLGERVEGGVRFLLLGVEGFGRERVYGYPDDAERY
FT                   LRFALAAKEVARGYDLVHAHDWTAALLALYAPTVYTIHNLAHQGLVDPGLFFSWTGLPW
FT                   SLFHMEALEFYGRVNLMKGGIVFARRVTTVSPSYAEEIQTPEFGMGLDGVLRRHAGKLR
FT                   GILNGLDTEVFDPGKDPYLPAPYTREDPSGKARAKEAFRERTGLRPPVLAYVGRLDYQK
FT                   GLDLVLKALPRLLEMGFRLYVQGVGDGGLQEAFLRAEEENPEGVRFLPAYDEAMARLAY
FT                   AGAEAVLVPSRFEPCGLVQMIASRYGTPPVARAVGGLKDTVEDGRGGVLFETYHPEGLL
FT                   YGVLRLFRLGAEEMGLRAMEKDFSWEGPARAYREVYREALG"
FT   CDS_pept        complement(20003..20374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82321.1 percent identity 99 in 123
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69842"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69842"
FT                   /db_xref="GOA:Q5SMC4"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69842.1"
FT                   /translation="MEAVFVYGTLKRGERNHGLVAPYLHRVLPGFVEGFRLYHLPWGPH
FT                   RPYAYPGMVPGEGRVFGEVLFLRPEALSLLDALEEEGEEYKRVRVRVETEEGPLEAWAY
FT                   LYLGGLEGALPLPQGVWKG"
FT   CDS_pept        complement(20401..21072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0020"
FT                   /product="response regulator"
FT                   /note="similar to GB:AAS82320.1 percent identity 98 in 223
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69843"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69843"
FT                   /db_xref="GOA:Q5SMC3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69843.1"
FT                   /translation="MARVLLVEDDSQVGELVRRFLEREGFAVAWVRFGREALERVGEEG
FT                   ADVVVLDRGLPDMEGLEVLKGLRSLDPLLPVLLLTGRADEESRVEGLLEGADDYLGKPF
FT                   SLRELLARIKALLRRAGKEGRRRFGPLEVDLGGRRAYLEGEPLRLSPTEMNLLLVFAQA
FT                   PGRVFTRGELLERVWGPEFEGSERVVDAYVRLLRKKLRDDPEAPRFIETVVGLGYRFLG
FT                   D"
FT   CDS_pept        complement(21081..21767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0021"
FT                   /product="putative NADPH oxidoreductase"
FT                   /note="similar to GB:AAS82319.1 percent identity 100 in 228
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69844"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69844"
FT                   /db_xref="GOA:Q5SMC2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69844.1"
FT                   /translation="MEKHPGKLFYRLSRLAPGDALPLKRGPKAKVYANPLETQALPPFR
FT                   QDGGPPLFRAMAHLRPLLPEVGASLTLKDLSQVLYPLAEREGRRGFPSAGEAYPLEAYL
FT                   VVRRVEGVFPGVYHYFPREHQLFQIASKVEEAAWAEALMGVALDRAAVLLVLTLLPERS
FT                   EALFGLRGYRYALLEAGYAAGLVLLAAVGQGLAAYPAETFHDEGVARLLGLPEGEYPGV
FT                   VVVLGR"
FT   CDS_pept        complement(21770..23014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0022"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="similar to GB:AAS82318.1 percent identity 99 in 414
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69845"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69845"
FT                   /db_xref="GOA:Q5SMC1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SMC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69845.1"
FT                   /translation="MVKVEVLGMILAGGQGSRLYPLTAKRAKPAVPFGAKYRIIDFVLN
FT                   NFVNSGIYAIYVLTQYKAQSLTEHIQRYWRFGAFLEDHFILLVPAQMYRYEELGPVWYR
FT                   GTADAIYQNLHLVHNHAPKAVAVFGGDHIFKMNIRHMVEYHYDTRADITIAAYPVPVAE
FT                   ATRFGVLQVDEEWRITEFQEKPEEPKPIPGRPDMALASMGNYIFRTEALFELLEADARD
FT                   ETSAHDFGKDVIPRALREGYRVYAYDFHRNPIPGQEGPNLYWRDVGTLDAYYEASMDLV
FT                   KVVPEFDLFNPEWPLRTANLFSPPAKFVHETGERVGRALNSLLAGGVIVSGGTVRESVL
FT                   FRRVRVNSYSLVERSVLFDDVEVGRYCRIRNAIIDKNVKIPPHTEIGYDLELDRARGFT
FT                   VTPEGVVVVPKGYRF"
FT   CDS_pept        23080..25173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0023"
FT                   /product="putative ATP-dependent protease La"
FT                   /note="similar to GB:AAS82317.1 percent identity 99 in 693
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69846"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69846"
FT                   /db_xref="GOA:Q5SMC0"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69846.1"
FT                   /translation="MRVASVRWFTPPTRPRPAPLFFGQERALRALEAAFLHRGHGYLVG
FT                   PSGLGKRARLLAFLEGRAFPKEELVYLPLGEEAFPLLLPEGEGRALVEGVEALFAEFTP
FT                   GLFREKGFLYAKNLVESRHEREAEALLQTLAQEAKAHGFALAEEEGGFTLTGQGPLPPE
FT                   LSAKLEETVLAYVEVRQRAQAEVAALRRSFAERLLQPRVEGLKARFPEAARYLDWLLES
FT                   LLRAAALEEEVEGEALLPRLLVEGGTRVVYEPNPTPERLFGHLEYEVREGVLTTHLGLL
FT                   RPGALMRAAGGVLVLEAHRVLELGSYPLLKRSLATGEIEPLAPRPEVRGPRLQPAPLKA
FT                   QVFLVGPPEVIALLEEDEEFLELFPFRVEFNPEMPYTEAHVAHLGGFLEAQGVRLLPEG
FT                   LAALADEARRMAGHQERLDARIYRLLDLAREAARYQDPVGREGVERALKAREDRFALEQ
FT                   ELFLKDVEEGVVALEVTGERVGEVNGLVVLEGPLPTGRPVRITAQAGPGREGILSIDRE
FT                   VGLGGQVFHKAVLTLAGYLRGTYAQLGALSATVSLVFEQSYGSLEGDSAGLAELLAVLS
FT                   AISGLPLRQDLAVTGAVDQTGRVLAVGRVAEKVEGFFRVCQTLGLTGTQGVVLPKANLP
FT                   HLTLRREVVEAVEEGVFHLFAVEEVDEAVELLFGRRAYWVHEKVREALEHFQKLENGDG
FT                   EKG"
FT   CDS_pept        complement(25272..27593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0024"
FT                   /product="penicillin acylase II precursor"
FT                   /note="similar to GB:AAS82314.1 percent identity 97 in 772
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69847"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69847"
FT                   /db_xref="GOA:Q5SMB9"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69847.1"
FT                   /translation="MLFPTMKRFLRGLARLLGLFLFLALLLGFSGYLYLRASLPQGEGR
FT                   IALEGLSAPVEVVRDGKGVVRIRAATLKDLFFAQGFVHAQERLWQMEFQRRVGQGRLSE
FT                   ILGEATLPQDRFLRTWGFYRAARAAYGRLYPEEKEAVDAYAAGVNAFLASGAPLPPEFR
FT                   LLGFRPEPWTGPDVLVWAKMMSYDLSGNWEEELKRHRLLARGVSPKRLLELMPPYPEDA
FT                   PTILSAEDLKLPLKREEAPSALLRMAPPRFMEASNNWVVSGSRTTTGKPFLANDPHLAL
FT                   QAPSLWFLMALEAPGLRAIGATLPGLPGVVIGRNERIAWGVTNVGADVEDLYLLEEVEG
FT                   RGYRYKGRVVPYGVREEVIRVKGGREEVLKVRETVYGPVITDALQAPPKTPMALRWVSL
FT                   DEEDHILMAFLEVNRAGNWEEFKKALLPYSAPSQNFVYADVEGNIGYIAPGKFPVRKEG
FT                   HTGMVPVPGNGEWDWLGYRRPEEWPQAFNPARGYLVTANHKVTPKGFPYALTYDWAEPY
FT                   RAERIEELLLAKEKLSLEDMKAIQQDQKSLLYRDFRPVLELLTPLSEGARAWRDRLLAW
FT                   DGTMAPGSEEALVFALWYTELTRLPQREVGEAYWDEPRYLLKALKEGDKNCDQPETEYR
FT                   ESCLDYAALALERALDRKEALGARAWGEVHRARFPHAVLTHTPLKRLSDREVAFGGDRY
FT                   TVNVGPFDPETLAMGHGPSYRQIVDLSDMEGSLFVHPMGQSGHFLSRHYADLLSFWRRG
FT                   DYLPMRFAGEGRALLLEPGR"
FT   CDS_pept        27605..28078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82313.1 percent identity 99 in 157
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69848"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69848"
FT                   /db_xref="GOA:Q5SMB8"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69848.1"
FT                   /translation="MDLLRASLSGVFLGLLFHRLGLPGGAVVGAMLGTGLAQLLASPAP
FT                   TPRGLDLTVQLAAGVLVGLSFRKELLSPKLLPYALLAALAFLALALLLAFLLAKPLGQP
FT                   PKALLFALAPGGITGMGPLSQAEGGSPALVGVFHTVRVLALFLLVPLLARLLR"
FT   CDS_pept        28088..28297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82312.1 percent identity 97 in 69
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69849"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69849"
FT                   /db_xref="GOA:Q5SMB7"
FT                   /db_xref="InterPro:IPR017123"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69849.1"
FT                   /translation="MRLEFLENGPIRVEGKRFVVRVGEKEEALERPRVFLCRCGGSGNK
FT                   PFCDGTHKRIGFQAPGGVLEVESD"
FT   CDS_pept        28350..29300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0027"
FT                   /product="probable potassium channel, beta subunit
FT                   (oxidoreductase)"
FT                   /note="similar to GB:AAS82311.1 percent identity 98 in 316
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69850"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69850"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69850.1"
FT                   /translation="MRYRKLGKWGLKVSEISLGAWVTFGDVVKDKETVREIVGIAYEGG
FT                   VNFFDNADVYAKGLAEEIMGEILQEFPRHTLVLSTKAYWPMSEDPNDRGLSRKHLLESI
FT                   TKSLKRLKTDYVDIFFAHRFDPEVPMEEIVYAMHTIVEKGYALYWGTSEWPAARIAEAV
FT                   TFAKENGLHPPVVEQPQYSMLYRERVENEILPEAERFGMGLVVWSPLAQGMLTGKYDEG
FT                   IPEGSRFARYDQFRERYLTEENRRKVLKLKAVADELGLTRTQLALAWVLRLPGISSAIT
FT                   GATRPEQIRENLGAAGVDLPQEALEKIEAILRGEA"
FT   CDS_pept        29417..30448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0028"
FT                   /product="putative macrolide-efflux protein"
FT                   /note="similar to GB:AAS82310.1 percent identity 91 in 347
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69851"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69851"
FT                   /db_xref="GOA:Q5SMB5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69851.1"
FT                   /translation="MLAADLGGGVATGFLLLLYLLGRLEVFHLYLVSALTGALSSLHWP
FT                   ALSAMLEKKGYARASGMMSLAESLAGVGAPVLAAALLKPLGLGGVFALDLLGAGAAVLT
FT                   LLLVPIPGLPPRTGPRTSLREEALYGFRFILERPLLLGLQLMFFGINLLTALGSTVLPA
FT                   MVLAKTGMSEATLALVRSAAGLGGVAGGLLLSLWGGPRKRVHGVFLGMALSSLALALMG
FT                   AVEGPSAWAVLAFLESLFIPVLNGSNQAIWQAKVPLSVQGKVFAARRMIAWFANPLGMA
FT                   LAGPLADGVFAPRYGQGEGIALMLLLFGSLGVLWGLSGYLLPKVREAERLLPDAKENQA
FT                   AAP"
FT   CDS_pept        30535..32013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80927.1 percent identity 52 in 499
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69852"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69852"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69852.1"
FT                   /translation="MGEPLLAPVLRLLEEGREREALALLQTPQEGLPEAERLALLGFLE
FT                   GRKGDLRAYRALALEAAQRAQTPLTLYHLGLALPPKAGALALEEALRRFQGDAKGEARL
FT                   HLALSLALERLGRPEALAHAALARLKDPSPWTTLHHLRLELLFGTKPFPEVLEEAEPFL
FT                   PHPFPGVRMLAGHTLALTHLLRGSSRRAKNLLRGLLPLLEPPSLASFLVLGALALDPPE
FT                   VRLLLEGAKAFLPREGWPWGFYLLARGLGEGDEAHLLAAHGLLREDGALYALLSEARLK
FT                   ALGVEVEAPLAPGLAPGLRPEARAFLLGQAEAPFLRLLGEGPLPSLGPRGTEALALLLA
FT                   HEAGLSGEALGEALYGEPNPGALKALLHRLREKGFRIACSPYRLENPPPSDLRAFLRAL
FT                   SRGDLEEALALYQGPLLPWSQAPGVEELRLELEEALRQAVLAQGDTENLFLLAERLGED
FT                   LEVWEALLERLPSQDPRLPIVRARVARLRREYGV"
FT   CDS_pept        32270..33244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0030"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80924.1 percent identity 72 in 29
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69853"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69853"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69853.1"
FT                   /translation="MLKEVQEVKVGGRTRRVYVRPFAWNLHAPTHMEWTPDGRLLVVER
FT                   TTGKVKDVTKGGDMEEAKPFAWGLQGPSSMCPLPDGRVLISEFWGNRIREISAGGEAEK
FT                   APVFLDGLIRPYSLAALGKVHVRIFAVASKEPTAFRDVAGAVYEITTGTPEIFIDQIPT
FT                   HRSPGLEGLAPSWSWKSEDWSAYASGCSKTSWIDDGGGGGGGGGKLLAIAASSLGRVLL
FT                   YPVGEGKKDLLSVALNYTLALDVGEMGGIKTHPQNGKVYVTKPREGEILALDKETPESY
FT                   AFHPPVVKGLPTPTCVRFTPDLEGLLVCSPTNGVIWEVRGAIV"
FT   CDS_pept        33231..34388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0031"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="similar to GB:AAS82309.1 percent identity 48 in 181
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69854"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69854"
FT                   /db_xref="GOA:Q5SMB2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69854.1"
FT                   /translation="MPLCRSFTPFSILLAAEGMRLFAAGFFYLPVYLLAAEKARTPIEA
FT                   TLPQTLLYTLGFASLWVGALLDRSDRKRVLVLSTLGQAALALALLPAPGLPLPYLLVLL
FT                   LLFEFLDRFRALGAGLYLRSLVPKENYEPRLGQLSALHFAADSLADPLAGAAYGKSAAL
FT                   PPLLGGPLLLLSSLLYTRLPPALPPKPRAPFRLGEAFAGLRFLLGHHLLRWVFLVARLH
FT                   GLVHGLLFSLLPLYVLRALEAPPWVYGLLSGAWGVGSATGALLLGRLLSAGRGLLATVS
FT                   LFLMGGVLLGLALLPPWPVAVGLAFLFGVGQQFWSLLVTGLTYRELPEELVGRGMGGVA
FT                   FVSSLLAPLGPLLGGALAGVALPLPFLLAGGLLLALAPWAGRGWR"
FT   CDS_pept        34463..34705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAB89253.1 percent identity 54 in 46
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69855"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69855"
FT                   /db_xref="GOA:Q5SMB1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69855.1"
FT                   /translation="MVKSRVSSKGQITLPKAIREALGLRPGEEVVFELREGGAFLRPRR
FT                   RVPLEALLGRLKGKRGFPGEEAERRAREEAWREGA"
FT   CDS_pept        34687..35103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0033"
FT                   /product="hypothetical protein"
FT                   /note="similar to REF:ZP_00340578.1 percent identity 31 in
FT                   120 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69856"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69856"
FT                   /db_xref="GOA:Q5SMB0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69856.1"
FT                   /translation="MEGRGLKPYYLDTSLMLRLLTGDPPELAAQALEVFRGAEEGRYTL
FT                   AVHPLAVAEAFYTLVSFYGVGRAKAAGALLDLLDREGVLLEDEEDLRPALEEAGKGGLS
FT                   LVDAFLAQRARRQGAGLATLDRKLGRRAGVELLP"
FT   CDS_pept        35234..36199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0034"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80924.1 percent identity 68 in 29
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69857"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69857"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69857.1"
FT                   /translation="MLKEVQEAKVGGRTRRVYVRPFAWGLKNPSHMEWTPDGRLLVSEH
FT                   TAGTVRDISKGGDASEAKPLAYNLQGPAAIRPTEDGKVLVVETWGGAIADIAGGGDATK
FT                   LPKLTENLKGPYTLAVLNPGKKGETLFVSESSSSFMTQITRLSLGDHEREPKAFILDIP
FT                   ARHGEPGLTPPESWPDKWEKYAAAGCVKNWIDDAAGRGFFYLAVGSLGQIFRINPDELP
FT                   EKITYSELVAHPNALVAWGLHRLGGMRFHPSSGLLFAVQPEMGEVIAVDPAQPGNYHFQ
FT                   PPVVRGLRMPTCVRFSQDSEKMYVCSSADGVVWEVEGFLT"
FT   CDS_pept        36233..37336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0035"
FT                   /product="hypothetical membrane protein"
FT                   /note="similar to REF:ZP_00226519.1 percent identity 28 in
FT                   376 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69858"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69858"
FT                   /db_xref="GOA:Q5SMA8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69858.1"
FT                   /translation="MASCAGGAVGTAASLYLARLDNPFYLGLQHAIGWGASVLALFTGY
FT                   LLDRTDRKKALSFGLLSGSLLRFLLGTSLGLIGPWTFLGLYLVDNILELLLEVRVLVPR
FT                   LVPQEREKAHGRLYTASLLADLLGAPLGAFLFVQNPSWPFFLGGALGFVAIHFAARLPP
FT                   IPPLGKAPPGVLAGLRWLYQEAFFRRLAGAVLGASFLRVMPFALLPLWSLQAGYGPIGY
FT                   GLLSTAFSLGGALGGLLAGKLKGKRPQRVLSLLFLMDAGAVLGLLFKPPLPLGLLLVAL
FT                   LGISAILLGVQEVVLRQALAPDALLGRVGGGMRFLSGSAGLLGALLAGIVGGKLGLEEV
FT                   YLGAGLGFLLLALAAWGFLGQIEKRAR"
FT   CDS_pept        37564..38499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0036"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80924.1 percent identity 75 in 29
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69859"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69859"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69859.1"
FT                   /translation="MLKEVQEVKVGGRTRRVHVRPFAWNLHAPTHMEWTPDGRLLVVER
FT                   TTGKVKDVTKGGDMEEAKPFAWGLQGPSSMCPLPDGRILITEFWGGRIRDISVGGPSEK
FT                   LAIYAEDLSKPYSLALDALGRLLVTEHLGHGVGRISILASGKAVPLVQGVPSVETPGFE
FT                   GYTPPHAWPDRWEGFVAGCGKWGTDPKVFPDRPYVFAVSIGGLGLIVGVPEDGGHYEAL
FT                   APEHTFARGLGWTGGMIAHPFDGMLYVTQPLQGEIRAINPRESRNYRFDPPVVSGIPMA
FT                   SCVRFTPDGEKMLVCSPQSGAIWQVEGFSD"
FT   CDS_pept        38506..39657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0037"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82310.1 percent identity 32 in 346
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69860"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69860"
FT                   /db_xref="GOA:Q5SMA6"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69860.1"
FT                   /translation="MRTRYLFAESLGVFGGSLAFTGLGLLLGLEGTTWTLALLAALPYL
FT                   TLPLDLLAGLLLDRLDRRTLLLAGVWLRAGILGLFALLPKEPLFLLPLAFLFQAVLALD
FT                   LPAWHALLVRLAQGRLEREGGRLQAAQLLGDGLGDLLAPPLLLLAKPLPFALGGLFLAG
FT                   EGLLLRDLPAYPPPRAAKGEGFTLRALLAGLAFLLGDGRLLPLTLYALALSFLSGLALA
FT                   LLPLLALAQGTPPALYGLYPLGLSLGGFLGSLAAGRVGPCLGIWGGHGLRVLGLALLLL
FT                   PFPFGPLGAFLVGGGGALSGVHLRAYRQRLAPEALLGRVQAGAVALLSSGSLLGTLLAG
FT                   GLGTLGPRVPLLTALLGLLLLLPLALGPLGCGRLLSLREGRFP"
FT   CDS_pept        39654..40811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0038"
FT                   /product="hypothetical protein"
FT                   /note="similar to REF:ZP_00017741.1 percent identity 26 in
FT                   390 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69861"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69861"
FT                   /db_xref="GOA:Q5SMA5"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69861.1"
FT                   /translation="MRFPFHNGPLWAEALSDLGASLGFSTLALEVARTGEAFWVGFFAA
FT                   LGYLTLGPLLLLSPWVERRDLARALLELRLARGLLFLPLPFLPREAALLVLYAYPLMVL
FT                   TDLAVVAWEGLLVRRGRDRLAERSGKLYAAWEVGGLVGVGLGPALFALHPALPYFLAAG
FT                   ILLLAWALLRPALTGEKGEREEAARPEALGRSLRRLLAHAPLRPYLLLSLLFTLAHALT
FT                   TALLGLLALRAGTPKALFGLVFVLQSLGYTLGSYFAGRVPPALAFRLGPLGAALGGMGF
FT                   LLPFPLLLAAPPLLGLGVALLSTHLRAVRGWLLPKEGLAPSLAAIRALLYGAGALGGLG
FT                   AGVLGKGNPALPLLVGALGFLVLLPFALGPLHPRRLEALRQEEAE"
FT   CDS_pept        40878..41126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0039"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82309.1 percent identity 62 in 87
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69862"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69862"
FT                   /db_xref="GOA:Q5SMA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69862.1"
FT                   /translation="MTIALLLWLEAFRLFGAGFSYFAHAALTALGALSPLEASSALAPL
FT                   GPLLGGALAGVALPLPFLLAGGLLLGFAALLGRRRAA"
FT   CDS_pept        41137..42486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0040"
FT                   /product="FAD/FMN-containing dehydrogenase"
FT                   /note="similar to GB:AAS82308.1 percent identity 99 in 449
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69863"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69863"
FT                   /db_xref="GOA:Q5SMA3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69863.1"
FT                   /translation="MEKLEALKRLFPGKVDLSESERLRHGKDEGYPEARPVLAVVYPEG
FT                   VEDVQKALRWAREWGVAVIPFGAGTSLEGHLYPVREAISLDLSRMNRVLEVRPQDFSCV
FT                   VEPGLTRKALNEALKGTGLFFPVDPGADASLGGMAATNASGTTTVRYGGMRQNVLALQV
FT                   VLASGEVLELGRGVRKTSSGYDLKDLFIGSEGTLGVITRLTLRLHPLPEHVHTLRVFFP
FT                   GVEEAAEASYRIMASGLPVARLELLDELAMRALNRYLKAGFPERPALFLEFHASTKEAL
FT                   EAERASALELVREAGALEVEAATTEEERRRQWEARHQAYWALVHLFPGHRFMITDTAVP
FT                   LSRLPEMVRFAQGLLREMGLTGNILGHVGDGNFHTLIPVLPEDYPKAEAYAERLVEKAL
FT                   ELGGTCTAEHGVGLRKRKFLPKEHGPALEWMRRLKALFDPEGLLNPGKVV"
FT   CDS_pept        complement(42483..43064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82307.1 percent identity 100 in 193
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69864"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69864"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69864.1"
FT                   /translation="MAYRERAAWAPEGYMLPLPGACLPSLPENLPGAPRPYRKGVSAGF
FT                   VFRQGDACVPVVRGMGVVAAFGGEVVKVDPDFQELSEEAWQALLERVREGASPEEMDIL
FT                   RGLEVHVRHPDGRTTVYAHLQAPYPGLKVGSRVHRGDPIGYVGNTGLRGGASRLLFEVW
FT                   EGEPDRSAFLFQGLEGEELLRRARAFFGLP"
FT   CDS_pept        complement(43369..43665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0042"
FT                   /product="50S ribosomal protein L28"
FT                   /note="similar to GB:AAS82306.1 percent identity 98 in 98
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69865"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69865"
FT                   /db_xref="GOA:P60494"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="PDB:1VVJ"
FT                   /db_xref="PDB:1VY4"
FT                   /db_xref="PDB:1VY5"
FT                   /db_xref="PDB:1VY6"
FT                   /db_xref="PDB:1VY7"
FT                   /db_xref="PDB:4L47"
FT                   /db_xref="PDB:4L71"
FT                   /db_xref="PDB:4LEL"
FT                   /db_xref="PDB:4LFZ"
FT                   /db_xref="PDB:4LNT"
FT                   /db_xref="PDB:4LSK"
FT                   /db_xref="PDB:4LT8"
FT                   /db_xref="PDB:4P6F"
FT                   /db_xref="PDB:4P70"
FT                   /db_xref="PDB:4TUA"
FT                   /db_xref="PDB:4TUB"
FT                   /db_xref="PDB:4TUC"
FT                   /db_xref="PDB:4TUD"
FT                   /db_xref="PDB:4TUE"
FT                   /db_xref="PDB:4V51"
FT                   /db_xref="PDB:4V5A"
FT                   /db_xref="PDB:4V5C"
FT                   /db_xref="PDB:4V5D"
FT                   /db_xref="PDB:4V5E"
FT                   /db_xref="PDB:4V5F"
FT                   /db_xref="PDB:4V5G"
FT                   /db_xref="PDB:4V5J"
FT                   /db_xref="PDB:4V5K"
FT                   /db_xref="PDB:4V5L"
FT                   /db_xref="PDB:4V5M"
FT                   /db_xref="PDB:4V5N"
FT                   /db_xref="PDB:4V5P"
FT                   /db_xref="PDB:4V5Q"
FT                   /db_xref="PDB:4V5R"
FT                   /db_xref="PDB:4V5S"
FT                   /db_xref="PDB:4V68"
FT                   /db_xref="PDB:4V6A"
FT                   /db_xref="PDB:4V6F"
FT                   /db_xref="PDB:4V6G"
FT                   /db_xref="PDB:4V7J"
FT                   /db_xref="PDB:4V7K"
FT                   /db_xref="PDB:4V7L"
FT                   /db_xref="PDB:4V7M"
FT                   /db_xref="PDB:4V7W"
FT                   /db_xref="PDB:4V7X"
FT                   /db_xref="PDB:4V7Y"
FT                   /db_xref="PDB:4V7Z"
FT                   /db_xref="PDB:4V87"
FT                   /db_xref="PDB:4V8A"
FT                   /db_xref="PDB:4V8B"
FT                   /db_xref="PDB:4V8C"
FT                   /db_xref="PDB:4V8D"
FT                   /db_xref="PDB:4V8E"
FT                   /db_xref="PDB:4V8F"
FT                   /db_xref="PDB:4V8G"
FT                   /db_xref="PDB:4V8H"
FT                   /db_xref="PDB:4V8I"
FT                   /db_xref="PDB:4V8J"
FT                   /db_xref="PDB:4V8N"
FT                   /db_xref="PDB:4V8O"
FT                   /db_xref="PDB:4V8Q"
FT                   /db_xref="PDB:4V8U"
FT                   /db_xref="PDB:4V8X"
FT                   /db_xref="PDB:4V90"
FT                   /db_xref="PDB:4V95"
FT                   /db_xref="PDB:4V97"
FT                   /db_xref="PDB:4V9A"
FT                   /db_xref="PDB:4V9B"
FT                   /db_xref="PDB:4V9H"
FT                   /db_xref="PDB:4V9I"
FT                   /db_xref="PDB:4V9R"
FT                   /db_xref="PDB:4V9S"
FT                   /db_xref="PDB:4W2E"
FT                   /db_xref="PDB:4W2F"
FT                   /db_xref="PDB:4W2G"
FT                   /db_xref="PDB:4W2H"
FT                   /db_xref="PDB:4W2I"
FT                   /db_xref="PDB:4W4G"
FT                   /db_xref="PDB:4WPO"
FT                   /db_xref="PDB:4WQ1"
FT                   /db_xref="PDB:4WQF"
FT                   /db_xref="PDB:4WQR"
FT                   /db_xref="PDB:4WQU"
FT                   /db_xref="PDB:4WQY"
FT                   /db_xref="PDB:4WR6"
FT                   /db_xref="PDB:4WRA"
FT                   /db_xref="PDB:4WRO"
FT                   /db_xref="PDB:4WSD"
FT                   /db_xref="PDB:4WSM"
FT                   /db_xref="PDB:4WT1"
FT                   /db_xref="PDB:4WT8"
FT                   /db_xref="PDB:4WU1"
FT                   /db_xref="PDB:4WZD"
FT                   /db_xref="PDB:4WZO"
FT                   /db_xref="PDB:4Y4O"
FT                   /db_xref="PDB:4Y4P"
FT                   /db_xref="PDB:4YPB"
FT                   /db_xref="PDB:4YZV"
FT                   /db_xref="PDB:4Z3S"
FT                   /db_xref="PDB:4Z8C"
FT                   /db_xref="PDB:4ZER"
FT                   /db_xref="PDB:4ZSN"
FT                   /db_xref="PDB:5CZP"
FT                   /db_xref="PDB:5D8B"
FT                   /db_xref="PDB:5DFE"
FT                   /db_xref="PDB:5DOX"
FT                   /db_xref="PDB:5DOY"
FT                   /db_xref="PDB:5E7K"
FT                   /db_xref="PDB:5E81"
FT                   /db_xref="PDB:5EL4"
FT                   /db_xref="PDB:5EL5"
FT                   /db_xref="PDB:5EL6"
FT                   /db_xref="PDB:5EL7"
FT                   /db_xref="PDB:5F8K"
FT                   /db_xref="PDB:5FDU"
FT                   /db_xref="PDB:5FDV"
FT                   /db_xref="PDB:5HAU"
FT                   /db_xref="PDB:5HCP"
FT                   /db_xref="PDB:5HCQ"
FT                   /db_xref="PDB:5HCR"
FT                   /db_xref="PDB:5HD1"
FT                   /db_xref="PDB:5IB7"
FT                   /db_xref="PDB:5IB8"
FT                   /db_xref="PDB:5IBB"
FT                   /db_xref="PDB:5J30"
FT                   /db_xref="PDB:5J3C"
FT                   /db_xref="PDB:5J4B"
FT                   /db_xref="PDB:5J4C"
FT                   /db_xref="PDB:5J8B"
FT                   /db_xref="PDB:5NDJ"
FT                   /db_xref="PDB:5NDK"
FT                   /db_xref="PDB:5OT7"
FT                   /db_xref="PDB:5UQ7"
FT                   /db_xref="PDB:5UQ8"
FT                   /db_xref="PDB:5VP2"
FT                   /db_xref="PDB:5VPO"
FT                   /db_xref="PDB:5VPP"
FT                   /db_xref="PDB:5W4K"
FT                   /db_xref="PDB:5WIS"
FT                   /db_xref="PDB:5WIT"
FT                   /db_xref="PDB:6BUW"
FT                   /db_xref="PDB:6BZ6"
FT                   /db_xref="PDB:6BZ7"
FT                   /db_xref="PDB:6BZ8"
FT                   /db_xref="PDB:6C5L"
FT                   /db_xref="PDB:6CAE"
FT                   /db_xref="PDB:6CFJ"
FT                   /db_xref="PDB:6CFK"
FT                   /db_xref="PDB:6CFL"
FT                   /db_xref="PDB:6CZR"
FT                   /db_xref="PDB:6FKR"
FT                   /db_xref="PDB:6GSJ"
FT                   /db_xref="PDB:6GSK"
FT                   /db_xref="PDB:6GSL"
FT                   /db_xref="PDB:6GZQ"
FT                   /db_xref="PDB:6GZX"
FT                   /db_xref="PDB:6GZZ"
FT                   /db_xref="PDB:6N9E"
FT                   /db_xref="PDB:6N9F"
FT                   /db_xref="PDB:6ND5"
FT                   /db_xref="PDB:6ND6"
FT                   /db_xref="PDB:6NDK"
FT                   /db_xref="PDB:6O97"
FT                   /db_xref="PDB:6OF1"
FT                   /db_xref="PDB:6Q95"
FT                   /db_xref="PDB:6QNQ"
FT                   /db_xref="PDB:6QNR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60494"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69865.1"
FT                   /translation="MSKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPN
FT                   LQKVRVRVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL"
FT   CDS_pept        43731..44183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0043"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="similar to GB:AAS82305.1 percent identity 100 in 150
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69866"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69866"
FT                   /db_xref="GOA:Q5SMA0"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SMA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69866.1"
FT                   /translation="MPTVLVPLLLALDQTLKLWALEHLSPVPKPLLGDLLYLTLVRNTG
FT                   AGFGLFQGQAPLLGLLSFLVGAGLLLLLARRRYPPLPALALSLLAAGALGNGVDRLGRG
FT                   WVVDYLDLGTSLPLIANFPVFNLADVCVTLGAVLLLLAPRRRRRWI"
FT   CDS_pept        complement(44202..45353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0044"
FT                   /product="putative Na(+)/H(+) antiporter"
FT                   /note="similar to GB:AAS82304.1 percent identity 99 in 383
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69867"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69867"
FT                   /db_xref="GOA:Q5SM99"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69867.1"
FT                   /translation="MSGSLLLLFVFLSAFLAPPLSRLLRMPVPVGELVIGLLLGHFLAQ
FT                   GVALPEILGFLADFGFLLLMFLAGLEVDFNLLRQLERRHFVFYALYVVGMFLGAGLLAG
FT                   LLGVGLAQALILALVSIGLMVATLRDMGILGRAFAKRVLILGVLGEVASLFGLTAMEKA
FT                   AHYQGLLSLLKEVGIIALFFLLLFLAFRLAGLFLWWYPEVGRRLVYEEDPSAMGIRLSL
FT                   ALMFAAAVMSGLVGLESVLGAFLAGMILSYFLQKKHDLEAKLSAMGYGFLIPIFFIRTG
FT                   MGIDLSGLDGRLLLEVGQALLLMLLIRLLPAPFLLLGGFRLREAFLAALLLAYPFTLMI
FT                   AGTEIARSAHLLDERAALVLLLAAALSSLLFPWAAKMLLRFLR"
FT   CDS_pept        complement(45343..46635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0045"
FT                   /product="probable potassium uptake protein TrkA"
FT                   /note="similar to GB:AAS82303.1 percent identity 99 in 430
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69868"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69868"
FT                   /db_xref="GOA:Q5SM98"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69868.1"
FT                   /translation="MSVILLGLGRYVEEIVEVVSAISDVVLVERDEARLRAFLEKAPVA
FT                   NLRALPGSATDVGLWKEVDLEAAEAVISFLSVEATLDVARLLRKALGYRSKIVHVSKAR
FT                   PDPQAVRELDLEVVSIPEVLGAILRNLLQGQGIVRYPVGIGLRKGEVVEVLITESSPAV
FT                   YARLRELRQPGARVALVYREGSPILPRADFRVQPGDRLLVVGDPRGVEIFVGAVIRGEP
FT                   TFPRRFGSVGALCRAEDEEALYLKERLKVRDWVEACEDPKGVAEVGVFLARDRDWVRRA
FT                   FQEGYPFPSFHLRGTHPYRSILVSANTEALSPLLASAMDLARIFGSEVYVLFVSRVEAF
FT                   MPPEEKELLENLKVLVERARKTSGLEVHLIRKEGNPVRETLRLLKGKFNLLALGYTPGR
FT                   RTAFFRPYVPQLLAQASPVSTLLVPEVNLER"
FT   CDS_pept        complement(46697..47854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0046"
FT                   /product="aspartate aminotransferase"
FT                   /note="similar to DBJ:BAA07487.1 percent identity 100 in
FT                   385 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69869"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69869"
FT                   /db_xref="GOA:Q56232"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PDB:1B5O"
FT                   /db_xref="PDB:1B5P"
FT                   /db_xref="PDB:1BJW"
FT                   /db_xref="PDB:1BKG"
FT                   /db_xref="PDB:1GC3"
FT                   /db_xref="PDB:1GC4"
FT                   /db_xref="PDB:1GCK"
FT                   /db_xref="PDB:5BJ3"
FT                   /db_xref="PDB:5BJ4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56232"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69869.1"
FT                   /translation="MRGLSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDT
FT                   PEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGKQAL
FT                   FNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITP
FT                   RTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVA
FT                   PEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTN
FT                   QEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAER
FT                   LLEAGVAVVPGTDFAAFGHVRLSYATSEENLRKALERFARVLGRA"
FT   CDS_pept        47885..48190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0047"
FT                   /product="probable nucleotidyltransferase"
FT                   /note="similar to GB:AAS82301.1 percent identity 98 in 101
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69870"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69870"
FT                   /db_xref="GOA:Q5SM96"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69870.1"
FT                   /translation="MTEGEVLEEVKRRVRTRLKGRRYRLYLFGSRARKEGSPRSDYDLA
FT                   LLADPPLDLATLAELREALEGLPILQPLDLVELSWAPGLKEVVKREGILLDEGREA"
FT   CDS_pept        48198..48557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82300.1 percent identity 98 in 119
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69871"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69871"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="PDB:1WTY"
FT                   /db_xref="PDB:2YWA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69871.1"
FT                   /translation="MASLARAVERLKAALERPKDEFIRDSAIQRFEFTFELAWKTLKTF
FT                   LELQGLEARSPRAAIRGAFQVGLLPEDPFWLEMLELRNLTNHTYDEALAERIYAELPKA
FT                   LERFQELLRRLEEPA"
FT   CDS_pept        complement(48554..49471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0049"
FT                   /product="diacylglycerol kinase-related protein"
FT                   /note="similar to GB:AAS82299.1 percent identity 98 in 305
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69872"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69872"
FT                   /db_xref="GOA:Q5SM94"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69872.1"
FT                   /translation="MEKWVIVNPAGGRGKVGRLSGAILKAARQEGAKAFLTEGPGHATE
FT                   LAQRAPEGARVVAVGGDGTVHEVLKGLAGTGKVLGVVPIGSGNDFARMLGLLGLPWPKA
FT                   LELALHAPEEAVDLGWVNGEPFGASLGIGFDALVAKKALSAPPFLRGMPRYLYALFAVL
FT                   KELSLPEARVLVDGEEVHRGRMLLLAAMNGPMYGGGIPIAPMADPRDGRLSVVLAGEFS
FT                   RTGVVLILPRLLLGRHLSHSRVRAYAGQEVAVEFAHPVPAHADGELLPEASLYRAEVRP
FT                   LGLRVVGGRAGARAGGLVPEPAGT"
FT   CDS_pept        49489..50172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0050"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="similar to GB:AAS82298.1 percent identity 97 in 227
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69873"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69873"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69873.1"
FT                   /translation="MGLLAHFLKGPHKKTTLLLTRAGPVENPRHVLYSHPGLPLSPKGR
FT                   SALLALLPLLQGFPVAHVYAADSLAEAEAARLFAEALGVPYTLLPELRERAWGAWEGLS
FT                   FPEVEARFPGAVAAWTADEAGFAPPGGESVREAWERGRRAVKALLGKHRGQAILVVGNC
FT                   TLNRAALSLALPLPPEEGLRLEQDYARLSVVDFYGEEGVVKALNLAVDWGHDPARGPQG
FT                   PPGAS"
FT   CDS_pept        50129..50983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82297.1 percent identity 97 in 284
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69874"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69874"
FT                   /db_xref="GOA:Q5SM92"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69874.1"
FT                   /translation="MIRPVARKDLPGLLRLLRHMDQSPERGVLAPEARDLEGLAEELED
FT                   GLVLLKEGEVAGYVGLYPFWDGAALEGPLAYREEDLPPLLEAAEGRAREVEVERLYAFP
FT                   REENATLRKALEGAGFGLLHVTYFFVKRPEGLDYPAPEGVRVEEGFPGAGVYRELYRES
FT                   EESWALRLRWTDEELEEHFQDPAVHLLVAYLKGVPVGLAEVELEGGEASVAYIGVVPEA
FT                   RGKGIGRTLLSEAAKLARRKGADLLRVRAHDHEKGALDLYRGLGFSLEEAVATYAKELK
FT                   ARR"
FT   CDS_pept        complement(50953..51837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0052"
FT                   /product="putative deacetylase"
FT                   /note="similar to GB:AAS82296.1 percent identity 98 in 294
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69875"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69875"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69875.1"
FT                   /translation="MRAYTTAHLSLPLPEGHPFPLYKYGGVAEALKGLLPVLPAPEVPR
FT                   EALFLAHEASYLEKLFGEGLSREESLRLGLPFSQALLRRALHAAGGTLAAALDALKTGL
FT                   GLNLSGGTHHAFPGRAEGYSLFNDVAVAIFWLRAKEGFSGRVLVVDLDAHQGNGTAFFF
FT                   REDPSVFTLSLHGERNYPLKKEKSDLDVGLPDGTGDEAYLWALEGALEKARAFRPDLVF
FT                   YNAGVDVLKGDRFGRLALSPEGVRRRDERVFRFVKALGAPLVVVMGGGYNRDPRLTVEA
FT                   HAATYRLALSSLA"
FT   CDS_pept        51878..52486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82295.1 percent identity 98 in 206
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69876"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69876"
FT                   /db_xref="GOA:Q5SM90"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69876.1"
FT                   /translation="MRLLVLSDQVHPHIHSPRFPENLPPFDLVLAAGDLPGAYLEYVAT
FT                   KVRVPVLFVPGNHGEEWVLEEGRRKRPGGVVNLHGRLFRHQGRLFYGIGGVPRYREGEG
FT                   QLSEGELLRLALKPFPRRLLLGHGVDVLLTHAPPPGPSAGEDFAHRGARAFLLFHRLFR
FT                   PRLHVHGHTPLLGANPERRHRTPLGVEVVHAQGYALIAL"
FT   CDS_pept        complement(52473..52922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0054"
FT                   /product="RNA methyltransferase"
FT                   /note="similar to GB:AAS82294.1 percent identity 100 in 149
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69877"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69877"
FT                   /db_xref="GOA:Q5SM89"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69877.1"
FT                   /translation="MLHLVLYQPEIPQNAGNVARTAAALGWPLHLIRPLGFLLSSPKLK
FT                   RAGLDYWPHVDLRLHDSFAAFLEALPRGARVFAFSARGEASLYEARFREGDYLLFGPES
FT                   RGLPEEVLARFPTLKIPMPGPVRSLNLAVAVGVAAYEAYRQLTGR"
FT   CDS_pept        complement(52922..54457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0055"
FT                   /product="ATP-dependent DNA helicase RecG-related protein"
FT                   /note="similar to GB:AAS82293.1 percent identity 99 in 511
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69878"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69878"
FT                   /db_xref="GOA:Q5SM88"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69878.1"
FT                   /translation="MTWEELEERLARGQDERTLFLPQDISPEDLARYAAGLANHKGGTL
FT                   FLGVSPEGKVLGAQDLHPLQVTHALFELTQGLLLPYVEVVEGPWGRVLALHVPQSPAAI
FT                   AVGTGRVPFWDGRRLSELKVGQSLPEPDFTAQVLPAASLSDLDPVEVLRLRRILEERGS
FT                   ALAALPDLELLFALGLLERVEGEVRPTVAGLLLAGTSLALRRLLPQAEVSYYFHETEEG
FT                   YSFREDLLRPIPALLERLKELIQARNRVRFLTVGLFRLEVWDFDQEVYREALVNALVHR
FT                   DWRSKDAIQVHHYRDRLEVSNPGGFPPGITPENVLRHPPKRRNPRLAEALYRLGYVERA
FT                   GSGVDKMYRLLLKYGKEPPEYRLFPEALTLVLYNPELDEAFVREIAEAQERLGGFSLDH
FT                   LIAVGYLRRVGEAGLEELARALQLPEEAARRVLSRMERMGLLRKEGGRYHLARRDLLAE
FT                   RALALLEAPRRRQEVERVLGLSRKRALELLRRLIREGRVERVGRGAATRYRRR"
FT   CDS_pept        54673..56013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0056"
FT                   /product="ammonium transporter"
FT                   /note="similar to GB:AAS82292.1 percent identity 98 in 446
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69879"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69879"
FT                   /db_xref="GOA:Q5SM87"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69879.1"
FT                   /translation="MRKGTLNGIAALGLSGLALAEGVDGADTAWMLVSTALVLLMTPAL
FT                   AFFYGGLVRSKNALNTMMMSFAALAFVGVGWALLGYTLAFGEGGPLLGGLGHLFLRGVG
FT                   LEAQGTIPHVLFLAFQGTFAIITAALVSGALVERMRFPAYLAFLTLWGLFVYAPLAHWV
FT                   WGGGFLGALGALDFAGGTVVHINAGVAALVGALVLGARKDYGRQAILPHNVPFTLLGAA
FT                   LLWFGWFGFNGGSALAANASAALAFANTMLAPAATLLVWTLLDLLRTGKATAVGAATAI
FT                   VVGLVAVTPAAGFVSPLSALLIGALAAFPSYYVLLWRARTRLDDSLDVFAGHGVGGITG
FT                   ALLTGVFAEKAWNGVADGLLFGNPMQLGIQAVAVLAAVVYSALGTFALLKLVGLLTPLR
FT                   AGPKEEGVGLDVTQHGEEAYTSGEGAILVLSEKAPAVPSLRPQGGEA"
FT   CDS_pept        56010..56360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0057"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="similar to GB:AAS82291.1 percent identity 100 in 116
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69880"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69880"
FT                   /db_xref="GOA:Q5SM86"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69880.1"
FT                   /translation="MKLIVAIVRPEKLNEVLEALFQAEVRGLTLSRVQGHGGETERVET
FT                   YRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRT
FT                   GEEDEAAVTPVQ"
FT   CDS_pept        56365..57267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0058"
FT                   /product="transcriptional repressor of class I heat-shock
FT                   genes"
FT                   /note="similar to GB:AAS82290.1 percent identity 99 in 300
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69881"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69881"
FT                   /db_xref="GOA:Q5SM85"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69881.1"
FT                   /translation="MTARQRRVLHLLVDEYIQTKAPVPSARIAEGLGLSPALARYELIA
FT                   LEEMGYLTKPHASAGRVPTRQGFRQYSLSLLPPRPLPEATRRRLERALEGAREPEAFLV
FT                   KVAVGLSGYPALLRLQPRRAPKLLQVHLSPLPEGTLAVLVLEGGRVKEVRLPLVLPQET
FT                   LRRAEEALTGPLETLPAAPKGLEDLFAHLSRALASGFALRYREGLSEALKEPEAKDPGF
FT                   LERLVALYEEGGEDLLTPPGRVDVRVGEVEGLALVQAGFQKGEWLGELTLIGPLRMRYA
FT                   EALSVAFSLSQVYTGQHAD"
FT   CDS_pept        57257..57928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0059"
FT                   /product="molybdenum cofactor biosynthesis protein D/E"
FT                   /note="similar to GB:AAS82289.1 percent identity 99 in 223
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69882"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69882"
FT                   /db_xref="GOA:Q5SM84"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69882.1"
FT                   /translation="MRIEVRLFALYREQAGTDRLALELPEGARVREAQKALEERFPRLR
FT                   LEGGMAAVNQALAGAETPLKEGDEVAFLPPVSGGQDSYGLTQEPLDLEALVAWATAPEY
FT                   GAVVSFLGTTRSPNRGEEVAFLEYEAYPEMAEKVMAEILAEMRARWPLGRIALWHRLGR
FT                   VDPGEASIAIVVSARHRKEAFAACQYAIDRVKQILPVWKKEHRKDGSFWVEGFAPEDKR
FT                   L"
FT   CDS_pept        57999..58238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0060"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82288.1 percent identity 98 in 79
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69883"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69883"
FT                   /db_xref="GOA:Q5SM83"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69883.1"
FT                   /translation="MTSFAFTAFLLLLVLFALPLLLGFLSGRAYRAGRGRVAFGLLLFG
FT                   GFVGLLARPRPLGLLLLALGLAWGYAAPRRPRGA"
FT   CDS_pept        complement(58225..58545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82287.1 percent identity 97 in 106
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69884"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69884"
FT                   /db_xref="InterPro:IPR021576"
FT                   /db_xref="PDB:2EBE"
FT                   /db_xref="PDB:2EBG"
FT                   /db_xref="PDB:2EI5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69884.1"
FT                   /translation="MQAVRLFQGYLWHPRALALDLKALLPGEVAGARLLWDEVPPPTPF
FT                   FEDGTPTHTQRFYQLTLLVLTEEPPEALKPLAEEAAEALGEVLEGLPPEVGWLLLEDLR
FT                   PL"
FT   CDS_pept        complement(58555..59637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0062"
FT                   /product="alanine racemase"
FT                   /note="similar to GB:AAS82286.1 percent identity 98 in 351
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69885"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69885"
FT                   /db_xref="GOA:Q5SM81"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69885.1"
FT                   /translation="MRPGGYPKGVQARAWVEVDLAALWANYRLLAGRAGGEVIPVLKAD
FT                   AYGHGALPLARFLEGKGVGRFAVATLEEGRRLREGGIKGEVLLLGSLHPLEAEEALRLG
FT                   LVPTLSNLEAAEALSQRARALGLVPRAHLKVDTGMNRVGFPSEEAVSALRAVEALGVRV
FT                   EGVYTHLATAGEDAAFVETQRRRFQEVRRALGEGYFYHLENSLGLLRHGATAGVRVGLA
FT                   LYGLVPGFGLRPILRILARPTLVKRLKAGDRVGYGGVYVARGGEWLATLPVGYADGLPW
FT                   GAVRFVKGPDGRLLEVAGRISMDQTTVLLPGPVGLEAVFEVLSADFGPTGLLAWAEARG
FT                   TLPYEVAVHLSRRLPRRYLE"
FT   CDS_pept        complement(59652..61763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0063"
FT                   /product="primosomal protein N"
FT                   /note="similar to GB:AAS82284.1 percent identity 99 in 703
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69886"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69886"
FT                   /db_xref="GOA:Q5SM80"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69886.1"
FT                   /translation="MALPLPLPPMSYLPPLGQEGEEALGRRVAVPFRGEVQVGVVVGEG
FT                   GRPSLNLRHAIAYLDPAPYLRPEEILFLEEAARYLFAPLGQVLADFLPPFPPLRHRVRL
FT                   YPGADPKVLPPGLGALVDWREARGFDPKLLDLLREAGMLEEELAFREARGVLVPLKPAH
FT                   PDPQLDRVLQVLRELGFAESQAALARAAGVGVGRVRRLVQEGYIGTASPEEAAPPPADG
FT                   VDVAPLHLPERPERVNGGRFLERVRVLKGLLGEGDHLVLFPEVSLLERFLAHFPGATPY
FT                   HGGLSGPVRERFFRRPRGLVFATYGGLLLPFTPRSLVVVEEGSESYKLPSGSRAFVPPL
FT                   AELRARLLGVPLTYLSLVPAVEVLERKGFALPVPKPRLLLLDLRRERGFPVTGRALALL
FT                   RQVEERGRQAVVLSARKGYSALLLCQDCGFRPMCPDCALPLRYHREGKGALVCHQCGHR
FT                   EDPPLLCPRCGSPLLAPKGPGVDWIREALAERLSLPVYRYAGDGKDDLTPLLEGRPGVV
FT                   VGTTALLRGPRLPDLALVLLPLADGFLLESDFRAAERYHRLLWALTELRPGRRPLLVLQ
FT                   TFTPEHPVHRALEAGEVEAYLWQEKALREALNYPPRVRMVKLEVRHRKEERAREKAFAL
FT                   LEALRAEAEEGEVLGPAPAPVPRVKGHYVFHLLLRGSTERLARLLGLLDRRQFRLDPDP
FT                   FHFVGLLED"
FT   CDS_pept        61796..62854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82283.1 percent identity 99 in 352
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69887"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69887"
FT                   /db_xref="GOA:Q5SM79"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69887.1"
FT                   /translation="MRFAVLFSGVALYSALYAVVPLLPLLERLFGAPPGAAGPGMGLPL
FT                   LLLVLLSPLTPRLSLPPGVLLGGGLLLVGVGGVLGALSPSLFLWTLARLLQGAGAALVP
FT                   ALAIALLPLLYPRRAWEVAGLYMAGNVLGGGLGRVLAGVLAEGLGVREALLFLSLPALA
FT                   LGLLLLGLPRGKTPPLGPARYDLRALPLYAVGAVLLFLNLFLANLLPYRLLDLGYRPAE
FT                   VGLVYLAYLFGLPGSALSGFLAARLGPRRTFRLAFLGVLVALGLLLLPPPFLVAGFVLL
FT                   MAFLFTAQSLASGAAGQRGPGVSGTYVASFYLGGTLAGLAYPLFLHSFPLAVGLGAALA
FT                   LLALLLAPVEAQ"
FT   CDS_pept        62864..63523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0065"
FT                   /product="glycolate oxidase subunit GlcE"
FT                   /note="similar to GB:AAS82282.1 percent identity 99 in 219
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69888"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69888"
FT                   /db_xref="GOA:Q5SM78"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR040948"
FT                   /db_xref="PDB:2YVS"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69888.1"
FT                   /translation="MEVHAADQYLVAPGEADLLEVHARLAGTGLFPPFPPVELPGGVGG
FT                   LVARGGFAQTFFFPAEVLGLTFRTPKGRRVRAGGVVVKNVQGYDLVRLFVGSFGLLGRA
FT                   EEVVLRLRPGRAQAFLRRPFSGSFPRLVPTPRFLFALEDEEGPWLYAYHFGHPKEVERF
FT                   REAFGGEEARPLDLRPRFPRGLGLGEGPLWDLRFRYQDGGASPPPPPAFLRLARVL"
FT   CDS_pept        63528..63887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0066"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82281.1 percent identity 98 in 119
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69889"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69889"
FT                   /db_xref="GOA:Q5SM77"
FT                   /db_xref="InterPro:IPR025557"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69889.1"
FT                   /translation="MDFPEGPRVSFRGKEVSMNAKEFFAALFDLAFERFVTIQLTGLVY
FT                   ALALAVGGIYALFAVVGAFEASAGLGVLTLLVLAPLGFLLYAVAVRVGLEALVSLIRIA
FT                   ENTREIRDALRKEKA"
FT   CDS_pept        complement(63918..64898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0067"
FT                   /product="L-asparaginase II"
FT                   /note="similar to GB:AAS82280.1 percent identity 99 in 326
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69890"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69890"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69890.1"
FT                   /translation="MSAEVLVYRGSLVENRHRVSLALWGPEGLVAYAGDPGRVAYLRSS
FT                   AKPFQALALYLTGAVERFGLTEEEVALATASHDGTPRHVEVAARFLGKLGLGPEHLVCG
FT                   VHPPFSREARAALEAQGLAPTPLHHNCSGKHAGMLAAALALGAPAEGYHLPDHPVQRLN
FT                   LATLEALSGARPGLATDGCSVPTFALSLARAARAFFLLADPGRAPEAYRTPLLRVREAM
FT                   RRHPDLVAGPGSVDTLLMERLPVVAKRGADGYYGLALLEGPRGPLGVALKVEDGATLAR
FT                   EVAVVALLRALGLDPGKTPWDRPPVRNHRGLEVGHLEARLGLVWV"
FT   CDS_pept        complement(64895..65179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82279.1 percent identity 98 in 94
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69891"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69891"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="PDB:2CWY"
FT                   /db_xref="PDB:2CXD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69891.1"
FT                   /translation="MVPDWEEVLGLWRAGRYYEVHEVLEPYWLKATGEERRLLQGVILL
FT                   AAALHQRRLGRPGLRNLRKAEARLEGLPCPLMGLDWRSLLQEARRRLGA"
FT   CDS_pept        65117..65998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0069"
FT                   /product="ABC transporter, periplasmic binding protein"
FT                   /note="similar to GB:AAS82278.1 percent identity 98 in 293
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69892"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69892"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69892.1"
FT                   /translation="MHLVVPPRPPQAQDLLPVGHHAPSLPGYTRPMRLLALLVLLGPAL
FT                   ALRLATTTSVYDSGLLDRLLEAFLRETGIRVQVLAVGTGQALRLAERKDVDAVLVHAPS
FT                   LEREALARGITAEPYCLAQNAFLLAGPEADPAQVREAENVLEALRRIAAQKAPFVSRGD
FT                   RSGTHLKELELWEKAGLKPQGPWYLESGAGMGQTLVLAAEKGAYTLTDLATFLTVGKRR
FT                   GLKALYAREDPLLLNQYAFHLVPGSPGEGEAQRLRAFLASEEAARIVAGLRVEGTPLFA
FT                   PLRGRCAFPLRP"
FT   CDS_pept        66001..66636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0070"
FT                   /product="ABC transporter permease protein"
FT                   /note="similar to GB:AAS82277.1 percent identity 99 in 211
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69893"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69893"
FT                   /db_xref="GOA:Q5SM73"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69893.1"
FT                   /translation="MPPAEILEIALRSLAVAGGATLLAALFGVPLGLWLALRGGGGVWG
FT                   RVLLYSGLALPSVVVGLLFYLLLSRSGPLGFLNLLYTPWAMVLAEATLAFPLIAAFVLS
FT                   GARGRVEEVRLLVRSLGGKERHVLPTLLAESRRTLAAALAAGFGGAISEVGAATLVGGD
FT                   IRHHTRVLTTAIVVETRMGELHAALALGAVLLGIALLVTAFLVILERE"
FT   CDS_pept        66633..67307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0071"
FT                   /product="ABC-transporter, ATP-binding subunit"
FT                   /note="similar to GB:AAS82276.1 percent identity 98 in 224
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69894"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69894"
FT                   /db_xref="GOA:Q5SM72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69894.1"
FT                   /translation="MILKAEDLTLAFPGFRLRVPRLALAPGEVLVVLGPSGSGKTTLLR
FT                   LLAGLLPPEGGRVTGGLRVYLPQTPPLLHRSVLDNAAFGLLLHGVPREEARRRAQARLK
FT                   EVGLEALAHRPAHHLSAGEAARLALARALAVEPEVLLLDEPTANLDPANALRVEALLRR
FT                   AAEEGRGVVLATHNLFQARRLGHRLLFLHRGEAVEEGPVAEVFAAPKDPRTQAFLRGEL
FT                   VF"
FT   CDS_pept        67430..68548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82275.1 percent identity 100 in 372
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69895"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69895"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69895.1"
FT                   /translation="MRPFVLLILLGLALGQSAPLEAVLVLREDVLEEGRLVAYTGTQRY
FT                   PVASEAELLRLLDRLARPPRPPRFIYQDGRWRGVEKKGLAFDREEALKAFREARAQGKK
FT                   RFLLPVRYTPPSPSLKDLYALGVREHLATAETGFWGSSPERVHNIRLAASRLDGLLVPP
FT                   GPFSFNRALGPIALETGFKEAYVIVGDRTETGVGGGVCQVSTTLFRAFFFAGLPILERH
FT                   AHSYQVAYYKPPGLDAAVIQPYKDLKVLNDTPGALWIQASVQEGRLRFHLFGTKDREVA
FT                   WEGPFITDRKPPLPPREIPDPTLPPGARKQVDFAAEGAKVVVRRRVRYGDGRVREDQVV
FT                   SVYRPWGAVYLVGPSPAPEAPPAPPEEAGAAP"
FT   CDS_pept        complement(68490..68753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0073"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82274.1 percent identity 100 in 87
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69896"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69896"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69896.1"
FT                   /translation="MASFKLHLLRLAREGQVEVPGVPGLRAYTLRERVERPGPAFYLLL
FT                   EGELVVDLPEGRYLHLRRGEAARVTEPHRLLPVERAVLLELG"
FT   CDS_pept        complement(68753..71245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0074"
FT                   /product="DNA topoisomerase IA"
FT                   /note="similar to GB:AAS82273.1 percent identity 98 in 830
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69897"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69897"
FT                   /db_xref="GOA:Q5SM69"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69897.1"
FT                   /translation="MPKSAKRRASQPTGAETLVVVESPAKARSIQKMLGPGYEVRASLG
FT                   HVVDLPERSLGVDVERDFAPTYEVKKDKKPVVEELKRAAEGKRLLIATDPDREGEAIGW
FT                   HVARLLGRDPKEPLRVEFHEITPRVVRQAVEAPRPIDQNLVDAQQARRVLDRLLGYNLS
FT                   PLLSLEFRKRALSAGRVQSVALRLVVEREEAIEAFRPEEYWVLRGVFAVEGGEAPLVAT
FT                   LHEVEGKRLWTGQGEKEGRLHLASEAEAHALAEALRKGSYRVAQVEVRERRKAPPPPFT
FT                   TSTLQQAASSRLGYTAARTMRIAQRLYEGVDLPEGTVGLITYMRTDSVRVAPEAVAAAR
FT                   EVIGKAFGPEYLPEAPRAYKNRREGVQDAHEAIRPTDPKRTPESVRPYLSEEEYRLYEL
FT                   IWRRFLASQMRDALYEQTAVTLADLEGRYAFRASGSVLRFEGYLRAWGRDAEEEEEPPV
FT                   PAVPEGVPARLEEVLEERRFTEPPPRYTDASLVKTMEELGIGRPSTYAPTLETLEKRGY
FT                   VARKGRTLFPTPLGRQVTAYLRERFPQVVAYEFTARMEERLDEVEEGRVPWPKVVWEFY
FT                   EPFLGELAQVPKKTCPRCGRPLELKVSRYGQFLGCTGYPECTYTEPLERREAEPIGEAC
FT                   PKCGRPLLRKEGRYGTFIACSGYPECDYTRDDGTPTGHTCPKCGGRVLEKRSRKGRPYY
FT                   KCENNACDFLSFYPLLEEACPACGWPLVKKGEKALCLNPACPEHEPSLLPAPKEAKKGR
FT                   SRGKGKPPLAPPKDWEELVPFLPGLSPEERRAVEALARGEALARGEALAEEEARLARRA
FT                   LFKLRMRKGKARKEPVRA"
FT   CDS_pept        71430..78038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0075"
FT                   /product="ribonucleoside-diphosphate reductase"
FT                   /note="similar to GB:AAS82272.1 percent identity 98 in 1564
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69898"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69898"
FT                   /db_xref="GOA:Q5SM68"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69898.1"
FT                   /translation="MDMRDGYFFDEHAQAIARRQYLQPGDGDILGMFRRVAREIAKAER
FT                   EEERSKWEEEFFRLMAEKRFSPGGRILAGAGTVHGNLLNCFVQGATENPPESFAGIMEV
FT                   AKKLALVTKVGGGNGVNLDPYRSKGKRARRAVEGVAYLSAEHPDVEDFIRGLMRPPINP
FT                   DGAKEEISLKNFARVVYGALSPELKALAERYGVRTVKEPPEGRILVPDDMGGIIDAARE
FT                   AADLARKGQKPHVDFSLLRPEGAPIRGSGGTSSGPVSFLFEIFDNFLEWVAWGAEEAGP
FT                   VATLRYVYAPVLRVVRQGGCLHPDTLVHTDRGTLRLRELVDPFRRGWQPHTLSVATDEG
FT                   WRPSPEGYNNGVAPTLRVVLENGLEVQGTLNHKLKVLREDGTREWVELQDLRPGDWVIW
FT                   VLDEHTGTPVQLAPLDEPLHPNTTPIRTPEVLTEDLAFLLGFFFGEGFVSGDRIGFSVH
FT                   EEEPMREEAKRLFRELFGLELREERKPGDRSVTLVVRSRPLVTWLRKNGLLKGKARELE
FT                   VPRAIRQSPRPVLAAFLRGLFEADGTITAGYPMLTTASKRLAQDVMVLLGGLGIPSKLL
FT                   RYNPLPGRFSKAEHYRVRVVTAKGLERYLERIGVPKGSRLEALHGIKPDIRRESSWPLP
FT                   HAEGLLKPLLTVTEKGRKGYASPYTPLRKDLLRYLRGERQLTATGYAMVLEKAQDLGLE
FT                   AEPFPFNEYYVRVASVEPGGEILTLDLSVEGNHTYLANGLVSHNTRRGAGMATLSIEHP
FT                   DLLDFLTAKDLDREKAEGDISTFNISVLATDRFLEAVEKDELWPVTPIEVPGKYYPYPV
FT                   EGPYTGKLPPLPEREDGAKAIPLYGGKVPARWLWHEIAWHAWATGEPGLIFVDRVNALS
FT                   ALKGLGERYQIRSTNPCFVGSTRIPTERGLVPIEELAREGGSFYLVTDNRAPFGGRGAP
FT                   LPGHGTAVRKAVRAFFTGVKPVVRLRTREGLEVTLTPDHLLLTPEGYREAGKLRPGEKI
FT                   LVQSGEGLFPKEESLPAQALAVVHERVATAGGRGGRGRADVRAQYRNLPTRWSRELGVA
FT                   LGWLLGDGYLREDGVGFYFSRKDFADLAWLPDLLRDWFGQGTLQETRSDTFHLHFNRIP
FT                   AEFFQALGLKAARATEKRVPESLFRAPREAVVGFLQGLFSADGSVQINEKKQDATIRLA
FT                   SSSLALLQDVQLLLLNLGILGKIHKRREAARKALPDGKGALREYPVAPQYELILGGENR
FT                   DRFAEVVGFLQEEKQSKLLAFLRHRPRGSYRKPFLATVASVEPAGEAPVYDLTEPVTHS
FT                   LIANGLVAHNCGEIPLTVGEPCDLGAMNLAAYVKDGEFQMEEFRRDVRTAIRFLDNVLD
FT                   VNKFALPDNEMAAKKLRRLGLGLMGLADALIKMGLPYDSEEARRKVYEIVSAMREEAIR
FT                   ASEALAEERGPFPLYEEHREYFQSLGIKPRRNVALLTVAPTGTTSMLMGVSSGIEPVFS
FT                   PFVWRRIGGEYKPLLHPLFVELMEAYPPAPGFAKEGKWDWEKIVEEIQKDGHGSVQNLP
FT                   FVPEAIRRVFLSAHDIHPLDHVRMQGAVQRAFDAEGYAANSISKCIAKGTLIPTSKGLI
FT                   PIEEIAPPHPEDTFVPVEGLYTAEGYRITAHYYAGKKRGVRIRLDNGAELVGAWESHRL
FT                   LTPEGWRLMRELKPGDVVLGKLVPSHGEGGLPIPEAKGLSLRTNARNLPLPERMSEDLA
FT                   LFLGMLAADGSTVEATGFVGIATKDPDVERVFQEVAGRLFGVEPKCTVDKRTGVRNLYL
FT                   TSRRLVRFVEALIGKGAAQKRVPSQILQGSPGEKLAFLRGLTLDGYVHANMGLVVYEGR
FT                   SQRLAYEAAELARSFGLPKVYQGRKKVLAPKETYYVHSVAVSGPLQELLEPLEAHKRAK
FT                   VEARYKVFVPQEVLAATRVGTHHPGYVSLKSVRQREAQAVYNTTAERLGWPTEILAHRV
FT                   VEVEEVGEVEMYDIEVEEVHRYVVNGLISHNTINLPNHATVEDVEAAYTEAYRTGCKGI
FT                   TVYRDGSREFQVLTVKKEAKEEKAGKTPEEAKPQEARAHEPGRPVYERPGRLMGFTDMV
FT                   KLFAPDGSKRSFLVTVNTLEGRPIEVILTSGKAGDEANADSEALGRVVSIALQYGVPPE
FT                   AIVRTLRGINGGLYGTYQGRLVSSKADLIAVALETVPQMAPGAPEDLSSAPVLSGGGIA
FT                   LAGAAPCPSCGEKALVREEGCWKCQACGYAKCG"
FT   CDS_pept        78135..78746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0076"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /note="similar to PDB:1BKG percent identity 99 in 203 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69899"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69899"
FT                   /db_xref="GOA:Q5SM67"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69899.1"
FT                   /translation="MRVKICGITRLEDALLAEALGAFALGFVLAPGSRRRIAPEAARAI
FT                   GEALGPFVVRVGVFRDQPPEEVLRLMEEARLQVAQLHGEEPPEWAEAVGRFYPVIKAFP
FT                   LEGPARPEWADYPAQALLLDGKRPGSGEAYPRAWAKPLLATGRRVILAGGIAPENLEEV
FT                   LALRPYALDLASGVEEAPGVKSAEKLRALFARLASLRMEG"
FT   CDS_pept        78743..79537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0077"
FT                   /product="inositol monophophatase family protein"
FT                   /note="similar to GB:AAS82270.1 percent identity 98 in 264
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69900"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69900"
FT                   /db_xref="GOA:Q5SM66"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69900.1"
FT                   /translation="MIGRRHPYYPYLEAALEAASLARGIHLYYLEKGFTEGTKSGPTDL
FT                   VTQADREAEEAVKGLLLSRFPEAGFLGEEGGSEGGKALRFIVDPLDGTVNYAHGFPFFA
FT                   VSIALEAESAIQMGVVMDTARGEVFYALRGEGAYLNGRPIRVTGRESLVGSLLATGFPY
FT                   DVAKDPENLTYFERALRKGLLVRRPGAAALDLAYVAAGRLEGFWEVKLNPWDVAAGWLL
FT                   VEEAGGRVTDLEGNPYRLGSRYILATNGRVHEALRRTLLGLD"
FT   CDS_pept        complement(79613..80332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82269.1 percent identity 98 in 239
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69901"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69901"
FT                   /db_xref="GOA:Q5SM65"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="PDB:4C8Y"
FT                   /db_xref="PDB:4C8Z"
FT                   /db_xref="PDB:4C97"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69901.1"
FT                   /translation="MVLAALVLVLEGEGLPEPLGLRGFFYGLLREVAPEVHDQGENPFA
FT                   LGFGGREGAAWARVSLLVEGLYARLAPRLYALEGEEVRLGPPFRVRAVLQEGHPWAGVS
FT                   TYPRLFQGPPSRDLALRFASPTFFRRKGVHYPVPEPRLVLESLLRRLEAFGPLKAPEGV
FT                   REALLERTTVRSLEGRTLPARTEVDTAGFVGRVVYHLPRATEEEALWLSALGRFAFYSG
FT                   VGAKTSLGYGRARAESA"
FT   CDS_pept        complement(80335..80571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0079"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82268.1 percent identity 96 in 78
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69902"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69902"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69902.1"
FT                   /translation="MGKRRSAVASDFPDHLRQVKPTHLLKTYGFGFAGPLGDLRRRARR
FT                   LLDLGPNALSIGLDPDRPPRPAQARHGLLSPGF"
FT   tRNA            complement(80908..80983)
FT                   /gene="tRNA-Ala-3"
FT                   /product="tRNA-Ala"
FT                   /note="anticodon: CGC"
FT   CDS_pept        complement(81021..81359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0080"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82266.1 percent identity 99 in 112
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69903"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69903"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69903.1"
FT                   /translation="MKRWLAFLPFLALAWALELRVTASLVVDLFPQAVVVERVTEPQGI
FT                   VVVYQASQAEAVFRYHDLDLRRRGWVRVKYEVKKGEWKAEYRKGKAKARLSVKDKKGRV
FT                   EVRLKEGD"
FT   CDS_pept        81423..82061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82265.1 percent identity 100 in 212
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69904"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69904"
FT                   /db_xref="GOA:Q5SM62"
FT                   /db_xref="InterPro:IPR009168"
FT                   /db_xref="InterPro:IPR041247"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69904.1"
FT                   /translation="MDEVWRKLAEPFPPGEVQWRVEALSRDKKRALVVPYVDARTVLDR
FT                   LDKVVGPEGWHDAYEVLSDAERLVKDERGERRERLCEVKCRLTVLGVTKEDVGEGDSLK
FT                   AAFSDALKRAAVKFGVGRYLYRLEKQWVDYDPEKGRFTPPKLPEAEPEAEAEEEKPEAH
FT                   RLIDQLLERLKEKGLGKEAARIVNKYGGYGKTPEETRKLYGELRNLLKG"
FT   CDS_pept        82058..82801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0082"
FT                   /product="probable phosphoesterase"
FT                   /note="similar to GB:AAS82264.1 percent identity 100 in 247
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69905"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69905"
FT                   /db_xref="GOA:Q5SM61"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69905.1"
FT                   /translation="MRVVALGDLHANFPLLWRILRREGLADEGFRPTEALRSGRVRLVL
FT                   LGDLVHPKTPRDYARLTGLEAYDPEDPFHLRLAAGAQIRELFRLKAFQEEAGDHVTILL
FT                   GNHEAALLEGSPILGNRHLKHLEFHPEHGGKALPEALRSWMASFPKELVLKGVHFAHVG
FT                   PVPWLQEYDGLFYAQSEAKTWWFLTPEYVERMGYRYGVYGHTPMPDGILLKDRFALIDA
FT                   LDLGEYLVLDPEADPPRPEVRRLHE"
FT   CDS_pept        82794..83609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0083"
FT                   /product="dimethyladenosine transferase"
FT                   /note="similar to GB:AAS82263.1 percent identity 99 in 271
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69906"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69906"
FT                   /db_xref="GOA:Q5SM60"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:3FUT"
FT                   /db_xref="PDB:3FUU"
FT                   /db_xref="PDB:3FUV"
FT                   /db_xref="PDB:3FUW"
FT                   /db_xref="PDB:3FUX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SM60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69906.1"
FT                   /translation="MSKLASPQSVRALLERHGLFADKRFGQNFLVSEAHLRRIVEAARP
FT                   FTGPVFEVGPGLGALTRALLEAGAEVTAIEKDLRLRPVLEETLSGLPVRLVFQDALLYP
FT                   WEEVPQGSLLVANLPYHIATPLVTRLLKTGRFARLVFLVQKEVAERMTARPKTPAYGVL
FT                   TLRVAHHAVAERLFDLPPGAFFPPPKVWSSLVRLTPTGALDDPGLFRLVEAAFGKRRKT
FT                   LLNALAAAGYPKARVEEALRALGLPPRVRAEELDLEAFRRLREGLEGAV"
FT   CDS_pept        83765..84124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0084"
FT                   /product="NADH-quinone oxidoreductase chain 7"
FT                   /note="similar to GB:AAS82262.1 percent identity 99 in 119
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69907"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69907"
FT                   /db_xref="GOA:Q56217"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="PDB:4HE8"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56217"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69907.1"
FT                   /translation="MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYE
FT                   SGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLF
FT                   VGFLYEWWKGVMRWH"
FT   CDS_pept        84115..84660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0085"
FT                   /product="NADH-quinone oxidoreductase chain 6"
FT                   /note="similar to GB:AAS82261.1 percent identity 99 in 181
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69908"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69908"
FT                   /db_xref="GOA:Q56218"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="PDB:2FUG"
FT                   /db_xref="PDB:2YBB"
FT                   /db_xref="PDB:3I9V"
FT                   /db_xref="PDB:3IAM"
FT                   /db_xref="PDB:3IAS"
FT                   /db_xref="PDB:3M9S"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56218"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69908.1"
FT                   /translation="MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLAC
FT                   CAIEMMASTDARNDLARFGSEVFRASPRQADVMIVAGRLSKKMAPVMRRVWEQMPDPKW
FT                   VISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAY
FT                   NERGERLPPVAAWKRTRG"
FT   CDS_pept        84664..85287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0086"
FT                   /product="NADH-quinone oxidoreductase chain 5"
FT                   /note="similar to GB:AAS82260.1 percent identity 100 in 207
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69909"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69909"
FT                   /db_xref="GOA:Q56219"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="PDB:2FUG"
FT                   /db_xref="PDB:2YBB"
FT                   /db_xref="PDB:3I9V"
FT                   /db_xref="PDB:3IAM"
FT                   /db_xref="PDB:3IAS"
FT                   /db_xref="PDB:3M9S"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="PDB:5B3P"
FT                   /db_xref="PDB:5B3Q"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56219"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69909.1"
FT                   /translation="MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMG
FT                   FNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGWKDGDGSRFFVRVYVPEEDPRLPTV
FT                   TDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFREGR
FT                   YIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG"
FT   CDS_pept        85284..86513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0087"
FT                   /product="NADH-quinone oxidoreductase chain 4"
FT                   /note="similar to GB:AAA97941.1 percent identity 100 in 409
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69910"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69910"
FT                   /db_xref="GOA:Q56220"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="PDB:2FUG"
FT                   /db_xref="PDB:2YBB"
FT                   /db_xref="PDB:3I9V"
FT                   /db_xref="PDB:3IAM"
FT                   /db_xref="PDB:3IAS"
FT                   /db_xref="PDB:3M9S"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56220"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69910.1"
FT                   /translation="MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMV
FT                   TLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDYLHSFAHDLAYALAVEKL
FT                   LGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLFEWV
FT                   TGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVG
FT                   VIPPEVAIDLGLTGGSLRASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIR
FT                   EMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETSMEAVIYHFKHYTEGFHPPKG
FT                   EVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIAS
FT                   LDPVMGDVDR"
FT   CDS_pept        86524..87069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0088"
FT                   /product="NADH-quinone oxidoreductase chain 2"
FT                   /note="similar to GB:AAS82258.1 percent identity 100 in 181
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69911"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69911"
FT                   /db_xref="GOA:Q56221"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="PDB:2FUG"
FT                   /db_xref="PDB:2YBB"
FT                   /db_xref="PDB:3I9V"
FT                   /db_xref="PDB:3IAM"
FT                   /db_xref="PDB:3IAS"
FT                   /db_xref="PDB:3M9S"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56221"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69911.1"
FT                   /translation="MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPER
FT                   IEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETL
FT                   GIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRL
FT                   EEIELPGKCGHHVHEVEV"
FT   CDS_pept        87066..88382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0089"
FT                   /product="NADH-quinone oxidoreductase chain 1"
FT                   /note="similar to GB:AAA97943.1 percent identity 100 in 438
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69912"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69912"
FT                   /db_xref="GOA:Q56222"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="PDB:2FUG"
FT                   /db_xref="PDB:2YBB"
FT                   /db_xref="PDB:3I9V"
FT                   /db_xref="PDB:3IAM"
FT                   /db_xref="PDB:3IAS"
FT                   /db_xref="PDB:3M9S"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56222"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69912.1"
FT                   /translation="MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVL
FT                   KEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMPKDDGKQHYLICNADESEPGSFKDR
FT                   YILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGKNLF
FT                   GTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVE
FT                   TLASVVPIMERGADWFAQMGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAG
FT                   GPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKGSMLGTGGVILIPERVSMVDA
FT                   MWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSF
FT                   CPLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR"
FT   CDS_pept        88384..90735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0090"
FT                   /product="NADH-quinone oxidoreductase chain 3"
FT                   /note="similar to GB:AAA97944.1 percent identity 99 in 783
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69913"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69913"
FT                   /db_xref="GOA:Q56223"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="PDB:2FUG"
FT                   /db_xref="PDB:2YBB"
FT                   /db_xref="PDB:3I9V"
FT                   /db_xref="PDB:3IAM"
FT                   /db_xref="PDB:3IAS"
FT                   /db_xref="PDB:3M9S"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56223"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69913.1"
FT                   /translation="MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGAC
FT                   RMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLAASCVTAVADGMVVDTLSDVVREAQ
FT                   AGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFTRRH
FT                   VDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGF
FT                   SGNITDICPVGALLDLTARFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRARE
FT                   VPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEATWEEAFLALKEGLKEARGEE
FT                   VGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVL
FT                   GDPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPL
FT                   MKWAAIHEVHRPGEEREILLALLGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVA
FT                   AERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDEPGALYAYYGFVPPEEA
FT                   LKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAE
FT                   GALQVLALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYL
FT                   RPTMWKAHQAVGKAQEAARAELWAHPETARAEALPEGAQVAVETPFGRVEARVVHREDV
FT                   PKGHLYLSALGPAAGLRVEGRVLVPAGGEA"
FT   CDS_pept        90732..91829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0091"
FT                   /product="NADH-quinone oxidoreductase chain 8"
FT                   /note="similar to GB:AAA97945.1 percent identity 99 in 365
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69914"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69914"
FT                   /db_xref="GOA:Q60019"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="PDB:4HE8"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60019"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69914.1"
FT                   /translation="MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVR
FT                   MGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRFLFVLAPLISVVFALLAFGLIPFGP
FT                   PGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLISYE
FT                   LGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLP
FT                   EAEQELVGGYHTEYSSIKWALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFL
FT                   KIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLWFLVTALVVALDLPRTYLLYL
FT                   SALSFLVLLGAVLYTPKPARKGGGA"
FT   CDS_pept        91826..92374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0092"
FT                   /product="NADH-quinone oxidoreductase chain 9"
FT                   /note="similar to GB:AAS82254.1 percent identity 100 in 182
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69915"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69915"
FT                   /db_xref="GOA:Q56224"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="PDB:2FUG"
FT                   /db_xref="PDB:2YBB"
FT                   /db_xref="PDB:3I9V"
FT                   /db_xref="PDB:3IAM"
FT                   /db_xref="PDB:3IAS"
FT                   /db_xref="PDB:3M9S"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56224"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69915.1"
FT                   /translation="MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTR
FT                   HPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLC
FT                   EEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVGYVV
FT                   PYVRPELEGFKAPTEGGKR"
FT   CDS_pept        92371..92901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0093"
FT                   /product="NADH-quinone oxidoreductase chain 10"
FT                   /note="similar to GB:AAA97947.1 percent identity 100 in 176
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69916"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69916"
FT                   /db_xref="GOA:Q56225"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="PDB:4HE8"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56225"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69916.1"
FT                   /translation="MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVA
FT                   LDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGIL
FT                   AAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPGKAS
FT                   RAKEAEKREEVAR"
FT   CDS_pept        92898..93185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0094"
FT                   /product="NADH-quinone oxidoreductase chain 11"
FT                   /note="similar to GB:AAA97948.1 percent identity 98 in 95
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69917"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69917"
FT                   /db_xref="GOA:Q56226"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="PDB:4HE8"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56226"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69917.1"
FT                   /translation="MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGF
FT                   ARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFRHRESTAVDDLSELRG"
FT   CDS_pept        93188..95008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0095"
FT                   /product="NADH-quinone oxidoreductase chain 12"
FT                   /note="similar to GB:AAA97949.1 percent identity 100 in 606
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69918"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69918"
FT                   /db_xref="GOA:Q56227"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="PDB:4HE8"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56227"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69918.1"
FT                   /translation="MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGA
FT                   GLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIVTGVGFLIHVYAIGYMGGDPGYSRF
FT                   FAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFIVNR
FT                   IGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPL
FT                   MVWLPDAMAGPTPVSALIHAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYG
FT                   ALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALFHVFTHAFFKALLFLASGSVI
FT                   HALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGG
FT                   VGFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGY
FT                   LALPHPLPNVLEPFLKPALAEVEAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVF
FT                   PAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGLLSGYFGLGGAARSLGQ
FT                   GLARLQTGYLRVYALLFVLGALLLLGVMRW"
FT   CDS_pept        95002..96411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0096"
FT                   /product="NADH-quinone oxidoreductase chain 13"
FT                   /note="similar to GB:AAS82250.1 percent identity 99 in 469
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69919"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69919"
FT                   /db_xref="GOA:Q56228"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="PDB:4HE8"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56228"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69919.1"
FT                   /translation="MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPG
FT                   GVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIALTVFLGALVARVEGRFLGLALLMEG
FT                   LLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPMLAAV
FT                   LGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENH
FT                   PSGLADALGTLYKVGVFAFFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDF
FT                   KTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGVYTGGLFLLAGRLYERTGTLE
FT                   IGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSV
FT                   IASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLA
FT                   EAFAKLLGGGA"
FT   CDS_pept        96408..97691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0097"
FT                   /product="NADH-quinone oxidoreductase chain 14"
FT                   /note="similar to GB:AAS82249.1 percent identity 99 in 427
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69920"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69920"
FT                   /db_xref="GOA:Q56229"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="PDB:4HE8"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56229"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69920.1"
FT                   /translation="MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWG
FT                   KPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSGRFEFYLLVLYAALGMHLLASTRHL
FT                   LLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGSLVL
FT                   GAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAA
FT                   LLRVAAPPEALALLVALSVVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQAL
FT                   GFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDPLLGLAFLVAMLSLLGLPPLA
FT                   GFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWAR
FT                   AAVVAAGVLLLALGLLPGLVLPALAAGG"
FT   CDS_pept        97704..99482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0098"
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="similar to EMB:CAC39622.1 percent identity 100 in
FT                   592 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69921"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69921"
FT                   /db_xref="GOA:Q5SM45"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="PDB:1IQ0"
FT                   /db_xref="PDB:1IR4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SM45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69921.1"
FT                   /translation="MLRRALEEAIAQALKEMGVPVRLKVARAPKDKPGDYGVPLFALAK
FT                   ELRKPPQAIAQELKDRLPLPEFVEEAVPVGGYLNFRLRTEALLREALRPKAPFPRRPGV
FT                   VLVEHTSVNPNKELHVGHLRNIALGDAIARILAYAGREVLVLNYIDDTGRQAAETLFAL
FT                   RHYGLTWDGKEKYDHFAGRAYVRLHQDPEYERLQPAIEEVLHALERGELREEVNRILLA
FT                   QMATMHALNARYDLLVWESDIVRAGLLQKALALLEQSPHVFRPREGKYAGALVMDASPV
FT                   IPGLEDPFFVLLRSNGTATYYAKDIAFQFWKMGILEGLRFRPYENPYYPGLRTSAPEGE
FT                   AYTPKAEETINVVDVRQSHPQALVRAALALAGYPALAEKAHHLAYETVLLEGRQMSGRK
FT                   GLAVSVDEVLEEATRRARAIVEEKNPDHPDKEEAARMVALGAIRFSMVKTEPKKQIDFR
FT                   YQEALSFEGDTGPYVQYAHARAHSILRKAGEWGAPDLSQATPYERALALDLLDFEEAVL
FT                   EAAEERTPHVLAQYLLDLAASWNAYYNARENGQPATPVLTAPEGLRELRLSLVQSLQRT
FT                   LATGLDLLGIPAPEVM"
FT   CDS_pept        99487..100533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0099"
FT                   /product="serine protease"
FT                   /note="similar to GB:AAS82247.1 percent identity 98 in 348
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69922"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69922"
FT                   /db_xref="GOA:Q5SM44"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69922.1"
FT                   /translation="MRALLLLALLLTLVLGQRLVAPEEVARAQVIQKALPAVVRVQGSA
FT                   LSPGGEDVVGTGFFVGPSRVVTNYHVIRDLKDLTVRLADGRTFLAERYAVDPGIDLALL
FT                   TVRGARAPGVLAFAQVEARRLPLGMGVVLVGFPYGQGPLASFGILSGVGPLEVPLPDPS
FT                   VGTEVGEYLFTDAPLTVGNSGSPLLNLQGEVVGLVADVIGGPAGIGGIGVAVPGDLVAQ
FT                   SIADLERFGLPQRGWLGASLISLDELPPVLLRAVGLTSTQGAMVDRVEPGSPAARAGLK
FT                   GAQRDTQGRLLALGDVILAVDGVAVKDKADVVRLVAQRRPGDRVRLTLWRDRRRLEVTV
FT                   VLMARPRE"
FT   CDS_pept        100538..101986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0100"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate
FT                   ligase"
FT                   /note="similar to GB:AAS82246.1 percent identity 99 in 482
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69923"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69923"
FT                   /db_xref="GOA:Q5SM43"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69923.1"
FT                   /translation="MPTLKELFALFGKEAPEVPVRGLTLDSRRVEPGFVFVAVPGVPLP
FT                   HRKPLDGHDFVPEALARGAVAVVGERPLALPVPYLQVADGRQALALLARRFHGEPDRKL
FT                   LLVGVTGSKGKSTTASLLHHLLKRAQGGSALLSTVGLRLGEEARPPVGHFTTPEAPEVY
FT                   AFLREAADRGLKSAVLEVSSHALALKRVEGLTFRVGVFVNFYPDDHLDFHGTAEAYFRA
FT                   KALLVERSDLAVLARSLPHFPRLAQRPHLSFGEGGEVYAEGLRETPEGLAFRLHTPWGS
FT                   GEAFLPLLGAYNLENALAASAAALALGVGLEAVLEGLATFPGVPGRMEVVLKAPFRVVI
FT                   DFAHTGKSLEAALKTLRPTTPGRLLLVVGAAGERDPQRRVDIGRVAARLADKTFFTEED
FT                   HRGEDLFAILEAMAQAARAEGGVYELVPDREEAILKAILEARPGDTVLLAGKGHEATLE
FT                   RGQVALPWNEREAALKALRARGLP"
FT   CDS_pept        complement(101955..102572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0101"
FT                   /product="transcriptional repressor, TetR family"
FT                   /note="similar to GB:AAS82245.1 percent identity 98 in 205
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69924"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69924"
FT                   /db_xref="GOA:Q5SM42"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="PDB:3ANG"
FT                   /db_xref="PDB:3ANP"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69924.1"
FT                   /translation="MAVREYQKKRRRERIFRAAMELFRNRGFQETTATEIAKAAHVSRG
FT                   TFFNYYPYKEAVLLDYGSQLLAGLREEVRRLLAQGREPVEVLRHLFRVLAEGTAREKDL
FT                   LLPMFYELLNPDPVRARAAFEALPLGDLIAEILKPLREQGVLRQDFSLERMGRTLADLY
FT                   FLSALRWAAYTPGRDLAEELEKNLRLLLEGMLVREAPAPGGL"
FT   CDS_pept        complement(102578..103081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0102"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82244.1 percent identity 99 in 167
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69925"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69925"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69925.1"
FT                   /translation="MEKALAVLLLPEFSELEAALALEAARRLGLPAYTVAKGRKGTLAL
FT                   AGSVWTPTYAFPAAPQPRALVIPGARRPRERARDPAYLAFLEEVWEGLEAVFVGFNAHL
FT                   FLEEAGRLPEAVAAPSGLGLEARGHRVVASPWHREGRVYTTRGGLYLLEALGAWMGRPI
FT                   LLVD"
FT   CDS_pept        complement(103082..103936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0103"
FT                   /product="putative oxidoreductase"
FT                   /note="similar to GB:AAS82243.1 percent identity 100 in 284
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69926"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69926"
FT                   /db_xref="GOA:Q5SM40"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69926.1"
FT                   /translation="METAITRMLGIRYPIVAAPMFLVSNAPLLQAVAEAGGIGVIPSLN
FT                   FRTHQAFREFLESFPEGVPFGVNLILKGNPRLEEDLEAVVERRVPLVVTSLGDPTRVVE
FT                   RVKAYGGVVWCDVVGLRHGRKAVEAGADALVAVACGAGGHAGRVSPFVLGPWLREELGV
FT                   PVLIAGGIATGRQVLAALALGDGVYIGTRFIATLESGAPLEYKEALLRAQPEDIEYTPE
FT                   VTGVPANFLRESLERFRQGGGKAWKEVYSAGHGVAFIREIPSAKEVVARLVEEYRAAKA
FT                   GLP"
FT   CDS_pept        complement(104002..104319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82242.1 percent identity 100 in 105
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69927"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69927"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="PDB:1V70"
FT                   /db_xref="PDB:2DCT"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69927.1"
FT                   /translation="MEIKDLKRLARYNPEKMAKIPVFQSERMLYDLYALLPGQAQKVHV
FT                   HEGSDKVYYALEGEVVVRVGEEEALLAPGMAAFAPAGAPHGVRNESASPALLLVVTAPR
FT                   P"
FT   tRNA            104375..104451
FT                   /gene="tRNA-Pro-1"
FT                   /product="tRNA-Pro"
FT                   /note="anticodon: GGG"
FT   CDS_pept        104416..104943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82241.1 percent identity 97 in 175
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69928"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69928"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69928.1"
FT                   /translation="MGSSVQIRPPRPARRARPKGRAFCYPLGVRLLLLLALLPACAGQG
FT                   ADPVLEALNRIRAEGRTCGGVYHPAAPPLAWDARLTAAARAHTEDMAAHGFLGHVGTDG
FT                   STVRERVEREGYLWSALGENVAYGPAQAEAALRAWAESPGHCANLMDPRFVHAGLWGRE
FT                   GYWTLVLGRPRP"
FT   CDS_pept        complement(104998..105660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0106"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /note="similar to GB:AAS82240.1 percent identity 99 in 220
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69929"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69929"
FT                   /db_xref="GOA:Q5SM37"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69929.1"
FT                   /translation="MGPVRFAPSILTADLARLGEAIREAEAAGVDWIHLDVMDGVFVPN
FT                   LTFGPLLVEAVRRVTSLPLDVHLMIVKPERYLEDFAQAGADHITVHFEATYHPHRAVQK
FT                   VKELGKKAGLAVNPGTPLEAFEPLLPDLDLALLMSVNPGFGGQRYLPTATERLRRLKAM
FT                   RDRLNPACLIVVDGGINRDTVAEARRAGADVAVAGSALFNDKPVAENLKALRLALLG"
FT   CDS_pept        complement(105660..106085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0107"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82239.1 percent identity 99 in 141
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69930"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69930"
FT                   /db_xref="GOA:Q5SM36"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69930.1"
FT                   /translation="MGEAFRKAEAAIYLFAGLLVVLGAVYVLGEALVQGVGLFLGGGGS
FT                   KVAVFLLDRVLLALMMAEILYTLVRFAREGQLQVEPFLVIGLIAGVRRILVVTAEGLQK
FT                   FSFSLQDPGFQAVLAELLLLSLMVLTLAWAYRLVRGV"
FT   CDS_pept        complement(106140..108095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0108"
FT                   /product="transketolase"
FT                   /note="similar to GB:AAS82238.1 percent identity 99 in 651
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69931"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69931"
FT                   /db_xref="GOA:Q5SM35"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="PDB:2E6K"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69931.1"
FT                   /translation="MKETRDLETLSVNAIRFLAIDAVEKARSGHPGMPMGMAPLAYLLF
FT                   REVMRHNPLDPDWPDRDRFVLSAGHGSMLLYAVLHLTGYDLPLEELKSFRQWGSKTPGH
FT                   PERGHTPGVEVTTGPLGQGISTAVGLALAERKLAAEFNRPGHVVVDHYTYVLASDGDLM
FT                   EGVSGEAASLAGHWGLSKLIVFWDDNRISIDGPTDLAFTEDVLARYRAYGWQTLRVEDV
FT                   NDLEALRKAIKLAKLDERPTLIAVRSHIGFGSPKQDSAKAHGEPLGPEAVEATRRNLGW
FT                   PYPPFVVPEEVYRHMDMREKGRAWQEAWEKALEAYARAYPDLHQELMRRLRGELPPLPE
FT                   EPPSFDKPIATRAASGRALNLLAPRLPELLGGSADLTPSNNTKAEGMEDFSRANPLGRY
FT                   LHFGVREHAMGAILNGLNLHGGYRAYGGTFLVFSDYMRPAIRLAALMGVPTVFVFTHDS
FT                   IALGEDGPTHQPVEHLMSLRAMPNLFVIRPADAYETFYAWLVALRRKEGPTALVLTRQA
FT                   VPLLSPEKARGLLRGGYVLEDVEEPQGVLVATGSEVHLALRAQALLREKGVRVRVVSLP
FT                   SFELFAAQPEAYRKEVLPPGLPVVAVEAGASLGWERYAHKVVALDRFGASAPYPEVYER
FT                   LGFTPERVAEAFLSLV"
FT   tRNA            108195..108271
FT                   /gene="tRNA-Arg-1"
FT                   /product="tRNA-Arg"
FT                   /note="anticodon: CCT"
FT   CDS_pept        complement(108345..109898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0109"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="similar to EMB:CAA65745.1 percent identity 100 in
FT                   510 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69932"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69932"
FT                   /db_xref="GOA:Q5SM34"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69932.1"
FT                   /translation="MGPERQSMEFKDFPLKPEILEALHGRGLTTPTPIQAAALPLALEG
FT                   KDLIGQARTGTGKTLAFALPIAERLAPSQERGRKPRALVLTPTRELALQVASELTAVAP
FT                   HLKVVAVYGGTGYGKQKEALLRGADAVVATPGRALDYLRQGVLDLSRVEVAVLDEADEM
FT                   LSMGFEEEVEALLSATPPSRQTLLFSATLPSWAKRLAERYMKNPVLINVIKDEPVTYEE
FT                   EAVPAPVRGRLEVLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHLAQALHGDLSQ
FT                   GERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHRSGRTGRAG
FT                   RGGRVVLLYGPRERRDVEALERAVGRRFKRVNPPTPEEVLEAKWRHLLARLARVPEKDY
FT                   RLHLDFAGRLFSEGRVEVVAALLALLLGGAPKEKSLLTGEEGWRTYKATGPRLSLPRLV
FT                   ALLKGQGLEVGKIAEAEGGLYVDLRPEARPEVAGLRLEPARRVEGLLEIPSRTRRPARA
FT                   "
FT   CDS_pept        complement(109949..111160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0110"
FT                   /product="molybdopterin biosynthesis MoeA"
FT                   /note="similar to GB:AAS82236.1 percent identity 99 in 403
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69933"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69933"
FT                   /db_xref="GOA:Q5SM33"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69933.1"
FT                   /translation="MRTNLSVEEALEAVLEAAQGELAVEELPLKEAFGRVLAEDLASLV
FT                   DHPDQDDTAIDGYACRAEDTLGASPEAPVRLRVVGEAPAGRPFPGEVGRGEAVAVYTGA
FT                   PIPKGADAVVRVEDTRREGDEVLLFAPASPKDIRPKGDDLRRGEVYLRRGDLLTPGRLG
FT                   LAAAMGHPRLKVFRKPRVGILSTGDEVVEPGEPLPFGGVYNSNAYSLLGLVLEAGGEPV
FT                   LLGKVPDQPEAVLERLEGAGPLDLLLTSGGVSMGEYDVVRKVLERHGEVVFWKVRQQPG
FT                   GPLLFARLGGLPVLGLPGNPVSSMVTFFLYGRPFLYKLLQRTEPPYGRLEARALTPFKG
FT                   AKGKKVFRRGVLSVAEKTVRSTGNQSSGVLRSMAFGNALVVLPPDRDAREGEEVEVIPL
FT                   TFVP"
FT   CDS_pept        complement(111167..112300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82235.1 percent identity 99 in 377
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69934"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69934"
FT                   /db_xref="GOA:Q5SM32"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69934.1"
FT                   /translation="MRAPVYRFLLAGFLWSFGANLVYFFLNFHLEALGFSRQAIGLAQA
FT                   VVLLSGVAFAWPLARLIPRVGYVRSLELAFLLGVGGGVLLGLGLFVFPGLALYGLAGAL
FT                   VQGAAAPLLARLVPEERRVAFFSLQAALTTASGFFSTLLAGYLSDLLGARWVLLFALPF
FT                   FALAYPLVRGLPRGGGEGKPFRFRGRFRAWLRLLLPQVVIGFGAGLVIPFLNLFLKEKF
FT                   GLSYGTTGLLFALSSLATGAAMLLQPFLAGRLGRLGAIVFVQALSLPFLAALAWAPWLP
FT                   LVTLALLIRGALMNAAGPVYAALVMDYLTEEERPGFFLLESALWSLLFALGSALSGAVQ
FT                   EALGLKAFDLLFGGTLALYALGILLWPWAFRGLERVD"
FT   CDS_pept        complement(112318..112980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0112"
FT                   /product="endonuclease III"
FT                   /note="similar to GB:AAS82234.1 percent identity 99 in 220
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69935"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69935"
FT                   /db_xref="GOA:Q5SM31"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69935.1"
FT                   /translation="MGGVACPKEGPKEKKARAREVLKALKAAYPGARTELRHENPFQLL
FT                   VATVLSAQATDKSVNEATPALFARFPDAKALAEATPEEVEPYIRRIGLYRTKAKNLVAL
FT                   ARRLVEEYGGEVPKEKEALMRLPGVGWKTATVVLGAAFGVPGIAVDTHVARLARRLCFS
FT                   EAKAPERIGKDLEALFPKEDWVFVHHALVLHGRYVCTARRPRCRACVLAPYCPSREA"
FT   CDS_pept        112995..113360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82233.1 percent identity 99 in 121
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69936"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69936"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="PDB:1WK2"
FT                   /db_xref="PDB:2DP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69936.1"
FT                   /translation="MERPKLGLIVREPYASLIVDGRKVWEIRRRKTRHRGPLGIVSGGR
FT                   LIGQADLVGVEGPFSVEELLAHQEKHLAEEAFLRAYAKDEPLYAWVLENAFRYEKPLHV
FT                   PRRPGRVMFVDLSEVRW"
FT   CDS_pept        complement(113326..115083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0114"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="similar to GB:AAS82232.1 percent identity 99 in 578
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69937"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69937"
FT                   /db_xref="GOA:Q5SM29"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69937.1"
FT                   /translation="MGYHGGTMRVLGRRIYWRWYGEVLLEGGVTLRMTGDVAKWLRPGD
FT                   RVRLRTEFKKPVLGFDEYALEAAFPLWPPFAKTLEHVRESPFGGEAYRYRLKVREATYE
FT                   GDYEAIAELEQFHYASEKEVVALWVCTQCQKTLPANARPLCDCGGEARLKEIRGSTPAS
FT                   RFLVLELAERLPFEPRILGYLRLDPPIPRMHRRTPEGVERDIRERIFPRDWFHPTYEGG
FT                   ADWQRALDRVNTAAARIARVVVHPDYRSEGFGALLVRVALEWAKERGAPEARREKHLVY
FT                   TIAQMARYHPFFEKVGFRYLFDTASGRPVLFYPLTEEAEAHLERFLREDPYAKAHGGRL
FT                   YKPRFGRVPGLPGPIRLRGVHKAYRSHLDLEGLSREVQEALLAFGVKARVVERAVLRGA
FT                   SLEIPPGSLVVLAGASGAGKTTLLRLLLGEAPDAGEVAVPPGRRVAYIPGEREVDLGED
FT                   PILEAVYRRLKDVGAAIEVLNRVGLSDAVLYRARPHELSTGQRERFRLALLLAERPDLL
FT                   LIDEFAAHLDVPTARRVALGLGKLCREAGVTLVAATHRPEVVAALDPDLLVYVGYGGLT
FT                   TVPRRGPRT"
FT   CDS_pept        complement(115132..116565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0115"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="similar to GB:AAK62359.1 percent identity 100 in 477
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69938"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69938"
FT                   /db_xref="GOA:Q5SM28"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="PDB:1H4Q"
FT                   /db_xref="PDB:1H4S"
FT                   /db_xref="PDB:1H4T"
FT                   /db_xref="PDB:1HC7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SM28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69938.1"
FT                   /translation="MAKEKGLTPQSQDFSEWYLEVIQKAELADYGPVRGTIVVRPYGYA
FT                   IWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEHVEGFSPELAVVTHAGGEELEE
FT                   PLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTRPFLRTSEFLWQEGHT
FT                   AHATREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDGK
FT                   ALQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVL
FT                   PPRLAPIQVVIVPIYKDESRERVLEAAQGLRQALLAQGLRVHLDDRDQHTPGYKFHEWE
FT                   LKGVPFRVELGPKDLEGGQAVLASRLGGKETLPLAALPEALPGKLDAFHEELYRRALAF
FT                   REDHTRKVDTYEAFKEAVQEGFALAFHCGDKACERLIQEETTATTRCVPFEAEPEEGFC
FT                   VRCGRPSAYGKRVVFAKAY"
FT   CDS_pept        116598..117818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0116"
FT                   /product="phosphonopyruvate decarboxylase"
FT                   /note="similar to GB:AAS82230.1 percent identity 98 in 406
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69939"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69939"
FT                   /db_xref="GOA:Q5SM27"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SM27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69939.1"
FT                   /translation="MDLFPVLKELAQKTPSKILLIVLDGVGGLPLEPGGPTELEAAKTP
FT                   NLDRLAEESALGLLTPVYPGLAPGSGPGHLALFGYDPFRYVVGRGALSALGLGADFREG
FT                   DVALRGNFATLDPEGKVVDRRAGRPPTEENQRVIAKLKEAIPRIEDVEVLFYTESEHRF
FT                   LVILRGEGLEDKVTDTDPQKTGLPPLKAKALDEASERTARLVNLLSERIREVLKDEPRM
FT                   NGALFRGASKKPSFPRMQEVYKLTPAAIASYPMYKGLASLVGMEVLPVEGEGDALEGKL
FT                   KALKENWGRYDFFYFHVKKTDAMGEDGNFHGKVEKVELFDALLPEILALGPDVLAITGD
FT                   HSTPALLKAHSWHPVPLLLKAPYLRADEARRFTEREAQRGSLGHLRGVELMPLLLAHAG
FT                   KLLKYGA"
FT   CDS_pept        117828..118376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82229.1 percent identity 97 in 182
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69940"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69940"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69940.1"
FT                   /translation="MIRHRLSLEEFQALLEKAPEGLRLELLDGEVYEMAPIGSGHASLV
FT                   TYLAKQLERLYGDRALVYVQNPLRLSPHSLPQPDLALLRPREDFYRERLPEAGDTLLVV
FT                   EVSFSPREMDLKKLALYAQGGVPEVWLVEEGGSLEVYREPRGTRYRHRLLVEPGEEVAP
FT                   LLLSHPPLLWDPPRGTPPA"
FT   CDS_pept        complement(118354..119328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0118"
FT                   /product="exopolyphosphatase family protein"
FT                   /note="similar to GB:AAS82228.1 percent identity 99 in 324
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69941"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69941"
FT                   /db_xref="GOA:Q5SM25"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SM25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69941.1"
FT                   /translation="MDGNAPEPRYWEKMRLVAEVLKAVEGPIYIATHVDPDGDAIGSSL
FT                   GLYRALKALGKEAYWVADPPRFLRFLPKEEEYSDPVEKLPPGATLVALDSAEPSRVVGV
FT                   PVEGFVINIDHHGTNPRFGHLHVVDPSKAATAQMVKDLIDLLGVEWTAEIATPVLTGIL
FT                   TDTGNFRFANTTPEVLRVAAELLGYGVKLAELTDRLQFRPPSYFRLMGQVLSTVAFHFG
FT                   GLLVTAHLPEDAGAEEDSDDFVGLIRYVEGSVVSVFLRKREEGVKVSIRSRGGVSAQNI
FT                   ALKLGGGGHVPAAGATLKGLDLDQAYERVLEAVREELTRAGYL"
FT   tRNA            complement(119407..119483)
FT                   /gene="tRNA-Ile"
FT                   /product="tRNA-Ile"
FT                   /note="anticodon: GAT"
FT   CDS_pept        complement(119525..120412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0119"
FT                   /product="putative acetyltransferase"
FT                   /note="similar to GB:AAS82217.1 percent identity 100 in 295
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69942"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69942"
FT                   /db_xref="GOA:Q5SM24"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69942.1"
FT                   /translation="MPWLLPREIAPLHQKALDRYLGSLTERLSDPNVDRNALVREELAR
FT                   LLYGRPYEELLEANPLAAMGLDPEGITFEAEYYAATDLEKFRRVKPLLWFWKVLDLTPL
FT                   GQSVHSGVAIRRALAPFIFKRVGKNPKFFQNVEFSVGYNLELGDDVVVHRYVFLDDIGG
FT                   IKIGDRTSLSDYVNVYSHTHHVLASPDVTLKETIIGSGVRITYHATVLAGVRIGDDAMV
FT                   GTGAVVTKDIPPHAIALGIPARPVRYKVRHDCPYCRKGEPHPSDLVPKLPDRKGNPDYP
FT                   DFLPPGFGTREAGS"
FT   CDS_pept        complement(120457..121362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0120"
FT                   /product="GTP-binding protein Era"
FT                   /note="similar to GB:AAS82216.1 percent identity 100 in 301
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69943"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69943"
FT                   /db_xref="GOA:Q5SM23"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="PDB:1WF3"
FT                   /db_xref="PDB:1X18"
FT                   /db_xref="PDB:1X1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SM23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69943.1"
FT                   /translation="MAEKTYSGFVAIVGKPNVGKSTLLNNLLGVKVAPISPRPQTTRKR
FT                   LRGILTEGRRQIVFVDTPGLHKPMDALGEFMDQEVYEALADVNAVVWVVDLRHPPTPED
FT                   ELVARALKPLVGKVPILLVGNKLDAAKYPEEAMKAYHELLPEAEPRMLSALDERQVAEL
FT                   KADLLALMPEGPFFYPEDYAKSDQTFGEWVAEILREEAMKRLWHEVPYAVATKVEEVAE
FT                   RENGVLYIKAILYVERPSQKAIVIGEGGRKIKEIGQATRKQLEALLGKKVYLDLEVKVY
FT                   PDWRKDPEALRELGYRSSVG"
FT   CDS_pept        121447..122451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0121"
FT                   /product="competence protein DprA (SMF protein (DNA
FT                   processing chain A))"
FT                   /note="similar to GB:AAL37758.1 percent identity 98 in 334
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69944"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69944"
FT                   /db_xref="GOA:Q5SM22"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69944.1"
FT                   /translation="MDPLALALLPGIGPKRLLEVLKAEDPLGFLRERFPEAWRHLPEAE
FT                   AQAERERGRAEALGVRLLGLWEEGFPEGLRALPQPPTHLYLKGELPPEREAVALVGTRR
FT                   ASPWALAFARRLARELAEAGLWVVSGLARGIDREAHLGALEAGGRTLGVLGSALDRVYP
FT                   PENRPLAQRMDLLSEFPFGTGPKPEFFPRRNRLIAGLCRAVVVVEAPLDSGALITARHA
FT                   LELGKEVLAVPGRPTDERSLGANRLIQDGAYPVLSAEDVLSYLGMSARPKPLPGLSPEE
FT                   EALYALLQEKKEALPEALAMALGIPPERVLSLLTLLELKGLARALPGGRYGPG"
FT   CDS_pept        complement(122455..123363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0122"
FT                   /product="manganese-containing pseudocatalase"
FT                   /note="similar to GB:AAS82214.1 percent identity 99 in 302
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69945"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69945"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="PDB:2CWL"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69945.1"
FT                   /translation="MFLRIDRLQIELPMPKEQDPNAAAAVQALLGGRFGEMSTLMNYMY
FT                   QSFNFRGKKALKPYYDLIANIATEELGHIELVAATINSLLAKNPGKDLEEGVDPESAPL
FT                   GFAKDVRNAAHFIAGGANSLVMGAMGEHWNGEYVFTSGNLILDLLHNFFLEVAARTHKL
FT                   RVYEMTDNPVAREMIGYLLVRGGVHAAAYGKALESLTGVEMTKMLPIPKIDNSKIPEAK
FT                   KYMDLGFHRNLYRFSPEDYRDLGLIWKGASPEDGTEVVVVDGPPTGGPVFDAGHDAAEF
FT                   APEFHPGELYEIAKKLYEKAK"
FT   CDS_pept        123473..124426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0123"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="similar to GB:AAS82213.1 percent identity 97 in 317
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69946"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69946"
FT                   /db_xref="GOA:Q5SM20"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69946.1"
FT                   /translation="MKLTLDQLRYLVALAEEGSFTRAAERVYLTQPALSVQIRKLEEAL
FT                   GTRLFDRRKGTLTEAGRVAVAQARRVLEEVERLRLLVQGEEACFQGPFRLGVIPTLAPY
FT                   LLPRLLPELKARYPRLSLSVREELTPGIVRGLEEGSLDAGLVGTEERHPGLGAEPLFAE
FT                   AFWAYVAPGHPLFEREAVHPLEIPLEDTWVLAEGHCFRDQVLSVCRPSLGGRSVEFQSG
FT                   DLETLVRLVDAVGGLTLLPEVALWTLSPAQRTRLRPLSPPGAGRTVYLLFREGSLKAPL
FT                   LRALAEEARRAFALLRSNARAQESAMMGAEVRHDQG"
FT   CDS_pept        124443..125369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0124"
FT                   /product="branched-chain amino acid aminotransferase
FT                   (IlvE)"
FT                   /note="similar to GB:AAS82212.1 percent identity 99 in 308
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69947"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69947"
FT                   /db_xref="GOA:Q5SM19"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="PDB:1WRV"
FT                   /db_xref="PDB:2EIY"
FT                   /db_xref="PDB:2EJ0"
FT                   /db_xref="PDB:2EJ2"
FT                   /db_xref="PDB:2EJ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69947.1"
FT                   /translation="MQIKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETA
FT                   KGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGA
FT                   KALGVNPLPNNPAEVMVAAWEWGAYLGEEAVRKGARLITSSWARFPANVMPGKAKVGGN
FT                   YVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALEHSVNLEGITRD
FT                   SVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVAL
FT                   RLREVYLEAVTGRRPEYEGWLTYVNGQ"
FT   CDS_pept        125359..125547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0125"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82211.1 percent identity 100 in 62
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69948"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69948"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69948.1"
FT                   /translation="MGNRRLRKSVESYQARIREHQAKIEEELRRPEPRWELIRYWEKEI
FT                   RTYPGRVERLLRRMGRR"
FT   CDS_pept        125549..125788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0126"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82210.1 percent identity 100 in 79
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69949"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69949"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69949.1"
FT                   /translation="MPKTEARKRVRKERLREVLEVLLDELEEASRAFQSAWKRAKENPE
FT                   DEEAWGELQVWVSVLGVKAKSLEELLEEEAFLTS"
FT   CDS_pept        complement(125778..126362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0127"
FT                   /product="tRNA (guanosine-2'-O-) methyltransferase"
FT                   /note="similar to GB:AAS82209.1 percent identity 100 in 194
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69950"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69950"
FT                   /db_xref="GOA:Q5SM16"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="PDB:1V2X"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SM16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69950.1"
FT                   /translation="MRERTEARRRRIEEVLRRRQPDLTVLLENVHKPHNLSAILRTCDA
FT                   VGVLEAHAVNPTGGVPTFNETSGGSHKWVYLRVHPDLHEAFRFLKERGFTVYATALRED
FT                   ARDFREVDYTKPTAVLFGAEKWGVSEEALALADGAIKIPMLGMVQSLNVSVAAAVILFE
FT                   AQRQRLKAGLYDRPRLDPELYQKVLADWLRK"
FT   CDS_pept        complement(126359..126979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0128"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /note="similar to GB:AAS82208.1 percent identity 100 in 206
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69951"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69951"
FT                   /db_xref="GOA:Q5SM15"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SM15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69951.1"
FT                   /translation="MRRFALTVALPKGRMFREAYEVLKRAGLDLPEVEGERTLLHGKEG
FT                   GVALLELRNKDVPIYVDLGIAEIGVVGKDVLLDSGRDLFEPVDLGFGACRLSLIRRPGD
FT                   TGPIRRVATKYPNFTARLLKERGWAADVVELSGNIELAAVTGLADAVVDVVQTGATLRA
FT                   AGLVEVEVLAHSTARLVVNRQALKLKRAVLKPLIQRLRELSGS"
FT   CDS_pept        complement(126976..128061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0129"
FT                   /product="alternative histidyl-tRNA synthetase"
FT                   /note="similar to GB:AAS82207.1 percent identity 100 in 361
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69952"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69952"
FT                   /db_xref="GOA:Q5SM14"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SM14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69952.1"
FT                   /translation="MIPEGTRFLLPPEARLKAEVVGKLQHLFRRHGYEPVELPALELYD
FT                   PDHPLAERAFKLVDKTGEVLALRSEFTTLLAKLLRAHLGEGAHRFQYAGPLWLREADAE
FT                   LGRLREYTQVGLELLGATGPLADAEVLELAFAALEALGVQGEVEVGLPSLVGEVLKASG
FT                   LPEALQRRAQQAIHRKNLPELKGLLAESPVPEEARKVLLALPDLYGGREVLKEARGLPL
FT                   PPKAQEALAQLERTLDLLGRPVLLDLGMARRYEYYSGIFFRAYTPGFGLPLLGGGRYDG
FT                   ALFPKAAGFALGVERLLEALRLPKEEEPPEVLALDLKALRRFARERRTELFHGEDPVAY
FT                   ARRRGIPFLARGEELFRVEEA"
FT   CDS_pept        complement(128065..128610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0130"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="similar to GB:AAS82206.1 percent identity 100 in 181
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69953"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69953"
FT                   /db_xref="GOA:Q5SM13"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69953.1"
FT                   /translation="MVKPDWWIREMARKGMIEPFEERLVREGVISYGLSSFGYDLRAAP
FT                   EWKIFTNVFSSLVDPKNFDPKSFVEYEGEEVVIPPNSFALTRSLEYIRMPDNVIAIALG
FT                   KSTYARCGIVVNVTPLEPGWEGHVTLEISNTTPLPAKVYAGEGIVQLLFLEGPRPEVTY
FT                   RDRKGKYQGQKGITLPRV"
FT   CDS_pept        128641..129525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82205.1 percent identity 98 in 293
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69954"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69954"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69954.1"
FT                   /translation="MRKLWPLALLLAACGAQDVGAGLDPLRLTATSLPPAYLGEPYSAS
FT                   LAAEGGVRPYSFTLDGKLPEGLSFQGGRLFGVPKEKGSFPLLLTVEDAAKNSRAQRLTL
FT                   TVSDPPPPRLALVLPPAQVEGPFLLLARVEGREAVGFQMEVRLADLEPDLAGLKALSPA
FT                   HLLDYDPATRLLRLDMAFAKPVKDREAFRFLLTPQKPLVPRLSPKVVFYDKEGKPLGQP
FT                   LPRGKPFAELLRLAQAWGREGKALKEDLDGDGKVGEADLRLLAQGYFPKPETPSPEVPG
FT                   GGEGQASGEEQAP"
FT   CDS_pept        complement(129522..130001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82204.1 percent identity 100 in 159
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69955"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69955"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="PDB:2DX6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69955.1"
FT                   /translation="MARIRVVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSI
FT                   QEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELG
FT                   LKTVAFPLLGTGVGGLPVEAVARVMLEEIKKAPDTLEVTLYGYREEDAEAIRRAL"
FT   CDS_pept        130031..130738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0133"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="similar to GB:AAS82203.1 percent identity 100 in 235
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69956"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69956"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69956.1"
FT                   /translation="MSRDLLGLEGKIVMVTGAGRGFGRAIAHGYGRNGATVIAVDPDVE
FT                   LATGVASEVEALGATAIPIRGDMSVVLDVTSTFEKVEELFGLLDGIVHVTTAESKTPFV
FT                   ELLEGEWYDLMSQDVKSSLYVLQQGLRHLAGGGFVTIVLPPAARIEPHTVSVRKAVEGL
FT                   IEGATRTFPGVRVNGVVPSRDPVGDPYDLPLVRAALGLGSMVSEGIRGVVLEVQLPEPP
FT                   LEFEPYAALRELP"
FT   CDS_pept        130735..131196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0134"
FT                   /product="ATP-cone domain protein"
FT                   /note="similar to GB:AAS82202.1 percent identity 100 in 153
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69957"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69957"
FT                   /db_xref="GOA:Q5SM09"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SM09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69957.1"
FT                   /translation="MKCPYCGHPDTRVVDSRPSDEGMAIRRRRECPSCGRRFTTYERTQ
FT                   LEPLMVVKRDGRKEPFNPDKLLRGLLLACEKRPVSEEVLRRFAYTFEDQVSGPEITSEE
FT                   IGLKALAFLKELDHVAYIRFASVYREFDSVERFIEEIRSLASLDKKEGD"
FT   rRNA            131300..132803
FT                   /gene="16Sa"
FT                   /product="16S ribosomal RNA"
FT   CDS_pept        132909..133373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0135"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to GB:AAS82201.1 percent identity 98 in 154
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69958"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69958"
FT                   /db_xref="GOA:Q5SM08"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69958.1"
FT                   /translation="MRRKRKGQRPTRRVVSAGGVVLKGDPPEVLVVSLRGGRVVTLPKG
FT                   QVEPGERYPETAVREVREETGVEASVLAPLGRVRYYFTVHEPEGPVTVSKEVHYFLMRH
FT                   LGGTPRPQLTEVEDAFFLPASEALERLSYPNEREMLKRALLRLRARAKKG"
FT   CDS_pept        complement(133326..134273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0136"
FT                   /product="LAO/AO transport system kinase"
FT                   /note="similar to GB:AAS82200.1 percent identity 99 in 315
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69959"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69959"
FT                   /db_xref="GOA:Q5SM07"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69959.1"
FT                   /translation="MSIPEELWRRFQEGDPRALARALTLVESGHPAGRELLKRVRGKGR
FT                   AKVVGVTGSPGAGKSTLTDRLILEARKRGERVAVLAVDPSSPFSGGAILGDRIRMMRHH
FT                   QDPGVYIRSMASRGALGGLAGATVAALSLLEAFGFDRIFVETVGVGQSEVDIARVADTT
FT                   LLVLTPAAGDAVQAFKAGVMEIADVFAVNKFDLPGGERIVQELKSALELSPPRPGGWRP
FT                   PIHPTVAASGEGVEALFESLEAHHRHLVEHGLLEAHRLERARFEVESVIQEWGRQRTQG
FT                   AGALVARVARGELTPEEAALALLGPGPEAEEGAL"
FT   CDS_pept        complement(134319..134693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0137"
FT                   /product="protein translation intiation inhibitor"
FT                   /note="similar to GB:AAS82199.1 percent identity 100 in 124
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69960"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69960"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="PDB:2CSL"
FT                   /db_xref="PDB:2CVL"
FT                   /db_xref="PDB:2CW4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69960.1"
FT                   /translation="MEAVKTDRAPAAIGPYAQAVKAGGFVFVSGQIPLAPDGSLVEGDI
FT                   RVQTERVMENLKAVLEAAGSGLSRVVQTTCFLADMEDFPGFNEVYARYFTPPYPARATV
FT                   AVKALPRGVRVEVACVALAE"
FT   CDS_pept        complement(134698..136518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0138"
FT                   /product="serine/threonine protein kinase"
FT                   /note="similar to GB:AAS82198.1 percent identity 99 in 606
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69961"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69961"
FT                   /db_xref="GOA:Q5SM05"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69961.1"
FT                   /translation="MAPVVLAGRYRLEAPLGSGGMAEVWRAVDERLGRKVAVKLLHPRA
FT                   LPPERERFLLEVRALSRLFHPGIVQVLDLGEEEGRPFFVMELVEGGTFDRLGPFEEGPE
FT                   GDAILRGAEEVMEALAHLHAQGILHRDLTPKNILLTREGHPKVMDFGLAYLLQESRHLT
FT                   RTGYTLGTPTYMAPEQAKGLPLTPKADLYSFGAVLYRTLTGRPPFEGENDQAILFQHVY
FT                   EEPKPPEALNPAVPRAVGEAVLALLAKHPEERPSHPGLFRGVLAGFQALRLATPRAGAS
FT                   RSGHYPFAPEPRRLALKGRVDLGGEAAWPGEMVYAGGRVFLGVGRSLVAVDLLTGEVAR
FT                   VALPDEVTAPPVVRKGGVYVGAWDGRVRRFRGQSLEWSAETGAEVTAACLVVGERVYVG
FT                   SRDGTLYAYEKDRPLFRFRAGGHLSASPTFYRGMVFVGSEDGWLYALDPKDGGVRYKVR
FT                   TGPVHAPVAGYKGVLYIPTWQGEVYAFDPLSRETLWSVALEGEIWGGLAVGEEHVYVAG
FT                   WDGVLRALDRLTGEEVWSLEVGKTTAGLAYAQGHVYAATEEGRLLAVDRRGQVVFEASG
FT                   LGPVQVPPLPLPEEVLVVSLSGRLYRFGVG"
FT   CDS_pept        complement(136528..136761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82197.1 percent identity 100 in 76
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69962"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69962"
FT                   /db_xref="PDB:5YTP"
FT                   /db_xref="PDB:5YTQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69962.1"
FT                   /translation="MAKKEKKRLQVVISEEQDALLTRAAYALSSPERLVSKSEVVRLAI
FT                   EKIARELEEGKAKEELEALLKHLKAEEGEEEA"
FT   CDS_pept        136879..138156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0140"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="similar to GB:AAS82196.1 percent identity 99 in 425
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69963"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69963"
FT                   /db_xref="GOA:Q5SM03"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SM03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69963.1"
FT                   /translation="MGVSRVLHVEGGTPLKGELRVYPAKNAALPILAASLLTPEPITLV
FT                   EVPRLRDVEVMLELLAHLGTQYAWEGRTLHLQTPEIKSTHAPYELVGQMRASFIVWGAL
FT                   LARAGEGHVSMPGGCAFGFRPVDQHIKALEALGAEVWEEDGTFHARRTRPLSGRVVFDL
FT                   PTVGGTEQAMLAVALGGEATLVQAAVEPEVVDLGHFLALLGAEVEGLGSPIVRIKGAPR
FT                   LKGGTYRIIPDRIEAGTYLLAAAATRGSLTLEGVRPDHLDALLDKLWRSGHRLEVGEDW
FT                   IRFRATPDPAPFHVEAREYPGFPTDLQPIATAYLATVPGQSTVVDRIYPDRFTHVGELA
FT                   RMGAELYLRDRILTVQGRRLHGAQVKALDIRAGGALVVAALSAEGASEIEGVYFLERGY
FT                   EHLTERLQALGARVHLRESPVALAAD"
FT   CDS_pept        complement(138178..138621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0141"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82195.1 percent identity 100 in 147
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69964"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69964"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69964.1"
FT                   /translation="MNVERWAQALKEEYPRGLLGEREALVSLLVGKGLSHAEAVEVARA
FT                   LEAQGYAHFLPGERPRWFFSSRSLDLKALMRALDQEFPEFVGEGDEEEEALAFLAARLG
FT                   DREVAREVLEAMRAAGYVERAYSPELARDRLFFRFPEALRLLG"
FT   CDS_pept        138665..139801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0142"
FT                   /product="peptide chain release factor 2"
FT                   /note="similar to GB:AAS82194.1 percent identity 99 in 378
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69965"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69965"
FT                   /db_xref="GOA:Q5SM01"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="PDB:2IHR"
FT                   /db_xref="PDB:4V4S"
FT                   /db_xref="PDB:4V5E"
FT                   /db_xref="PDB:4V5J"
FT                   /db_xref="PDB:5MDY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SM01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69965.1"
FT                   /translation="MRLASQSAILVKVWTWNASRNAWKASGGIFDIPQKETRLKELERR
FT                   LEDPSLWNDPEAARKVSQEAARLRRTVDTFRSLESDLQGLLELMEELPAEEREALKPEL
FT                   EEAAKKLDELYHQTLLNFPHAEKNAILTIQPGAGGTEACDWAEMLLRMYTRFAERQGFQ
FT                   VEVVDLTPGPEAGIDYAQILVKGENAYGLLSPEAGVHRLVRPSPFDASGRRHTSFAGVE
FT                   VIPEVDEEVEVVLKPEELRIDVMRASGPGGQGVNTTDSAVRVVHLPTGITVTCQTTRSQ
FT                   IKNKELALKILKARLYELERKKREEELKALRGEVRPIEWGSQIRSYVLDKNYVKDHRTG
FT                   LMRHDPENVLDGDLMDLIWAGLEWKAGRRQGTEEVEAE"
FT   CDS_pept        complement(139806..140468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0143"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="similar to GB:AAS82193.1 percent identity 100 in 220
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69966"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69966"
FT                   /db_xref="GOA:Q5SM00"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SM00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69966.1"
FT                   /translation="MREALDRALNQLLEESLRMLSLVREMTQEATEALVQADRAKAQGV
FT                   VAKDKEVDALELKVENQAIAVIARHQPVASDLRLIFTVIKALTDLERAGDYAMHVAEDA
FT                   LLLAQEPPLKRYVTLPEMGRRLTEMMDALAKAVAERDAALARRVLEMDDQVDGLYEEVT
FT                   RELITYMMEDPRTITKALTLMRVARSYERLGDHLENIAERVIYWLTGEVYKAPEDVY"
FT   CDS_pept        complement(140483..141376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0144"
FT                   /product="sensor histidine kinase"
FT                   /note="similar to GB:AAS82192.1 percent identity 97 in 297
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69967"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69967"
FT                   /db_xref="GOA:Q5SLZ9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69967.1"
FT                   /translation="MSPEAWTLPWEEAREGLVVHRDRQVVYLNPAAAELLAVDREKVRG
FT                   LPLILALRDHRLEALALEGGEAVLEVRGRVLSARARPGLLYLLDVTEARRRGLEAEEAG
FT                   ALLAHEFRTPLAGMAVLLRALAPKDPREAQVLDLLKKEVARLTRLVESLAHLRPGRREA
FT                   FALEDLWLRLSALMQDRLRGRRVEVALGHRVEADPEALLQILLNLLDNALKYGQDPIRL
FT                   LSRVRGGRLYLEVRDRGAPLPDYEGLFQPGRRGGEGSGQGLGLYLVRRLAQGLGGGAYA
FT                   LREGEENVFGVWLPVD"
FT   CDS_pept        complement(141373..142044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0145"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /note="similar to GB:AAS82191.1 percent identity 99 in 223
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69968"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69968"
FT                   /db_xref="GOA:Q5SLZ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69968.1"
FT                   /translation="MATLLLVEDEPSLRLGLRLALEGAGHRVLEAATAQEAWPLLREAE
FT                   LVVLDWMLPDEPGVRLLDRMRQGPYESLPVLMLTARAGVRDRVEGLSRGADDYLVKPFA
FT                   VEELLARLEALLRRAGKRKVLRRGPLLLDLERMEARLEGNPLPLTRREFALLAYLAERP
FT                   GRVCTREELLEAVWGPDYLGTPRTVDQHVLQLREKLGEDPKAPRFLETVRGVGYRFREE
FT                   A"
FT   CDS_pept        complement(142125..143252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0146"
FT                   /product="alanyl-tRNA synthetase-related protein"
FT                   /note="similar to GB:AAS82190.1 percent identity 100 in 375
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69969"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69969"
FT                   /db_xref="GOA:Q5SLZ7"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69969.1"
FT                   /translation="MRLYQLDSYATRFQARVERVWSDEKGHYAVLSQTLFYPESGGQPA
FT                   DRGVLRGPFGEVQVLHAYEEEKAFGDVVHVLSAPIPEGVEVEGEIDWPRRFRHMQRHTA
FT                   QHLLSQALLRAGGYHTVAVSLDSPVCTVDLEEEAEEAGVLEAEALANFAVYADYPVEAF
FT                   YVSEEELARYPLRRPPKVRGKVRLVRIGDFDLAACGGTHLKTSAQAGPIKVLKWERYKG
FT                   GTRVYFMAGWEALEDYHAKHALLARLALAFSTNPLELEKPIRKLQDELYALKGENQALR
FT                   EGLAEALLPRALEEKALLVPLPVLGELGKRLARFEGTFLLVAPEGRFVAVGPRRGEVLE
FT                   RLKALGGRGGGKEAVQGALPPGRAVEALARVRELL"
FT   CDS_pept        143251..143469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0147"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAO09366.1 percent identity 37 in 61
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69970"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69970"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69970.1"
FT                   /translation="MPLRIRRMAPLDREEFARGFSQARRSLASATQDLGRPAFGHALLR
FT                   LAPLRGLNRGRAEAQGTLWWLEGASER"
FT   CDS_pept        143466..144197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0148"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /note="similar to GB:AAS82189.1 percent identity 100 in 243
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69971"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69971"
FT                   /db_xref="GOA:Q5SLZ5"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69971.1"
FT                   /translation="MKGERLDKVLARLGLGSRKEVARLVRQGKVRVLGQVVKDPGFRVP
FT                   EGAALEVEGRPLEVRRHLHVLLHKPPGFVTSRTEGPSVYALLQGFPTRDLSPVGRLDKD
FT                   AEGLLLFTTDGLLLHRLTHPRHKVAKRYLVHLERPVGPKDQEAFREGILLDGKKTLPAE
FT                   LTPLEDPTWAEVVLKEGRFHQIKRMFRARGNRVLRLKRLALGPLELGDLPPGKARPLTE
FT                   AEEKALYAAVGLGGEDPEDEV"
FT   CDS_pept        complement(144165..144509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0149"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82188.1 percent identity 100 in 103
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69972"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69972"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69972.1"
FT                   /translation="MLREWIRGISYQALGEAPVPLEALPLLYEALFRLAEEKGLQVQSL
FT                   DPGEAAPTGGVRAWRVRLLLEGPYAGVLGYLEGLPGLGKPLWVEAYTLEPVGERGERLA
FT                   LDLVLRVLAP"
FT   CDS_pept        complement(144747..145229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0150"
FT                   /product="hypothetical protein"
FT                   /note="similar to PDB:1BKG percent identity 32 in 121 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69973"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69973"
FT                   /db_xref="GOA:Q5SLZ3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69973.1"
FT                   /translation="MRLTKRQRRPPGTQAAASPGQPARPLPESEDPVERARWHAIWLLA
FT                   TGHAIPQVAQTLGYSTCWVRDTLPRHNEGQPPLLPPELWEAFRQALLQPHPQDGIWTIR
FT                   NAALWLSERLGRPVDPRRAWNWRKRLGFAPLRPRHRGGTSSCAQVQERAGSGFCPR"
FT   CDS_pept        complement(145309..145818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0151"
FT                   /product="molybdopterin converting factor, subunit 1
FT                   (moaD)"
FT                   /note="similar to PDB:1BKG percent identity 100 in 168 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69974"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69974"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015272"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR036473"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69974.1"
FT                   /translation="MPKVNLYATFRDLTGKSQLELPGATVGEVLENLVRAYPALKEELF
FT                   EGEGLAERVSVFLEGRDVRYLQGLSTPLSPGATLDLFPPVAGGGFERTFGAFPPWLLER
FT                   YLEEWGGTREGEGVYRLPGAVVRFREVEPLKVGSLSIPQLRVEVEGEEAERWFERIAFA
FT                   ASRGGG"
FT   CDS_pept        complement(145876..147702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0152"
FT                   /product="tungsten-containing aldehyde:ferredoxin
FT                   oxidoreductase"
FT                   /note="similar to GB:AAS82176.1 percent identity 99 in 608
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69975"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69975"
FT                   /db_xref="GOA:Q5SLZ1"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69975.1"
FT                   /translation="MLGGYAHRIARIDLSTGQVEYFAPDPKDLEMYVGGRGLGVKYVFE
FT                   NGPQVDPLGPENLLCIMNGPLSGTRAKMSGRLAVVTKSPLTGTVTDSHMGGWTAAKLKW
FT                   AGFDGLLIKGASEKPVYLLVKDGEVSIHDASDLWGKTTHETCRILRERHGEEADVMAIG
FT                   PAGENLVRFANWINNDERAAGRGGTGAVAGSKKLKAIVVVGTHDKMPQPKDPELWKEAD
FT                   RLASATINDPKNVTAPKKGGLSLYGTNVLMNITNVMGALPTFNAQHTCIEGAEKISGEY
FT                   IREHRLIKDNTCHACPVACKKMVEVHINGKTIRFESYEYESAWALGAHSGHTDTDWTGY
FT                   AIYLCNAYGMDTIEAGNAIAVLMEATEKGYYQGEDGIRFGDKEGEIRVLEAIAYRKGVG
FT                   DMLAEGPARFAKAIGHPEIALEVKGQSIPAYDPRGLKGMGIAYATSNRGACHLRAYTPA
FT                   SEILGVPYKTDPLAWEGKGKLTKLFQDLSAFTDSLDLCKFSQFAEGPEEYAKQLAAYWG
FT                   RPVTPEEILRIGERIYNLERYYNNLAGWGEGSDYLPERFLKEPSDCAGSKGQVTELDRM
FT                   LEEYYRERGWERGVVPPAKLQELGILSQAADD"
FT   CDS_pept        complement(147827..148786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0153"
FT                   /product="NADPH:quinone reductase"
FT                   /note="similar to GB:AAS82175.1 percent identity 99 in 319
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69976"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69976"
FT                   /db_xref="GOA:Q5SLZ0"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69976.1"
FT                   /translation="MRAIRVHEVGGPEVLRLEELPVPEPGPGEVLVRLLAIGVNFIDTY
FT                   KRKGLYPVPAPFTLGEEGAGVVEKVGEGVVGVRPGDRVAFANVQGAYAEYLVVPAERLV
FT                   PVPEGLDPKLAAAALLQGMTVHYLLKSTYPVAPGDQVLVHAGAGGVGQLLIQWAKRLGA
FT                   TVYATASTEEKRGLCLQAGADYALPYEGFAEAVKALSGGGVDVVYDGVGKDTFLGSLAA
FT                   LRPRGMLVLFGQSSGPVPPQDPQILNRMGSLFLTRPTLHHYTASRKELLFRAGEVFRGV
FT                   LEGWLKVRIGAEFPLENAREAHEALEGRRTTGKVLLLP"
FT   CDS_pept        148859..149290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0154"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82174.1 percent identity 96 in 143
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69977"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69977"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69977.1"
FT                   /translation="MAEVNMNAKRMLVWVWLLLAPALGGSLGYGFLGFQGAWQGGGGGF
FT                   GTFQGVALGGESWGGPRGYGGVFLAGAWLPVGPGVFLLPALGLGGESGGFLLDLGVRGF
FT                   WFFREEGGWAFGVGAGYALPLGSSRGGWYVRLAFGGGRP"
FT   CDS_pept        149287..149838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0155"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82173.1 percent identity 98 in 183
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69978"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69978"
FT                   /db_xref="GOA:Q5SLY8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69978.1"
FT                   /translation="MKPEEAKALLEAAERAEEEARLRLVLLGGWYLVLWGGLWGVGNLL
FT                   LAWSPEAGERFWTVAGPLGAALSFYLGARQGGRVQSLMGFQTFALWGLLTLFALLHWIP
FT                   LLPPWTLAGESFLVSLVAFAYAYMGVLWRLPGMVWAGLGLFALDLLLFRLFPGLFHLGM
FT                   AATGLLALVYGGVCLWRWTR"
FT   CDS_pept        149814..150110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82172.1 percent identity 98 in 98
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69979"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69979"
FT                   /db_xref="GOA:Q5SLY7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69979.1"
FT                   /translation="MPLALDPLIHQETRLRIVALLAGLGEGAKAEFTWLKEALGLTEGN
FT                   LSSHLQKLEEAGYVRVEKGFRGKRPKTWVALTPEGRAAYEAYRKALLDLLQGR"
FT   CDS_pept        complement(150186..151235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0157"
FT                   /product="probable NADH-dependent flavin oxidoreductase"
FT                   /note="similar to GB:AAS82171.1 percent identity 99 in 349
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69980"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69980"
FT                   /db_xref="GOA:Q5SLY6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69980.1"
FT                   /translation="MGLLFTPLELRGLRLKNRLAMSPMCQYSATEGGEVTDWHLLHYPT
FT                   RALGGVGLVIVEATAVLPEGRISPFDLGIWSEDHLPGLRELARRIREAGAVPGIQLAHA
FT                   GRKAGTARPWEGGRPLGWKVVGPSPIPFAEGYPVPEALDEAGMARVLEAFVEGAKRALR
FT                   AGFLVVELHMAHGYLLSSFLSPLANRREDAYGGSRENRMRFPLEVARAVREAIPPELPL
FT                   FVRVSATDWAEGGWGLEDTLAFAERLKALGVDLLDLSSGGVVPGVRVPVAPGFQVPFAD
FT                   AVRKRVGMPTGAVGLLTTPEQAETVLQAGSADLVLLGRVLLRDPYFPLKAAKALGAEAP
FT                   VPPQYQRAF"
FT   CDS_pept        151266..154250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0158"
FT                   /product="alpha-dextran endo-1,6-alpha-glucosidase
FT                   ((amylo)pullulanase)"
FT                   /note="similar to GB:AAS82170.1 percent identity 98 in 994
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69981"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69981"
FT                   /db_xref="GOA:Q5SLY5"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR019248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69981.1"
FT                   /translation="MRAWLWKPFQEEPYGGDTVKKRFWAAVFLLATGLAQPLKVAILWH
FT                   QHQPPYENPLTGQYEGPWVRMHGVNGYPWMAEVLLEFPEVKVSFDYTSTLLKQIQDYLS
FT                   GKAKDAYWRVSEKPAGALTPEERAFVVERFFDINPRFVAESPRYQELQAKRNRGEAFTD
FT                   QDLTDLRVLWNLLWINRDYIAKDPRLRALREKDRGFSQEDLNYVLKKHLELMATILPLH
FT                   RTLWERGQIDLLTTPYYHPILPILLDKEAIRESNPTLALPKEPIAWPEDARWQVRSGKA
FT                   YFRELFGREPLGMWPPEGAVSQKAAELYAEEGIGFLVTDEAVLGKSGLPVNPLTLTRPY
FT                   HVEKDGKRLVLFFRHRDLSDRIGFRYSGMPAEEAVEDFIASLLEIRRQVIRENPEAVLT
FT                   IALDGENAWEHYPENGNTFRRLLYKRLSEEQAKGTLKTVRFSEVLDLPSVALPRLGTGG
FT                   WTGDFAMWAGEPEENEAWDRLSRARQAVVAYREAGGDPKVAERAMGLIYAAQASDWFWW
FT                   YGQDTGFPNNPPFDEGFRALLRAVYEALGRKPPEELFIAVRPPAAPQGTPGRIRPRLDG
FT                   RVDPPEEWKGAAYLPDLEGTAMQTQDDLLRGVYLGFDEQNVYLRVDLREGMRATDLLGR
FT                   GFRLHVYATTPGEEGGAAFPEGSRASLGFPLQQRITLDLDQVRDGEGVPVRYAYRDGAW
FT                   VLATSPADLRGRRAYVGEVVEMRLPHTTLRAEPGDTLRLAVVLEREGRVVDTAPDAHPL
FT                   ALSLPQRLAGKEVLAIPDPEGDEHGPGTYTYPKDNAFAPFQGLFDLLEMRILDSGATWT
FT                   FVFSFKEMTNPWGAPAGFSHQLLNVYLDFKDGGRTDPFAKGAKVAFDPEHPWDLFLKAA
FT                   GWPQYGQRVGFPDGTDTADGITVGSNPADKQVIVQLDKKHFNPAPGQRVCFYVLVGSQD
FT                   GYGPDHFRPVAKEAGPWNLGGAENEDAPLVVDYLWPEEGVQEAMLSRYGGGRHAVLKPY
FT                   CVAWP"
FT   CDS_pept        154269..154922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0159"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82169.1 percent identity 99 in 217
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69982"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69982.1"
FT                   /translation="MDRDLEAAFRRVEELLFGGPSRPGLTLYDLQRLVGYPAKGKEPYV
FT                   HTLPALPGVQAVRLYYYPEDPELELIVEIVDREGKQHLRHFRWNGVTWETPKGKKGELK
FT                   ATAVPQGPLKVGEDYFLGFAPEEAVALEAALRRGEAPGLKYLLCPRCRTRIFYAYAANP
FT                   QGLACPTCGNPTLLFKTLAGEERKDPLEALAEEQRRLRLALEELLAYLKRKLGP"
FT   CDS_pept        155014..155715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82168.1 percent identity 97 in 233
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69983"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69983"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69983.1"
FT                   /translation="MLLFLGPTDAGKTTLARRLLQKAGEAFLLDLDPGQGALPGTFSLF
FT                   LHREGRLLLVRRTLLGTLSPAGAEAKALVAALRLARLIPPGSPAVGDTDGLLDPEYRLL
FT                   QVEALSPAEVVVLGAEGLYRALAWRKDLRVRLLPPLPEARRKTPAERRKNRQERLLAHF
FT                   QEAGPRLAPLEGPPLWNRLYGLLDPEGFFLGYGRLLAFGGGEGLFLTPAKGEVAKALPT
FT                   RLALPTPALPG"
FT   CDS_pept        complement(155693..158329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0161"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="similar to GB:AAS82167.1 percent identity 99 in 878
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69984"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69984"
FT                   /db_xref="GOA:Q5SLY2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023356"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69984.1"
FT                   /translation="MEKYNPHAIEAKWQRFWEEKGFMKAKDLPGGRGKQYVLVMFPYPS
FT                   GDLHMGHLKNYTMGDVLARFRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDWTYEN
FT                   IRQAKESLRLMGILYDWDREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQ
FT                   TVLANEQVVEGRCWRHEDTPVEKRELEQWYLRITAYAERLLKDLEGLNWPEKVKAMQRA
FT                   WIGRSEGAEILFPVEGKEVRIPVFTTRPDTLFGATFLVLAPEHPLTLELAAPEKREEVL
FT                   AYVEAAKRKTEIERQAEGREKTGVFLGAYALNPATGERIPIWTADYVLFGYGTGAIMAV
FT                   PAHDQRDYEFARKFGLPIKKVIERPGEPLPEPLERAYEEPGIMVNSGPFDGTESEEGKR
FT                   KVIAWLEEKGLGKGRVTYRLRDWLISRQRYWGTPIPMVHCEACGVVPVPEEELPVLLPD
FT                   LKDVEDIRPKGKSPLEAHPEFYETTCPKCGGPAKRDTDTMDTFFDSSWYYLRYTDPHND
FT                   RLPFDPEKANAWMPVDQYIGGVEHAVLHLLYSRFFTKFLHDLGMVKVEEPFQGLFTQGM
FT                   VLAWTDFGPVEVEGSVVRLPEPTRIRLEIPESALSLENVRKMGAELRPHEDGTLHLWKP
FT                   AVMSKSKGNGVMVGPFVKEQGADIARITILFAAPPENEMVWTEEGVQGAWRFLNRIYRR
FT                   VAEDREALLETSGVFQAEALEGKDRELYGKLHETLKKVTEDLEALRFNTAIAALMEFLN
FT                   ALYEYRKDRPVTPVYRTAIRYYLQMLFPFAPHLAEELWHWFWPDSLFEAGWPELDEKAL
FT                   EKDVVEVAVQVNGRVRGTIHIPKDAPLEVARAEALKVRNVRAHLEGKEVVKEIYVPGKI
FT                   LNLVVRG"
FT   CDS_pept        complement(158501..160111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0162"
FT                   /product="30S ribosomal protein S1"
FT                   /note="similar to GB:AAS82166.1 percent identity 99 in 536
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69985"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69985"
FT                   /db_xref="GOA:Q5SLY1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69985.1"
FT                   /translation="MEDKATQTPEQTFSMEAALQETEARLEKRVRPGQILTGKVVLVGS
FT                   EGVAVDIGAKTEGIIPFNQLTTKPLSEEELRNLLSPGDEVKVQVLRVDPETGQILLSRK
FT                   KIEAQEKWDRIQELYEKGEPVTVTIKERVKGGVVAELDGVQGFMPASQLDLRRVPNLDE
FT                   FVGQQVLAKIIEFHRRKGRVILSRRAVLEEEQKKAREAFLKSLEPGQVVEGTVVEVTDF
FT                   GVFVNLGPVDGLVHRSEITWGRFNHPREVIQKGQKVKAQVLSVDPEKERVNLSIKALIP
FT                   DPWTTVAEKYPVGTRVRGKVVGLTQFGAFVEVEPGLEGLIHISELSWTKRPKHPSEVVK
FT                   EGDEVEAVVLRLDPEERRLSLGLKQTQPDPWQQLTEKYPPGTVLKGKVTGVTDFGVFVE
FT                   IEPGIEGLVHVSELDHKRVENPAALFKKGDEMEVVVLNIDPVEQRVSLSRKRLLPPPLP
FT                   QEEERPRRARSGKERARRKGAPRREDRREYEYGAVAEYNLYDASSVPTTTATVKLGDLY
FT                   GDLLASLGLEEEAEEKSRG"
FT   tRNA            160333..160419
FT                   /gene="tRNA-Leu-1"
FT                   /product="tRNA-Leu"
FT                   /note="anticodon: GAG"
FT   CDS_pept        160376..160888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82165.1 percent identity 97 in 170
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69986"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69986"
FT                   /db_xref="GOA:Q5SLY0"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69986.1"
FT                   /translation="MPARACGFKSRPRHQTEARKGLVSLMRLLLSRRLSCLEDTQALAE
FT                   EVLGLLPRGALVALEGPLGAGKTTFVGFLARALGFPGRVTSPTYTLIHTYPTPEGPVVH
FT                   ADLYRLKDPSLLLGQLEAALEGARLGLVEWGEPHLLGASHLLRLSPEGEARRAELWEVG
FT                   PGEEKGV"
FT   CDS_pept        complement(160850..161335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0164"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="similar to GB:AAS82164.1 percent identity 98 in 161
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69987"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69987"
FT                   /db_xref="GOA:Q5SLX9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69987.1"
FT                   /translation="MTKLWTLLVAGALSLALAVKPGEPLLDFLLLDPKGQPVTPATMSK
FT                   PAVIVFWASWCTVCKAEFPGLHRVAEETGVPFYVISREPRDTREVVLEYMKTYPRFIPL
FT                   LASDRDRPHEVAARFKVLGQPWTFVVDREGKVVALFAGRAGREALLDALLLAGADLP"
FT   CDS_pept        complement(161379..161861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82163.1 percent identity 98 in 160
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69988"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69988"
FT                   /db_xref="GOA:Q5SLX8"
FT                   /db_xref="InterPro:IPR019250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69988.1"
FT                   /translation="MPSGRAHEALNLAALGGLALAHLAAGGSPEDPRAWAFGLAYLAGT
FT                   YLLSPDLDLAERGVRASRRWGIFAAFWRPYGWLFRHRGLSHTWLLGPLTRLAYLGAWVG
FT                   LLLLVLRWTLGLQVSLDLPPELWGFGLLGYYASQWLHLLADGIRPDHGLKRLRRPR"
FT   CDS_pept        complement(161869..162618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82162.1 percent identity 99 in 249
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69989"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69989"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69989.1"
FT                   /translation="MRYPRRYRGGESVRQGYFALLTADPLRGALNRVEARLIEEARGEA
FT                   LFLIPYALRDLAEAWRLVYRDLGLRRGRVVYLRRREEAFDPEVARRVAESPLVILAAES
FT                   LPEFLDLIRNSLLLQALAEVYRQGGGVVAVGEAAGLLGEAAFYALEGEVRAGFGLALLR
FT                   GLALLPRVEERGRFLALSRLVADNPDLVGLGLLENTALRLLRGLGEVWAGGVTLVDAGG
FT                   AEYTGRGVRGLRVDVLSTGERFPLPSL"
FT   CDS_pept        162660..163229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0167"
FT                   /product="transcriptional regulator (TetR/AcrR family)"
FT                   /note="similar to GB:AAS82161.1 percent identity 99 in 189
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69990"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69990"
FT                   /db_xref="GOA:Q5SLX6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="PDB:3VUQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69990.1"
FT                   /translation="MAAMITPPGAGVKDKKRAILEATLAVLRERGLSGLKMEEVARRAE
FT                   VGKGTIYLYFRDKRDLLKALVEERTWAFYREVEEVVRRKAPFFVRLEEVLRRRLAWVQE
FT                   WRGLWAAVAREAMDDPTPWLKGLHEHYLRLLEELLRSGQSEGAVRTGLSPRATAAVIAA
FT                   MGCTPSLEVEAYLEHLMEVLRKGVEP"
FT   CDS_pept        163226..163720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82160.1 percent identity 98 in 164
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69991"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69991"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="PDB:4L5G"
FT                   /db_xref="PDB:4XAX"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69991.1"
FT                   /translation="MKEFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRS
FT                   KAYVPVEAPHSVGLRKALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYR
FT                   IAQMAGQLRAWEVERGLPDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWGEEL
FT                   N"
FT   CDS_pept        complement(163895..164461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0169"
FT                   /product="'hypothetical protein"
FT                   /note="similar to GB:AAS82159.1 percent identity 99 in 188
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69992"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69992"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="PDB:1WWM"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69992.1"
FT                   /translation="MLGLDLLKEVPGLLEEIKALPLRLDEERFRFWLQQDYPFVEALYR
FT                   YQVGLLLEAPQAHRAPLVQALMATVEELDWLLLQGASPSAPVHPVRAGYIALLEEMGRL
FT                   PYAYRVVFFYFLNGLFLEAWAHHVPEEGPWAELSQHWFAPEFQAVLYDLEVLARGLWED
FT                   LDPEVVRTYLRRILEAEKATWSLLL"
FT   CDS_pept        complement(164439..165266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0170"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /note="similar to GB:AAS82158.1 percent identity 100 in 275
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69993"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69993"
FT                   /db_xref="GOA:P83700"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="PDB:1UEK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P83700"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69993.1"
FT                   /translation="MERLAPAKVNLGLSVRFRREDGYHELHTLFAPFSLADRLVVEPVS
FT                   SGLHFQGPYGRENLAYRAASLYLEAAGQPGGVRILLEKRIPEGAGLGGGSSDAAQVLLA
FT                   LQALYPAEVDLFALARTLGADVPFFLLGRGAEARGVGERLKPLALPPVPAVVFFPGLRV
FT                   PTPLVYRAVRPEDFGPDLPVEAILEALARGEEPPYWNSLEGPAFRLFPELKEVRGRMRA
FT                   LGLRGVLMSGSGSAFFGLAEGPDHARRAAEALRAWGRAWAGTLGGGDAGSGPA"
FT   CDS_pept        complement(165254..165895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0171"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="similar to GB:AAS82157.1 percent identity 99 in 213
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69994"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69994"
FT                   /db_xref="GOA:Q5SLX2"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="PDB:2PX7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69994.1"
FT                   /translation="MEVSVLIPAAGNGLRLGRGPKAFLQVGGRTLLEWTLAAFRDAAEV
FT                   LVALPPGAEPPKGLGAVFLEGGATRQASVARLLEAASLPLVLVHDVARPFVSRGLVARV
FT                   LEAAQRSGAAVPVLPVPDTLMAPEGEAYGRVVPREAFRLVQTPQGFFTALLREAHAYAR
FT                   RKGLEASDDAQLVQALGYPVALVEGEATAFKITHPQDLVLAEALARVWSA"
FT   CDS_pept        165910..166695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0172"
FT                   /product="undecaprenol kinase"
FT                   /note="similar to GB:AAS82156.1 percent identity 99 in 261
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69995"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69995"
FT                   /db_xref="GOA:Q5SLX1"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69995.1"
FT                   /translation="MGRVSAWEALLLGVVEGLTEFLPVSSTGHLTLLFHLLGLPVEEDP
FT                   FLKTFLVAIQLGAILAVLLLYGRRLAADRALWLRIAVAFVPTGVIGFLFYPLIKGVILG
FT                   NDAVVAFFLFFVGAVLLFADRLAERAQYQDVKALPLARVAWIGVFQGLAALFPGTSRSG
FT                   ATILGGLLLGLNRQAAAEFSFLLALPTMFAAVGYDLWKSAPEVPEGGWSLLLLGFLAAL
FT                   VTALVTVRWMLAFVARHGFRPFALYRMALAAVYAFFFLR"
FT   CDS_pept        complement(166687..167748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0173"
FT                   /product="aminotransferase, class V"
FT                   /note="similar to GB:AAS82155.1 percent identity 99 in 353
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69996"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69996"
FT                   /db_xref="GOA:Q5SLX0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="PDB:2YRI"
FT                   /db_xref="PDB:2YRR"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69996.1"
FT                   /translation="MLLLTPGPTPIPERVQKALLRPMRGHLDPEVLRVNRAIQERLAAL
FT                   FDPGEGALVAALAGSGSLGMEAGLANLDRGPVLVLVNGAFSQRVAEMAALHGLDPEVLD
FT                   FPPGEPVDPEAVARALKRRRYRMVALVHGETSTGVLNPAEAIGALAKEAGALFFLDAVT
FT                   TLGMLPFSMRAMGVDYAFTGSQKCLSAPPGLAPIAASLEARKAFTGKRGWYLDLARVAE
FT                   HWERGGYHHTTPVLLHYALLEALDLVLEEGVAARERRAREVYAWVLEELKARGFRPYPK
FT                   ASPLPTVLVVRPPEGVDADRLVRALYAEGVAVAGGIGPTRGQVLRLGLMGEGARREAYQ
FT                   AFLKALDRALALA"
FT   CDS_pept        167897..168949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0174"
FT                   /product="alternative chaperone protein DnaJ"
FT                   /note="similar to GB:AAS82154.1 percent identity 99 in 350
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69997"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69997"
FT                   /db_xref="GOA:Q5SLW9"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69997.1"
FT                   /translation="MKDYYAILGVSREASQEEIKKAYRRLALKYHPDRNPGDKEAEERF
FT                   KEINEAYAVLSDPKKRAAYDRGHLEAPEYRPEDLFDLFFQEVFGVRGHRRPPRGEDLEA
FT                   EVEVELQDLLHGAEKEVRYTRLVPCEACGGEGGRRTPCPTCRGQGVVESYRQSFFGTVV
FT                   TRTACPHCKGRGYLLAETCPACRGRGRVPREERVRVQVPPGMDEGHLLRVPGYGNLGPG
FT                   GPGDLYLRIRVRPHPHLERQGPDLVYRLRLGLAQAALGARVEVPGLEGPIPLDIPPGTG
FT                   HGEVFALEGGGLPLPGGRGRGTLRVVVELAVPKKLSPKAQKLLRAYAEEVGEEVAPEGF
FT                   WERLKGFFRK"
FT   CDS_pept        169065..169286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0175"
FT                   /product="cold shock protein"
FT                   /note="similar to GB:AAS82153.1 percent identity 100 in 73
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69998"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69998"
FT                   /db_xref="GOA:Q5SLW8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="PDB:3A0J"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69998.1"
FT                   /translation="MQKGRVKWFNAEKGYGFIEREGDTDVFVHYTAINAKGFRTLNEGD
FT                   IVTFDVEPGRNGKGPQAVNVTVVEPARR"
FT   CDS_pept        169360..169833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0176"
FT                   /product="probable acetyltransferase"
FT                   /note="similar to GB:AAS82152.1 percent identity 100 in 157
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD69999"
FT                   /db_xref="EnsemblGenomes-Tr:BAD69999"
FT                   /db_xref="GOA:Q5SLW7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:3EXN"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD69999.1"
FT                   /translation="MGAMHVLTLDLAPVTPKDAPLLHRVFHLSPSYFALIGMELPTLED
FT                   VVRDLQTLEVDPRRRAFLLFLGQEPVGYLDAKLGYPEAEDATLSLLLIREDHQGRGLGR
FT                   QALERFAAGLDGVRRLYAVVYGHNPKAKAFFQAQGFRYVKDGGPTLTWYVRPL"
FT   CDS_pept        complement(169950..170189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0177"
FT                   /product="ferredoxin"
FT                   /note="similar to GB:AAS82151.1 percent identity 100 in 79
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70000"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70000"
FT                   /db_xref="GOA:P03942"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="PDB:1H98"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03942"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70000.1"
FT                   /translation="MPHVICEPCIGVKDQSCVEVCPVECIYDGGDQFYIHPEECIDCGA
FT                   CVPACPVNAIYPEEDVPEQWKSYIEKNRKLAGLE"
FT   CDS_pept        complement(170250..170789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0178"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82150.1 percent identity 100 in 179
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70001"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70001"
FT                   /db_xref="GOA:Q5SLW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70001.1"
FT                   /translation="MRTVRELRLAGLFAYLASLVIALLLSLALHLLLGGQGELGWEGFN
FT                   AYGLLEGLLFLLAFTWSLALGQRATRIPCSTLLTAGLFGPRAAKRLARPLARVEGVEAY
FT                   EGRGLALLYQEGRPVGLLGLSDHILPLEEVPSVEAETAVTELAPLFFQHPIVLVVQGEE
FT                   VLGAVPREAYFRYLGA"
FT   CDS_pept        complement(170794..171492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82149.1 percent identity 99 in 232
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70002"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70002"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="PDB:2DPW"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70002.1"
FT                   /translation="MRPSAIVLAGGKEAWAERFGVGSKALVPYRGRPMVEWVLEALYAA
FT                   GLSPVYVGENPGLVPAPALTLPDRGGLLENLEQALEHVEGRVLVATGDIPHLTEEAVRF
FT                   VLDKAPEAALVYPIVPKEAVEARFPRTKRTYARLREGTFTGGNLLLLDKSLFRKALPLA
FT                   RRVVALRKRPLALARLVGWDVLLKLLLGRLSLAEVEARAQRILGVEARALVTPYPEVGV
FT                   DVDREEDLVS"
FT   CDS_pept        complement(171503..177706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0180"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /note="similar to GB:AAS82148.1 percent identity 99 in 2067
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70003"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70003"
FT                   /db_xref="GOA:Q5SLW3"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70003.1"
FT                   /translation="MGRKLRFAHLHQHTQFSLLDGAAKLSDLLKWVKETTPEDPALAMT
FT                   DHGNLFGAVEFYKKATEMGIKPILGYEAYVAAESRFDRKRGKGLDGGYFHLTLLAKDFT
FT                   GYQNLVRLASRAYLEGFYEKPRIDREILREHAEGLIALSGCLGAEIPQFILQDRLDLAE
FT                   ARLNEYLSIFKDRFFIEIQNHGLPEQKKVNEVLKEFARKYGLGMVATNDGHYVRKEDAR
FT                   AHEVLLAIQSKSTLDDPGRWRFPCDEFYVKTPEEMRAMFPEEEWGDEPFDNTVEIARMC
FT                   NVELPIGDKMVYRIPRFPLPEGRTEAQYLMELTFKGLLRRYPDRITEGFYREVFRLLGK
FT                   LPPHGDGEALAEALAQVEREAWERLMKSLPPLAGVKEWTAEAIFHRALYELSVIERMGF
FT                   PGYFLIVQDYINWARRNGVSVGPGRGSAAGSLVAYAVGITNIDPLRFGLLFERFLNPER
FT                   VSMPDIDTDFSDRERDRVIQYVRERYGEDKVAQIGTLGSLASKAALKDVARVYGIPHKK
FT                   AEELAKLIPVQFGKPKPLQEAIQVVPELRAEMEKDPKVREVLEVAMRLEGLNRHASVHA
FT                   AGVVIAAEPLTDLVPLMRDQEGRPVTQYDMGAVEALGLLKMDFLGLRTLTFLDEVKRIV
FT                   KASQGVELDYDALPLDDPKTFALLSRGETKGVFQLESGGMTATLRGLKPRRFEDLIAIL
FT                   SLYRPGPMEHIPTYIRRHHGLEPVSYSEFPHAEKYLKPILDETYGIPVYQEQIMQIASA
FT                   VAGYSLGEADLLRRCLAEGSLVLDAATGQRVPIEKVRPGMEVFSLGPDYRLYRVPVLEV
FT                   LESGVREVVRLRTRSGRTLVLTPDHPLLTPEGWKPLCDLPLGTPIAVPAELPVAGHLAP
FT                   PEERVTLLALLLGDGNTKLSGRRGTRPNAFFYSKDPELLAAYRRCAEALGAKVKAYVHP
FT                   TTGVVTLATLAPRPGAQDPVKRLVVEAGMVAKAEEKRVPEEVFRYRREALALFLGRLFS
FT                   TDGSVEKKRISYSSASLGLAQDVAHLLLRLGITSQLRSRGPRAHEVLISGREDILRFAE
FT                   LIGPYLLGAKRERLAALEAEARRRLPGQGWHLRLVPPAVAYRISEAKRRSGLSWSEAGR
FT                   RVAVAGSCLSSGLNLKRPRRYLFRHRLFLLGEAFADPGLEALAEGQVLWDPIVAVEPAG
FT                   KARTFDLRVPPFANFVSEDLVVHNSMGKKKVEEMKSHRERFVQGAKERGVPEEEANRLF
FT                   DMLEAFANYGFNKCLPARARVVDWCTGRVVRVGEIVRGEAKGVWVVSLDEARLRLVPRP
FT                   VVAAFPSGKAQVYALRTATGRVLEATANHPVYTPEGWRPLGTLAPGDYVALPRHLSYRP
FT                   SLHLEGHELDLLGFALAEGHLRHPSGVYLYTSSEEELAAMEEALRAFPNTRIRVVWRRG
FT                   VAHVYVGRVDRRQEAGAVAFLRRMGLLGLDAKTKRLPEAVFGLPPEEVARFLGRLWTGD
FT                   GGVDPKGRLIHYATASKELAWGVQHLLLRLGLQSRLVEKRFSGGYKGYAVYLLGGLEAA
FT                   RRFAETVGPYLVGKRRQDLEALLASWEKAGRSTRDVLPLAFLEEVRAAVAEVAQGQVAD
FT                   LLREAGLAEGLLCLGRGRRGLSRATVGRLAALTGSLALLRLAEAEVYWDRVEAVEPLGE
FT                   EEVFDLTVEGTHTFVAEDVIVHNSHAAAYSLLSYQTAYVKAHYPVEFMAALLSVERHDS
FT                   DKVAEYIRDARAMGIEVLPPDVNRSGFDFLVQGRQILFGLSAVKNVGEAAAEAILRERE
FT                   RGGPYRSLGDFLKRLDEKVLNKRTLESLIKAGALDGFGERARLLASLEGLLKWAAENRE
FT                   KARSGMMGLFSEVEEPPLAEAAPLDEITRLRYEKEALGIYVSGHPILRYPGLRETATCT
FT                   LEELPHLARDLPPRSRVLLAGMVEEVVRKPTKSGGMMARFVLSDETGALEAVAFGRAYD
FT                   QVSPRLKEDTPVLVLAEVEREEGGVRVLAQAVWTYEELEQVPRALEVEVEASLLDDRGV
FT                   AHLKSLLDEHAGTLPLYVRVQGAFGEALLALREVRVGEEALGALEAAGFRAYLLPDREV
FT                   LLQGGQAGEAQEAVPF"
FT   CDS_pept        177761..178063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82147.1 percent identity 98 in 100
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70004"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70004"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70004.1"
FT                   /translation="MMHRKRVLSATEARVHFGEVLRRVEEGEVIVVEGRGRPQAVILSV
FT                   KAYARLTAGKEDPLEALLSFNRAIRARLGRPLTPPEEVVSALREERDRELGGAGR"
FT   CDS_pept        178038..178484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82146.1 percent identity 98 in 148
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70005"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70005"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70005.1"
FT                   /translation="MSWVVLDASFLLRLLLAADPRAEAVRLYRGWRQEDRPLAAPTLAL
FT                   YEAADALYRYALAGEMTLAEAETFLGHLQRLGIRFFAEPWTHTRALELAWALGLKAAYD
FT                   AHYLALAEGFQGAFWTADKRLHQRALEGQAQGLLPGVSLHLLEP"
FT   CDS_pept        178481..179044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0183"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="similar to GB:AAS82145.1 percent identity 97 in 187
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70006"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70006"
FT                   /db_xref="GOA:Q5SLW0"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70006.1"
FT                   /translation="MTLGELREEVWNALARYDLALHPTPPHGHHPNFLGARRAAERLLK
FT                   TPEFQGARRVLAGMDAVLKPLREEALRQGKELLLPHPDRPGEFLLLRDVDPRKLKRVRE
FT                   AYRFGVRVALEEATPDLVLIGAVAVDEEGGWVGKGYGFPQSWLRVEAPFATLAHPVMVY
FT                   PRLPVPPERRVDLIATPQRLLRLG"
FT   CDS_pept        complement(179036..180298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0184"
FT                   /product="pyruvate dehydrogenase complex, dihydrolipoamide
FT                   acetyltransferase E2 component"
FT                   /note="similar to GB:AAS82144.1 percent identity 100 in 420
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70007"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70007"
FT                   /db_xref="GOA:Q5SLV9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="PDB:2EQ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70007.1"
FT                   /translation="MEVKLPELGDNVTQATVVGVLVKEGDRVEPGQPLLELETDKAVVE
FT                   VPAEAGGVVKRVLVKVGDEVRPGQPFLELAEAEGGAEAPPLKAEERPEAPAPKAEEAPR
FT                   PAPKEAPPAPQEAPSERRLIPAAPSIRRLARELGVDLTRLRGTGLAGRITEEDVRRAAG
FT                   LGEAAPAALPAAPAPRLPDFTKWGPVRREPMSGVRKATVRSMSQAWAQVPMVTHFDEAD
FT                   VTELEALRKQYAKKAEEKGFRLTLTAFLLKALALTLKAFPKFNASLDVEAQEIVYKDYI
FT                   HIGVAVDTPHGLLVPVIRDVDRKGVLRLAEELQEISQRARERKLSPEEMQGATFSLSNL
FT                   GGIGGTGFTPIVNWPEVAILGVSRSQMKPLWDPGKEAFVPRLVMPFSLTYDHRLIDGAD
FT                   AARFCRHLAGILEDPLGLALA"
FT   CDS_pept        complement(180308..183025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0185"
FT                   /product="pyruvate dehydrogenase complex, pyruvate
FT                   dehydrogenase E1 component"
FT                   /note="similar to GB:AAS82143.1 percent identity 99 in 867
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70008"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70008"
FT                   /db_xref="GOA:Q5SLV8"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70008.1"
FT                   /translation="MTEKELKAAFQALSPEEKARFLEIENREWLESLEYVLKVEGPERV
FT                   EELLRLLDEYLFRHGVYPANRLSTPYLNTLPKEKEPPYPGDLELERRIANILRWNVAMM
FT                   VTRANKKADGIGGHIATYASIAELYEVGFNHFFRGPEAGLDRDLVFFQGHASPGNYARA
FT                   FLEGRLKEEDLENFRREVHPPVPGGRGLSSYPHPWLMPDFWEFPTVSMGLGPIQAIYQA
FT                   RFMRYLEDRGLKPKSSAKVWAFLGDGEHDEPETVGALHLAARENLDNLIFVVNCNLQRL
FT                   DGPVRGNSKVIQELERLYRGAGWRVIKVVWGSAWDELLAKDKEGHLLRRFEALVDGESQ
FT                   RYAAFGGKELRERFFNTPELKKLIEGMTDEELTELTRSRGGHDMVKIYAAYKAAVEHRG
FT                   SPVVILARTIKGYGMGPTVMAKNVAHQVKKLTEEDLKEARRFLGIPIPEEKLPELPYYH
FT                   PGPDSPEVRYLLERRKALGGFVPERRVRFQGGLEVPEEEFFREFYEGSGGREISTTMAF
FT                   VRILAKLLRHPKIGKYIVPIVPDEARTFGMEALIAQVGVYSPQGQLYVPVDAGTLTAYK
FT                   ESQKGQILEEGITEAGAMAEFIAAGTAYAHWGIPTIPFFITYSMFGLQRIGDLVWAAAD
FT                   QRARGFFLGATAGRTTLAGEGLQHQDGQSHVYALAAPNLLAYDPAFAYEFAVILEDGLR
FT                   RMYGRGEDVFYYITIENENYVHPPMPEPREKVKEGILKGLYLFRAGEGKGPKVQLFGTG
FT                   PILNEALKAQELLAKYGVVADVWSATSYKALYVDAIEAERETRLLGKARRPYVQEALEG
FT                   HEGPIVAATDYLKALPNLIRGYVDRPFAVLGTDGFGRSDTREALRDFFEVDARHIAYTA
FT                   LALLHGEGKVTKRTLNQARKDLGLKLEEVPPHRR"
FT   CDS_pept        183132..183989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0186"
FT                   /product="probable transcriptional regulator"
FT                   /note="similar to GB:AAS82142.1 percent identity 100 in 285
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70009"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70009"
FT                   /db_xref="GOA:Q5SLV7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70009.1"
FT                   /translation="MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQALERELGV
FT                   RLLERRPFRLTPAGDLLRREGARLLKELEALKEAVRRAGQEALRFGVPENLLPDLMPLL
FT                   DHLRRGLGQAVEVLEMHTPEQVRALKEGRLDYGLAGLKVEDPEVAKEPLLRVPIVVALP
FT                   ETHPLAPRARVPLRALKEEPFLLLPKDFLPPLYEAFMEVFRRAGFAPKVVREVARFSQA
FT                   VSLVAAGLGVHLTLAPYRVYPHPGVVLRPLEEEAALEVALIYARRPPPPRLEEVRRLLR
FT                   ALAL"
FT   CDS_pept        183999..184934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0187"
FT                   /product="putative protein phosphatase"
FT                   /note="similar to GB:AAS82141.1 percent identity 100 in 311
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70010"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70010"
FT                   /db_xref="GOA:Q5SLV6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70010.1"
FT                   /translation="MDRLEAALKTHPGLKRPKNEDAVGGEATPWGGVYVVADGMGGHRT
FT                   GEVASRLAVETVLARLSREEPPSPKDLLEALEEANGRIHREAQRPENRGMGTTCTVLVL
FT                   DLPYALVAHVGDSRAYLLREGNLLQLTEDHSWVAERVRQGLLSPEEARTHRWRNVITNA
FT                   LGSFPQARVDLLGLKLRPGDTFLLCTDGLSGVLEERALKEVLAHFPPAEAAERLVALAN
FT                   EWGGPDNVSVAVVRVPEALPERQRPYALPLEAAKGEPVRLQVGEVPEELTTQILEPAPK
FT                   RGRVGWRDALLILLWVVVVAYILLNSLRTP"
FT   CDS_pept        184971..185384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0188"
FT                   /product="nucleoside diphosphate kinase"
FT                   /note="similar to DBJ:BAC67699.1 percent identity 100 in
FT                   137 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70011"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70011"
FT                   /db_xref="GOA:Q5SLV5"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="PDB:1WKJ"
FT                   /db_xref="PDB:1WKK"
FT                   /db_xref="PDB:1WKL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70011.1"
FT                   /translation="MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELA
FT                   ERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGD
FT                   FATTIDENVIHGSATLEDAQREIALFFRPEELL"
FT   CDS_pept        complement(185470..186015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82139.1 percent identity 100 in 181
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70012"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70012"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70012.1"
FT                   /translation="MERVAIFIDGSNLYKGLVQHLGSDYRLNFVEFITLLTAGRKLLRA
FT                   YYYNAPLPPEDPAAKAHQSFLNYLKRVPYVTVRLGRLERRADGFVEKGVDIQIAVDMLR
FT                   LAFVNAYDIAVLVSGDGDFAEVVRVVQDLGKQVENTTFHALSSHRLAQQADHFYPLDDF
FT                   PWERLRAQVSPASPEEEA"
FT   CDS_pept        complement(186188..186544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0190"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="similar to GB:AAS82138.1 percent identity 100 in 117
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70013"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70013"
FT                   /db_xref="GOA:Q5SLV3"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70013.1"
FT                   /translation="MGEIALLGLEFYGRHGVMPEEGRLGARFVVDLWLSVPFEGKGDRL
FT                   EETVDYAAVYALVEEAVRHRRFYLIEALADHLAEELLKAFPRLQAVRVRVHKPHAPIPG
FT                   VFRDVYAETQKSRI"
FT   CDS_pept        complement(186516..187400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0191"
FT                   /product="dihydropteroate synthase"
FT                   /note="similar to GB:AAS82137.1 percent identity 98 in 294
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70014"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70014"
FT                   /db_xref="GOA:Q5SLV2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="PDB:2DQW"
FT                   /db_xref="PDB:2DZA"
FT                   /db_xref="PDB:2DZB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70014.1"
FT                   /translation="MGAPPLGPTIIPPVRTLWLRDRALDLDRVRLLGVLNLTPDSFSDG
FT                   GRYLDPERALERAREMVAEGADILDLGAESTRPGAAPVPVEEEKRRLLPVLEAVLSLGV
FT                   PVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHMPVPDPATMM
FT                   AHARYRDVVAEVKAFLEAQARRALSAGVPQVVLDPGFGFGKLLEHNLALLRRLDEIVAL
FT                   GHPVLVGLSRKRTIGELSGVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREALGV
FT                   WEALYGGDRPSRA"
FT   CDS_pept        187399..188238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82136.1 percent identity 100 in 279
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70015"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70015"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70015.1"
FT                   /translation="MRLLAALDFGLTHESVVATARALAPALGLEAHLVHVIPDPYFQGL
FT                   AHRFPDLAPLLREALDRVEARVREALGATGLKARVLRGLPAFAVGGEAARAKLVVLGQT
FT                   GDDPLERLARGGLARYLLHRGEAPVLLVPPERPLTAVRRIGVGLDESDASLAAFRLALS
FT                   WKEALGAEVLGLHLVSGEGGCCYPTYLDPKGLSLAEVLEKAEAFLRARYTPLDRLLVTK
FT                   GEDEADLVELARREKLDLLVLGSKAKRTWRRRLGGTVEAALQRTDLPLLVVPEATVW"
FT   CDS_pept        188249..189457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0193"
FT                   /product="putative membrane protein"
FT                   /note="similar to GB:AAS82135.1 percent identity 100 in 402
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70016"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70016"
FT                   /db_xref="GOA:Q5SLV0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70016.1"
FT                   /translation="MRHGPSWFLRLSAYWFATSFKWFLVLLVLLPAKVAEVSPPEEKAS
FT                   RLGFLFGLGAVMAILGPPVMGYLSDRLGRRRPFLLWGSLLTAFALLLLVHAPSYTALLF
FT                   AYLLLQVADDLATGPYSALIPDLVPKGERGAASGYMGVLQVSGQVLAGAVGFLLPLAPQ
FT                   AYLAALLNLLGAALSLSLVPDRLPKANPRPFLKAMAAPWRDRDFLLVYLTRFLVMLGFY
FT                   LAQTYLQYYLADVVRSFQALGRTLTEAPFQAVALLGLLISLGAALASVPAGRASDRLGR
FT                   KPLIYLSGAGLGLLMPFLLLFPRYDLLLALALVFGLFYGVYLAVDWALVADVLKDPEAH
FT                   ATDMGLWQTAIVVPQVLAGAFGRPLDLLNAQTPGLGYQVLYLLAALFFLLGAFGVAGVR
FT                   RSR"
FT   CDS_pept        189560..190102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0194"
FT                   /product="probable tripartite transporter, small subunit"
FT                   /note="similar to GB:AAS82134.1 percent identity 98 in 180
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70017"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70017"
FT                   /db_xref="GOA:Q5SLU9"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70017.1"
FT                   /translation="MRALLALSRAIDALSEGVGRIIVWLVLAVSLLSAGNALMRYAFRY
FT                   SSNAYLEAQWYLFSLIFLLGGAYALKHNAHVRIDLVYGRLSKRTQAWIDLVGTLLFLIP
FT                   MSLGVIYLSWDWVANAVAIREMSPDVGGLPRWPIKIALPVGFALLALQGLSELIKRLAF
FT                   LTGHLPDWTPGEEEEVV"
FT   CDS_pept        190104..191603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0195"
FT                   /product="probable tripartite transporter, large subunit"
FT                   /note="similar to GB:AAS82133.1 percent identity 98 in 499
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70018"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70018"
FT                   /db_xref="GOA:Q5SLU8"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70018.1"
FT                   /translation="MDLYAVMPPLMFAALVVFLLSGYPVAFSLGAVGIVFGFLGIALDL
FT                   FPPALLKAMPDRIFGIMSNQLLLAIPFFTFMGIILEKSGLAEDLLDTMGRLFGPLRGGL
FT                   ALSVVFVGAILAATTGVVAASVMAMGLISLPVMLKYGYNPRVASGVILGSATLAQIIPP
FT                   SVVLIVLADQLGVSVGDMYVAALVPSALTVGLYFLYVIYLALFRPQWVPALPPEARPEA
FT                   GKEPEAAFALLSYLLVAVGSWKLGGFLHLPGWLEGLEVLLGLALWTLLLLPRIRRNPLL
FT                   RRALFSMVPPLVLIFLVLGTVLIGLATPTEAGAMGVVGALLLAALNRRLSFPVLYQAME
FT                   GTAKLTAFVIFILIGSTLFSLVFRGVDGDLWVEGFLTGLPGGEVGFIVFVMVLVFLLGF
FT                   FIDFFEIAFIVLPLLALGADALNIDKVWFGLLVGVNLQTSFLTPPFGFALFYLRNVAPK
FT                   EVKTLDIYQGGLPFIGLQLLVLVLTYLLQEPIMEFVRNFRF"
FT   CDS_pept        complement(191670..192749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0196"
FT                   /product="transporter, periplasmic component"
FT                   /note="similar to GB:AAS82132.1 percent identity 97 in 359
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70019"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70019"
FT                   /db_xref="GOA:Q5SLU7"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="InterPro:IPR041722"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70019.1"
FT                   /translation="MKRRDFLKRAGIGVAASAAFGPVFAQGSPTVRWRMASSFPKSLDT
FT                   IYGAAEVLADRVSALTGGRFQIRVYQAGEIVPGLQVMDAVQQGTVEAGHTASYYYVGKA
FT                   QVLAFDTSVPFGLTARQQNAWMYHGGGIELFRPIFADFNIIQFPGGNTGVQMGGWFRKE
FT                   VRSLADLKGLKMRIPGPGGQVMSRLGVVPQVLAGGDIYPALERGTIDATEWVGPYDDEK
FT                   LGFYKVAKYYYYPGWHEPGPMLSFYVNLQEWRKLPKEYQQAFEVAAAEANQWMMAKYDR
FT                   VNPPALQRLLRAGVRLRKWPNEIMQAAQKAAFEWFEEEAAKDATYRKVYTAWKAFREEQ
FT                   YRWFAVAELGYAQFAFPGV"
FT   CDS_pept        complement(192816..193295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0197"
FT                   /product="S-layer-like protein"
FT                   /note="similar to GB:AAS82131.1 percent identity 99 in 159
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70020"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70020"
FT                   /db_xref="InterPro:IPR025493"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70020.1"
FT                   /translation="MRVFLLALAAFLSACTLTLYPEGLSVTYRVDFGGAILRFEPDRGR
FT                   GATYFVGEEVRFFLTLDRPGWVSLVVQDPDGYTYELDRFHLSRGTHVLPPGPYRYTLTP
FT                   PRGLHRVRAVYTQSPPSSRVRLEGRYTDWDARLRLYVEASGARAYDVAETYFYVR"
FT   CDS_pept        complement(193335..193946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0198"
FT                   /product="ribonuclease HII"
FT                   /note="similar to GB:AAS82130.1 percent identity 98 in 203
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70021"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70021"
FT                   /db_xref="GOA:Q5SLU5"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70021.1"
FT                   /translation="MAEGPLEAPFWRKGLLVAGLDEAGRGAWAGPIVVGAVVLPPGEYP
FT                   FRDSKLLSPKARERLAEKVKEVALAFALGVAEAAEVDRLGVLKATLLAAERALLSLPLA
FT                   PEALVTDYLPLPTPLPLLSPPKADEKSPTVAAASILAKVHRDRIMDELDRLYPGYGFAR
FT                   HKGYGTQEHQEALLALGPSPVHRKRFAPVAQAPLRFPEAP"
FT   CDS_pept        193971..195518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0199"
FT                   /product="type B carboxylesterase"
FT                   /note="similar to GB:AAS82129.1 percent identity 96 in 515
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70022"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70022"
FT                   /db_xref="GOA:Q5SLU4"
FT                   /db_xref="InterPro:IPR000997"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70022.1"
FT                   /translation="MLRRLLPFLALLGGALAQAFWVETPLGRAQGRLEGGAIAFYGLPY
FT                   AEAERFRAPKPLKAWPPGVGQEAVACPQAPGITAWFGGPIPLEREDCLVLNVYLPAQIP
FT                   PPGGFPVMVYLHGGGFTSGAGAEPIYRGHRLSEEGVVVVAPNYRLGPLGFLALPALAEE
FT                   DPKAVGNYGLLDVLEALRFVRDYIRYFGGDPKNVTLFGESAGGMLVCTLLATPEARGLF
FT                   QKAIVQSGGCGYVRALEEDYAQGEAWAKARGCDPKDLACLRALPLERLLPEEPTLEATG
FT                   RFLSNPSLFRTGPFKPHLSPFLLPQDPREALREGKAAGTPLIAGANAEEVAFPSLQALL
FT                   GPGDWEEAERRLLESGLSREKAQALLAHYRKGVPDPKRAWGEVQTDLTLLCPSLKAARL
FT                   QAPHAPTYAYLFTFRAPGFEGLGAFHGLELAPLFGNLLERPFLPLFLRQEAQEEAEYLG
FT                   KKMRRYWTSFAKDGEPKGWPRWPLYREGLLLRLDVPLGLLPDLYEERCGALEVLGLL"
FT   CDS_pept        195523..197535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0200"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="similar to GB:AAS82128.1 percent identity 99 in 670
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70023"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70023"
FT                   /db_xref="GOA:Q5SLU3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037920"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70023.1"
FT                   /translation="MRARATCPLDCPDACSLLLTLEEGRLLRVEGDPRHPITQGFACAK
FT                   TYRYPERVRERLLYPLRRVGRKGEGKFVRVSWEEALDEIAKRLMEVLDREGGEAVLPYH
FT                   YAGTTGLVENQHPLAFFRAIGASELLETICATAGSAAWEMTYGPRLGPDPEDIPENARY
FT                   ILLWGINSLSTNSHLTPFLKEARRRGAKVVHIDPYENLTSRFADLHLKLRPGTDAALAY
FT                   ALAHVLFREGLLDWEYLGKAAVGLEEFQKEAEKWTPKRASALTGVPEEAILRLAREMGE
FT                   AKRVFLRVGYGMTRHPGGGNALRAVVLLPALLGAWRYPGCGAMLSTSGAFPLNKRFLGG
FT                   RHLLEGGHPHQGYFRPNPKARAVNMNQLGTALTELDPPIRVLFVFNTNPLVVAPNTGKV
FT                   KAGLAREDLFTVVLEQVMTETARFADYLLPATLFYEHPDLYTSYGHYYLSWNEPLSPPA
FT                   GEARPNTWVFRELAKRLGLKEPTLYWTAEEVAESLLASDHPYLEGITLERLKREGFVKL
FT                   NLPRPFLPFAEGQVRFSPPPEVIPTEPLPEYPLILLTPPAHRFLNTTYGDVKALVEAEG
FT                   GEPRLLIHPEDAEARGIRDGMLVHIRSPWGRITRKAHVTEAPIPGTVVLEGTWWEKWAP
FT                   DGKGVNHLTSERLTDLGGGSTFHSTPVEVEPLRLA"
FT   CDS_pept        complement(197532..199016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0201"
FT                   /product="Mg(2+) chelatase family protein"
FT                   /note="similar to GB:AAS82127.1 percent identity 100 in 494
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70024"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70024"
FT                   /db_xref="GOA:Q5SLU2"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70024.1"
FT                   /translation="MLAQVRSYALFGLDAVPVTVEVDVSPGLPSYALVGLPDKAVEESR
FT                   ERVRAALKNAGFPYPQARVVVNLAPAELRKEGSQFDLPIALGLLAAQGVVPLEALSPFA
FT                   LAGELGLDGSLRPVPGAVNLALGALAEGKKLLLPLESAKEAALVEGVEVYGARSLQEAV
FT                   AFLKGEEALAEARPEEAPEAVEALDLRDVKGQAKAKRALEIAAAGFHHLLMVGSPGSGK
FT                   TMLARRLPFLLPPLSREEALEVTRIHSAAGKPVRGLVKAPPFRAPHHTVSYAGLIGGGA
FT                   IPKPGEVSLAHRGVLFLDEFPEFSREALEALRQPLEDGVVTVARARASLTFPARFLLVA
FT                   AMNPCPCGWHGDPERPCTCTPAAQRRYAARISGPLLDRFDLVVEVPRLTPEELARAPEG
FT                   EGTEAVRERVLRARERMLARQGRPNGLLSGRALREHARLTPPAQALLQEAAKRMLLSAR
FT                   SYDRVLRVARTVADLLGEERVGEAHVAEALAYRRAL"
FT   CDS_pept        199103..200197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82126.1 percent identity 98 in 364
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70025"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70025"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70025.1"
FT                   /translation="MARELHVAYNKMRRALEERLGLLRRLGGMDLRLIQVANEEWLYML
FT                   QEDTRNSLAIEGYFTTERELREVLRGRKGAAEVLNYFRTAQFVYEQALQDLQEEAWHLD
FT                   VAFVNNIHGQLFRETPQEAERGRPADGVERRIQGAKVRPPLEAGDYLRAFVRAVPLLLK
FT                   RGEVLEALAKVHTLFEAIHPYRGGNGRVGRVLLNYVAIRSGLPPLVVKSLEDQDRKRYY
FT                   EALEQADRGLHHGFPPPEPNALVGTLDQGEWRPLALLLGEALLARLDKVIALALVRFAD
FT                   LLPLDQVARSLGVDRQILYVWQQRGRLVVYRPGGKRNLLSHPWLFLGTRERPPLLPPEL
FT                   PPPRPEWPERVKDLQRLLFHPEDL"
FT   CDS_pept        complement(200179..201318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82125.1 percent identity 99 in 379
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70026"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70026"
FT                   /db_xref="GOA:Q5SLU0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70026.1"
FT                   /translation="MAARVFFLFALGYFLSYFYRSANAVLAKDLSQELGLGPAELGFMT
FT                   SLFYLAFAAAQLPLGGLLDRVGPRAVTPALLLVAALGSVVFGLAQSFAVLALGRALIGV
FT                   GMAAALMGSMRAFSLWFPRNYATVSTLLVGLGATGGLMAATPLALLKEALGWRGVFLLG
FT                   AFVVALVALALYLGVRNTPPGVAWPGGQRGDGLGEVFRNGRLLRVAFLAFAFAGSFLAL
FT                   QTLWAGDYAYHLGLTALEVGNLLFLYSGGAVLGFLVSGYLADRLGTARVLLASALLFAL
FT                   GLLLLLLKALVPAYALLGFFGAFNILTLTQARELVPSHLVGRGTTLVNLFGIGGTFLLQ
FT                   WGVGVAVEALGYALAFGGLLALLLLALGLYLPLLHKSSG"
FT   CDS_pept        complement(201320..202132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0204"
FT                   /product="conserved hypothetical protein, integral membrane
FT                   protein"
FT                   /note="similar to GB:AAS82124.1 percent identity 99 in 270
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70027"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70027"
FT                   /db_xref="GOA:Q5SLT9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70027.1"
FT                   /translation="MIPVALAALLWGLGGALAGRFMREIPPEVLIPLRFLLSFLLLLPL
FT                   VLARPPHPDERRRLLGVGLALSGAQAFYYLAIHATTVATGIFLQYLAPSLLTLYALLKG
FT                   ERLPGRALFGVGLALLGAYLLVVGPEGLRGGALGVAYGLLSAVSFAAYAAFAHGLRTPA
FT                   FVALGVATGVGALLSLPVLGLHGEKVLALGPAQWGAVAYLVTLGTVVPFGLFLLGVRTL
FT                   PARTATLVAMLEPLSGALFAWPLAGEPLRPEALLGGGMILGGVWLNRR"
FT   CDS_pept        complement(202129..203025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82123.1 percent identity 99 in 298
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70028"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70028"
FT                   /db_xref="GOA:Q5SLT8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70028.1"
FT                   /translation="MRTMRPPGWKIAAVLLVGILAISFGSILVRLALRASGDQSLAFSL
FT                   VMSAGRLALAALLLAPGWTRPLEGRAGLPFALAAGGFLALHFAFWITSLSYTSVAASTA
FT                   LVTTNPVWVTLLGWWLFGERPSFLTLLGVGVALLGGVLIGLGDSEGGGGANPLLGDFLA
FT                   LLGAVAASCYFLLGREAQRRGLSTWAYVRVAYTAAALLLLPLPYLFGGGYGGYPLEVYA
FT                   YLLLMALLPQLVGHTSFNWATRHIPPVLVTLAILFEPVGASLLAYFLFGELPGSRVLLG
FT                   ALILLVGVALAVVGGRR"
FT   CDS_pept        203137..204264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0206"
FT                   /product="nicotinamide nucleotide transhydrogenase, alpha
FT                   subunit 1"
FT                   /note="similar to GB:AAS82122.1 percent identity 100 in 375
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70029"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70029"
FT                   /db_xref="GOA:Q5SLT7"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70029.1"
FT                   /translation="MVTVAVPKERAPGERRVALVPEVVARLVKGGARVRVERGAGEGAY
FT                   HPDEAYQEAGAEVVERGELLKGAHLLFTVQPPPEDLIQALEPGAIVVGFVQPHKNLELV
FT                   RALQAKKATVIAMELIPRITRAQSMDALSSQATVAGYLAAIHAARLSPRFFPMLTTAAG
FT                   TIRPAKVMVMGVGVAGLMAIATAKRLGAQVFAYDVRKAALEQALSLGAKPIELPISAEG
FT                   EGGYARELTEEEKRIQHEALRDHVAGMDVLITTAQVPGRRAPILLTEDMVERLKPGTVV
FT                   VDLAAESGGNCVLTKPGEVVEVRGVRVYGPLNLPSELSVHASEMYAKNLYNLSSLLIEK
FT                   GAFAPKWEDEIVRAALLMKEGEVLHGPTKALLGGA"
FT   CDS_pept        204264..204566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0207"
FT                   /product="nicotinamide nucleotide transhydrogenase, alpha
FT                   subunit 2"
FT                   /note="similar to GB:AAS82121.1 percent identity 99 in 100
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70030"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70030"
FT                   /db_xref="GOA:Q5SLT6"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70030.1"
FT                   /translation="MEFNFWSALYIFVLTAFLGYELITRVPVILHTPLMSGSNFIHGVV
FT                   VVGAMVVLGHAETGLEKLIGFLGVILGAANAAGGYAVTVRMLEMFERKPGQGGGR"
FT   CDS_pept        204566..205918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0208"
FT                   /product="nicotinamide nucleotide transhydrogenase, beta
FT                   subunit"
FT                   /note="similar to GB:AAS82120.1 percent identity 99 in 450
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70031"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70031"
FT                   /db_xref="GOA:Q5SLT5"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70031.1"
FT                   /translation="MDLIQAAYFVVAILFIVGLKRMAHPTTAKSGIVWAGWGMVLAVLA
FT                   TFFWPGMGNFALILLALLLGSAVAWWAAVRVAMTDMPQMVAIYNGMGGGAAATIAAVEL
FT                   LKGAFENTGLMALAILGGLIGSVAFTGSLIAFAKLQGIMKSRPILFPGQKAVNALVLAL
FT                   TLVLGLSLLWNDATASIVLFFLLALLFGVLMTLPIGGGDMPVAISFYNAFTGMAVGFEG
FT                   FAVGNPALMVAGTLVGAAGTLLTVLMARAMNRSVWSVLVGGFGVEQEAGEVKGSLKPID
FT                   VEDAAVMLAYAGKVVFVPGYGMALSQAQHKLKELADLLEARGVEVKFAIHPVAGRMPGH
FT                   MNVLLAEAGVDYDKLKDLEEINPEFPTVDVAVVIGANDVVNPAARRPGSPLYGMPILDV
FT                   DKAKNVIVIKRGQGKGFAGVENELFYAENTRMLYGDAQKVLTELIQALKRL"
FT   CDS_pept        206107..206628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0209"
FT                   /product="50S ribosomal protein L10"
FT                   /note="similar to GB:AAS82119.1 percent identity 99 in 173
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70032"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70032"
FT                   /db_xref="GOA:Q8VVE3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="PDB:4V51"
FT                   /db_xref="PDB:4V6F"
FT                   /db_xref="PDB:4V7J"
FT                   /db_xref="PDB:4V7K"
FT                   /db_xref="PDB:4W2E"
FT                   /db_xref="PDB:4WPO"
FT                   /db_xref="PDB:4WQF"
FT                   /db_xref="PDB:4WQU"
FT                   /db_xref="PDB:4WQY"
FT                   /db_xref="PDB:5A9Z"
FT                   /db_xref="PDB:5AA0"
FT                   /db_xref="PDB:5HAU"
FT                   /db_xref="PDB:5IMQ"
FT                   /db_xref="PDB:5IMR"
FT                   /db_xref="PDB:5J8B"
FT                   /db_xref="PDB:5ZLU"
FT                   /db_xref="PDB:6GSL"
FT                   /db_xref="PDB:6QNQ"
FT                   /db_xref="PDB:6QNR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VVE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70032.1"
FT                   /translation="MPNKRNVELLATLKENLERAQGSFFLVNYQGLPAKETHALRQALK
FT                   QNGARLFVAKNTLIRLALKELGLPELDGLQGPSAVVFYEDPVAAAKTLVQFAKSNPKGI
FT                   PQVKSGLLQGQILTAKDVEALAELPTMDELRAELVGVLQAPMAELVGVLGGVARELVGI
FT                   LEAYAEKKAA"
FT   CDS_pept        206642..207019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0210"
FT                   /product="50S ribosomal protein L12"
FT                   /note="similar to GB:AAS82118.1 percent identity 100 in 125
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70033"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70033"
FT                   /db_xref="GOA:Q8VVE2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="PDB:4V42"
FT                   /db_xref="PDB:4V4P"
FT                   /db_xref="PDB:4V51"
FT                   /db_xref="PDB:4V6F"
FT                   /db_xref="PDB:6GSL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VVE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70033.1"
FT                   /translation="MALDIERIKEELSQATVLELKQLIDALKEAWGVTAAAPVAVAAAP
FT                   AAGAAAAPAEEKTEFDVILKEAGAKKLEVIKELRAITGLGLKEAKDLAEKGGPVKEGVS
FT                   KQEAEEIKKKLEAVGAVVELK"
FT   CDS_pept        complement(207069..208184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0211"
FT                   /product="lipoprotein releasing system transmembrane
FT                   protein"
FT                   /note="similar to GB:AAS82117.1 percent identity 99 in 371
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70034"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70034"
FT                   /db_xref="GOA:Q5SLT2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70034.1"
FT                   /translation="MRFALFLAWAHIWRRPLQSALAVLGVGVGVGVLLVALSLANGFMD
FT                   GLVRATLKAYPQLVLFSLEPTLPPLPSHPEVEAAAPFAATKALLTRPAEAGRGPGVDFA
FT                   TLVGLGAGGEALYPELGLRLEPGGIYLGAALMQSLDARPGDRLYALSATQERVELKVLG
FT                   SFRTGNYLIDSGFAFTDLESVKRLSGLEAQGYQVRLKDPWRAREVGWALAGSRFFPQPW
FT                   QDTQRTLLEQLSLQRQVLGLLIFLIVAVAALGVANLLFLKVVEKTPEIALLRAMGASRG
FT                   TVGLVFALEGAILGVGGVALGNLLGYLLGLYLARRPLDLPGELYFLTHLPVEMRLADFL
FT                   WVSGASLLAVLLSALLPLLRALRVRPGVVLR"
FT   CDS_pept        complement(208206..208637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82116.1 percent identity 100 in 143
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70035"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70035"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70035.1"
FT                   /translation="MRGLLLAISLLAVPWPQALAQSAGKPKVLILEATAYTSSVRETDS
FT                   TPHITATGARTRLGILAVSRDLLEILPFGTKVRLKDLGTIYGRGKGQFDALFKDIVFVV
FT                   ADVMNARWRKKVDIWFPDRATALRFGRRKVQLEVVAYPE"
FT   CDS_pept        complement(208824..209621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0213"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82115.1 percent identity 99 in 199
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70036"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70036"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70036.1"
FT                   /translation="MWRIMALLSLFLAACNLSLSPPLAGDLPVGGNLVATLPPAQGASG
FT                   GSLRPGVAVFRLLPDQDGAVEVAAVSAGLELSARLRLVLLDERGVVQAVSVARNWFGAY
FT                   PEVAPLGLRPQGITTDPGVRLNFRGQAGQAYHLRVENYALAEDRVNLSATGFVPNPSGK
FT                   GEALTSGSVQGAIEFVGEFDRYDVSGAGGYLRFVYAGPLDLVALLYNGPDDLYPRALDP
FT                   VRNCAPLSPATLLVVRDRGLARAGFDEEGSGRYTLELSSTPCP"
FT   CDS_pept        complement(209751..211319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0214"
FT                   /product="probable kinase"
FT                   /note="similar to GB:AAS82114.1 percent identity 99 in 522
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70037"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70037"
FT                   /db_xref="GOA:Q5SLS9"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70037.1"
FT                   /translation="MAEAWGPEAVAEAFRYATRWFQVYVEELNALNVYPVPDGDTGTNM
FT                   LHTLEAARRELDLADTSRMDQVARALAYGSLLGARGNSGVILSQILRGFAEALKGKRAL
FT                   DGSLLRRALRMGAESGYKAVMRPVEGTILTVARAAGEGARGEALEEVLETALEAAREAL
FT                   ERTPELLPVLRQAGVVDAGGAGYVRLLEGMRGYALGLPLPEPPKVERYAQTAFATEEFG
FT                   YCTEFLMEGVEVPVERIREAVAPFGDSLLVVGAEGYVKGHIHTDDPDGLLATVARFGRV
FT                   VRTKVEDMTQQHTEILSTFGLLAEEVPPTGLVAVALGHGLARAFRSLGARVVAGGQTQN
FT                   PSVEDLLAAIRSVPNPKVILLPNNPNVFLAATEAAKLAREAGKEVHVLKTRTLGQGLAA
FT                   AVRYTPEALPEELLPEMEEAMAGAVTLEVTWASRDAEVEGLKVLKDRPIGLLDGRLVLV
FT                   GETPEEVVEGLVRMAREGKEVLTLFLGPNTPKEKAQGVAQKFPELAVEILPGGPDLYAY
FT                   LGVLE"
FT   CDS_pept        complement(211312..211653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0215"
FT                   /product="alkaline shock protein"
FT                   /note="similar to GB:AAS82113.1 percent identity 100 in 113
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70038"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70038"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70038.1"
FT                   /translation="MPGRVVLTEAALASLLALVAHEVPGVVGMAPAGLKDQVGRILGRQ
FT                   EAGEGVVVRPDPQSPGRYQVDLYVVLAYGTRVPALAEALGERLAYAARHLGGVELSQVR
FT                   VHVVGVRCG"
FT   CDS_pept        complement(211656..212765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0216"
FT                   /product="alanine dehydrogenase"
FT                   /note="similar to GB:AAS82112.1 percent identity 99 in 369
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70039"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70039"
FT                   /db_xref="GOA:Q5SLS7"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:2EEZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70039.1"
FT                   /translation="MVIGVPKEIKTLENRVALTPGGVESLVRRGHTVLVERGAGEGSGL
FT                   SDAEYARAGAELVGREEAWGAEMVVKVKEPLPEEYGFLREGLILFTYLHLAADRGLTEA
FT                   MLRSGVTGIAYETVQLPDGTLPLLVPMSEVAGRMAPQVGAQFLEKPKGGRGVLLGGVPG
FT                   VAPASVVILGGGTVGTNAAKIALGMGAQVTILDVNHKRLQYLDDVFGGRVITLTATEAN
FT                   IKKSVQHADLLIGAVLVPGAKAPKLVTRDMLSLMKEGAVIVDVAVDQGGCVETIRPTTH
FT                   AEPTYVVDGVVHYGVANMPGAVPRTSTFALTNQTLPYVLKLAEKGLDALLEDAALLKGL
FT                   NTHKGRLTHPGVAEAFGLPYTPPEEALRG"
FT   CDS_pept        complement(212768..213706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0217"
FT                   /product="tRNA pseudouridine 55 synthase"
FT                   /note="similar to GB:AAS82111.1 percent identity 100 in 312
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70040"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70040"
FT                   /db_xref="GOA:Q5SLS6"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70040.1"
FT                   /translation="MALYAVDKPLHLTSHDVVEEARRRLSTRRVGHTGTLDPLATGLLL
FT                   LVTNESTKLVPFLSGEDKEYIAWVSFGATTPTLDAEGPISEEAPARFDRKDLEAALPRF
FT                   LEVREQVPPLYSAIKVGGKRAYEAAREGKPLALGPRPVRYLEVELLAFDPEPIPHPIAP
FT                   SARGWRLAERRGRPVRLPRPLGAYPTAVVRLVVGPGTYVRAFARDLGEMLGTKAFLSGL
FT                   VRTRVGRVGLERAVALSDLSPEKAIPELDVLPFPVVELSHTEARRVLEGMPLPIPAMGY
FT                   VTLVDSKRRLLAIAEGDGFKLKIRRVFAKEA"
FT   CDS_pept        213747..214541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0218"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="similar to GB:AAS82110.1 percent identity 99 in 264
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70041"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70041"
FT                   /db_xref="GOA:Q5SLS5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="PDB:1WZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70041.1"
FT                   /translation="MLASLEARYPGLAFAWPRPGVLEITFRGEKLNAMPPALHRGLARV
FT                   WRDLEAVEGVRAVLLRGEGGVFSAGGSFGLIEEMRASHEALLRVFWEARDLVLGPLNFP
FT                   RPVVAAVEKVAVGAGLALALAADIAVVGKGTRLLDGHLRLGVAAGDHAVLLWPLLVGMA
FT                   KAKYHLLLNEPLTGEEAERLGLVALAVEDEKVYEKALEVAERLAQGPKEALHHTKHALN
FT                   HWYRSFLPHFELSLALEFLGFSGKELEEGLKALKEKRPPEFP"
FT   CDS_pept        214538..215245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0219"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /note="similar to GB:AAS82109.1 percent identity 99 in 235
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70042"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70042"
FT                   /db_xref="GOA:Q5SLS4"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70042.1"
FT                   /translation="MKALRLQAFLARAGVASRRKAEDLIREGRVRVNGKVAVLGQKVGP
FT                   EDLVEVDGKRVELPQKRLVLALHKPKGYTTTRHDPHARRTVFDLLPKIPGLHPVGRLDR
FT                   DSEGLLLLTNDGDLTHRLTHPRFGVRKVYRVWTEGGTLPKEVCRRLLLGVDLEDGPARA
FT                   LACRPAPGGAVLVLAEGRKREVRRMLQRVGYPVRRLLRLQVGPIRLGDLPPGKWRRLSE
FT                   REVKALLRLVGLE"
FT   CDS_pept        215242..215787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0220"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /note="similar to GB:AAS82108.1 percent identity 99 in 181
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70043"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70043"
FT                   /db_xref="GOA:Q5SLS3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="PDB:3ACB"
FT                   /db_xref="PDB:3ACC"
FT                   /db_xref="PDB:3ACD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70043.1"
FT                   /translation="MKGMFTPGNGPVQISAEAIKKRVEELGGEIARDYQGKTPHLICVL
FT                   NGAFIFMADLVRAIPLPLTMDFIAISSYGNAFKSSGEVELLKDLRLPIHGRDVIVVEDI
FT                   VDTGLTLSYLLDYLEARKPASVRVAALLSKPSRRQVEVPIHYLGFEIEDAYVYGYGLDR
FT                   AQFDRNLPFITSIRPEEE"
FT   CDS_pept        215784..216452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82107.1 percent identity 100 in 222
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70044"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70044"
FT                   /db_xref="GOA:Q5SLS2"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70044.1"
FT                   /translation="MRYLDLLTALFATVLLVSNVASTKLVVLGPFTFDGGTLLFPLAYI
FT                   FGDVLTEVYGYRKSRRVIWIGFFALLLATLTFQAVAHLPAPPDAESQRFGEAFGLLLGL
FT                   TPRIVLGSLLAYFLGEFANAYVLAKLKVRTEGRFFWLRALASTLVGQGLDTGVFLLVAF
FT                   YGVFPKEVLLAVFLSNYAFKLGVEALMLPFTYAVVGFLKRAEGMDAYDRDTDFNPFRLT
FT                   "
FT   CDS_pept        216549..217775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0222"
FT                   /product="adenylosuccinate synthase"
FT                   /note="similar to GB:AAS82106.1 percent identity 100 in 408
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70045"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70045"
FT                   /db_xref="GOA:Q5SLS1"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70045.1"
FT                   /translation="MPGIAIIGAQWGDEGKGKVVDVLAREADYVIRYQGGANAGHTVVA
FT                   EGKVFKLNLLPSGVIHPHAVNVLGDGMVIDPFRFQEEVEGLRKEGFDPKILVSERAHLV
FT                   LPHHKHVESRHNFVGTTGRGIGPAYSDRARRVGIRAGDLLDEATLRERVRRLLAEKPNS
FT                   TREAGWDTEEKALADLHRMREILSPYIADTGSLLREAWRKGKRLLFEGAQATLLDLNYG
FT                   TYPYVTSSHPTVGGILVGTGLSHKAITKVYGVAKAYTTRVGEGPFPTELQGELAHHLRE
FT                   KGGEYGTTTGRPRRVGWLDLVALRYACEVNGFDGLVLTKLDVLSGLEKVKVAVEYLDGA
FT                   RPGEASPEAVRYLELPGWGDLSHVKRREDLPANLLRYLELVEEHTGVPVVLFSTSPRRE
FT                   DTFGAVSWV"
FT   CDS_pept        complement(217780..218571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82105.1 percent identity 98 in 263
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70046"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70046"
FT                   /db_xref="GOA:Q5SLS0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:2YQZ"
FT                   /db_xref="PDB:2YR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70046.1"
FT                   /translation="MSSALLRAAYAYDRLRAHPPEVAGQIATAMASAVHPKGEEPVFLE
FT                   LGVGTGRIALPLIARGYRYIALDADAAMLEVFRQKIAGVDRKVQVVQADARAIPLPDES
FT                   VHGVIVVHLWHLVPDWPKVLAEAIRVLKPGGALLEGWDQAEASPEWTLQERWRAFAAEE
FT                   GFPVERGLHAKRLKEVEEALRRLGLKPRTREVARWREERTPREALEALSERLYSFTQGL
FT                   PEPVHARVMERLWAWAEAELGDLDRPFPVEKRFLLRVSRLG"
FT   CDS_pept        218605..219651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0224"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="similar to GB:AAS82104.1 percent identity 99 in 348
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70047"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70047"
FT                   /db_xref="GOA:Q5SLR9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005908"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70047.1"
FT                   /translation="MKGLILAAGRGTRLRPLTHTRPKPAIRVAGRPIIHYAVENLLEAG
FT                   VREIGVVVSPETERDLKVALEGYPVRYVLQEEPQGLAHAVDVARGFLGESPFVLYLGDN
FT                   LFQKGIRRFLEAFKPGVSAVIALVRVEDPRQFGVAVLEGNRVVRLLEKPKDPPSDLAVA
FT                   GVYVFSPEVLEVVRGLKPSARGEYEITDAIQGLIDRGKTVVGVEVEGWWKDTGRHQDLL
FT                   DANRLLLEELTPKVEGDVVESQLTGRVVVEKGAKVVRSTVIGPAHIGAGAVVEEAFVGP
FT                   FTSVGPRARVVRSEVEYSLLEEEAVVEEVRLRLQECILGVRAEVKSRDGLPRAHRLILG
FT                   DLSQVELA"
FT   CDS_pept        219655..220539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0225"
FT                   /product="biotin operon
FT                   repressor/biotin-[acetyl-CoA-carboxylase] synthetase"
FT                   /note="similar to GB:AAS82103.1 percent identity 99 in 294
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70048"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70048"
FT                   /db_xref="GOA:Q5SLR8"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70048.1"
FT                   /translation="MPGLLDLLTESWQSGEALAERLGVSRAAVSKEARRLRAEGYPVEV
FT                   SRRGYRILPGTPLPHLFHPRGRLGRPYRYLGRVGSTQDVLRAWAEEGAPEGALVLAEVQ
FT                   ERGRGRRGRPWESRPGGSLTFSLLLRPGLPLSALGLLPLLAGLALREAVGVGGLKWPND
FT                   LLAPDGGKLAGVLLEARAEGEEVSYALLGVGVNVAWAPEGAAFLQAYAPLSRREVLEGF
FT                   LLKLEALLPLLQTPEALLERYRQASLTLGRKVRVHTGKGVVEGLAEDVLPDGSLLVGGV
FT                   RVGAGEVELLPLL"
FT   CDS_pept        220638..221063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82102.1 percent identity 99 in 141
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70049"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70049"
FT                   /db_xref="InterPro:IPR018699"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70049.1"
FT                   /translation="MFARIFTKEEADALLPEIQRVLSQMRQARAELKEAQARLPEARGL
FT                   ERRALEEEVRFLLGSLEADARYLASLGVFLKDLDQGLVDFPGRVGGQVVFLCWKEGEPE
FT                   VAHYHPLSGGFAERKPLAEATPTLPQKARPGEKRPGA"
FT   CDS_pept        complement(221014..221406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82101.1 percent identity 99 in 130
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70050"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70050"
FT                   /db_xref="GOA:Q5SLR6"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="PDB:2EJQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70050.1"
FT                   /translation="MTYEAFVELVERLWEEVPEDFKRGLQGVHVFPEAKPEPGLEGVWR
FT                   LGEYLDPGPPSAFGGFEDLGRHIALYYGSFLEVAGEGFDWEAEVWETLLHELRHHLESL
FT                   AGRDDLVQEDLRRLDAFRRGGPSGEG"
FT   CDS_pept        complement(221403..221816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82100.1 percent identity 98 in 137
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70051"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70051"
FT                   /db_xref="GOA:Q5SLR5"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70051.1"
FT                   /translation="MRLRVVAVGRPRLAYARLGVEEYARRMRRYAPLDLVFVRKGEELL
FT                   PKAEGHRKVVLDERGRLLTTEELYRRLLAWEGERVAFLVGGAEGHPEAVREEADLLLSL
FT                   SPLTLQHELALLVLMEQLYRVLTLRAGHPYHRP"
FT   CDS_pept        221947..223050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0229"
FT                   /product="2-oxoisovalerate dehydrogenase, E1 component
FT                   alpha subunit"
FT                   /note="similar to PDB:1BKG percent identity 100 in 367 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70052"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70052"
FT                   /db_xref="GOA:Q5SLR4"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="PDB:1UM9"
FT                   /db_xref="PDB:1UMB"
FT                   /db_xref="PDB:1UMC"
FT                   /db_xref="PDB:1UMD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70052.1"
FT                   /translation="MVKETHRFETFTEEPIRLIGEEGEWLGDFPLDLEGEKLRRLYRDM
FT                   LAARMLDERYTILIRTGKTSFIAPAAGHEAAQVAIAHAIRPGFDWVFPYYRDHGLALAL
FT                   GIPLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVASPIASHVPPAAGAAISMKLL
FT                   RTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFYAISVDYRHQTHSPTIA
FT                   DKAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRYGPHSSADDDSR
FT                   YRPKEEVAFWRKKDPIPRFRRFLEARGLWNEEWEEDVREEIRAELERGLKEAEEAGPVP
FT                   PEWMFEDVFAEKPWHLLRQEALLKEEL"
FT   CDS_pept        223060..224034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0230"
FT                   /product="2-oxoisovalerate dehydrogenase, E1 component beta
FT                   subunit"
FT                   /note="similar to GB:AAS82098.1 percent identity 99 in 324
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70053"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70053"
FT                   /db_xref="GOA:Q5SLR3"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="PDB:1UM9"
FT                   /db_xref="PDB:1UMB"
FT                   /db_xref="PDB:1UMC"
FT                   /db_xref="PDB:1UMD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70053.1"
FT                   /translation="MALMTMVQALNRALDEEMAKDPRVVVLGEDVGKRGGVFLVTEGLL
FT                   QKYGPDRVMDTPLSEAAIVGAALGMAAHGLRPVAEIQFADYIFPGFDQLVSQVAKLRYR
FT                   SGGQFTAPLVVRMPSGGGVRGGHHHSQSPEAHFVHTAGLKVVAVSTPYDAKGLLKAAIR
FT                   DEDPVVFLEPKRLYRSVKEEVPEEDYTLPIGKAALRREGKDLTLIGYGTVMPEVLQAAA
FT                   ELAKAGVSAEVLDLRTLMPWDYEAVMNSVAKTGRVVLVSDAPRHASFVSEVAATIAEDL
FT                   LDMLLAPPIRVTGFDTPYPYAQDKLYLPTVTRILNAAKRALDY"
FT   CDS_pept        224037..224240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0231"
FT                   /product="2-oxoisovalerate dehydrogenase, E1 component beta
FT                   subunit"
FT                   /note="similar to GB:AAS82097.1 percent identity 98 in 67
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70054"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70054"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70054.1"
FT                   /translation="MREIIFLVEEAEEGGFVARALGEAIFTEGETWEELKEMVRDAVRC
FT                   HFGEEAPPIIRLHFVREEVLTP"
FT   CDS_pept        224493..225848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0232"
FT                   /product="pyruvate dehydrogenase complex, dihydrolipoamide
FT                   acetyltranferase E2 component"
FT                   /note="similar to GB:AAS82096.1 percent identity 99 in 451
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70055"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70055"
FT                   /db_xref="GOA:Q5SLR1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="PDB:2EQ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70055.1"
FT                   /translation="MPKEILMPELAESVVEGEILKWLVEEGDYLKKDQPFVEVMTDKVT
FT                   VELPSPYEGVLLKKLAKEGEVVKVHAPIALIAEPGEAVEGVKEAPPVQAVEERSIVEPG
FT                   LPAKEEKEDLSLFKPDPTQVAVKNPFLSGEKPQEGARPGRVLAVPAARKLARELGIPIE
FT                   EVPGSGPLGRVRVEDVRAYAERRKAPPERPEEGPQVLPAGFPPPPKYAPPKGYEHLEER
FT                   VPLRGIRRTIAQGLWQSHLYTVRTLNVDEADLTELVRLRERLKPQAEAQGVKLTYLPFI
FT                   VKAVVRALKKFPMLNTSLDEERQEIVYKRYYHIGLAVATERGLIVPVVRDADRKSVLEL
FT                   AQEIAELSQKAREGRLAPEEVTGSTFTITNIGSVGATLSFPIIHLPDAAILGVHSIRKR
FT                   PWVMPDGSIRPRDIMFLSLSFDHRLVDGAEAAMFTREVIRLLENPDLLLLEM"
FT   CDS_pept        225850..227244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0233"
FT                   /product="pyruvate dehydrogenase complex, dihydrolipoamide
FT                   dehydrogenase E3 component"
FT                   /note="similar to GB:AAS82095.1 percent identity 99 in 461
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70056"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70056"
FT                   /db_xref="GOA:Q5SLR0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:2EQ6"
FT                   /db_xref="PDB:2EQ8"
FT                   /db_xref="PDB:2EQ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70056.1"
FT                   /translation="MTPMKTYDLIVIGTGPGGYHAAIRAAQLGLKVLAVEAGEVGGVCL
FT                   NVGCIPTKALLHAAETLHHLKVAEGFGLKAKPELDLKKLGGWRDQVVKKLTGGVGTLLK
FT                   GNGVELLRGFARLVGPKEVEVGGERYGAKSLILATGSEPLELKGFPFGEDVWDSTRALK
FT                   VEEGLPKRLLVIGGGAVGLELGQVYRRLGAEVTLIEYMPEILPQGDPETAALLRRALEK
FT                   EGIRVRTKTKAVGYEKKKDGLHVRLEPAEGGEGEEVVVDKVLVAVGRKPRTEGLGLEKA
FT                   GVKVDERGFIRVNARMETSVPGVYAIGDAARPPLLAHKAMREGLIAAENAAGKDSAFDY
FT                   QVPSVVYTSPEWAGVGLTEEEAKRAGYKVKVGKFPLAASGRALTLGGAEGMVKVVGDEE
FT                   TDLLLGVFIVGPQAGELIAEAALALEMGATLTDLALTVHPHPTLSESLMEAAEAFHKQA
FT                   IHILNR"
FT   CDS_pept        complement(227477..228697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0234"
FT                   /product="transposase"
FT                   /note="similar to DBJ:BAC55317.1 percent identity 99 in 405
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70057"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70057"
FT                   /db_xref="GOA:Q5SJJ0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SJJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70057.1"
FT                   /translation="MFNRGAHLGTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDRT
FT                   AFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYARRLVDVGEVAVAL
FT                   YAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLDGLS
FT                   LKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGLRRVL
FT                   LFVTDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRSRDRALLAEDLRRVYGAESR
FT                   EEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLMERFIREL
FT                   RRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQERYAPRT
FT                   QTLTQSP"
FT   CDS_pept        complement(228776..229426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82093.1 percent identity 100 in 216
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70058"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70058"
FT                   /db_xref="GOA:Q5SLQ8"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70058.1"
FT                   /translation="MKRGLGAAWPVALGYFPVAVAFGALGAQAGLSPLWVQLTSLLVFA
FT                   GASQFALVGLLAQGVPPLLAALLGLLLNLRHAFYGPALRPYLRGGPLEAFFLTDEVFAV
FT                   ALRALPGLPPGERRGYFLGLGLGAYLSWNLGTALGVLGAQGLLAFPGLGEALSFALPAL
FT                   FFLLALPHLKNPVALLAGGVALGFHLLGQTAWGLFLAGVTGLLGEGFGERRRP"
FT   CDS_pept        complement(229423..230754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82092.1 percent identity 99 in 443
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70059"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70059"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70059.1"
FT                   /translation="MGPPPGREVGPGEEVEFAGDEPHVYASEEGASLLVFLHYPLPPRP
FT                   QGEAGSPEKASLALREVSLGVGGLALEGRWLAPGFQEGVFVRWGANRTYLFSLPLAPLP
FT                   RLEAQGLLGEALALLHAPKEDLRSHGQSPSLLLRTLAWEGLLLKGEVADPAPLLVQTAR
FT                   SPVGSSKEEDWESRISVDLYARVELLHPGYARQPLFLAYGLQAVGLERGRFLDVGTGPG
FT                   HHLLLLLELLPHLEPVAVEPSPASRQALAQLIPGVEVLPEDFTLLDPEETFPLIVCVGA
FT                   SHHMSTWRFLEKAYRLLRPGGLLAVADEFLRPFTTREERARNLVLHHTAYLLPFPLEET
FT                   EALWALRLLALQGESRGLRALAEEALQDLETRSDAFATFARLELQALLAGLDYEVETKT
FT                   YPRRFLELTFAVGFELEHHHRLFATHGRGSWDGGTHLFLLRRPK"
FT   CDS_pept        complement(230822..231691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0237"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /note="similar to GB:AAS82091.1 percent identity 100 in 289
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70060"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70060"
FT                   /db_xref="GOA:Q5SLQ6"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:1WP4"
FT                   /db_xref="PDB:2CVZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70060.1"
FT                   /translation="MEKVAFIGLGAMGYPMAGHLARRFPTLVWNRTFEKALRHQEEFGS
FT                   EAVPLERVAEARVIFTCLPTTREVYEVAEALYPYLREGTYWVDATSGEPEASRRLAERL
FT                   REKGVTYLDAPVSGGTSGAEAGTLTVMLGGPEEAVERVRPFLAYAKKVVHVGPVGAGHA
FT                   VKAINNALLAVNLWAAGEGLLALVKQGVSAEKALEVINASSGRSNATENLIPQRVLTRA
FT                   FPKTFALGLLVKDLGIAMGVLDGEKAPSPLLRLAREVYEMAKRELGPDADHVEALRLLE
FT                   RWGGVEIR"
FT   CDS_pept        complement(231701..232060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0238"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82090.1 percent identity 99 in 119
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70061"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70061"
FT                   /db_xref="GOA:Q5SLQ5"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70061.1"
FT                   /translation="MSRKTALFLLDLLALLLFAGVGLLSHGLPLSLGGLARNVLPVLFV
FT                   WLLLAPFLGTYRRPTWKNLLLTWLFAFPAGLWLRQMVLGGTFGVGFFVFLGVAMGFSLL
FT                   FLLLLRGLAKGLRLW"
FT   CDS_pept        complement(232057..233028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0239"
FT                   /product="lipoic acid synthase"
FT                   /note="similar to GB:AAS82089.1 percent identity 100 in 323
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70062"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70062"
FT                   /db_xref="GOA:Q5SLQ4"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70062.1"
FT                   /translation="MKPKFETVELLSPTGEVVELKVVKRGLAQARPEPVDRNKPAWIKA
FT                   PLPTGPRYQALKAMVRELRLHTVCQEALCPNIGECWTHGTLTVMILGDICTRACKFCAV
FT                   HTGNPKGLVDPEEPRRVAEAIARMGVRYVVLTSVDRDDLPDGGASHFAATIRAIKERAP
FT                   GVLVEALTPDFQGDLKAVETVLAANPEVYAQNLETVRRLTPKVRDPRAGYEQTLKVLAH
FT                   AKKVRPDILTKSSLMLGLGETEEEILEAMRDLRAAGVDILTLGQYLRPTPAHLPVARYV
FT                   PPEDFKRYEAWGYELGFREVFAGPLVRSSYRADRVFLEATQR"
FT   CDS_pept        complement(233018..233671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0240"
FT                   /product="lipoate-protein ligase B"
FT                   /note="similar to GB:AAS82088.1 percent identity 99 in 217
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70063"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70063"
FT                   /db_xref="GOA:Q5SLQ3"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="PDB:2QHS"
FT                   /db_xref="PDB:2QHT"
FT                   /db_xref="PDB:2QHU"
FT                   /db_xref="PDB:2QHV"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70063.1"
FT                   /translation="MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVI
FT                   TLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLR
FT                   QIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLND
FT                   FTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPVEGSVHEA"
FT   CDS_pept        complement(233814..234638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0241"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="similar to GB:AAS82087.1 percent identity 99 in 274
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70064"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70064"
FT                   /db_xref="GOA:Q5SLQ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70064.1"
FT                   /translation="MARAVLVTGAGSGIGLATARLLTAKGYRVYGGVRREEDAARLAQE
FT                   GVVPLLLDVTREEDLLRARERLVGEGLWGLVVNAGIAVAGPLELVPLSAFREALEVNVL
FT                   GAFATVKAFLPLLRASRGRVVLMGSVSGLVALPLMGPYAASKFALEALADALRVELLPF
FT                   GVRVVLIEPGSVATPIWERSLRRAEGYLEPPPPGTEGVYGRYLEVARRVAERSAKRGLP
FT                   PERVAEAVLKALESPNPRARYLVAHPARARETLLLRLFPAPLRDRLVARFLG"
FT   CDS_pept        complement(234742..235188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0242"
FT                   /product="50S ribosomal protein L9"
FT                   /note="similar to GB:AAS82085.1 percent identity 98 in 148
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70065"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70065"
FT                   /db_xref="GOA:Q5SLQ1"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="PDB:1VVJ"
FT                   /db_xref="PDB:1VY4"
FT                   /db_xref="PDB:1VY5"
FT                   /db_xref="PDB:1VY6"
FT                   /db_xref="PDB:1VY7"
FT                   /db_xref="PDB:4L47"
FT                   /db_xref="PDB:4L71"
FT                   /db_xref="PDB:4LEL"
FT                   /db_xref="PDB:4LFZ"
FT                   /db_xref="PDB:4LNT"
FT                   /db_xref="PDB:4LSK"
FT                   /db_xref="PDB:4LT8"
FT                   /db_xref="PDB:4P6F"
FT                   /db_xref="PDB:4P70"
FT                   /db_xref="PDB:4TUA"
FT                   /db_xref="PDB:4TUB"
FT                   /db_xref="PDB:4TUC"
FT                   /db_xref="PDB:4TUD"
FT                   /db_xref="PDB:4TUE"
FT                   /db_xref="PDB:4V42"
FT                   /db_xref="PDB:4V4P"
FT                   /db_xref="PDB:4V4X"
FT                   /db_xref="PDB:4V4Y"
FT                   /db_xref="PDB:4V4Z"
FT                   /db_xref="PDB:4V51"
FT                   /db_xref="PDB:4V5A"
FT                   /db_xref="PDB:4V5C"
FT                   /db_xref="PDB:4V5D"
FT                   /db_xref="PDB:4V5E"
FT                   /db_xref="PDB:4V5J"
FT                   /db_xref="PDB:4V5K"
FT                   /db_xref="PDB:4V67"
FT                   /db_xref="PDB:4V68"
FT                   /db_xref="PDB:4V6A"
FT                   /db_xref="PDB:4V6F"
FT                   /db_xref="PDB:4V6G"
FT                   /db_xref="PDB:4V7J"
FT                   /db_xref="PDB:4V7K"
FT                   /db_xref="PDB:4V7L"
FT                   /db_xref="PDB:4V7M"
FT                   /db_xref="PDB:4V7W"
FT                   /db_xref="PDB:4V7X"
FT                   /db_xref="PDB:4V7Y"
FT                   /db_xref="PDB:4V7Z"
FT                   /db_xref="PDB:4V87"
FT                   /db_xref="PDB:4V8A"
FT                   /db_xref="PDB:4V8B"
FT                   /db_xref="PDB:4V8C"
FT                   /db_xref="PDB:4V8D"
FT                   /db_xref="PDB:4V8E"
FT                   /db_xref="PDB:4V8F"
FT                   /db_xref="PDB:4V8G"
FT                   /db_xref="PDB:4V8H"
FT                   /db_xref="PDB:4V8I"
FT                   /db_xref="PDB:4V8J"
FT                   /db_xref="PDB:4V8N"
FT                   /db_xref="PDB:4V8X"
FT                   /db_xref="PDB:4V95"
FT                   /db_xref="PDB:4V97"
FT                   /db_xref="PDB:4V9A"
FT                   /db_xref="PDB:4V9B"
FT                   /db_xref="PDB:4V9I"
FT                   /db_xref="PDB:4V9R"
FT                   /db_xref="PDB:4V9S"
FT                   /db_xref="PDB:4W2E"
FT                   /db_xref="PDB:4W2F"
FT                   /db_xref="PDB:4W2G"
FT                   /db_xref="PDB:4W2H"
FT                   /db_xref="PDB:4W2I"
FT                   /db_xref="PDB:4W4G"
FT                   /db_xref="PDB:4WPO"
FT                   /db_xref="PDB:4WQ1"
FT                   /db_xref="PDB:4WQF"
FT                   /db_xref="PDB:4WQR"
FT                   /db_xref="PDB:4WQU"
FT                   /db_xref="PDB:4WQY"
FT                   /db_xref="PDB:4WR6"
FT                   /db_xref="PDB:4WRA"
FT                   /db_xref="PDB:4WRO"
FT                   /db_xref="PDB:4WSD"
FT                   /db_xref="PDB:4WSM"
FT                   /db_xref="PDB:4WT1"
FT                   /db_xref="PDB:4WT8"
FT                   /db_xref="PDB:4WU1"
FT                   /db_xref="PDB:4WZD"
FT                   /db_xref="PDB:4WZO"
FT                   /db_xref="PDB:4Y4O"
FT                   /db_xref="PDB:4Y4P"
FT                   /db_xref="PDB:4YPB"
FT                   /db_xref="PDB:4YZV"
FT                   /db_xref="PDB:4Z3S"
FT                   /db_xref="PDB:4Z8C"
FT                   /db_xref="PDB:4ZER"
FT                   /db_xref="PDB:4ZSN"
FT                   /db_xref="PDB:5CZP"
FT                   /db_xref="PDB:5D8B"
FT                   /db_xref="PDB:5DFE"
FT                   /db_xref="PDB:5DOX"
FT                   /db_xref="PDB:5DOY"
FT                   /db_xref="PDB:5E7K"
FT                   /db_xref="PDB:5E81"
FT                   /db_xref="PDB:5EL4"
FT                   /db_xref="PDB:5EL5"
FT                   /db_xref="PDB:5EL6"
FT                   /db_xref="PDB:5EL7"
FT                   /db_xref="PDB:5F8K"
FT                   /db_xref="PDB:5FDU"
FT                   /db_xref="PDB:5FDV"
FT                   /db_xref="PDB:5HAU"
FT                   /db_xref="PDB:5HCP"
FT                   /db_xref="PDB:5HCQ"
FT                   /db_xref="PDB:5HCR"
FT                   /db_xref="PDB:5HD1"
FT                   /db_xref="PDB:5IB7"
FT                   /db_xref="PDB:5IB8"
FT                   /db_xref="PDB:5IBB"
FT                   /db_xref="PDB:5J30"
FT                   /db_xref="PDB:5J3C"
FT                   /db_xref="PDB:5J4B"
FT                   /db_xref="PDB:5J4C"
FT                   /db_xref="PDB:5J8B"
FT                   /db_xref="PDB:5NDJ"
FT                   /db_xref="PDB:5NDK"
FT                   /db_xref="PDB:5OT7"
FT                   /db_xref="PDB:5UQ7"
FT                   /db_xref="PDB:5UQ8"
FT                   /db_xref="PDB:5VP2"
FT                   /db_xref="PDB:5VPO"
FT                   /db_xref="PDB:5VPP"
FT                   /db_xref="PDB:5W4K"
FT                   /db_xref="PDB:5WIS"
FT                   /db_xref="PDB:5WIT"
FT                   /db_xref="PDB:6BUW"
FT                   /db_xref="PDB:6BZ6"
FT                   /db_xref="PDB:6BZ7"
FT                   /db_xref="PDB:6BZ8"
FT                   /db_xref="PDB:6C5L"
FT                   /db_xref="PDB:6CAE"
FT                   /db_xref="PDB:6CFJ"
FT                   /db_xref="PDB:6CFK"
FT                   /db_xref="PDB:6CFL"
FT                   /db_xref="PDB:6CZR"
FT                   /db_xref="PDB:6FKR"
FT                   /db_xref="PDB:6GSJ"
FT                   /db_xref="PDB:6GSK"
FT                   /db_xref="PDB:6GSL"
FT                   /db_xref="PDB:6GZQ"
FT                   /db_xref="PDB:6GZX"
FT                   /db_xref="PDB:6GZZ"
FT                   /db_xref="PDB:6ND5"
FT                   /db_xref="PDB:6ND6"
FT                   /db_xref="PDB:6NDK"
FT                   /db_xref="PDB:6O97"
FT                   /db_xref="PDB:6OF1"
FT                   /db_xref="PDB:6Q95"
FT                   /db_xref="PDB:6QNQ"
FT                   /db_xref="PDB:6QNR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70065.1"
FT                   /translation="MKVILLEPLENLGDVGQVVDVKPGYARNYLLPRGLAVLATESNLK
FT                   ALEARIRAQAKRLAERKAEAERLKEILENLTLTIPVRAGETKIYGSVTAKDIAEALSRQ
FT                   HGVTIDPKRLALEKPIKELGEYVLTYKPHPEVPIQLKVSVVAQE"
FT   CDS_pept        complement(235199..235465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0243"
FT                   /product="30S ribosomal protein S18"
FT                   /note="similar to GB:AAS82084.1 percent identity 98 in 88
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70066"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70066"
FT                   /db_xref="GOA:Q5SLQ0"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="PDB:1FJG"
FT                   /db_xref="PDB:1FKA"
FT                   /db_xref="PDB:1G1X"
FT                   /db_xref="PDB:1HNW"
FT                   /db_xref="PDB:1HNX"
FT                   /db_xref="PDB:1HNZ"
FT                   /db_xref="PDB:1HR0"
FT                   /db_xref="PDB:1I94"
FT                   /db_xref="PDB:1I95"
FT                   /db_xref="PDB:1I96"
FT                   /db_xref="PDB:1I97"
FT                   /db_xref="PDB:1IBK"
FT                   /db_xref="PDB:1IBL"
FT                   /db_xref="PDB:1IBM"
FT                   /db_xref="PDB:1J5E"
FT                   /db_xref="PDB:1JGO"
FT                   /db_xref="PDB:1JGP"
FT                   /db_xref="PDB:1JGQ"
FT                   /db_xref="PDB:1L1U"
FT                   /db_xref="PDB:1ML5"
FT                   /db_xref="PDB:1N32"
FT                   /db_xref="PDB:1N33"
FT                   /db_xref="PDB:1N34"
FT                   /db_xref="PDB:1N36"
FT                   /db_xref="PDB:1VVJ"
FT                   /db_xref="PDB:1VY4"
FT                   /db_xref="PDB:1VY5"
FT                   /db_xref="PDB:1VY6"
FT                   /db_xref="PDB:1VY7"
FT                   /db_xref="PDB:1X18"
FT                   /db_xref="PDB:1XMO"
FT                   /db_xref="PDB:1XMQ"
FT                   /db_xref="PDB:1XNQ"
FT                   /db_xref="PDB:1XNR"
FT                   /db_xref="PDB:2E5L"
FT                   /db_xref="PDB:2F4V"
FT                   /db_xref="PDB:2HHH"
FT                   /db_xref="PDB:2UU9"
FT                   /db_xref="PDB:2UUA"
FT                   /db_xref="PDB:2UUB"
FT                   /db_xref="PDB:2UUC"
FT                   /db_xref="PDB:2UXB"
FT                   /db_xref="PDB:2UXC"
FT                   /db_xref="PDB:2UXD"
FT                   /db_xref="PDB:2ZM6"
FT                   /db_xref="PDB:3OTO"
FT                   /db_xref="PDB:3T1H"
FT                   /db_xref="PDB:3T1Y"
FT                   /db_xref="PDB:4AQY"
FT                   /db_xref="PDB:4B3M"
FT                   /db_xref="PDB:4B3R"
FT                   /db_xref="PDB:4B3S"
FT                   /db_xref="PDB:4B3T"
FT                   /db_xref="PDB:4DR1"
FT                   /db_xref="PDB:4DR2"
FT                   /db_xref="PDB:4DR3"
FT                   /db_xref="PDB:4DR4"
FT                   /db_xref="PDB:4DR5"
FT                   /db_xref="PDB:4DR6"
FT                   /db_xref="PDB:4DR7"
FT                   /db_xref="PDB:4DUY"
FT                   /db_xref="PDB:4DUZ"
FT                   /db_xref="PDB:4DV0"
FT                   /db_xref="PDB:4DV1"
FT                   /db_xref="PDB:4DV2"
FT                   /db_xref="PDB:4DV3"
FT                   /db_xref="PDB:4DV4"
FT                   /db_xref="PDB:4DV5"
FT                   /db_xref="PDB:4DV6"
FT                   /db_xref="PDB:4DV7"
FT                   /db_xref="PDB:4GKJ"
FT                   /db_xref="PDB:4GKK"
FT                   /db_xref="PDB:4JI0"
FT                   /db_xref="PDB:4JI1"
FT                   /db_xref="PDB:4JI2"
FT                   /db_xref="PDB:4JI3"
FT                   /db_xref="PDB:4JI4"
FT                   /db_xref="PDB:4JI5"
FT                   /db_xref="PDB:4JI6"
FT                   /db_xref="PDB:4JI7"
FT                   /db_xref="PDB:4JI8"
FT                   /db_xref="PDB:4JV5"
FT                   /db_xref="PDB:4JYA"
FT                   /db_xref="PDB:4K0K"
FT                   /db_xref="PDB:4KHP"
FT                   /db_xref="PDB:4L47"
FT                   /db_xref="PDB:4L71"
FT                   /db_xref="PDB:4LEL"
FT                   /db_xref="PDB:4LF4"
FT                   /db_xref="PDB:4LF5"
FT                   /db_xref="PDB:4LF6"
FT                   /db_xref="PDB:4LF7"
FT                   /db_xref="PDB:4LF8"
FT                   /db_xref="PDB:4LF9"
FT                   /db_xref="PDB:4LFA"
FT                   /db_xref="PDB:4LFB"
FT                   /db_xref="PDB:4LFC"
FT                   /db_xref="PDB:4LFZ"
FT                   /db_xref="PDB:4LNT"
FT                   /db_xref="PDB:4LSK"
FT                   /db_xref="PDB:4LT8"
FT                   /db_xref="PDB:4NXM"
FT                   /db_xref="PDB:4NXN"
FT                   /db_xref="PDB:4OX9"
FT                   /db_xref="PDB:4P6F"
FT                   /db_xref="PDB:4P70"
FT                   /db_xref="PDB:4TUA"
FT                   /db_xref="PDB:4TUB"
FT                   /db_xref="PDB:4TUC"
FT                   /db_xref="PDB:4TUD"
FT                   /db_xref="PDB:4TUE"
FT                   /db_xref="PDB:4V42"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4V4I"
FT                   /db_xref="PDB:4V4P"
FT                   /db_xref="PDB:4V4R"
FT                   /db_xref="PDB:4V4S"
FT                   /db_xref="PDB:4V4T"
FT                   /db_xref="PDB:4V4X"
FT                   /db_xref="PDB:4V4Y"
FT                   /db_xref="PDB:4V4Z"
FT                   /db_xref="PDB:4V51"
FT                   /db_xref="PDB:4V5A"
FT                   /db_xref="PDB:4V5C"
FT                   /db_xref="PDB:4V5D"
FT                   /db_xref="PDB:4V5E"
FT                   /db_xref="PDB:4V5F"
FT                   /db_xref="PDB:4V5G"
FT                   /db_xref="PDB:4V5J"
FT                   /db_xref="PDB:4V5K"
FT                   /db_xref="PDB:4V5L"
FT                   /db_xref="PDB:4V5M"
FT                   /db_xref="PDB:4V5N"
FT                   /db_xref="PDB:4V5P"
FT                   /db_xref="PDB:4V5Q"
FT                   /db_xref="PDB:4V5R"
FT                   /db_xref="PDB:4V5S"
FT                   /db_xref="PDB:4V68"
FT                   /db_xref="PDB:4V6A"
FT                   /db_xref="PDB:4V6F"
FT                   /db_xref="PDB:4V6G"
FT                   /db_xref="PDB:4V7J"
FT                   /db_xref="PDB:4V7K"
FT                   /db_xref="PDB:4V7L"
FT                   /db_xref="PDB:4V7M"
FT                   /db_xref="PDB:4V7W"
FT                   /db_xref="PDB:4V7X"
FT                   /db_xref="PDB:4V7Y"
FT                   /db_xref="PDB:4V7Z"
FT                   /db_xref="PDB:4V87"
FT                   /db_xref="PDB:4V8A"
FT                   /db_xref="PDB:4V8B"
FT                   /db_xref="PDB:4V8C"
FT                   /db_xref="PDB:4V8D"
FT                   /db_xref="PDB:4V8E"
FT                   /db_xref="PDB:4V8F"
FT                   /db_xref="PDB:4V8G"
FT                   /db_xref="PDB:4V8H"
FT                   /db_xref="PDB:4V8I"
FT                   /db_xref="PDB:4V8J"
FT                   /db_xref="PDB:4V8N"
FT                   /db_xref="PDB:4V8O"
FT                   /db_xref="PDB:4V8Q"
FT                   /db_xref="PDB:4V8U"
FT                   /db_xref="PDB:4V8X"
FT                   /db_xref="PDB:4V90"
FT                   /db_xref="PDB:4V95"
FT                   /db_xref="PDB:4V97"
FT                   /db_xref="PDB:4V9A"
FT                   /db_xref="PDB:4V9B"
FT                   /db_xref="PDB:4V9H"
FT                   /db_xref="PDB:4V9I"
FT                   /db_xref="PDB:4V9R"
FT                   /db_xref="PDB:4V9S"
FT                   /db_xref="PDB:4W2E"
FT                   /db_xref="PDB:4W2F"
FT                   /db_xref="PDB:4W2G"
FT                   /db_xref="PDB:4W2H"
FT                   /db_xref="PDB:4W2I"
FT                   /db_xref="PDB:4W4G"
FT                   /db_xref="PDB:4WPO"
FT                   /db_xref="PDB:4WQ1"
FT                   /db_xref="PDB:4WQF"
FT                   /db_xref="PDB:4WQR"
FT                   /db_xref="PDB:4WQU"
FT                   /db_xref="PDB:4WQY"
FT                   /db_xref="PDB:4WR6"
FT                   /db_xref="PDB:4WRA"
FT                   /db_xref="PDB:4WRO"
FT                   /db_xref="PDB:4WSD"
FT                   /db_xref="PDB:4WSM"
FT                   /db_xref="PDB:4WT1"
FT                   /db_xref="PDB:4WT8"
FT                   /db_xref="PDB:4WU1"
FT                   /db_xref="PDB:4WZD"
FT                   /db_xref="PDB:4WZO"
FT                   /db_xref="PDB:4X62"
FT                   /db_xref="PDB:4X64"
FT                   /db_xref="PDB:4X65"
FT                   /db_xref="PDB:4X66"
FT                   /db_xref="PDB:4Y4O"
FT                   /db_xref="PDB:4Y4P"
FT                   /db_xref="PDB:4YHH"
FT                   /db_xref="PDB:4YPB"
FT                   /db_xref="PDB:4YY3"
FT                   /db_xref="PDB:4YZV"
FT                   /db_xref="PDB:4Z3S"
FT                   /db_xref="PDB:4Z8C"
FT                   /db_xref="PDB:4ZER"
FT                   /db_xref="PDB:4ZSN"
FT                   /db_xref="PDB:5AA0"
FT                   /db_xref="PDB:5BR8"
FT                   /db_xref="PDB:5CZP"
FT                   /db_xref="PDB:5D8B"
FT                   /db_xref="PDB:5DFE"
FT                   /db_xref="PDB:5DOX"
FT                   /db_xref="PDB:5DOY"
FT                   /db_xref="PDB:5E7K"
FT                   /db_xref="PDB:5E81"
FT                   /db_xref="PDB:5EL4"
FT                   /db_xref="PDB:5EL5"
FT                   /db_xref="PDB:5EL6"
FT                   /db_xref="PDB:5EL7"
FT                   /db_xref="PDB:5F8K"
FT                   /db_xref="PDB:5FDU"
FT                   /db_xref="PDB:5FDV"
FT                   /db_xref="PDB:5HAU"
FT                   /db_xref="PDB:5HCP"
FT                   /db_xref="PDB:5HCQ"
FT                   /db_xref="PDB:5HCR"
FT                   /db_xref="PDB:5HD1"
FT                   /db_xref="PDB:5IB7"
FT                   /db_xref="PDB:5IB8"
FT                   /db_xref="PDB:5IBB"
FT                   /db_xref="PDB:5IWA"
FT                   /db_xref="PDB:5J30"
FT                   /db_xref="PDB:5J3C"
FT                   /db_xref="PDB:5J4B"
FT                   /db_xref="PDB:5J4C"
FT                   /db_xref="PDB:5J8B"
FT                   /db_xref="PDB:5LMN"
FT                   /db_xref="PDB:5LMO"
FT                   /db_xref="PDB:5LMP"
FT                   /db_xref="PDB:5LMQ"
FT                   /db_xref="PDB:5LMR"
FT                   /db_xref="PDB:5LMS"
FT                   /db_xref="PDB:5LMT"
FT                   /db_xref="PDB:5LMU"
FT                   /db_xref="PDB:5LMV"
FT                   /db_xref="PDB:5NDJ"
FT                   /db_xref="PDB:5NDK"
FT                   /db_xref="PDB:5OT7"
FT                   /db_xref="PDB:5UQ7"
FT                   /db_xref="PDB:5UQ8"
FT                   /db_xref="PDB:5VP2"
FT                   /db_xref="PDB:5VPO"
FT                   /db_xref="PDB:5VPP"
FT                   /db_xref="PDB:5W4K"
FT                   /db_xref="PDB:5WIS"
FT                   /db_xref="PDB:5WIT"
FT                   /db_xref="PDB:5WNP"
FT                   /db_xref="PDB:5WNQ"
FT                   /db_xref="PDB:5WNR"
FT                   /db_xref="PDB:5WNS"
FT                   /db_xref="PDB:5WNT"
FT                   /db_xref="PDB:5WNU"
FT                   /db_xref="PDB:5WNV"
FT                   /db_xref="PDB:6BUW"
FT                   /db_xref="PDB:6BZ6"
FT                   /db_xref="PDB:6BZ7"
FT                   /db_xref="PDB:6BZ8"
FT                   /db_xref="PDB:6CAE"
FT                   /db_xref="PDB:6CAO"
FT                   /db_xref="PDB:6CAP"
FT                   /db_xref="PDB:6CAQ"
FT                   /db_xref="PDB:6CAR"
FT                   /db_xref="PDB:6CAS"
FT                   /db_xref="PDB:6CZR"
FT                   /db_xref="PDB:6DTI"
FT                   /db_xref="PDB:6FKR"
FT                   /db_xref="PDB:6GSJ"
FT                   /db_xref="PDB:6GSK"
FT                   /db_xref="PDB:6GSL"
FT                   /db_xref="PDB:6GZQ"
FT                   /db_xref="PDB:6GZX"
FT                   /db_xref="PDB:6GZZ"
FT                   /db_xref="PDB:6MKN"
FT                   /db_xref="PDB:6MPF"
FT                   /db_xref="PDB:6MPI"
FT                   /db_xref="PDB:6ND5"
FT                   /db_xref="PDB:6ND6"
FT                   /db_xref="PDB:6NDK"
FT                   /db_xref="PDB:6O97"
FT                   /db_xref="PDB:6OF1"
FT                   /db_xref="PDB:6Q95"
FT                   /db_xref="PDB:6QNQ"
FT                   /db_xref="PDB:6QNR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70066.1"
FT                   /translation="MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLS
FT                   ETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTEKLVRK"
FT   CDS_pept        complement(235462..236253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0244"
FT                   /product="single-stranded DNA binding protein"
FT                   /note="similar to GB:AAC28386.2 percent identity 99 in 263
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70067"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70067"
FT                   /db_xref="GOA:Q5SLP9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="PDB:2CWA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70067.1"
FT                   /translation="MARGLNRVFLIGALATRPDMRYTPAGLAILDLTLAGQDLLLSDNG
FT                   GEREVSWYHRVRLLGRQAEMWGDLLDQGQLVFVEGRLEYRQWEREGERRSELQIRADFL
FT                   DPLDDRGKERAEDSRGQPRLRAALNQVFLMGNLTRDPELRYTPQGTAVARLGLAVNERR
FT                   QGAEERTHFVEVQAWRDLAEWAAELRKGDGLFVIGRLVNDSWTSSSGERRFQTRVEALR
FT                   LERPTRGPAQAGGSRSREVQTGGVDIDEGLEDFPPEEELPF"
FT   CDS_pept        complement(236263..236568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0245"
FT                   /product="30S ribosomal protein S6 (TS9)"
FT                   /note="similar to GB:AAS82082.1 percent identity 100 in 101
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70068"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70068"
FT                   /db_xref="GOA:Q5SLP8"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="PDB:1FJG"
FT                   /db_xref="PDB:1FKA"
FT                   /db_xref="PDB:1G1X"
FT                   /db_xref="PDB:1HNW"
FT                   /db_xref="PDB:1HNX"
FT                   /db_xref="PDB:1HNZ"
FT                   /db_xref="PDB:1HR0"
FT                   /db_xref="PDB:1I94"
FT                   /db_xref="PDB:1I95"
FT                   /db_xref="PDB:1I96"
FT                   /db_xref="PDB:1I97"
FT                   /db_xref="PDB:1IBK"
FT                   /db_xref="PDB:1IBL"
FT                   /db_xref="PDB:1IBM"
FT                   /db_xref="PDB:1J5E"
FT                   /db_xref="PDB:1JGO"
FT                   /db_xref="PDB:1JGP"
FT                   /db_xref="PDB:1JGQ"
FT                   /db_xref="PDB:1L1U"
FT                   /db_xref="PDB:1ML5"
FT                   /db_xref="PDB:1N32"
FT                   /db_xref="PDB:1N33"
FT                   /db_xref="PDB:1N34"
FT                   /db_xref="PDB:1N36"
FT                   /db_xref="PDB:1QD7"
FT                   /db_xref="PDB:1VVJ"
FT                   /db_xref="PDB:1VY4"
FT                   /db_xref="PDB:1VY5"
FT                   /db_xref="PDB:1VY6"
FT                   /db_xref="PDB:1VY7"
FT                   /db_xref="PDB:1XMO"
FT                   /db_xref="PDB:1XMQ"
FT                   /db_xref="PDB:1XNQ"
FT                   /db_xref="PDB:1XNR"
FT                   /db_xref="PDB:2E5L"
FT                   /db_xref="PDB:2F4V"
FT                   /db_xref="PDB:2HHH"
FT                   /db_xref="PDB:2KJV"
FT                   /db_xref="PDB:2KJW"
FT                   /db_xref="PDB:2UU9"
FT                   /db_xref="PDB:2UUA"
FT                   /db_xref="PDB:2UUB"
FT                   /db_xref="PDB:2UUC"
FT                   /db_xref="PDB:2UXB"
FT                   /db_xref="PDB:2UXC"
FT                   /db_xref="PDB:2UXD"
FT                   /db_xref="PDB:2VQE"
FT                   /db_xref="PDB:2VQF"
FT                   /db_xref="PDB:2ZM6"
FT                   /db_xref="PDB:3OTO"
FT                   /db_xref="PDB:3T1H"
FT                   /db_xref="PDB:3T1Y"
FT                   /db_xref="PDB:3ZZP"
FT                   /db_xref="PDB:4AQY"
FT                   /db_xref="PDB:4B3M"
FT                   /db_xref="PDB:4B3R"
FT                   /db_xref="PDB:4B3S"
FT                   /db_xref="PDB:4B3T"
FT                   /db_xref="PDB:4DR1"
FT                   /db_xref="PDB:4DR2"
FT                   /db_xref="PDB:4DR3"
FT                   /db_xref="PDB:4DR4"
FT                   /db_xref="PDB:4DR5"
FT                   /db_xref="PDB:4DR6"
FT                   /db_xref="PDB:4DR7"
FT                   /db_xref="PDB:4DUY"
FT                   /db_xref="PDB:4DUZ"
FT                   /db_xref="PDB:4DV0"
FT                   /db_xref="PDB:4DV1"
FT                   /db_xref="PDB:4DV2"
FT                   /db_xref="PDB:4DV3"
FT                   /db_xref="PDB:4DV4"
FT                   /db_xref="PDB:4DV5"
FT                   /db_xref="PDB:4DV6"
FT                   /db_xref="PDB:4DV7"
FT                   /db_xref="PDB:4GKJ"
FT                   /db_xref="PDB:4GKK"
FT                   /db_xref="PDB:4JI0"
FT                   /db_xref="PDB:4JI1"
FT                   /db_xref="PDB:4JI2"
FT                   /db_xref="PDB:4JI3"
FT                   /db_xref="PDB:4JI4"
FT                   /db_xref="PDB:4JI5"
FT                   /db_xref="PDB:4JI6"
FT                   /db_xref="PDB:4JI7"
FT                   /db_xref="PDB:4JI8"
FT                   /db_xref="PDB:4JV5"
FT                   /db_xref="PDB:4JYA"
FT                   /db_xref="PDB:4K0K"
FT                   /db_xref="PDB:4KHP"
FT                   /db_xref="PDB:4L47"
FT                   /db_xref="PDB:4L71"
FT                   /db_xref="PDB:4LEL"
FT                   /db_xref="PDB:4LF4"
FT                   /db_xref="PDB:4LF5"
FT                   /db_xref="PDB:4LF6"
FT                   /db_xref="PDB:4LF7"
FT                   /db_xref="PDB:4LF8"
FT                   /db_xref="PDB:4LF9"
FT                   /db_xref="PDB:4LFA"
FT                   /db_xref="PDB:4LFB"
FT                   /db_xref="PDB:4LFC"
FT                   /db_xref="PDB:4LFZ"
FT                   /db_xref="PDB:4LNT"
FT                   /db_xref="PDB:4LSK"
FT                   /db_xref="PDB:4LT8"
FT                   /db_xref="PDB:4NXM"
FT                   /db_xref="PDB:4NXN"
FT                   /db_xref="PDB:4OX9"
FT                   /db_xref="PDB:4P6F"
FT                   /db_xref="PDB:4P70"
FT                   /db_xref="PDB:4TUA"
FT                   /db_xref="PDB:4TUB"
FT                   /db_xref="PDB:4TUC"
FT                   /db_xref="PDB:4TUD"
FT                   /db_xref="PDB:4TUE"
FT                   /db_xref="PDB:4V42"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4I"
FT                   /db_xref="PDB:4V4P"
FT                   /db_xref="PDB:4V4R"
FT                   /db_xref="PDB:4V4S"
FT                   /db_xref="PDB:4V4T"
FT                   /db_xref="PDB:4V4X"
FT                   /db_xref="PDB:4V4Y"
FT                   /db_xref="PDB:4V4Z"
FT                   /db_xref="PDB:4V51"
FT                   /db_xref="PDB:4V5A"
FT                   /db_xref="PDB:4V5C"
FT                   /db_xref="PDB:4V5D"
FT                   /db_xref="PDB:4V5E"
FT                   /db_xref="PDB:4V5F"
FT                   /db_xref="PDB:4V5G"
FT                   /db_xref="PDB:4V5J"
FT                   /db_xref="PDB:4V5K"
FT                   /db_xref="PDB:4V5L"
FT                   /db_xref="PDB:4V5M"
FT                   /db_xref="PDB:4V5N"
FT                   /db_xref="PDB:4V5P"
FT                   /db_xref="PDB:4V5Q"
FT                   /db_xref="PDB:4V5R"
FT                   /db_xref="PDB:4V5S"
FT                   /db_xref="PDB:4V68"
FT                   /db_xref="PDB:4V6A"
FT                   /db_xref="PDB:4V6F"
FT                   /db_xref="PDB:4V6G"
FT                   /db_xref="PDB:4V7J"
FT                   /db_xref="PDB:4V7K"
FT                   /db_xref="PDB:4V7L"
FT                   /db_xref="PDB:4V7M"
FT                   /db_xref="PDB:4V7W"
FT                   /db_xref="PDB:4V7X"
FT                   /db_xref="PDB:4V7Y"
FT                   /db_xref="PDB:4V7Z"
FT                   /db_xref="PDB:4V87"
FT                   /db_xref="PDB:4V8A"
FT                   /db_xref="PDB:4V8B"
FT                   /db_xref="PDB:4V8C"
FT                   /db_xref="PDB:4V8D"
FT                   /db_xref="PDB:4V8E"
FT                   /db_xref="PDB:4V8F"
FT                   /db_xref="PDB:4V8G"
FT                   /db_xref="PDB:4V8H"
FT                   /db_xref="PDB:4V8I"
FT                   /db_xref="PDB:4V8J"
FT                   /db_xref="PDB:4V8N"
FT                   /db_xref="PDB:4V8O"
FT                   /db_xref="PDB:4V8Q"
FT                   /db_xref="PDB:4V8U"
FT                   /db_xref="PDB:4V8X"
FT                   /db_xref="PDB:4V90"
FT                   /db_xref="PDB:4V95"
FT                   /db_xref="PDB:4V97"
FT                   /db_xref="PDB:4V9A"
FT                   /db_xref="PDB:4V9B"
FT                   /db_xref="PDB:4V9H"
FT                   /db_xref="PDB:4V9I"
FT                   /db_xref="PDB:4V9R"
FT                   /db_xref="PDB:4V9S"
FT                   /db_xref="PDB:4W2E"
FT                   /db_xref="PDB:4W2F"
FT                   /db_xref="PDB:4W2G"
FT                   /db_xref="PDB:4W2H"
FT                   /db_xref="PDB:4W2I"
FT                   /db_xref="PDB:4W4G"
FT                   /db_xref="PDB:4WPO"
FT                   /db_xref="PDB:4WQ1"
FT                   /db_xref="PDB:4WQF"
FT                   /db_xref="PDB:4WQR"
FT                   /db_xref="PDB:4WQU"
FT                   /db_xref="PDB:4WQY"
FT                   /db_xref="PDB:4WR6"
FT                   /db_xref="PDB:4WRA"
FT                   /db_xref="PDB:4WRO"
FT                   /db_xref="PDB:4WSD"
FT                   /db_xref="PDB:4WSM"
FT                   /db_xref="PDB:4WT1"
FT                   /db_xref="PDB:4WT8"
FT                   /db_xref="PDB:4WU1"
FT                   /db_xref="PDB:4WZD"
FT                   /db_xref="PDB:4WZO"
FT                   /db_xref="PDB:4X62"
FT                   /db_xref="PDB:4X64"
FT                   /db_xref="PDB:4X65"
FT                   /db_xref="PDB:4X66"
FT                   /db_xref="PDB:4Y4O"
FT                   /db_xref="PDB:4Y4P"
FT                   /db_xref="PDB:4YHH"
FT                   /db_xref="PDB:4YPB"
FT                   /db_xref="PDB:4YY3"
FT                   /db_xref="PDB:4YZV"
FT                   /db_xref="PDB:4Z3S"
FT                   /db_xref="PDB:4Z8C"
FT                   /db_xref="PDB:4ZER"
FT                   /db_xref="PDB:4ZSN"
FT                   /db_xref="PDB:5A9Z"
FT                   /db_xref="PDB:5AA0"
FT                   /db_xref="PDB:5BR8"
FT                   /db_xref="PDB:5CZP"
FT                   /db_xref="PDB:5D8B"
FT                   /db_xref="PDB:5DFE"
FT                   /db_xref="PDB:5DOX"
FT                   /db_xref="PDB:5DOY"
FT                   /db_xref="PDB:5E7K"
FT                   /db_xref="PDB:5E81"
FT                   /db_xref="PDB:5EL4"
FT                   /db_xref="PDB:5EL5"
FT                   /db_xref="PDB:5EL6"
FT                   /db_xref="PDB:5EL7"
FT                   /db_xref="PDB:5F8K"
FT                   /db_xref="PDB:5FDU"
FT                   /db_xref="PDB:5FDV"
FT                   /db_xref="PDB:5HAU"
FT                   /db_xref="PDB:5HCP"
FT                   /db_xref="PDB:5HCQ"
FT                   /db_xref="PDB:5HCR"
FT                   /db_xref="PDB:5HD1"
FT                   /db_xref="PDB:5IB7"
FT                   /db_xref="PDB:5IB8"
FT                   /db_xref="PDB:5IBB"
FT                   /db_xref="PDB:5IMQ"
FT                   /db_xref="PDB:5IMR"
FT                   /db_xref="PDB:5IWA"
FT                   /db_xref="PDB:5J30"
FT                   /db_xref="PDB:5J3C"
FT                   /db_xref="PDB:5J4B"
FT                   /db_xref="PDB:5J4C"
FT                   /db_xref="PDB:5J8B"
FT                   /db_xref="PDB:5LMN"
FT                   /db_xref="PDB:5LMO"
FT                   /db_xref="PDB:5LMP"
FT                   /db_xref="PDB:5LMQ"
FT                   /db_xref="PDB:5LMR"
FT                   /db_xref="PDB:5LMS"
FT                   /db_xref="PDB:5LMT"
FT                   /db_xref="PDB:5LMU"
FT                   /db_xref="PDB:5LMV"
FT                   /db_xref="PDB:5NDJ"
FT                   /db_xref="PDB:5NDK"
FT                   /db_xref="PDB:5OT7"
FT                   /db_xref="PDB:5UQ7"
FT                   /db_xref="PDB:5UQ8"
FT                   /db_xref="PDB:5VP2"
FT                   /db_xref="PDB:5VPO"
FT                   /db_xref="PDB:5VPP"
FT                   /db_xref="PDB:5W4K"
FT                   /db_xref="PDB:5WIS"
FT                   /db_xref="PDB:5WIT"
FT                   /db_xref="PDB:5WNP"
FT                   /db_xref="PDB:5WNQ"
FT                   /db_xref="PDB:5WNR"
FT                   /db_xref="PDB:5WNS"
FT                   /db_xref="PDB:5WNT"
FT                   /db_xref="PDB:5WNU"
FT                   /db_xref="PDB:5WNV"
FT                   /db_xref="PDB:5ZLU"
FT                   /db_xref="PDB:6BUW"
FT                   /db_xref="PDB:6BZ6"
FT                   /db_xref="PDB:6BZ7"
FT                   /db_xref="PDB:6BZ8"
FT                   /db_xref="PDB:6C5L"
FT                   /db_xref="PDB:6CAE"
FT                   /db_xref="PDB:6CAO"
FT                   /db_xref="PDB:6CAP"
FT                   /db_xref="PDB:6CAQ"
FT                   /db_xref="PDB:6CAR"
FT                   /db_xref="PDB:6CAS"
FT                   /db_xref="PDB:6CFJ"
FT                   /db_xref="PDB:6CFK"
FT                   /db_xref="PDB:6CFL"
FT                   /db_xref="PDB:6CZR"
FT                   /db_xref="PDB:6DTI"
FT                   /db_xref="PDB:6FKR"
FT                   /db_xref="PDB:6GSJ"
FT                   /db_xref="PDB:6GSK"
FT                   /db_xref="PDB:6GSL"
FT                   /db_xref="PDB:6GZQ"
FT                   /db_xref="PDB:6GZX"
FT                   /db_xref="PDB:6GZZ"
FT                   /db_xref="PDB:6MKN"
FT                   /db_xref="PDB:6MPF"
FT                   /db_xref="PDB:6MPI"
FT                   /db_xref="PDB:6ND5"
FT                   /db_xref="PDB:6ND6"
FT                   /db_xref="PDB:6NDK"
FT                   /db_xref="PDB:6O97"
FT                   /db_xref="PDB:6OF1"
FT                   /db_xref="PDB:6Q95"
FT                   /db_xref="PDB:6QNQ"
FT                   /db_xref="PDB:6QNR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70068.1"
FT                   /translation="MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGL
FT                   RRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA"
FT   tRNA            complement(236668..236743)
FT                   /gene="tRNA-Asn"
FT                   /product="tRNA-Asn"
FT                   /note="anticodon: GTT"
FT   CDS_pept        complement(236836..237525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0246"
FT                   /product="50S ribosomal protein L1"
FT                   /note="similar to GB:AAS82081.1 percent identity 99 in 229
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70069"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70069"
FT                   /db_xref="GOA:Q5SLP7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="PDB:2OM7"
FT                   /db_xref="PDB:3TG8"
FT                   /db_xref="PDB:4V42"
FT                   /db_xref="PDB:4V4P"
FT                   /db_xref="PDB:4V4X"
FT                   /db_xref="PDB:4V4Y"
FT                   /db_xref="PDB:4V4Z"
FT                   /db_xref="PDB:4V51"
FT                   /db_xref="PDB:4V5A"
FT                   /db_xref="PDB:4V5C"
FT                   /db_xref="PDB:4V5D"
FT                   /db_xref="PDB:4V5E"
FT                   /db_xref="PDB:4V5F"
FT                   /db_xref="PDB:4V5G"
FT                   /db_xref="PDB:4V5J"
FT                   /db_xref="PDB:4V5K"
FT                   /db_xref="PDB:4V5L"
FT                   /db_xref="PDB:4V5M"
FT                   /db_xref="PDB:4V5N"
FT                   /db_xref="PDB:4V5P"
FT                   /db_xref="PDB:4V5Q"
FT                   /db_xref="PDB:4V5R"
FT                   /db_xref="PDB:4V5S"
FT                   /db_xref="PDB:4V68"
FT                   /db_xref="PDB:4V6A"
FT                   /db_xref="PDB:4V7J"
FT                   /db_xref="PDB:4V7K"
FT                   /db_xref="PDB:4V7L"
FT                   /db_xref="PDB:4V7M"
FT                   /db_xref="PDB:4V8J"
FT                   /db_xref="PDB:4V8N"
FT                   /db_xref="PDB:4V8O"
FT                   /db_xref="PDB:4V8Q"
FT                   /db_xref="PDB:4V8U"
FT                   /db_xref="PDB:4V8X"
FT                   /db_xref="PDB:4V90"
FT                   /db_xref="PDB:4V97"
FT                   /db_xref="PDB:4V9H"
FT                   /db_xref="PDB:4WF1"
FT                   /db_xref="PDB:4WPO"
FT                   /db_xref="PDB:4WQF"
FT                   /db_xref="PDB:4WQU"
FT                   /db_xref="PDB:4WQY"
FT                   /db_xref="PDB:4WT8"
FT                   /db_xref="PDB:4WU1"
FT                   /db_xref="PDB:4WZD"
FT                   /db_xref="PDB:4WZO"
FT                   /db_xref="PDB:5A9Z"
FT                   /db_xref="PDB:5AA0"
FT                   /db_xref="PDB:5E7K"
FT                   /db_xref="PDB:5E81"
FT                   /db_xref="PDB:5EL4"
FT                   /db_xref="PDB:5EL5"
FT                   /db_xref="PDB:5EL6"
FT                   /db_xref="PDB:5EL7"
FT                   /db_xref="PDB:5HAU"
FT                   /db_xref="PDB:5NPM"
FT                   /db_xref="PDB:5OT7"
FT                   /db_xref="PDB:5UQ7"
FT                   /db_xref="PDB:5UQ8"
FT                   /db_xref="PDB:6C5L"
FT                   /db_xref="PDB:6Q95"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70069.1"
FT                   /translation="MPKHGKRYRALLEKVDPNKVYTIDEAARLVKELATAKFDETVEVH
FT                   AKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKI
FT                   LDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIE
FT                   FRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPS
FT                   VRINPHS"
FT   CDS_pept        complement(237518..237961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0247"
FT                   /product="50S ribosomal protein L11"
FT                   /note="similar to GB:AAS82080.1 percent identity 100 in 147
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70070"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70070"
FT                   /db_xref="GOA:Q5SLP6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="PDB:3EGV"
FT                   /db_xref="PDB:4V42"
FT                   /db_xref="PDB:4V4P"
FT                   /db_xref="PDB:4V4T"
FT                   /db_xref="PDB:4V4X"
FT                   /db_xref="PDB:4V4Y"
FT                   /db_xref="PDB:4V4Z"
FT                   /db_xref="PDB:4V51"
FT                   /db_xref="PDB:4V5E"
FT                   /db_xref="PDB:4V5F"
FT                   /db_xref="PDB:4V5J"
FT                   /db_xref="PDB:4V5M"
FT                   /db_xref="PDB:4V5N"
FT                   /db_xref="PDB:4V68"
FT                   /db_xref="PDB:4V6F"
FT                   /db_xref="PDB:4V9H"
FT                   /db_xref="PDB:4W2E"
FT                   /db_xref="PDB:4WPO"
FT                   /db_xref="PDB:4WQF"
FT                   /db_xref="PDB:4WQU"
FT                   /db_xref="PDB:4WQY"
FT                   /db_xref="PDB:5A9Z"
FT                   /db_xref="PDB:5AA0"
FT                   /db_xref="PDB:5D8B"
FT                   /db_xref="PDB:5HAU"
FT                   /db_xref="PDB:5IMQ"
FT                   /db_xref="PDB:5IMR"
FT                   /db_xref="PDB:5J8B"
FT                   /db_xref="PDB:5ZLU"
FT                   /db_xref="PDB:6C5L"
FT                   /db_xref="PDB:6GSL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70070.1"
FT                   /translation="MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAAT
FT                   ANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQV
FT                   LEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA"
FT   CDS_pept        complement(238005..238559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0248"
FT                   /product="transcription antitermination protein NusG"
FT                   /note="similar to GB:AAS82079.1 percent identity 100 in 184
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70071"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70071"
FT                   /db_xref="GOA:P35872"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="PDB:1NZ8"
FT                   /db_xref="PDB:1NZ9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35872"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70071.1"
FT                   /translation="MSIEWYAVHTLVGQEEKAKANLEKRIKAFGLQDKIFQVLIPTEEV
FT                   VELREGGKKEVVRKKLFPGYLFIQMDLGDEEEPNEAWEVVRGTPGITGFVGAGMRPVPL
FT                   SPDEVRHILEVSGLLGKKEAPKAQVAFREGDQVRVVSGPFADFTGTVTEINPERGKVKV
FT                   MVTIFGRETPVELDFSQVVKA"
FT   CDS_pept        complement(238556..238738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0249"
FT                   /product="preprotein translocase SecE subunit"
FT                   /note="similar to GB:AAS82078.1 percent identity 100 in 60
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70072"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70072"
FT                   /db_xref="GOA:P38383"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="PDB:2ZJS"
FT                   /db_xref="PDB:2ZQP"
FT                   /db_xref="PDB:5AWW"
FT                   /db_xref="PDB:5CH4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38383"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70072.1"
FT                   /translation="MFARLIRYFQEARAELARVTWPTREQVVEGTQAILLFTLAFMVIL
FT                   GLYDTVFRFLIGLLR"
FT   CDS_pept        complement(238738..238902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0250"
FT                   /product="50S ribosomal protein L33"
FT                   /note="similar to GB:AAS82077.1 percent identity 100 in 54
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70073"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70073"
FT                   /db_xref="GOA:P35871"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="PDB:1VVJ"
FT                   /db_xref="PDB:1VY4"
FT                   /db_xref="PDB:1VY5"
FT                   /db_xref="PDB:1VY6"
FT                   /db_xref="PDB:1VY7"
FT                   /db_xref="PDB:4L47"
FT                   /db_xref="PDB:4L71"
FT                   /db_xref="PDB:4LEL"
FT                   /db_xref="PDB:4LFZ"
FT                   /db_xref="PDB:4LNT"
FT                   /db_xref="PDB:4LSK"
FT                   /db_xref="PDB:4LT8"
FT                   /db_xref="PDB:4P6F"
FT                   /db_xref="PDB:4P70"
FT                   /db_xref="PDB:4TUA"
FT                   /db_xref="PDB:4TUB"
FT                   /db_xref="PDB:4TUC"
FT                   /db_xref="PDB:4TUD"
FT                   /db_xref="PDB:4TUE"
FT                   /db_xref="PDB:4V4P"
FT                   /db_xref="PDB:4V4X"
FT                   /db_xref="PDB:4V4Y"
FT                   /db_xref="PDB:4V4Z"
FT                   /db_xref="PDB:4V51"
FT                   /db_xref="PDB:4V5A"
FT                   /db_xref="PDB:4V5C"
FT                   /db_xref="PDB:4V5D"
FT                   /db_xref="PDB:4V5E"
FT                   /db_xref="PDB:4V5F"
FT                   /db_xref="PDB:4V5G"
FT                   /db_xref="PDB:4V5J"
FT                   /db_xref="PDB:4V5K"
FT                   /db_xref="PDB:4V5L"
FT                   /db_xref="PDB:4V5M"
FT                   /db_xref="PDB:4V5N"
FT                   /db_xref="PDB:4V5P"
FT                   /db_xref="PDB:4V5Q"
FT                   /db_xref="PDB:4V5R"
FT                   /db_xref="PDB:4V5S"
FT                   /db_xref="PDB:4V68"
FT                   /db_xref="PDB:4V6A"
FT                   /db_xref="PDB:4V6F"
FT                   /db_xref="PDB:4V6G"
FT                   /db_xref="PDB:4V7J"
FT                   /db_xref="PDB:4V7K"
FT                   /db_xref="PDB:4V7L"
FT                   /db_xref="PDB:4V7M"
FT                   /db_xref="PDB:4V7W"
FT                   /db_xref="PDB:4V7X"
FT                   /db_xref="PDB:4V7Y"
FT                   /db_xref="PDB:4V7Z"
FT                   /db_xref="PDB:4V87"
FT                   /db_xref="PDB:4V8A"
FT                   /db_xref="PDB:4V8B"
FT                   /db_xref="PDB:4V8C"
FT                   /db_xref="PDB:4V8D"
FT                   /db_xref="PDB:4V8E"
FT                   /db_xref="PDB:4V8F"
FT                   /db_xref="PDB:4V8G"
FT                   /db_xref="PDB:4V8H"
FT                   /db_xref="PDB:4V8I"
FT                   /db_xref="PDB:4V8J"
FT                   /db_xref="PDB:4V8N"
FT                   /db_xref="PDB:4V8O"
FT                   /db_xref="PDB:4V8Q"
FT                   /db_xref="PDB:4V8U"
FT                   /db_xref="PDB:4V8X"
FT                   /db_xref="PDB:4V90"
FT                   /db_xref="PDB:4V95"
FT                   /db_xref="PDB:4V97"
FT                   /db_xref="PDB:4V9A"
FT                   /db_xref="PDB:4V9B"
FT                   /db_xref="PDB:4V9H"
FT                   /db_xref="PDB:4V9I"
FT                   /db_xref="PDB:4V9R"
FT                   /db_xref="PDB:4V9S"
FT                   /db_xref="PDB:4W2E"
FT                   /db_xref="PDB:4W2F"
FT                   /db_xref="PDB:4W2G"
FT                   /db_xref="PDB:4W2H"
FT                   /db_xref="PDB:4W2I"
FT                   /db_xref="PDB:4W4G"
FT                   /db_xref="PDB:4WPO"
FT                   /db_xref="PDB:4WQ1"
FT                   /db_xref="PDB:4WQF"
FT                   /db_xref="PDB:4WQR"
FT                   /db_xref="PDB:4WQU"
FT                   /db_xref="PDB:4WQY"
FT                   /db_xref="PDB:4WRO"
FT                   /db_xref="PDB:4WSD"
FT                   /db_xref="PDB:4WT1"
FT                   /db_xref="PDB:4WT8"
FT                   /db_xref="PDB:4WZD"
FT                   /db_xref="PDB:4Y4O"
FT                   /db_xref="PDB:4Y4P"
FT                   /db_xref="PDB:4YPB"
FT                   /db_xref="PDB:4YZV"
FT                   /db_xref="PDB:4Z3S"
FT                   /db_xref="PDB:4Z8C"
FT                   /db_xref="PDB:4ZER"
FT                   /db_xref="PDB:4ZSN"
FT                   /db_xref="PDB:5A9Z"
FT                   /db_xref="PDB:5AA0"
FT                   /db_xref="PDB:5CZP"
FT                   /db_xref="PDB:5D8B"
FT                   /db_xref="PDB:5DFE"
FT                   /db_xref="PDB:5DOX"
FT                   /db_xref="PDB:5DOY"
FT                   /db_xref="PDB:5F8K"
FT                   /db_xref="PDB:5FDU"
FT                   /db_xref="PDB:5FDV"
FT                   /db_xref="PDB:5HAU"
FT                   /db_xref="PDB:5HCP"
FT                   /db_xref="PDB:5HCQ"
FT                   /db_xref="PDB:5HCR"
FT                   /db_xref="PDB:5HD1"
FT                   /db_xref="PDB:5IB7"
FT                   /db_xref="PDB:5IMQ"
FT                   /db_xref="PDB:5IMR"
FT                   /db_xref="PDB:5J30"
FT                   /db_xref="PDB:5J3C"
FT                   /db_xref="PDB:5J4B"
FT                   /db_xref="PDB:5J4C"
FT                   /db_xref="PDB:5J8B"
FT                   /db_xref="PDB:5OT7"
FT                   /db_xref="PDB:5UQ7"
FT                   /db_xref="PDB:5UQ8"
FT                   /db_xref="PDB:5VP2"
FT                   /db_xref="PDB:5VPP"
FT                   /db_xref="PDB:5W4K"
FT                   /db_xref="PDB:5WIS"
FT                   /db_xref="PDB:5WIT"
FT                   /db_xref="PDB:5ZLU"
FT                   /db_xref="PDB:6BUW"
FT                   /db_xref="PDB:6BZ6"
FT                   /db_xref="PDB:6BZ7"
FT                   /db_xref="PDB:6BZ8"
FT                   /db_xref="PDB:6CAE"
FT                   /db_xref="PDB:6CZR"
FT                   /db_xref="PDB:6FKR"
FT                   /db_xref="PDB:6GSL"
FT                   /db_xref="PDB:6GZQ"
FT                   /db_xref="PDB:6GZX"
FT                   /db_xref="PDB:6GZZ"
FT                   /db_xref="PDB:6ND5"
FT                   /db_xref="PDB:6ND6"
FT                   /db_xref="PDB:6NDK"
FT                   /db_xref="PDB:6O97"
FT                   /db_xref="PDB:6OF1"
FT                   /db_xref="PDB:6Q95"
FT                   /db_xref="PDB:6QNQ"
FT                   /db_xref="PDB:6QNR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35871"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70073.1"
FT                   /translation="MASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRK
FT                   HTVHREVKI"
FT   CDS_pept        complement(238947..240167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0251"
FT                   /product="translation elongation factor EF-Tu.B"
FT                   /note="similar to EMB:CAA43956.1 percent identity 100 in
FT                   406 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70074"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70074"
FT                   /db_xref="GOA:P60339"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="PDB:2C77"
FT                   /db_xref="PDB:2P8W"
FT                   /db_xref="PDB:2P8X"
FT                   /db_xref="PDB:2P8Z"
FT                   /db_xref="PDB:3DWU"
FT                   /db_xref="PDB:4V5L"
FT                   /db_xref="PDB:4V68"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60339"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70074.1"
FT                   /translation="MAKGEFIRTKPHVNVGTIGHVDHGKTTLTAALTFVTAAENPNVEV
FT                   KDYGDIDKAPEERARGITINTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAI
FT                   LVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPELLDLVEMEVRDLLNQYE
FT                   FPGDEVPVIRGSALLALEQMHRNPKTRRGENEWVDKIWELLDAIDEYIPTPVRDVDKPF
FT                   LMPVEDVFTITGRGTVATGRIERGKVKVGDEVEIVGLAPETRKTVVTGVEMHRKTLQEG
FT                   IAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLKKEEGGRHTGFFSGYR
FT                   PQFYFRTTDVTGVVQLPPGVEMVMPGDNVTFTVELIKPVALEEGLRFAIREGGRTVGAG
FT                   VVTKILE"
FT   tRNA            complement(240225..240300)
FT                   /gene="tRNA-Thr-3"
FT                   /product="tRNA-Thr"
FT                   /note="anticodon: GGT"
FT   tRNA            complement(240304..240379)
FT                   /gene="tRNA-Gly-4"
FT                   /product="tRNA-Gly"
FT                   /note="anticodon: CCC"
FT   tRNA            complement(240406..240491)
FT                   /gene="tRNA-Tyr"
FT                   /product="tRNA-Tyr"
FT                   /note="anticodon: GTA"
FT   tRNA            complement(240504..240579)
FT                   /gene="tRNA-Thr-2"
FT                   /product="tRNA-Thr"
FT                   /note="anticodon: TGT"
FT   CDS_pept        240650..241945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0252"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="similar to GB:AAS82075.1 percent identity 99 in 431
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70075"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70075"
FT                   /db_xref="GOA:Q5SLP1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="PDB:2DKF"
FT                   /db_xref="PDB:3A4Y"
FT                   /db_xref="PDB:3IDZ"
FT                   /db_xref="PDB:3IE0"
FT                   /db_xref="PDB:3IE1"
FT                   /db_xref="PDB:3IE2"
FT                   /db_xref="PDB:3IEK"
FT                   /db_xref="PDB:3IEL"
FT                   /db_xref="PDB:3IEM"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70075.1"
FT                   /translation="MRIVPFGAAREVTGSAHLLLAGGRRVLLDCGMFQGKEEARNHAPF
FT                   GFDPKEVDAVLLTHAHLDHVGRLPKLFREGYRGPVYATRATVLLMEIVLEDALKVMDEP
FT                   FFGPEDVEEALGHLRPLEYGEWLRLGALSLAFGQAGHLPGSAFVVAQGEGRTLVYSGDL
FT                   GNREKDVLPDPSLPPLADLVLAEGTYGDRPHRPYRETVREFLEILEKTLSQGGKVLIPT
FT                   FAVERAQEILYVLYTHGHRLPRAPIYLDSPMAGRVLSLYPRLVRYFSEEVQAHFLQGKN
FT                   PFRPAGLEVVEHTEASKALNRAPGPMVVLAGSGMLAGGRILHHLKHGLSDPRNALVFVG
FT                   YQPQGGLGAEIIARPPAVRILGEEVPLRASVHTLGGFSGHAGQDELLDWLQGEPRVVLV
FT                   HGEEEKLLALGKLLALRGQEVSLARFGEGVPV"
FT   CDS_pept        complement(241947..242204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0253"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82074.1 percent identity 98 in 85
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70076"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70076"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70076.1"
FT                   /translation="MMGDPRELFWEDEGLTEGLTDEEAQFLLGWLMDVAEDLDPAHLAH
FT                   LRRLGREITRLARDYGVPVGELVQLVELAWSDPEPEGLQA"
FT   CDS_pept        complement(242201..242485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0254"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82073.1 percent identity 98 in 94
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70077"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70077"
FT                   /db_xref="GOA:Q5SLN9"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70077.1"
FT                   /translation="MYNGRALDRPVYRFLRLLFLLGLVHGFYLLAQEGLRAWELARERA
FT                   ALKEEVARARAEVERLKEEVRAARDPAYLEALLRRMGWVRKDEEVRRWP"
FT   CDS_pept        242597..243040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0255"
FT                   /product="ferric uptake regulation protein"
FT                   /note="similar to GB:AAS82072.1 percent identity 97 in 147
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70078"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70078"
FT                   /db_xref="GOA:Q5SLN8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70078.1"
FT                   /translation="MPRTKEKESYRARLKAVGLRHTLPRERILSFLDRKNVHPTPEELY
FT                   QGLKKRGYDIGLSTVYLNLHVLREHGLIYEFKDPKGATRYDGYNEPHVHLVCTSCGKVE
FT                   DLLLKNLPELDVNPAMQAAAERTGWALEGFRLEFRGKCPNCQR"
FT   CDS_pept        complement(243126..244703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0256"
FT                   /product="leucine aminopeptidase"
FT                   /note="similar to GB:AAS82071.1 percent identity 97 in 525
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70079"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70079"
FT                   /db_xref="GOA:Q5SLN7"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70079.1"
FT                   /translation="MRALSSWRSTWILPSGRRTARAQAQGAFIITPSRAAAPPRAGCFA
FT                   RRSHRIPPILPRPRGKTLDVVTLRAVSTGLAEGQAPLKVVWAKEGALLPQGEALDARFE
FT                   GRLRQALKEAGLKAGESLLLYTEEGPVLLFGRGEDDRESGGRLAQALQRLAFPEALVEP
FT                   LEDAYALAEGLLLGAYRFDRLKTKREEKALTLLLPGVSEALLERARRVAEGVYLARDLV
FT                   NEPPNLLTPEALAERALELRALGVEVEVLDEKAIAELGMGAFLAVAQGSENPPRFIRLR
FT                   YAPEGAKARLDLVGKGLTFDSGGYSLKPTESMATMKSDMAGAAAVLGAFKAAALLGLPV
FT                   ELRGYIAACENLVSGRAYRVGDVLKTLSGKTVEVMNTDAEGRLTLADALAYAEREGAER
FT                   ILELSTLTGAAVVALGEEVAALFATEPSWGERVREAAEKAGEKVWPMPLEKAYREKLKS
FT                   PVADLKNVGDRYGGAIAAALFLAEFVQVPLVHLDIAGPAFARKAHALGPEGGTGFGVRT
FT                   ILKVAEAL"
FT   CDS_pept        244543..245433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82070.1 percent identity 97 in 296
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70080"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70080"
FT                   /db_xref="GOA:Q5SLN6"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70080.1"
FT                   /translation="MGGMRWLLLAKQPALGGAAALEGVMMKAPWAWALAVRLPDGRIHV
FT                   ERHEERALTERYPWTRLPLLRGVVALFDALSVSYRALARSAELAGGEEVPRGALWGTVA
FT                   VSLLVGIALFIVFPGFLAGLFVDAARHPALYNLLAGLLKVGILVGYLLFIRRMPEIRRF
FT                   FMYHGAEHKAIHAYEKGLPLTVENVLAQPRFHPRCGTTFIAFVIVVSVLVYSLIPAPEV
FT                   LWWRLLARVLFLPLVAALAYELLYFSARHQDPFSRLLRELGFRFQALTVAEPTPEMVEV
FT                   AIRSTEAALGERVVA"
FT   CDS_pept        245430..246533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0258"
FT                   /product="probable tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /note="similar to GB:AAS82069.1 percent identity 100 in 367
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70081"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70081"
FT                   /db_xref="GOA:Q5SLN5"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70081.1"
FT                   /translation="MKRVLVAMSGGVDSSVAALLLKEAGYEVVGAMMRFWPDLPPPSLE
FT                   AGKPRAWESCCTPDAAYEARRVADRLGIPFYLLDYREVFEEEIISPFLQDYAQGRTPNP
FT                   CARCNTFVKFGALLKQARRLGLDYVATGHYVRKEGLALLRGLDPHKDQTYFLWGTPKEA
FT                   LPHLLFPVGGLTKPEVRALAEKAGLPTARRPESQNLCFVAGDLKGFLKERLKPRPGPLV
FT                   DALTGEVVGEHEGASLYTLGQRKGLGLYKTHLERYVVGVDPERNVVYVGPKEACYFEGL
FT                   EGEGLNLLAELPEEVEVQVRYRTPPVRAKVESLSPLRLRFAHPVFAVTPGQSAVFYRGE
FT                   RLLGGAVIRRGLYNLAGLEDPRALTFS"
FT   CDS_pept        246570..247538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0259"
FT                   /product="phosphate ABC transporter, periplasmid
FT                   phosphate-biniding protein"
FT                   /note="similar to GB:AAS82068.1 percent identity 77 in 322
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70082"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70082"
FT                   /db_xref="GOA:Q5SLN4"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70082.1"
FT                   /translation="MRGKAWMLTAVALTGLGLAQIRADGSSTVYPITQAVAEEFVTRNP
FT                   QVRISVAFSGTGAGFQKFCRGETDVQNASRPIRKSELEACQKAGIQFIEIPVAYDALSI
FT                   LVNRQNTWAQCLTTAQLKSIWEPNAKVNYWKDLNPAWPNRRIVLFGAGTDSGTFDYFTE
FT                   AIMGRAGSIRKDYFPSEDDNVIMRGVTGNPYAMAFVGFAYYEENKDKVKAVAIDHGKGC
FT                   VLPSRETVLDGTYQPLSRPLFIYVNVKSLDRPEVQAFVDFYLSPAARRAIRSTGYVELP
FT                   DEAYRIGQGLVARKKTGSFFTDLPPGTPLAKFIEELRKEVQ"
FT   CDS_pept        247596..248498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0260"
FT                   /product="probable phosphate ABC transporter, permease
FT                   protein"
FT                   /note="similar to GB:AAS82067.1 percent identity 85 in 300
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70083"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70083"
FT                   /db_xref="GOA:Q5SLN3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70083.1"
FT                   /translation="MEILKQRPSRNPKEVLTFALLVFLSSITLLTTLGVILSLVGDVAQ
FT                   FFRRVPLTEFLFAPEWTPLFADPRYGISPLIAGTFLVTLIALLVAVPLGLALAIYLSEY
FT                   ASGAARARIKGTLELFEGIPTVVFGYFALLFVTPLLQRVIPDLNIFNPLSAGLVMGFAI
FT                   IPYISNVAADAMESVPRSIREAAYALGARPYEVALRVVFPAAISGIIAAIILATSRAIG
FT                   ETMIVAIAAGQRPILTLDPRETIATMTSYIVQAATGDQPTGSTAYYALFAVGFTLFLLT
FT                   LFLNILAQYVVERYRERYE"
FT   CDS_pept        248830..249705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0261"
FT                   /product="probable phosphate ABC transporter, permease
FT                   protein"
FT                   /note="similar to GB:AAS82066.1 percent identity 87 in 291
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70084"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70084"
FT                   /db_xref="GOA:Q5SLN2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70084.1"
FT                   /translation="MWNTQEGPFRYVVTGLRDERVADFSLLEGLRRWEELKAGLGEGER
FT                   LVLNPWLDQSFLTRTPSRSPLTAGIGVAIWGTIWVLSLALLIAIPVGIGTAILLEEYLR
FT                   EGTLNRILEVNLRNLAGVPSIVYGLLGLAIFVREMGLGPTILSAALTLGLLGIPVIVVT
FT                   ARESLRAVPESLRQAAFALGATRRQVVFRVVVPAALPGMVTGVILSAARLIGEAAPLLL
FT                   VGAAAYVPFYPTGPLSEYTVIPVQIYLWVSMNIPEFARVAAAGILVMLLVLSGLYFLAL
FT                   YLRNRFRREW"
FT   CDS_pept        249699..250514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0262"
FT                   /product="probable phosphate ABC transporter, ATP-binding
FT                   protein"
FT                   /note="similar to GB:AAS82065.1 percent identity 96 in 271
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70085"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70085"
FT                   /db_xref="GOA:Q5SLN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70085.1"
FT                   /translation="MVSLEMLKEHETVRTAPVSEAEALVDVRGLSLWYGKKQALYDISV
FT                   RFPRNQVTAIIGPSGCGKSTLLRSLNRMNDLVPGVRVEGEVLYEGVNIYDPRVDPVAVR
FT                   RHIGMVFQKPNPFPKTIFENVAFGLRLMGVKGSELEDRVVEALKRAALWEEVKDRFKKE
FT                   SGLRLSGGQQQRLCIARAIAVEPPLLLMDEPTSALDPIATQAIEDLILELKERYTVVIV
FT                   THNMQQAARVSDRTLFMHLGVLVEEGPTEVIFTKPKHPYTEAYITGRFG"
FT   CDS_pept        250524..251696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0263"
FT                   /product="multidrug-efflux transporter"
FT                   /note="similar to GB:AAS82064.1 percent identity 99 in 390
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70086"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70086"
FT                   /db_xref="GOA:Q5SLN0"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70086.1"
FT                   /translation="MSPLALLFLTLFNSVLGLSILFPILGPLGRALGLTEVQVGLFSTG
FT                   YALMQFLLSPYWGRRSERGRKPVLLVGILGFAASFLLFGVFALLGERGLVPPGLLFFLL
FT                   LLARLLGGAFSSATLPTAQAYVADVTGRENRTAGMALLGAAFGLAVILGPALGAGLAAL
FT                   FGLLAPVFFSAGIALLNALFVYLVLPESRPRGQEAGARLSPFDPRVFPLLLLGLALNLS
FT                   SVALEQTIAFYFQDRLLLGGVETAQKVGLALVFYGVVAVFVQGVLVRKTGWPPRVLLSL
FT                   GLPLGILGFVLLVYAKTFWALALGLALQGVGQGLALPGVTAALSLAVGEGEQGLVAGLN
FT                   SSAQALGRMLGPIVGTGLYRLAPEGPYVLGASLLLLALLFLPALFRRARL"
FT   CDS_pept        251698..252729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0264"
FT                   /product="RecF protein"
FT                   /note="similar to GB:AAS82063.1 percent identity 99 in 343
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70087"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70087"
FT                   /db_xref="GOA:Q5SLM9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="PDB:5ZWU"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70087.1"
FT                   /translation="MRLLLFRQRNFRNLALEAYRPPPGLSALVGANAQGKTSLLLGIHL
FT                   ALGGEVPLGLADLVRFGEEEAWLHAEVETELGAYRLEHRLGPGGREVLLNGKRVSLRTL
FT                   WELPGSVLVSPLDLEAVLGPKEERRAYLDRLIARFSRRYAALLSAYEKALRQRNALLKA
FT                   GGEGLSAWDRELARYGDEIVALRRRFLRRFAPILREVHAALAAKEAGLRLEETAGEGVL
FT                   RALEASRAEERERGQTLVGPHRDDLVFLLEGRPAHRFASRGEAKTLALALRLAEHRLLG
FT                   EHHGEPPLLLVDEWGEELDEARRRAVLAYAQALPQAILAGLEAPPGVPVCSVVRGVVLC
FT                   PGA"
FT   CDS_pept        252687..253472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82062.1 percent identity 99 in 261
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70088"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70088"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70088.1"
FT                   /translation="MLGGTRGGPVPWRLKEVIPEALKRAGGKERLRRGLVLAAWREVAG
FT                   KDLARFTEAVALEEGVLVVHVPDPVVAHQLTYTRLALLRRYEERFPGAVREIRFQVGPL
FT                   EAEGVEAPPPSDPGRLREAGRKALALAEKAPPELRERVARAALALFQRQRGDPCPVCQT
FT                   PSETHPCPTCRRHLEDPGVRRAAERLMRGQEAGLEGDALRAARHLARENLLAQMRDLYP
FT                   EALRSEEFRPLLADLARRYRNLFPQEPLPEGVRSLLKEG"
FT   CDS_pept        253473..254249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0266"
FT                   /product="cell wall-binding endopeptidase-related protein"
FT                   /note="similar to GB:AAS82061.1 percent identity 94 in 265
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70089"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70089"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="PDB:4UZ2"
FT                   /db_xref="PDB:4UZ3"
FT                   /db_xref="PDB:4XCM"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70089.1"
FT                   /translation="MRRAFLLAFLGLALAQATYTVAPGDTLYSIARRYGTTVEELMRLN
FT                   GLESFLLQPGQVLKLPSRERTHVVAPGDTLFSLARRYGTTVEALMRLNGLSSPEIKVGQ
FT                   VLRLPEEGEAPPPPPPEPEALDPESPLLRAVLRYLGVPYKYGANSPLALDCSAFVAQVY
FT                   AELGVALPRTTKEQYQAFPPVEAPRPGDLVFFSFGGKEVDHVGIYLGRGVFAHASSYGS
FT                   RVVIESLEAPFYRKVYRGARRVMASPEPPPAPSATP"
FT   CDS_pept        complement(254203..255123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0267"
FT                   /product="oxygen-insensitive NADPH nitroreductase"
FT                   /note="similar to GB:AAS82060.1 percent identity 98 in 306
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70090"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70090"
FT                   /db_xref="GOA:Q5SLM6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70090.1"
FT                   /translation="MELLDVLARRRSVRRFKPLPLPEEDLEKLLFALQRAPTDASAQLY
FT                   SAIRVRDPRLRDEVARLSGDQEHIRQAAEFFLFLADVHRLERLLAHRGQRMAFWPRTAL
FT                   HFAILDAGIAASYLALTAEALGYGVCFIGGVLNGVETLTDLLGLPPGVLPVVGLAVGVP
FT                   DEEGPPRPRLPRRLVVHEDRYRPYAAEDLEEAYRAMAPYSRVGDWNRVLRRYFAEGGTM
FT                   EAREKPYGKVLSRQGFDPDLPKGAPFYSLGALLEEALAEARGVLFRKGEVWLEEEARAF
FT                   RGEGRPGEALLMALRKARGEVPDWP"
FT   CDS_pept        complement(255137..255640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82059.1 percent identity 97 in 167
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70091"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70091"
FT                   /db_xref="InterPro:IPR021330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70091.1"
FT                   /translation="MGRAVKVALAVLALGLSAFALYLWASPYLFLRALQGAVLEGDRAR
FT                   LERLVDFPRVREGLKAQVQARLLREMGQEVAQNPLAGLAYLFVAGMVDPLVDALVSPEG
FT                   LAALGTGMGPGEAPKEAVKGWRLAYQDFRTAYVYHPEDPRSRLYLERQGLFGWKVVRME
FT                   LPLE"
FT   CDS_pept        complement(255678..256745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0269"
FT                   /product="type IV prepilin peptidase (PilD)"
FT                   /note="similar to GB:AAS82058.1 percent identity 99 in 355
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70092"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70092"
FT                   /db_xref="GOA:Q5SLM4"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70092.1"
FT                   /translation="MWPLFALLLGLAVGSFLNVVVHRLPRGESVAYPPSRCPQCGHRLG
FT                   PWDLVPVLSYLALKGRCRYCARPISPRYPLVEALTGGLFLLASLFYPPGVEALLVFLFL
FT                   AFLVALAFIDVDTFELPDPLTYGLLFLGLLASWALAFPLPFRESLDGSLMAAGGLALVA
FT                   GYGNLFLRRFREARAEVPVGPHQVHMAALFGALLGPGVGMALAFLAWALSARTGRAVAL
FT                   PDRLTLPLLPLAFLLAPALGLDFLESLKGSLLAAGGLALAGGLYWAFRPLPEEGEEEPV
FT                   AMGYGDVKLLGALGAWLGPYAFLALFLGVFAGALLGLLLRQRKLPFGPYLALGGVVAFF
FT                   FGEALWGAYLRLLGV"
FT   CDS_pept        256812..258344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0270"
FT                   /product="carboxypeptidase"
FT                   /note="similar to GB:AAS82057.1 percent identity 99 in 510
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70093"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70093"
FT                   /db_xref="GOA:Q5SLM3"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="PDB:3HOA"
FT                   /db_xref="PDB:5WVU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70093.1"
FT                   /translation="MTPEAAYQNLLEFQRETAYLASLGALAAWDQRTMIPKKGHEHRAR
FT                   QMAALARLLHQRMTDPRIGEWLEKVEGSPLVQDPLSDAAVNVREWRQAYERARAIPERL
FT                   AVELAQAESEAESFWEEARPRDDWRGFLPYLKRVYALTKEKAEVLFALPPAPGDPPYGE
FT                   LYDALLDGYEPGMRARELLPLFAELKEGLKGLLDRILGSGKRPDTSILHRPYPVEAQRR
FT                   FALELLSACGYDLEAGRLDPTAHPFEIAIGPGDVRITTRYYEDFFNAGIFGTLHEMGHA
FT                   LYEQGLPKEHWGTPRGDAVSLGVHESQSRTWENLVGRSLGFWERFFPRAREVFASLGDV
FT                   SLEDFHFAVNAVEPSLIRVEADEVTYNLHILVRLELELALFRGELSPEDLPEAWAEKYR
FT                   DHLGVAPKDYKDGVMQDVHWAGGLFGYFPTYTLGNLYAAQFFQKAEAELGPLEPRFARG
FT                   EFQPFLDWTRARIHAEGSRFRPRVLVERVTGEAPSARPFLAYLEKKYAALYG"
FT   CDS_pept        complement(258408..260039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0271"
FT                   /product="60 kDa chaperonin (Protein Cpn60) (GroEL
FT                   protein)"
FT                   /note="similar to GB:AAS82056.1 percent identity 100 in 543
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70094"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70094"
FT                   /db_xref="GOA:Q5SLM2"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70094.1"
FT                   /translation="MAKILVFDEAARRALERGVNAVANAVKVTLGPRGRNVVLEKKFGS
FT                   PTITKDGVTVAKEVELEDHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLK
FT                   NVAAGANPLALKRGIEKAVEAAVEKIKALAIPVEDRKAIEEVATISANDPEVGKLIADA
FT                   MEKVGKEGIITVEESKSLETELKFVEGYQFDKGYISPYFVTNPETMEAVLEDAFILIVE
FT                   KKVSNVRELLPILEQVAQTGKPLLIIAEDVEGEALATLVVNKLRGTLSVAAVKAPGFGD
FT                   RRKEMLKDIAAVTGGTVISEELGFKLENATLSMLGRAERVRITKDETTIVGGKGKKEDI
FT                   EARINGIKKELETTDSEYAREKLQERLAKLAGGVAVIRVGAATETELKEKKHRFEDALN
FT                   ATRAAVEEGIVPGGGVTLLRAISAVEELIKKLEGDEATGAKIVRRALEEPARQIAENAG
FT                   YEGSVIVQQILAETKNPRYGFNAATGEFVDMVEAGIVDPAKVTRSALQNAASIGALILT
FT                   TEAVVAEKPEKKESTPASAGAGDMDF"
FT   CDS_pept        complement(260052..260357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0272"
FT                   /product="10 kDa chaperonin (Protein Cpn10) (groES
FT                   protein)"
FT                   /note="similar to GB:AAS82055.1 percent identity 100 in 101
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70095"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70095"
FT                   /db_xref="GOA:P61493"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="PDB:1WNR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61493"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70095.1"
FT                   /translation="MAAEVKTVIKPLGDRVVVKRIEEEPKTKGGIVLPDTAKEKPQKGK
FT                   VIAVGTGRVLENGQRVPLEVKEGDIVVFAKYGGTEIEIDGEEYVILSERDLLAVLQ"
FT   CDS_pept        complement(260454..261143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0273"
FT                   /product="hypothetical protein (transposase related
FT                   protein)"
FT                   /note="similar to GB:AAS81959.1 percent identity 99 in 229
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70096"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70096"
FT                   /db_xref="GOA:Q5SLM0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70096.1"
FT                   /translation="MRPSWRGFPGNWRPISPRSPRRKAKRLRTRRRHTWRRFPPLYLMD
FT                   TTGLAYRSKDRLLRFRRGKEVRRVRGHARLLALMRWDRERRLLWPWGGVVGEGYAPDPR
FT                   LGGEVLRRFPPSRGWLLADAGFDGKEVWGVLGEAGVRPVIRLRGGGEAREEARVRAREG
FT                   WDPEVYRFRGVVEGVFGGMKTRLGGGYLWERKPWTAMARALLELIAYGLRVLLSLLPPP
FT                   PGYKAIY"
FT   CDS_pept        261386..261484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0274"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82394.1 percent identity 96 in 30
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70097"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70097"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70097.1"
FT                   /translation="MGLASLRRKPRLPIRREIYTRPPDLCKASPGG"
FT   CDS_pept        complement(261493..262275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0275"
FT                   /product="RNA 2'-O ribose methyltransferase"
FT                   /note="similar to GB:AAS82054.1 percent identity 98 in 260
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70098"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70098"
FT                   /db_xref="GOA:Q5SLL8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="PDB:4X3L"
FT                   /db_xref="PDB:4X3M"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70098.1"
FT                   /translation="MRIESPQNPRVKALAALKERKERERTGRFLVEGRREVERALEAGL
FT                   SLETLLLGPKARPEDRALAGGAEVLELSERALARVSTRENPAQVLGVFRLPRRSLAGVT
FT                   LGAAPLVLVLLGLEKPGNLGAILRAADGAGADLVLVAEGVDLFSPQVIRNSTGAVFALP
FT                   VYPVAEGEAARFLEEHNLPLVAATPEGERLYWEGDYRGGVAFLLGAEDKGLPEAWKRRA
FT                   QVRVRIPMRGRADSLNVAVTAALLLYEALRQRSGGAPL"
FT   CDS_pept        complement(262265..264385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0276"
FT                   /product="probable acyl-CoA synthetase"
FT                   /note="similar to GB:AAS82053.1 percent identity 99 in 706
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70099"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70099"
FT                   /db_xref="GOA:Q5SLL7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70099.1"
FT                   /translation="MEFLRRLSPTSLRLRFFSPISPEKAAELLLSAKPEEEKVTLVVLL
FT                   GEPPRIVATGEYVRVKGEDTAEVAFLVDDAFQGKGLGTLLLERLALIAAKRGVRRFQAF
FT                   VLAENKQMLSVFMESGFRVRAHREGGEVEVEFEILMEEETARRFEWREKVSTIASLHPF
FT                   FFPRGVAVVGASRDPESIGYRVLENLIFGRFQGPVFPVNEAIGREGGTVGPLLAYPGLE
FT                   SVPGPVDLVVVAVPKERVPEALEAAGRRGARGAIVLTTGFTPKEAQALADKARRLGMRL
FT                   LGPGSLGLVHTHPGVRLAAGLAPLPKEGVLAISSQSGTLGRAVLAFAEEMGLGVASFVS
FT                   LGAKADISSNDLLQFWEEDERTRVILLYLEHFGNPRRFSRLARRIGKKKPILAVHPSRD
FT                   PLVRALFAQAGVVRANSLEEAFDVALLLAQGPLPENGRVRLISNASGPSNLALEALKEG
FT                   GMEVEHVDLGSTADLEAFRRALAEAEASDAGSVFLLFVPMGFAPEEEVLGLLREVRGGK
FT                   TYLACLMGLSSGRARVLGSVPVYRFPESAAIALARAWGYRRWREEPLFFPDFQDLRLEE
FT                   ARRLVEGKRALSQEEGEALLRAFGLSLGEEEGLRLRLLAEPHPLFGPVLVLVLPTPLGD
FT                   QVLEQRLSPLTAKDAEELLRPLAGRVEGLPAYKELVLRVSRMLEELPQVERLLLELSGP
FT                   RVAAFTISLRAD"
FT   CDS_pept        264753..266000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0277"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /note="similar to GB:AAS82052.1 percent identity 99 in 415
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70100"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70100"
FT                   /db_xref="GOA:Q5SLL6"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="PDB:1ZZG"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70100.1"
FT                   /translation="MLRLDTRFLPGFPEALSRHGPLLEEARRRLLAKRGEPGSMLGWMD
FT                   LPEDTETLREVRRYREANPWVEDFVLIGIGGSALGPKALEAAFNESGVRFHYLDHVEPE
FT                   PILRLLRTLDPRKTLVNAVSKSGSTAETLAGLAVFLKWLKAHLGEDWRRHLVVTTDPKE
FT                   GPLRAFAEREGLKAFAIPKEVGGRFSALSPVGLLPLAFAGADLDALLMGARKANETALA
FT                   PLEESLPLKTALLLHLHRHLPVHVFMVYSERLSHLPSWFVQLHDESLGKVDRQGQRVGT
FT                   TAVPALGPKDQHAQVQLFREGPLDKLLALVIPEAPLEDVEIPEVEGLEAASYLFGKTLF
FT                   QLLKAEAEATYEALAEAGQRVYALFLPEVSPYAVGWLMQHLMWQTAFLGELWEVNAFDQ
FT                   PGVELGKVLTRKRLAG"
FT   CDS_pept        266089..267678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0278"
FT                   /product="ATP-dependent phosphoenolpyruvate carboxykinase"
FT                   /note="similar to PDB:1BKG percent identity 100 in 529 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70101"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70101"
FT                   /db_xref="GOA:Q5SLL5"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="PDB:1J3B"
FT                   /db_xref="PDB:1XKV"
FT                   /db_xref="PDB:2PC9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70101.1"
FT                   /translation="MQRLEALGIHPKKRVFWNTVSPVLVEHTLLRGEGLLAHHGPLVVD
FT                   TTPYTGRSPKDKFVVREPEVEGEIWWGEVNQPFAPEAFEALYQRVVQYLSERDLYVQDL
FT                   YAGADRRYRLAVRVVTESPWHALFARNMFILPRRFGNDDEVEAFVPGFTVVHAPYFQAV
FT                   PERDGTRSEVFVGISFQRRLVLIVGTKYAGEIKKSIFTVMNYLMPKRGVFPMHASANVG
FT                   KEGDVAVFFGLSGTGKTTLSTDPERPLIGDDEHGWSEDGVFNFEGGCYAKVIRLSPEHE
FT                   PLIYKASNQFEAILENVVVNPESRRVQWDDDSKTENTRSSYPIAHLENVVESGVAGHPR
FT                   AIFFLSADAYGVLPPIARLSPEEAMYYFLSGYTARVAGTERGVTEPRATFSACFGAPFL
FT                   PMHPGVYARMLGEKIRKHAPRVYLVNTGWTGGPYGVGYRFPLPVTRALLKAALSGALEN
FT                   VPYRRDPVFGFEVPLEAPGVPQELLNPRETWADKEAYDQQARKLARLFQENFQKYASGV
FT                   AKEVAEAGPRTE"
FT   CDS_pept        267678..268613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0279"
FT                   /product="putative threonine dehydratase"
FT                   /note="similar to GB:AAS82050.1 percent identity 95 in 311
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70102"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70102"
FT                   /db_xref="GOA:Q5SLL4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="PDB:1VE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70102.1"
FT                   /translation="MPSLQDLYAAFRRIAPYTHRTPLLTSRLLDGLLGKRLLLKAEHLQ
FT                   KTGSFKARGALSKALALENPKGLLAVSSGNHAQGVAYAAQVLGVKALVVMPEDASPYKK
FT                   ACARAYGAEVVDRGVTAKNREEVARALQEETGYALIHPFDDPLVIAGQGTAGLELLAQA
FT                   GRMGVFPGAVLAPVGGGGLLAGLATAVKALSPTTLVLGVEPEAADDAKRSLEAGRILRL
FT                   EAPPRTRADGVRTLSLGERTFPILRERVDGILTVSEEALLEAERLLFTRTKQVVEPTGA
FT                   LPLAAVLEHGARLPQTLALLLSGGNRDFSP"
FT   CDS_pept        complement(268656..269831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0280"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="similar to GB:AAS82048.1 percent identity 100 in 391
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70103"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70103"
FT                   /db_xref="GOA:Q5SLL3"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70103.1"
FT                   /translation="MAGVKERAVLVLEDGTVYHGYAFGARGKTVGEVVFNTAQTGYQEI
FT                   MTDPSYHGQIVVMTYPHQGNYGVNVYDMQSNRPWVRGFVAKEFSRVASNPRAQQTIGEF
FT                   MEFYGVVGIEGIDTRALVRKIREGGVLKGTIAHASLFGAPDHAFTQEELEALRREAQAW
FT                   TDIDGRDMTPEVSTPLPYAWPTLKSGRRIVVMDFGIKHAIVENLAALGFEVIVVPGKTP
FT                   AHQIMALEPHGLLISNGPGDPTMPRYAHETIWKLMGLLPTFGICLGHQLLALAAGGRTF
FT                   KMKFGHRGANHPVKNLQTGKIEITSQNHGYAVDIDSLKDFRPTHVNLNDGTLEGMAHAR
FT                   YPVFSVQYHPEAAPGPHDALYLFRRFLEEVEAFHGATGLPVEKQRADQHGI"
FT   CDS_pept        complement(270019..270282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82046.1 percent identity 98 in 87
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70104"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70104"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="PDB:2DSY"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70104.1"
FT                   /translation="MDGMGTLTRYLEEAMARARYELIADEEPYYGEIPDLPGVWATGKS
FT                   LKECEANLQAALEDWLLFLLSRGETPPPLGEVRIELPHGEAA"
FT   CDS_pept        complement(270284..270817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0282"
FT                   /product="probable acetyltransferase"
FT                   /note="similar to GB:AAS82045.1 percent identity 97 in 177
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70105"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70105"
FT                   /db_xref="GOA:Q5SLL1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70105.1"
FT                   /translation="MRGLSLSPVVLPEVRREAGVELRKARLEDVDAIYWLIRYWAEKGL
FT                   MLVRSHSHLYENIRDFWVLEDEDGQIVGTVALHVLWRDLAEIRGLAVHPTRQGQGLGRW
FT                   LVLGAEREARDLGLPRVFAWTLQVNFFRALGYRVTSREALPPKVWSECNACPFYENCRE
FT                   IAVVKEFSPGASGG"
FT   CDS_pept        complement(270819..272207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0283"
FT                   /product="argininosuccinate lyase"
FT                   /note="similar to GB:AAS82044.1 percent identity 99 in 462
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70106"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70106"
FT                   /db_xref="GOA:Q5SLL0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="PDB:2E9F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70106.1"
FT                   /translation="MAHRTWGGRFGEGPDALAARFNASLAFDRALWREDLWQNRVHARM
FT                   LHAVGLLSAEELEAILKGLDRIEEEIEAGTFPWREELEDVHMNLEARLTELVGPPGGKL
FT                   HTARSRNDQVATDLRLYLRGAIDELLALLLALRRVLVREAEKHLDPLYVLPGYTHLQRA
FT                   QPVLLAHWFLAYYEMLKRDAGRLEDAKERLNESPLGAAALAGTGFPIDRHFTARELGFK
FT                   APMRNSLDAVASRDFALEVLSALNIGMLHLSRMAEELILYSTEEFGFVEVPDAFATGSS
FT                   IMPQKKNPDILELIRAKAGRVLGAFVGLSAVVKGLPLAYNKDLQEDKEPLLDALATYRD
FT                   SLRLLAALLPGLKWRRERMWRAAEGGYTLATELADYLAEKGLPFREAHHVVGRLVRRLV
FT                   EEGRALKDLTLEELQAHHPLFAEDALPLLRLETAIHRRRSYGGTAPEAVRERLEEAKKE
FT                   VGLD"
FT   CDS_pept        complement(272197..273399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0284"
FT                   /product="argininosuccinate synthetase"
FT                   /note="similar to SP:P59846 percent identity 100 in 400 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70107"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70107"
FT                   /db_xref="GOA:P59846"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="PDB:1J1Z"
FT                   /db_xref="PDB:1J20"
FT                   /db_xref="PDB:1J21"
FT                   /db_xref="PDB:1KH1"
FT                   /db_xref="PDB:1KH2"
FT                   /db_xref="PDB:1KH3"
FT                   /db_xref="PDB:1KOR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59846"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70107.1"
FT                   /translation="MKIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAR
FT                   EKALRTGASKAIALDLKEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAE
FT                   EEGAEAIAHGATGKGNDQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIP
FT                   VPVTQEKPYSMDANLLHISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFE
FT                   GDPVAVNGERLSPAALLQRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHA
FT                   RRAVESLTLDREVLHQRDMLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLK
FT                   LYKGNVYVVGRKAPKSLYRQDLVSFDEAGGYDQKDAEGFIKIQALRLRVRALVEREGHG
FT                   A"
FT   CDS_pept        273598..275592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAF12643.1 percent identity 24 in 691
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70108"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70108"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70108.1"
FT                   /translation="MRKALGLGLLLGALLLAGCGQDTVKPSVTITAPQNGATVNQDTLT
FT                   VQGTAQDNVRVNRVTYQLNNGQEQEVPITPGTSVNFAFTLTLPQGQNTITVHAYDPSGN
FT                   KGTASVQVTYDPQAVHTLSGYVVRENAGGPVASSTLKLYRGGALVATTTTASDGSFTFT
FT                   NLAPGTYRLEAQKPGMAGSLVEGIRVPEMASITLVQKPAFDATATTTPPTLLITQDGNI
FT                   PLEGGIFTDVIPFRVQVDTSKDYVRPMRYIYVALGRTPGSAFVTNSATWTRRIFTDTED
FT                   TGNQALSGSNVAGFGDADGENVYLEVVAYDFNENRSHYILPITFINTNPTQANTVQAPT
FT                   QVAATAITLTQAVGFYGVKAPAKIQVPVAKGQVGELALDPMAVPEGSNLYVEVRWCYTD
FT                   TSAPPFAFDIERSTDGANWVRVGTVGGGASSSCSSNPFNRPFYFRDASPDLTPGQTYHY
FT                   RVVARGASSAESQPSSTTPLPPFFAPLLSPADESVGVSKTPDFVIGHPQLQIGADGAAY
FT                   NLVLWDTLTGDGVAWQTLSGYNLYVEFGNGDNGIPAGEALVYGFHPAVNNFVIFTDTTD
FT                   PNNPNLVPVDVAQGEVTLPYDFDGLAQLPELQALRTYAWQLYVSYAYKYNPGENYRISA
FT                   YSIQTWPSSTSFIRISRTGTQVFDFTTGE"
FT   CDS_pept        275602..277671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0286"
FT                   /product="serine protease, subtilase family"
FT                   /note="similar to GB:AAF12479.1 percent identity 47 in 741
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70109"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70109"
FT                   /db_xref="GOA:Q5SLK7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017306"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70109.1"
FT                   /translation="MKKPLILSALALAALLSACSQAPRPTNASPTPGLVTTSEGVRHYQ
FT                   GQVVVGYEDESGLQEAIRKLGAKEIARIPELKAALLEVPGDAVKASRTLKGLPGLRYAE
FT                   PHLAQVTPPKDDPVELPRGRESGLIPLGNPSDQILDELPQYALDPRHLAAKAAWDRGFE
FT                   GEGVVVAIIDDPADVTHPDLAPNWAGKAYDPVTDTTYTSASGWLNFIQGLNAPADLYHG
FT                   TYVASTVSAPRDGQGIAGLAPKTKFLPVAIFQPDYVGDFYVARGIVWAVNNGAQVLNNS
FT                   WGGLGYGQLVKEAFDYALANGVVVVASAGNSYKDEVRTPAGYPGIIASAAADGNRNKTD
FT                   FSTYGRHISSAAPGLDVLLANPTWLGGGYGLISGTSFSGPYTAAAAALVKAACPGATPY
FT                   QVRRALETTTWEKTFTREKGWGHLHAGQLAELLSQGCAALPAKGAVVRVKVEYFNERGT
FT                   FPGLLADVILRGKGLKPGDPTDPTPVYWARTDQNGEAWFYEIAPGEYDIYVAGADLALT
FT                   GGPPEERGTFVGTLVATPGSSAFSPDSKLVRLNASEVNLNPTDPYEPNDTLSQAKPIAY
FT                   GQTTQLAYIFGQPQDYDYFQFTGSAGDTIKARVYARSSIGGTLDSYLYLLDENGQVLAE
FT                   NDDIIFGQITDSEIIFTLPQDGTYYLVVTSYTIANGGSDDSPFNKYRLELQKTN"
FT   CDS_pept        complement(277724..279091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0287"
FT                   /product="2-oxoglutarate dehydrogenase E3 component
FT                   (dihydrolipoamide dehydrogenase)"
FT                   /note="similar to GB:AAS82042.1 percent identity 99 in 455
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70110"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70110"
FT                   /db_xref="GOA:Q5SLK6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:2EQ7"
FT                   /db_xref="PDB:2YQU"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70110.1"
FT                   /translation="MYDLLVIGAGPGGYVAAIRAAQLGMKVGVVEKEKALGGTCLRVGC
FT                   IPSKALLETTERIYEAKKGLLGAKVKGVELDLPALMAHKDKVVQANTQGVEFLFKKNGI
FT                   ARHQGTARFLSERKVLVEETGEELEARYILIATGSAPLIPPWAQVDYERVVTSTEALSF
FT                   PEVPKRLIVVGGGVIGLELGVVWHRLGAEVIVLEYMDRILPTMDLEVSRAAERVFKKQG
FT                   LTIRTGVRVTAVVPEAKGARVELEGGEVLEADRVLVAVGRRPYTEGLSLENAGLSTDER
FT                   GRIPVDEHLRTRVPHIYAIGDVVRGPMLAHKASEEGIAAVEHMVRGFGHVDYQAIPSVV
FT                   YTHPEIAAVGYTEEELKAQGIPYKVGKFPYSASGRARAMGETEGFIKVLAHAKTDRILG
FT                   VHGIGARVGDVLAEAALALFFKASAEDLGRAPHAHPSLSEILKEAALAAWERPIHL"
FT   CDS_pept        complement(279093..280313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0288"
FT                   /product="2-oxoglutarate dehydrogenase E2 component
FT                   (dihydrolipoamide succinyltransferase)"
FT                   /note="similar to GB:AAS82041.1 percent identity 98 in 406
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70111"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70111"
FT                   /db_xref="GOA:Q5SLK5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="PDB:2EQ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70111.1"
FT                   /translation="MQELKVPSVGESIVEVEIGAWLKGEGESFAQDEPLVELITDKATL
FT                   ELPAPFAGTLKQILKRTGETARVGEAIALLEEGRAEAAPKAQAPAEAPKEPSPEPLAMP
FT                   AAERLMQEKGVSPAEVQGTGLGGRILKEDVMRHLEERAPAKPQEAPPPPPPSRPAPPPS
FT                   TPPQPPADKPWRVSEAVPMTPLRRRIAERLLMVRQTTAMLTTFNEADMSAVIALRKEFG
FT                   EAFQKKYGVKLGFMSFFVKAVVQALKEIPELNAEIRDNHIVYHRYYDIGIAVGGGEGLV
FT                   VPVIRDADRLSFAEIEQKIADFAERARTKKLKPEELMGGTFTITNGGIYGSLNSTPLLN
FT                   PPQVGILGMHAIQERPVVRDGQVVIRPMMYLALSYDHRIVDGREAVTFLRRVKELIENP
FT                   ARLLLEV"
FT   CDS_pept        complement(280324..283014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0289"
FT                   /product="2-oxoglutarate dehydrogenase E1 component
FT                   (2-oxoglutarate dehydrogenase)"
FT                   /note="similar to GB:AAS82040.1 percent identity 99 in 896
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70112"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70112"
FT                   /db_xref="GOA:Q5SLK4"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70112.1"
FT                   /translation="MELTLESQGYLESLYRAYLEDPLSLPEDWRRYFSALTLEDLEDGR
FT                   RERQAAPLPGEALDLGFLLKVEALRQAYRELGHLAARIDPLGRERPRPKALSLEAHGLS
FT                   PEDLKRPLPPLFGAPTLGALLERLEATYLGPVGFEVAHVEPEERAWLLSRIEAPWPKPA
FT                   PEVRRRVLRSLLQASLFEAFLQRKYLGAKTFSVEGLESLIPLLQEAVQEAARFGVREVV
FT                   LGMAHRGRLNVLAHVVEKPFEAIFREFEELFPEGYVGDVKYHLGHSTDVETPWGPVHVS
FT                   LNFNPSHLEFVNPVALGRVRAKQDRFGDRERKRGLAVLVHGDAAFIGEGIVQETLNLSQ
FT                   LPGYRVGGTLHVVANNQLGFTTLPSEYTSSRYPTDVAKMVGAPIFHVNAEALDELLFVL
FT                   ALALEYRSRYGKDVVIDLVGYRRRGHNETDEPTFTQPGMYALIAKKPEPWRVYAERLEA
FT                   EGLVSEEELKAWQEAYLERLESEFARVKAEATPVVYSTLGGVWQGYVGGPDHLVPEADT
FT                   AFPKEGLKNLLVRLSSVPEGFQVHPKLKRFLEARREMAEEKRPVDWATAEALAFATLAV
FT                   EGHRVRLTGQDALRGTFTQRHAALYDYRTGERYIPLQHLAEGQAEVEIHNSPLSEAGVL
FT                   GFEYGYSLDYPEGLVLWEAQFGDFVNVAQVYIDQFLASAEVKWNRLSGLVLLLPHGLEG
FT                   QGPEHSSARLERFLQLAAKDNLQVAYPTTPAQFFHLLRRQVKRKIRKPLVVMTPKSLLR
FT                   HPEVVSALEELAEGRFQKVIPERVKGARKVLLTSGKVYYDLLQKRKELQAEDVAILRLE
FT                   LLYPFPEAELQEALGAYPKKVPVVFVQEEPVNQGAWWYLSARFCGEIYGHPFSVVARPE
FT                   SPSPAVGSSKVHKLEQEELLEEAFR"
FT   CDS_pept        283093..283857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0290"
FT                   /product="probable enoyl-CoA hydratase"
FT                   /note="similar to GB:AAS82039.1 percent identity 99 in 254
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70113"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70113"
FT                   /db_xref="GOA:Q5SLK3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="PDB:3HRX"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70113.1"
FT                   /translation="MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREV
FT                   RALLLTGAGRAFSAGQDLTEFGDRKPDYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAG
FT                   AGMSLALWGDLRLAAVGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLS
FT                   AEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALAL
FT                   EAVLQGQAGQTQDHEEGVRAFREKRPPRFQGR"
FT   CDS_pept        283854..284429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0291"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="similar to GB:AAS82038.1 percent identity 100 in 191
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70114"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70114"
FT                   /db_xref="GOA:Q9F1Q3"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="PDB:1IXR"
FT                   /db_xref="PDB:1IXS"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9F1Q3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70114.1"
FT                   /translation="MIRYLRGLVLKKEAGGFVLLAGGVGFFLQAPTPFLQALEEGKEVG
FT                   VHTHLLLKEEGLSLYGFPDEENLALFELLLSVSGVGPKVALALLSALPPRLLARALLEG
FT                   DARLLTSASGVGRRLAERIALELKGKVPPHLLAGEKVESEAAEEAVMALAALGFKEAQA
FT                   RAVVLDLLAQNPKARAQDLIKEALKRLR"
FT   CDS_pept        complement(284412..285161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0292"
FT                   /product="probable hydrolase"
FT                   /note="similar to GB:AAS82037.1 percent identity 99 in 249
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70115"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70115"
FT                   /db_xref="GOA:Q5SLK1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70115.1"
FT                   /translation="MKLLLLDLDDTLLQDLPVSRAVLEDLGRKAGVEGFFARVKARAEA
FT                   LFREAPFYPWAEAIGHSALEALWARYSTPGLEALAAWAGPFRERVFREALEEAGGPPER
FT                   ARELAEAFFRERRRYPLYPEAEAFLAEARRRGLALALLTNGVPDLQREKLVGAGLAHHF
FT                   SLVLISGEVGIGKPDPRLFRMALCAFGVAPEEAAMVGDNPQKDVRGARLAGVRAVWVDR
FT                   GLRPEDPEASPDLRVGDLREVFLAEAL"
FT   CDS_pept        complement(285158..285526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0293"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82036.1 percent identity 100 in 122
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70116"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70116"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70116.1"
FT                   /translation="MSETLLVYVPDLGQGVSFYQALGLALEELLPEREALLSPLEGPLL
FT                   LLRPGEGGVARGPQRPRPEGQGFARLRVEEGRLVFLVDNLAHEKLRLAKYGLGFREAGD
FT                   HLLLFDPGGNPVLVREEA"
FT   CDS_pept        complement(285523..286038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82035.1 percent identity 99 in 171
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70117"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70117"
FT                   /db_xref="GOA:Q5SLJ9"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="PDB:1WEH"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70117.1"
FT                   /translation="MRLLAVFVSSRLSPEDPLYARWVRYGEVLAEEGFGLACGGYQGGM
FT                   EALARGVKAKGGLVVGVTAPAFFPERRGPNPFVDLELPAATLPQRIGRLLDLGAGYLAL
FT                   PGGVGTLAELVLAWNLLYLRRGVGRPLAVDPYWLGLLKAHGEIAPEDVGLLRVVADEED
FT                   LRRFLRSL"
FT   CDS_pept        complement(286039..286473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0295"
FT                   /product="universal stress protein UspA-like protein"
FT                   /note="similar to GB:AAS82034.1 percent identity 98 in 144
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70118"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70118"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70118.1"
FT                   /translation="MCQKILMPTDGSPCSLQALEHGLDLAKTLGAKVHFLYVLENPAQT
FT                   IWIAPESVPYGMELLEDLRKAGEEAIKKALDLARAKGVEATGEVKEGVPIPTIVEAAKE
FT                   YDLLVMGTHGRTGLDRLLLGSVTEGVLHRTSVPVLVVRCR"
FT   CDS_pept        286526..287242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0296"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /note="similar to GB:AAS82033.1 percent identity 100 in 238
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70119"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70119"
FT                   /db_xref="GOA:Q5SLJ7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70119.1"
FT                   /translation="MWIYGRNPVLEALRAGRARRVLVARGVEGWLLKELERLGAPYTLV
FT                   PRIELDTLLRTTHHQGIAAEVEDPPYASLEDALRLAASRKEPPLLVALDGVTDPRNYGA
FT                   MIRSALALGAHGVVSEERRAAPLSPLALKASAGAALKLPVVKVKNLPRTLKALKEEGLW
FT                   VYGLDVRGEKAPWELDYARPLVLVVGSEGEGMRRLVRETCDELFRIPIREEAESLNASV
FT                   ALGIALYQARLARGVG"
FT   CDS_pept        287247..288317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0297"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="similar to GB:AAS82032.1 percent identity 99 in 356
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70120"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70120"
FT                   /db_xref="GOA:Q5SLJ6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70120.1"
FT                   /translation="MDWVRLLSRLVQAESLPGEEGEAAGLLLEALKGMGLEATLDEAGN
FT                   IEALLGEKGPEVVLTGHMDVVPVGDPARWPYPQGAVAEGSLWGRGAVDMKGSLVAMLLA
FT                   LETLARGALKGRVRFLAVVQEEVGGLGSRFAAERLSPLAFVLGEPSSGRLMRGHRGRAE
FT                   VWADFEGRETHAALAGPENPLFDLGAYLLALQDLPLPPGVKLTPTRVDTHPGARNQTPG
FT                   VVRLYLDVRYEPEADLDGLLAALRTLGPASVYLPEEERASGEVRMTLPALWPPYRLPED
FT                   HPLLQAALQALGQEEAGLWPFTTDAPYLGAKAPVLGLGPGDPALAHTPMEHVPLRAVEE
FT                   AAQAYVRLVEALWNAA"
FT   CDS_pept        288302..288538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82031.1 percent identity 100 in 78
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70121"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70121"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70121.1"
FT                   /translation="MERRLIAGKPYRRLLVAPRPVAEGMKARLEARGLPVYLETPFAGL
FT                   PEAATGTYMGDVALYVPEEVLGEAEALLREDVP"
FT   CDS_pept        288535..289443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0299"
FT                   /product="glucokinase"
FT                   /note="similar to GB:AAS82030.1 percent identity 99 in 302
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70122"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70122"
FT                   /db_xref="GOA:Q5SLJ4"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="PDB:3VOV"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70122.1"
FT                   /translation="MKVVGLDLGGTKIAAGVFDGKRLLSKVVVPTPKEGGERVAEALAE
FT                   AAERAEREAGVRGEAIGLGTPGPLDFRRGVIRFAPNIPGVQDFPIRRILEEATGRPVFL
FT                   ENDANAAALAEHHLGAAQGEESSLYLTVSTGIGGGVVLGGRVLRGERGQGGELGHLTLL
FT                   PGGPACGCGLEGCLEALAAGRALERDATYAFQRPVDTRELFRLFQAGDPKAERLVLQAA
FT                   RYVGIGLASLVKAFDPGVVVLGGGVALNAPEGYWEALLEAYRRYLQGWEAPPLRRARLG
FT                   AEAGLLGAALTAYLEVKDGSG"
FT   CDS_pept        289430..289642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82029.1 percent identity 100 in 70
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70123"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70123"
FT                   /db_xref="GOA:Q5SLJ3"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70123.1"
FT                   /translation="MEAGKVLVYAGAFLLLLGLLLLYFPKLFAWFGHLPGDIRIEREGL
FT                   RVYIPITSALLLSLLLTLLLNLFRR"
FT   CDS_pept        complement(289562..289810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0301"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82028.1 percent identity 97 in 82
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70124"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70124"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70124.1"
FT                   /translation="MGLEDPPWPLLTLDQGEVGVLDLAPVFRYALPAKRGPLTLGLRGP
FT                   VVAAFTLAFHRLAAEEVEEEGEEEGEEEGGGDGDVHP"
FT   CDS_pept        290132..290341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0302"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82022.1 percent identity 100 in 69
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70125"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70125"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70125.1"
FT                   /translation="MKMFLAQKGVPFEFVNAREDEEARKKVTALAGSPTAGVVLEWEGG
FT                   TEVIRGVSPASLHAWLARYRGKEA"
FT   CDS_pept        complement(290320..290829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82021.1 percent identity 100 in 169
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70126"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70126"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="PDB:2YQY"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70126.1"
FT                   /translation="MVRLEDYGTWDEALKRLEASRKALLALLREADPAWLSAPLREGAW
FT                   TPLMVAEHVALVEDSTARVLRRLRRLAAGENLPPVPVKPGEFKDGKPQAPEGVRPKGGL
FT                   SLEEVLALLDRARAFLLEEVAKADPQNPATFPHPFFGELNPLGWLRAAAYHEAHHLKAL
FT                   QASLPR"
FT   CDS_pept        290981..291766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0304"
FT                   /product="enoyl-[acyl carrier protein] reductase"
FT                   /note="similar to GB:AAS82020.1 percent identity 98 in 261
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70127"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70127"
FT                   /db_xref="GOA:Q5SLI9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:1ULU"
FT                   /db_xref="PDB:2WYU"
FT                   /db_xref="PDB:2WYV"
FT                   /db_xref="PDB:2WYW"
FT                   /db_xref="PDB:2YW9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70127.1"
FT                   /translation="MLTVDLSGKKALVMGVTNQRSLGFAIAAKLKEAGAEVALSYQAER
FT                   LRPEAEKLAEALGGALLFRADVTQDEELDALFAGVKEAFGGLDYLVHAIAFAPREAMEG
FT                   RYIDTRRQDWLLALEVSAYSLVAVARRAEPLLREGGGIVTLTYYASEKVVPKYNVMAIA
FT                   KAALEASVRYLAYELGPKGVRVNAISAGPVRTVAARSIPGFTKMYDRVAQTAPLRRNIT
FT                   QEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMGMELEG"
FT   CDS_pept        291802..293022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0305"
FT                   /product="GcpE protein"
FT                   /note="similar to GB:AAO21364.1 percent identity 99 in 406
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70128"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70128"
FT                   /db_xref="GOA:Q5SLI8"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="PDB:4S38"
FT                   /db_xref="PDB:4S39"
FT                   /db_xref="PDB:4S3A"
FT                   /db_xref="PDB:4S3B"
FT                   /db_xref="PDB:4S3C"
FT                   /db_xref="PDB:4S3D"
FT                   /db_xref="PDB:4S3E"
FT                   /db_xref="PDB:4S3F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70128.1"
FT                   /translation="MEGMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVL
FT                   ELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAE
FT                   ALDKFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNAR
FT                   RPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRT
FT                   QAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEI
FT                   LQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAV
FT                   MGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVK
FT                   TRFAPKA"
FT   CDS_pept        293022..294179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0306"
FT                   /product="queuine tRNA ribosyltransferase"
FT                   /note="similar to GB:AAS82018.1 percent identity 99 in 384
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70129"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70129"
FT                   /db_xref="GOA:Q5SLI7"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70129.1"
FT                   /translation="MDPFRFQVEARAGRARVGRLFTPHGAVETPLFMPVGTAGSVKGLM
FT                   PKDLEAIGSQVLLTNTYHLLLRPGPERVRALGGLHGFAGWKGPWLTDSGGFQVMSLGHM
FT                   RRIDEEGVVFQSHLDGRLIKLTPERSIAVQEALGADLIMAFDECPPYPSPREYLEASLE
FT                   RTLRWLERSLKAKTRPDQALFGIAQGGTDPELRRRSTLETIRFDLPGYAIGGLAVGEPK
FT                   EAMFAMVELSTRLLPEDRPRYLMGVGHPEDLVAAMGLGVDLFDCVYPTRTGRFGSALVP
FT                   EGRLNLKNARFLEDRRPLEEGCDCYTCQTFGRAYLAHLVRAGEMLGGILLSLHNLRHLH
FT                   RLTEAARQAIREGRYGDFAREFARRRFGREVPPWFREALAAGGHG"
FT   misc_feature    294264..295499
FT                   /note="TTHA0307 and TTHA0308, disrupted by frameshift"
FT   CDS_pept        294264..294677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0307"
FT                   /product="uracil permease [N-terminal]"
FT                   /note="similar to GB:AAS82017.1 percent identity 100 in 137
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70130"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70130"
FT                   /db_xref="GOA:Q5SLI6"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70130.1"
FT                   /translation="MTPRHLILGLQHTVAMFGATVLVPLLTGLNPSVALFTAGVGTLVF
FT                   HLVTGRMVPVFLGSSFAFIAPILAAKEAGFSLSAIGGGIAAAGLVYVLFALLVLLIGSE
FT                   RVRQVFPPVVTGPVIVVIGLTLAPVAVEMAGKD"
FT   CDS_pept        294699..295499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0308"
FT                   /product="uracil permease [C-terminal]"
FT                   /note="similar to GB:AAS82017.1 percent identity 99 in 266
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70131"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70131"
FT                   /db_xref="GOA:Q5SLI5"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70131.1"
FT                   /translation="MGAVASAVFFRGLFQMVPVLVGVGAGYLLALLLGRVDLSPVREAP
FT                   WFALPAFTPATLEWGAVLLIAPVALVTVMEHIGDILTNGRVVGKDFFVKPGLHRTLLGD
FT                   GLATSLAGLLGGPANTTYSENTGVLAVTRVYDPLVLRIAAGFAILLAFIPKLSALLQTL
FT                   PQGVLGGISMLLFGMIASIGIRTLAEAEIDFTQSRNLIVVSAILVLGLGGAVANLGTVQ
FT                   VAGAAVPLKVSGMALAALVGVVLNLLLPPRLEPRTLLEEEERLP"
FT   CDS_pept        complement(295640..296737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82016.1 percent identity 99 in 365
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70132"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70132"
FT                   /db_xref="GOA:Q5SLI4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70132.1"
FT                   /translation="MREAFLKVWENPYVRVAAYLLFFYGLFLLVARAWPALSVLLTAFA
FT                   FAYLVHPLVQALERRRLPRAVGVVLVYLLLGLFLALASFLAAQTVVELSRLARDLPRLL
FT                   DPLLAWLVALPDRAQAVPVPESLRPVLEELTRNLRGLLQGFLEALVRWLQGLLAQGGSL
FT                   LGFFTSLLGGVFQLFTALILSAYFLYDLPRLGRAALAVFPEPYQPLAQDLAAKLNASVG
FT                   GYVRGQLLVALCVGFLVGLGFWLVGVPLAASLGFLAGVFNLIPFVGVVVSGVPALLLAA
FT                   TGGLGKAALALLVMVAANQLEAHVLGPLIVGRATRLHPVTAIAAILTGGTLFGLWGALL
FT                   AVPAAAFLKVVLEDYYKGSRFYREG"
FT   CDS_pept        296888..298714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0310"
FT                   /product="cytochrome c oxidase assembly factor (CtaA) +
FT                   protoheme IX farnesyltransferase (CtaB)"
FT                   /note="similar to GB:AAS82015.1 percent identity 99 in 608
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70133"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70133"
FT                   /db_xref="GOA:Q5SLI3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70133.1"
FT                   /translation="MKTPAWSRLAGYAWGVLLWNVLVALFGAYVRATGSGAGCGAHWPT
FT                   CNGEVIPRAPQVETLIEFTHRATSGLAFLSVLALFLWALRAFPKGHPARFGAGLALFFM
FT                   VTESLVGASLVLFGWTADNVSRERAVVQMVHLANTYFLLAALALTAWWASGGGPLRLRG
FT                   QGAVGLALFLGLLALLFLGMSGAVTALGDLLFPVGSTLEALERSLTPGEHFLVRLRVLH
FT                   PLIAVSVGLYVVFAGYLVAHLRPSPLTRRLAQGLAYLYGAQLLAGLINVALKAPVWMQI
FT                   LHLLLAYAIWLLFVFLATSALERGAKRVELGEGGEAVHRGTGGATWRDYLALTKPRVIS
FT                   LLLFTALFGALIAAKGWPGLGVFLAVALGGYMMAGAANAINMVVDRDIDARMKRTAKRP
FT                   TVTQRVSSRDALLFAFALAVLGFAVLWWGANLLAATLALMGLIWYVLVYTLYLKRRTWH
FT                   NIVIGGAAGAFPPLVGWAAVTGELSLFAWYLFALIFFWTPVHFWALALMIQDDYRAVGV
FT                   PMLPVVLGERATVIQIALYALLTALISLMPLLLGELGLLYLAASLLLNALLLLKSLALY
FT                   RRPERRTAVSLYKYSMLYLALLFAAMAVDRAV"
FT   CDS_pept        298729..299742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0311"
FT                   /product="cytochrome caa3 oxidase subunit IIc"
FT                   /note="similar to GB:AAA27484.1 percent identity 100 in 337
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70134"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70134"
FT                   /db_xref="GOA:Q5SLI2"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="PDB:2YEV"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70134.1"
FT                   /translation="MQRSFAALGLWGLSLAQEAHRVAITHPGGSFNQEVAFLFPWVYFF
FT                   SFLIFLVVAGSLAYVTWKFRARPEDQEEPPQIHGNDRLEVVWTLIPLAIVFVLFGLTAK
FT                   ALIQVNRPIPGAMKVEVTGYQFWWDFHYPELGLRNSNELVLPAGVPVELEITSKDVIHS
FT                   FWVPGLAGKRDAIPGQTTRISFEPKEPGLYYGFCAELCGASHARMLFRVVVLPKEEFDR
FT                   FVEAAKASPAPVADERGQQVFQQNCAACHGVARSMPPAVIGPELGLWGNRTSLGAGIVE
FT                   NTPENLKAWIRDPAGMKPGVKMPGFPQLSEEDLDALVRYLEGLKVEGFDFGALPKF"
FT   CDS_pept        299755..302130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0312"
FT                   /product="cytochrome caa3 oxidase subunit I (polypeptide I
FT                   + III)"
FT                   /note="similar to GB:AAA27485.1 percent identity 100 in 791
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70135"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70135"
FT                   /db_xref="GOA:P98005"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="PDB:2YEV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P98005"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70135.1"
FT                   /translation="MAITAKPKAGVWAVLWDLLTTVDHKKIGLMYTATAFFAFALAGVF
FT                   SLLIRTQLAVPNNQFLTGEQYNQILTLHGATMLFFFIIQAGLTGFGNFVVPLMLGARDV
FT                   ALPRVNAFSYWAFLGAIVLALMSYFFPGGAPSVGWTFYYPFSAQSESGVDFYLAAILLL
FT                   GFSSLLGNANFVATIYNLRAQGMSLWKMPIYVWSVFAASVLNLFSLAGLTAATLLVLLE
FT                   RKIGLSWFNPAVGGDPVLFQQFFWFYSHPTVYVMLLPYLGILAEVASTFARKPLFGYRQ
FT                   MVWAQMGIVVLGTMVWAHHMFTVGESTLFQIAFAFFTALIAVPTGVKLFNIIGTLWGGK
FT                   LQMKTPLYWVLGFIFNFLLGGITGVMLSMTPLDYQFHDSYFVVAHFHNVLMAGSGFGAF
FT                   AGLYYWWPKMTGRMYDERLGRLHFWLFLVGYLLTFLPQYALGYLGMPRRYYTYNADIAG
FT                   WPELNLLSTIGAYILGLGGLVWIYTMWKSLRSGPKAPDNPWGGYTLEWLTASPPKAHNF
FT                   DVKLPTEFPSERPLYDWKKKGVELKPEDPAHIHLPNSSFWPFYSAATLFAFFVAVAALP
FT                   VPNVWMWVFLALFAYGLVRWALEDEYSHPVEHHTVTGKSNAWMGMAWFIVSEVGLFAIL
FT                   IAGYLYLRLSGAATPPEERPALWLALLNTFLLVSSSFTVHFAHHDLRRGRFNPFRFGLL
FT                   VTIILGVLFFLVQSWEFYQFYHHSSWQENLWTAAFFTIVGLHGLHVVIGGFGLILAYLQ
FT                   ALRGKITLHNHGTLEAASMYWHLVDAVWLVIVTIFYVW"
FT   CDS_pept        302175..302894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0313"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82012.1 percent identity 98 in 239
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70136"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70136"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70136.1"
FT                   /translation="MKREGMRLLVVDFDYFFPVPQDPRDPLAPLFAWAHFETPYYLLEA
FT                   WEERALAFLLRGLSLPEARGWEGFWGRFAFAREAVLYYAESNALAFHPEVRRGVEEVVL
FT                   FDAHHDAGYRPLGEEPACDDWMVFYHRLGARLRVYYPPWRDPSLEPEPKVPVALEVDPG
FT                   GRVEGVFHRVFVCRSGAWVPPWADPGFFAFLEEAPLPKVALEALLPRPFSLEALKRRVA
FT                   LEGFGLRFMERLKGRAG"
FT   tRNA            302941..303016
FT                   /gene="tRNA-Lys-1"
FT                   /product="tRNA-Lys"
FT                   /note="anticodon: TTT"
FT   tRNA            303023..303097
FT                   /gene="tRNA-Glu-1"
FT                   /product="tRNA-Glu"
FT                   /note="anticodon: CTC"
FT   tRNA            303099..303175
FT                   /gene="tRNA-Val-1"
FT                   /product="tRNA-Val"
FT                   /note="anticodon: TAC"
FT   CDS_pept        complement(303317..304537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0314"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="similar to GB:AAS82011.1 percent identity 100 in 405
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70137"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70137"
FT                   /db_xref="GOA:Q5SLH9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70137.1"
FT                   /translation="MWRGPREGRRIILSILGGLRGNRGRILLNGWLIWLGDTLMNPNII
FT                   LASFAARLGASPVLIGLVPALPLAGGLLPQALLVGWVARHGRKLPLYRRASAFRFAGLL
FT                   LLVFGAFFLGAWPGLLLGVFLAGLFLFALFTAVASLPYWEVLAKAVPREERPGLFAAIY
FT                   MGGGVLAFLAGFGVRALLGLDLPFPLGYALLFALGTLAYGAAWYVFGRVEEPEEEVAVG
FT                   RTDLRLPLRRPGFRAYLTARLFLGLAGMVEPFYAAYAVRVLGKEAELGLYLALNALAFI
FT                   LSNALWSALARRGAKAVFLGGGVLVLATPLLALALPPGAFALVFFLQGAYLAALGIAGN
FT                   TYLLNLAPPEERTATVGLANSFLGLFAFSPVLGGWVVGAWGYGALFLLSAGLAVLGLWA
FT                   VRRLPEV"
FT   CDS_pept        304494..305459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82010.1 percent identity 99 in 321
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70138"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70138"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70138.1"
FT                   /translation="MLRMILLPSLGPLHILHPRYNAATVLAILEAANPPVVYLASHSEA
FT                   SLAEGTWREEDPLLFHLLPWAEARGVPVVPVDREAHLKGEAEAFREALAQYPAARPHLE
FT                   RLAAFDRDLSALLQRPLTPERLYAPEFLGELGALYEGFVRAFGEGPATGFRARRVAGVV
FT                   EALKGREGAVVADLLDFLLLLEAFPQEGPPPHRPTEAERVRALLDRAWLLKEEDDWGAL
FT                   VEQLFAIGSPEALYLAAQVYLASGQWEDALALMEEVFRMDFQHPGYLPGYVLARMGQLL
FT                   DLAGERERALRAYRGVLALSWAPEEARAVALAGLKTPFRL"
FT   CDS_pept        305528..305971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0316"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82009.1 percent identity 97 in 147
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70139"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70139"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70139.1"
FT                   /translation="MEVQLRRARRAMYLRLAAWHAGPLGLAWAGRPELAPRYPEAYARC
FT                   GGAPGLACAGVGGEPRVCLVRRLERLARSAERGGRRRRAQEKALVEELLLCVGHLQKEL
FT                   PPEFLPLLEATEKALRQDLDYLRSAASAPLSPEQKGQDQGQGP"
FT   CDS_pept        complement(305918..306622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0317"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82008.1 percent identity 97 in 234
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70140"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70140"
FT                   /db_xref="GOA:Q5SLH6"
FT                   /db_xref="InterPro:IPR019248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70140.1"
FT                   /translation="MLFLFQDPLGDAHGLAYLYPQAALYREAGEGYADLTALAGEVREG
FT                   ELVLKLRLARYPNPLGGPLGFSLATALVYLDLAPGGEEALLPGLRTPPGQGWEAAFVVT
FT                   GFGVERKSPEGKREAVGAWREGEWVVWSTGLPPGEYGYYGAVGLFDPFAPWYLRPVSPE
FT                   GGAWVLGAPLGMPPVVDVLALRPEDPRAAYQEGVLRPLRPKRFALEAPSLAAFGLGALS
FT                   LVLAFLLGRKGR"
FT   CDS_pept        complement(306631..307857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82007.1 percent identity 100 in 408
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70141"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70141"
FT                   /db_xref="GOA:Q5SLH5"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70141.1"
FT                   /translation="MWSGKGRGVWAHPAWRWLHPGMRVKRYAALAGLGVGMAAWGLGQA
FT                   LPLPALPPLAAWGVAALGGGLLVLGVRAMNRSMLSAFTRPEEVPERVYVRRRLERGPRV
FT                   VAFGGGTGLSRALSGLKEGTANLTAVVAVTDDGGSTGRLRLAYGLPAVGDLVDCLAALS
FT                   DHPALPRLLAYRFHRGEFSGHTFGNLFLVTLYEASGDFAEAVRQANAILNLRGQVLPAT
FT                   PQAVRLAARLQDGRRVVGEVALREAGGRVREVGLEPEPSVVMGEVLEALRRADLVLLGP
FT                   GSLYTSVIPSFLPGPIREAVRRSGALVVYVVNLMTEPGETDGYTAYDHYKAVAHHLGRR
FT                   PDVVVVHTAPIPEPVLRRYAAEGRHPVAYDPRPFRVDGVRVLEGDFREAGELAQHDPKK
FT                   LARAVLKLV"
FT   CDS_pept        complement(307838..308659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82006.1 percent identity 99 in 273
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70142"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70142"
FT                   /db_xref="GOA:Q5SLH4"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70142.1"
FT                   /translation="MRFLVLTGLSGAGKTTARGFLEDLGYFMVDNLPPRLWLPLLQEAA
FT                   ARGLARVGVVVDARALAFFQDLEEVLEALRPTVVYLEARPEVLLRRYNLTRRVHPLGAG
FT                   NLMREIAEERRALAGLRGRAHLVVDTSELSPRGLKEALARFLGEEGGFLLRLVSFGFKW
FT                   GPPQEADLVLDVRPLPNPHYDPALRPRTGLDPEVRRYVFSEAAEPYYRALLAVAGLAAE
FT                   GARAEGRAFYTVAVGCTGGRHRSVAVAERLAEELSGRFAVEVVHRDVEREG"
FT   CDS_pept        complement(308668..309585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0320"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="similar to GB:AAS82005.1 percent identity 99 in 305
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70143"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70143"
FT                   /db_xref="GOA:Q5SLH3"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70143.1"
FT                   /translation="MRVAFFGTPLWAVPVLDALRKRHQVVLVVSQPDKPQGRGLRPAPS
FT                   PVARYAEAEGLPLLRPARLREEAFLEALRQAAPEVAVVAAYGKLIPKEALDIPPHGFLN
FT                   LHPSLLPKYRGAAPVQRALLAGERETGVSIMRLDEGLDTGPLYAVWRTPILPDEDAVAL
FT                   GNRLRDKGVELLLEVLERLPELTPRPQEGEASYAPPLSKEEGRLDFGESAEALYRRHRA
FT                   VQPWPGSYFFHRGQRVKALRLRPEPGEGEPGVVARVGPEGVVVGTASGLLLLLEVQPEG
FT                   RRAMPAADWARGYGVAPGTRLGQV"
FT   CDS_pept        complement(309582..310160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0321"
FT                   /product="polypeptide deformylase"
FT                   /note="similar to GB:AAS82004.1 percent identity 100 in 192
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70144"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70144"
FT                   /db_xref="GOA:Q5SLH2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70144.1"
FT                   /translation="MVYPIRLYGDPVLRRKARPVEDFSGIKRLAEDMLETMFEAKGVGL
FT                   AAPQIGLSQRLFVAVEYADEPEGEEERPLRELVRRVYVVANPVITYREGLVEGTEGCLS
FT                   LPGLYSEEVPRAERIRVEYQDEEGRGRVLELEGYMARVFQHEIDHLDGILFFERLPKPK
FT                   REAFLEANRAELVRFQKEARALLKELSQG"
FT   CDS_pept        complement(310166..310975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82003.1 percent identity 98 in 269
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70145"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70145"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70145.1"
FT                   /translation="MRDWPAFLLALLVAFALWYSLQERAPVVERSLKVPLQVVGLGEGR
FT                   RALGLPREVLLRLRGPAPLLEGRALPVSAYLDLSGAEGEVVREVRVAAPQGVEVLEVVP
FT                   ARVGVVVEVEAQRQIPVEVLAQGAWVLTDPAFVEAVGPESQVEAAVSAVGLDLGDEVVL
FT                   FPFGPEGPLEGVELRPNRVRVVERREALFLKEVPLSLKPPPGRRLLDYAPKTVRLVGPR
FT                   EALEGLAGVAATLQEALGPGEVEVAVAPDLPPGVQTLGPVRVRVALE"
FT   CDS_pept        complement(310968..311693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS82002.1 percent identity 99 in 241
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70146"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70146"
FT                   /db_xref="GOA:Q5SLH0"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70146.1"
FT                   /translation="MSLTWRDLLDIFLVGVLLYSLYRILAGTRALNLVRGVLIYLATWF
FT                   LASLLGLSTLSWILGNAATLGAFALIVVFQPELRGLLERLGRGQGALRPPPVALEMEEL
FT                   LLGLRRLAERRHGALLALERRTPLGEYAASGEVLDARLSARLLETLFYPGTPLHDGGAI
FT                   VREGRLFAAGCVFPLSEVGMGLGTRHRAALGLSEVSDALVIVVSEETGAIRVAEGGRLS
FT                   PPLSLEALRARLKEVVRDA"
FT   CDS_pept        complement(311697..312842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0324"
FT                   /product="phosphopentomutase"
FT                   /note="similar to GB:AAS82001.1 percent identity 98 in 381
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70147"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70147"
FT                   /db_xref="GOA:Q5SLG9"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70147.1"
FT                   /translation="MKAVAIVLDSVGLGYLPDAPLFGDEGADTLDHTVLKTGIALPHLA
FT                   GLGLGRVPGVHTLPRAERPRGGFGRMREVNPGKDTTTGHWEFVGIHLEKPFRTFPHGFP
FT                   EDVLREWAEAIGVGGWLLNRPYSGTEAIRDHGEAHLKTGYPIVYTSADSVFQVAAHVDV
FT                   VPVEELYRFCQVARERLVGELQVARVIARPFAGEPGRFYRLEHLRKDFALEPPRNVLDV
FT                   LKEGGLEVVGVGKIPDIYAGRGFTRKVKTKDNRDGLEKTLALMGEPFSGLVFTNLVDFD
FT                   SKYGHRRDPEGYGRALVELDAFLPRLLAALGPEDHLFLVSDHGNDPTFFGTDHTREYGM
FT                   LLWVGPGVEGELGTRETFADLGATWARLFGLAWDGPGTSLV"
FT   CDS_pept        complement(312839..313096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0325"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82000.1 percent identity 100 in 85
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70148"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70148"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70148.1"
FT                   /translation="MDLAEKLSELAQALSQASAAVGVLEAIEEVLDEYKDGELTLKEAM
FT                   EEIQGLVEEFQAVRALSEMAPEELMALAEEEEEDEGGLRS"
FT   CDS_pept        complement(313106..314176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0326"
FT                   /product="putative ATP/GTP-binding integral membrane
FT                   protein"
FT                   /note="similar to GB:AAS81999.1 percent identity 98 in 352
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70149"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70149"
FT                   /db_xref="GOA:Q5SLG7"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70149.1"
FT                   /translation="MGALLFRAPRAARPACGPFLCCRTQVRALSLRAMRLVERTPEVDL
FT                   DRLLQGFVPPPRFLGATFQTYRPDPRYPSQALVKERLRRWVHDRPRGFLRPRLPGPQGI
FT                   YLDGGFGVGKTHLLVAAYLEAPSPKAFLTFEELTYTLGLLGLREGARRFSGLRYLFLDE
FT                   FELDDPGNAQMVTHFLALTMDRGLRVATTSNTPPGALGEGRFNAEQFRHQIQSLARRFA
FT                   VERIEGEDFRHRDPDRLPDPLPEERLLALYREDPRPKSLDDFPELIAHLRRLHPIRYRY
FT                   LFDGLKAVYLRGLEPLHDQNDALRFVHFVDQLYNLGLDLKASGAPLKDLFPESYRHGAF
FT                   AKKYGRALSRLAELLG"
FT   CDS_pept        complement(314192..315082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0327"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="similar to GB:AAS81998.1 percent identity 100 in 296
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70150"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70150"
FT                   /db_xref="GOA:Q5SLG6"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="PDB:3APT"
FT                   /db_xref="PDB:3APY"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70150.1"
FT                   /translation="MKIRDLLKARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAF
FT                   VSITYGAMGSTRERSVAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGVENLL
FT                   ALRGDPPRGERVFRPHPEGFRYAAELVALIRERYGDRVSVGGAAYPEGHPESESLEADL
FT                   RHFKAKVEAGLDFAITQLFFNNAHYFGFLERARRAGIGIPILPGIMPVTSYRQLRRFTE
FT                   VCGASIPGPLLAKLERHQDDPKAVLEIGVEHAVRQVAELLEAGVEGVHFYTLNKSPATR
FT                   MVLERLGLRPASGQP"
FT   CDS_pept        315142..315732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0328"
FT                   /product="probable isochorismatase"
FT                   /note="similar to GB:AAS81997.1 percent identity 100 in 196
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70151"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70151"
FT                   /db_xref="GOA:Q5SLG5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70151.1"
FT                   /translation="MVQVPEIPKVETVELPAKETALIVVDMQNDFAHPKGALFVPDAPQ
FT                   SVPAIRLLLERARQAGAKVVYTQDWHREDDPEFQIWPRHAVAGTWGAEILEELKPEPED
FT                   LVIRKVRYDAFYGTPLDHYLHLFGVKHVVVTGTVANICVLHTAGSAALRWYNVVLPEDA
FT                   TSALTPFDLEATLRQVTFLYQGKVTRAEGVRFV"
FT   CDS_pept        315725..316282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0329"
FT                   /product="DNA-3-methyladenine glycosidase"
FT                   /note="similar to GB:AAS81996.1 percent identity 98 in 185
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70152"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70152"
FT                   /db_xref="GOA:Q5SLG4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70152.1"
FT                   /translation="MFEHPVLAAFYRRHGPAPFAPNPFPQRPPFRVLAESVVAQQLSTR
FT                   AAARLAERLFRLVPPTPEAFLEAPLDLLRQAGLSRAKALALKDLAAKAEEGLLDGLDRL
FT                   EDEAVVERLTRVRGVGLWTAEMFLMFGLGRPDVWPVRDLGLRRAAARLFGVAPEALPAF
FT                   GEAFRPYRSHLAWYLWRSLSSP"
FT   CDS_pept        316258..316854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS81995.1 percent identity 100 in 198
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70153"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70153"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70153.1"
FT                   /translation="MAKPVLPLKEAPASGEVALLRLLEARGQEVVPTWVVDLEAEFYRL
FT                   ANLPERITALFQGVFGVRIDEERLLVAAEEARRAVRESYLLPERAEAFLEALKGRGPFL
FT                   LRYAGEAEGERASTPQEALFALKRLWARRFEVEAILERYPALLPPFTPVLVQEVAGEVA
FT                   EDPFLSLDLSRALGREVVAYAWAGKLVRVESPHGG"
FT   CDS_pept        316844..317647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0331"
FT                   /product="histidinol phosphatase"
FT                   /note="similar to GB:AAS81994.1 percent identity 99 in 267
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70154"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70154"
FT                   /db_xref="GOA:Q5SLG2"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="PDB:2YXO"
FT                   /db_xref="PDB:2YZ5"
FT                   /db_xref="PDB:2Z4G"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70154.1"
FT                   /translation="MVDSHVHTPLCGHAEGHPEAYLEEARAKGLKGVVFTDHSPMPPWY
FT                   DPESRMRLEALPFYLLALERVRERAQDLYVGIGLEADFHPGTEGFLAQLLRRYPFDYVI
FT                   GSVHYLGAWPLDHPDHQEEYAWRDLKEVFRAYFQEVEKAARSGLFHAIGHLDLPKKFGH
FT                   RLPEEALLELAEPALRAVAEAGLFLDVNTAGLRRPAKEVYPAPALLRRARELGIGLVLG
FT                   SDAHRPEEVGFAFPEVQALLAGLGFREAYYFVEGSPVAYPLSRAS"
FT   CDS_pept        complement(317623..317889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0332"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS81993.1 percent identity 100 in 88
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70155"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70155"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70155.1"
FT                   /translation="MRLEEARIAVDEALSAYRRCVEAEVEEYGPEYERVTFMEYEAPAP
FT                   DPCAEAFLRLVEAVRAYEAAGGSREDLDLGRERKRVYEALDKG"
FT   CDS_pept        complement(317912..318574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS81992.1 percent identity 99 in 220
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70156"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70156"
FT                   /db_xref="GOA:Q5SLG0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70156.1"
FT                   /translation="MTWPAFSLGVWGYPERMDPRVPPGQFVTERFPILTYGETPKVAKE
FT                   AWRLEVTGLVETPLVLTYEDLLARPQVELTRDFHCVTRWSRLDVTWKGVRTRDLLEEAR
FT                   PRPEAVAALVESYGGYTTNLLLEDLLREDVLLAHTLFGKPLPPERGGPVRLLVPHLYAW
FT                   KSAKWVRRIVLLDHLELGFWERLGYHWRGDPWKEERFQEGPVPAHRIRFAARNKPGR"
FT   CDS_pept        complement(318605..318937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS81991.1 percent identity 100 in 110
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70157"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70157"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70157.1"
FT                   /translation="MRLEGEALLLRVFLGESDRYEGRPLYEAIVLEARRRGLSGATVLK
FT                   GFMGFGAHSRIHTAKILQLSEDLPVVVEIVDTEEKIQAFLPVLDGMVREGLVTLEKVRV
FT                   LLYRSR"
FT   CDS_pept        complement(318942..319319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS81990.1 percent identity 98 in 125
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70158"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70158"
FT                   /db_xref="GOA:Q5SLF8"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70158.1"
FT                   /translation="MERYLLVALGGALGSLLRYGLGALVQGSLGAGFPWSTLFVNALGS
FT                   FLIGLTLRLSLEGALSGEARLFLAVGVLGGFTTFSSLSYETLALLQGGEVGKALLYAFG
FT                   SLFLGLFLAFLGYRLGGALVG"
FT   CDS_pept        319340..319813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0336"
FT                   /product="riboflavin synthase, beta subunit
FT                   (6,7-dimethyl-8-ribityllumazine synthase (RibH))"
FT                   /note="similar to GB:AAS81989.1 percent identity 100 in 157
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70159"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70159"
FT                   /db_xref="GOA:Q5SLF7"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70159.1"
FT                   /translation="MKPKTLSPILTAKGVRLAIAVGRFNERVTKLLLEGALEAYARLGG
FT                   DPAEVLVAWVPGSFELPLVAKRLAQRPDVDAVVALGAVIRGETPHFEYVAGQAASGLMQ
FT                   AMLQTEKPIVFGVLTTNTPEEAQERAGGKAGNKGAEAVFTAIEMVRLLEAISR"
FT   CDS_pept        complement(319800..320204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS81988.1 percent identity 100 in 134
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70160"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70160"
FT                   /db_xref="GOA:Q5SLF6"
FT                   /db_xref="InterPro:IPR016942"
FT                   /db_xref="InterPro:IPR025508"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70160.1"
FT                   /translation="MRTDRNQLRFNQALLVLLLPLAALLDLPWLVYLLFLLMASQHTPL
FT                   DLMAVLKRLLRVPPQMVDEDPRPHRFARFLGAVFLGLASLALLLGLKPLGYALALLVAL
FT                   LAFVNLAFGFCLGCFLYLHLRYARALFTGK"
FT   CDS_pept        complement(320293..321060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS81987.1 percent identity 99 in 255
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70161"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70161"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="PDB:2CW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70161.1"
FT                   /translation="MRPVYFLSDFGLEDPYVAVVKAVLAERAPGPAVVDLAHALPPQDL
FT                   RRAAYALFEALPYLPEGAVVLAVVDPGVGTARRAVAALGRWTYVGPDNGLFTLAWLLDP
FT                   PRRAFLLEPPRPRPKAALPGWAPGEATFHGRDVFAPAAAHLALGLPPEGLGPEVPVETL
FT                   ARLPLALTEGPEGEVLTFDRFGNAITTLLRAPVGGFVEVGGRRVPVRRTFGEVPEGAPV
FT                   AYLGSAGLLEVAVNRGSAREALGLKEGMPVRLL"
FT   CDS_pept        complement(321060..322499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0339"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS81986.1 percent identity 99 in 479
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70162"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70162"
FT                   /db_xref="GOA:Q5SLF4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70162.1"
FT                   /translation="MRGVWALAVALGLAWGQGGDYAARCARLYAQGALEAAQATCELGL
FT                   VVAPQDREVLRLLVRIHLDKGEVAQAQAYLDRLGEDPEAPYLRARALLAEGRYREVLAL
FT                   GLEGTEGRLLRALALERLGRLEEALALARGLPLDREVRLLLGRLYLELGRPLEGVAYLG
FT                   DTPEEVVLKGRLLLAGGRLAEAASLLEEVRSRLSPESPLYREALAALVLARFGRLDGQG
FT                   GFSVLGELAQVENLPGLGLARLWPWLLCAVAFLGLLVYGESRIEPLRTVEVVEDPLPGP
FT                   GRLYLFALGGLGVALLVSVATGLGLYGNALALFTPYQQGVVLPLFHLAYGLYLFLGLYL
FT                   WQRRRFPGLLGPKEAWVEGFWVGPLLLGLLWAYGQVRGFLGLGGLPPSLLTFLGLALAE
FT                   PFFRGLVPWVFRERYRDLALPLAALFFAVAWPGPALFLLLVGWLLLRLKERTGGLLGLA
FT                   LGWVVAGVVMGLFPSAWLRRF"
FT   CDS_pept        322548..323240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS81985.1 percent identity 99 in 230
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70163"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70163"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70163.1"
FT                   /translation="MRQALFAAALLAVALAQGDLAGLIAQGRFAEAYERGVREATPQAL
FT                   VLAAQAASYHAMYVAKPEEKRAWFERAEKAASQAIAQDPGLAEAHFERARALGRLSQFK
FT                   GILEALAEGLAPRIRADLEETLKRKPDHAGAMVALALWHFELVQKGWLVAATQGADRAR
FT                   VEPLMRRAIELEPEAIVHRVEYARVLAAWGRKEEARKQLETALALPARTAADRYEKERA
FT                   QKALAELR"
FT   CDS_pept        323247..323741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0341"
FT                   /product="molybdopterin biosynthesis enzyme, MoaB"
FT                   /note="similar to GB:AAS81984.1 percent identity 99 in 164
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70164"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70164"
FT                   /db_xref="GOA:Q5SLF2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="PDB:2IS8"
FT                   /db_xref="PDB:3MCH"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70164.1"
FT                   /translation="MFRVGILTVSDKGFRGERQDTTHLAIREVLAGGPFEVAAYELVPD
FT                   EPPMIKKVLRLWADREGLDLILTNGGTGLAPRDRTPEATRELLDREVPGLAELMRLVGL
FT                   RKTPMAALSRGVAGVRGRTLILNLPGSPKGARESLEAVLPVLPHALSLVTGKPWKEGHH
FT                   E"
FT   CDS_pept        323734..324864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0342"
FT                   /product="probable N-succinyldiaminopimelate
FT                   aminotransferase"
FT                   /note="similar to GB:AAS81983.1 percent identity 99 in 376
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70165"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70165"
FT                   /db_xref="GOA:Q5SLF1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PDB:2DOU"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70165.1"
FT                   /translation="MSRVPEPSVFLVVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLK
FT                   ALAEALNDPTTYGYCLKSCTLPFLEEAARWYEGRYGVGLDPRREALALIGSQEGLAHLL
FT                   LALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLREDGLADLKAVPEGVWREAKVLL
FT                   LNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALPGAKERV
FT                   VELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALKTPKEV
FT                   VRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEGVDDLEFGLRLVERGVALA
FT                   PGRGFGPGGKGFVRIALVRPLEELLEAAKRIREALD"
FT   CDS_pept        complement(324874..326118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0343"
FT                   /product="folyl-polyglutamate synthetase"
FT                   /note="similar to GB:AAS81982.1 percent identity 98 in 414
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70166"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70166"
FT                   /db_xref="GOA:Q5SLF0"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70166.1"
FT                   /translation="MDPLSWLYARQGRFAPGLERIRAFLARLGHPEEAYPVALVGGTNG
FT                   KGTTARALAAILEEAGFRVGLYTSPHLVDFRERIQVQGRPIPEEKLLALLAELRPHAER
FT                   LEASFFEVATALALLHFAREGVEFAVLEVGLGGRLDATNATEPVLSVVTNVGHDHLEVL
FT                   GPTLKDVAREKAGIFRGGVPALTAARGEGLGVLRAEALARKTPLWVLGEDFHAEGVEAL
FT                   PQGLAFTLRLERTGEALRLTARLLGPHQAENLALAALSGRLLGAGWEAVKRGVARAENP
FT                   GRLQRLLWRGRELLLDGAHNPEGALALREALRFHGLLPAAFVLGFSRDKDHAAMAEALR
FT                   GLGPVVLTRYASPRSEDPRALLPLFPGAKVVEDPLEALEEAFSREGRVVVAGSLYLVGE
FT                   VLRRLEGLPAEERWQ"
FT   CDS_pept        complement(326119..326514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0344"
FT                   /product="ferric uptake regulatory protein"
FT                   /note="similar to GB:AAS81981.1 percent identity 100 in 131
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70167"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70167"
FT                   /db_xref="GOA:Q5SLE9"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70167.1"
FT                   /translation="MALKRLTRQRKAILEVVRQARHHPDAAWIYQEVRKRVPKVSLGTI
FT                   YRNLEALVAEGYLVPITKAGEATRYDANLHPHHHLVCEACGAIVDLEVDLPDLRALARE
FT                   AHPGVEVREAEVTFKGLCPACKAALKG"
FT   CDS_pept        complement(326557..327462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0345"
FT                   /product="porphobilinogen deaminase"
FT                   /note="similar to GB:AAS81980.1 percent identity 100 in 301
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70168"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70168"
FT                   /db_xref="GOA:Q5SLE8"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70168.1"
FT                   /translation="MRVVVVGTRGSALALAQTRFVVERLKETWPETEFKIRTIKTRGDQ
FT                   GASPREEAIFVKEIQEALLSREIDIAVHSLKDLPTESPRGLKIASVPRRQDPRDVFLGK
FT                   AAKRLKDLPPGAVVGTSSVRRKAQILALRPDLVVRDLRGNVDTRLAALGNGEYDGIVLA
FT                   AAGLIRLDLRNRIDEFLDPGEVLPAPGQGALALEVREGDDLAEELCYALHHPPSYHRVR
FT                   AERAFLRGLGAGCLAPVGALAHVEEDGTLRLEGVLLTPDGKSFIRAEIEGDVSEAEELG
FT                   LDLARDVLEQGGREILAQIR"
FT   CDS_pept        complement(327520..327969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0346"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="similar to GB:AAS81979.1 percent identity 100 in 149
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70169"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70169"
FT                   /db_xref="GOA:Q5SLE7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="PDB:3CGM"
FT                   /db_xref="PDB:3CGN"
FT                   /db_xref="PDB:3LUO"
FT                   /db_xref="PDB:4ODK"
FT                   /db_xref="PDB:4ODL"
FT                   /db_xref="PDB:4ODM"
FT                   /db_xref="PDB:4ODN"
FT                   /db_xref="PDB:4ODO"
FT                   /db_xref="PDB:4ODP"
FT                   /db_xref="PDB:4ODQ"
FT                   /db_xref="PDB:4ODR"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70169.1"
FT                   /translation="MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALE
FT                   GREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLT
FT                   VVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAH"
FT   CDS_pept        328078..328992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0347"
FT                   /product="O-acetylserine (thiol)-lyase (cysteine synthase)"
FT                   /note="similar to GB:AAS81978.1 percent identity 99 in 304
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70170"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70170"
FT                   /db_xref="GOA:Q5SLE6"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="PDB:1VE1"
FT                   /db_xref="PDB:2ECO"
FT                   /db_xref="PDB:2ECQ"
FT                   /db_xref="PDB:2EFY"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70170.1"
FT                   /translation="MRVEGAIGKTPVVRLAKVVEPDMAEVWVKLEGLNPGGSIKDRPAW
FT                   YMIKDAEERGILRPGSGQVIVEPTSGNTGIGLAMIAASRGYRLILTMPAQMSEERKRVL
FT                   KAFGAELVLTDPERRMLAAREEALRLKEELGAFMPDQFKNPANVRAHYETTGPELYEAL
FT                   EGRIDAFVYGSGTGGTITGVGRYLKERIPHVKVIAVEPARSNVLSGGKMGQHGFQGMGP
FT                   GFIPENLDLSLLDGVIQVWEEDAFPLARRLAREEGLFLGMSSGGIVWAALQVARELGPG
FT                   KRVACISPDGGWKYLSTPLYAEP"
FT   CDS_pept        329005..329352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS81977.1 percent identity 97 in 115
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70171"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70171"
FT                   /db_xref="GOA:Q5SLE5"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70171.1"
FT                   /translation="MRSLFARLLLNTVALWFLTLLYPGVYFRAGAGLLDYLVAGAVWGL
FT                   ANALVRPVLLFLTLPLNLLTLGLFTLVVNGLVLFLVAAVTPLEVTGFGAALVGALVLSL
FT                   VSLVLSWALRD"
FT   CDS_pept        complement(329349..329780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0349"
FT                   /product="CBS domain protein"
FT                   /note="similar to GB:AAS81976.1 percent identity 100 in 143
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70172"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70172"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70172.1"
FT                   /translation="MTVRQVLVHKGGGVHAIHPEATVLDALRKLAEHDIGALLVMEGER
FT                   LLGIFTERDYARKLVLLGRFSKDTKVREVMTTDVPTVAPEASLEEAMRLMTERRTRHLP
FT                   VVEGERVVGVVSIGDLVKAIITHQGMLIAELSRYVSENR"
FT   CDS_pept        complement(329824..330630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS81975.1 percent identity 99 in 268
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70173"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70173"
FT                   /db_xref="GOA:Q5SLE3"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="PDB:3AB7"
FT                   /db_xref="PDB:3AB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70173.1"
FT                   /translation="MRILLATDGSPQARGAEALAEWLAYKLSAPLTVLFVVDTRLARIP
FT                   ELLDFGALTVPVPVLRTELERALALRGEAVLERVRQSALAAGVAVEAVLEEGVPHEAIL
FT                   RRARAADLLVLGRSGEAHGDGFGGLGSTADRVLRASPVPVLLAPGEPVELEGALLGYDA
FT                   SESAVRALHALAPLARALGLGVRVVSVHEDPARAEAWALEAEAYLRDHGVEASALVLGG
FT                   DAADHLLRLQGPGDLLALGAPVRRLVFGSTAERVIRNAQGPVLTAR"
FT   CDS_pept        complement(330627..331763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0351"
FT                   /product="probable efflux protein (fosmidomycin
FT                   resistance)"
FT                   /note="similar to GB:AAS81974.1 percent identity 99 in 378
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70174"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70174"
FT                   /db_xref="GOA:Q5SLE2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70174.1"
FT                   /translation="MLPLLLAWLHTTNDLFSNFLTPLLPKLMDRFGVGLGTAGLLVSAY
FT                   SLTGSLLQPFAGLVADRVDRRLLAALGPVLVALGMGSMGLWPRFEALLFVLALAGVGSA
FT                   LFHASGASLVGEYAPTERRGFWLSFFGSAGNLGLSLGPIVALYVAGRWGLEALFWLTPL
FT                   VLLPALVLLRLPPVRRAGRPAGFRDFLRVFRGDVARLWGMATLRSLVFLSFSTTLPYWY
FT                   ATKGLPDGYTALSLSIYSLSATLGILVGGTLSDRLGRKAVLVGTLTLGLPLYLGLLFFP
FT                   AENPLYLLLLAATGALMNAGIPVAVALAQELEPGQTATVSGLLMGFTWGFAGLFYAPIG
FT                   RLIEAFGVLPVLLGLGVLLLPAWALARGVREPARTMGV"
FT   tRNA            complement(331865..331941)
FT                   /gene="tRNA-Arg-4"
FT                   /product="tRNA-Arg"
FT                   /note="anticodon: CCG"
FT   CDS_pept        331985..333811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0352"
FT                   /product="peptidyl-prolyl cis-trans isomerse, PpiC family"
FT                   /note="similar to GB:AAS81973.1 percent identity 99 in 608
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70175"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70175"
FT                   /db_xref="GOA:Q5SLE1"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70175.1"
FT                   /translation="MFGLSKRAITILFGLLALAFALGAILLFTPQAAQQTRGKPVLWVN
FT                   GKALYELDLLRLQGNDPLYAASPEGLLKTLVDTYFLEQVILTEALKQDAARVRVSSAEV
FT                   RQEVNRIREQFGLKDKAAYEQFLNQVGYTDAQLRAEVKTQLQIQKRLEQIRSGAKPTEE
FT                   EVRFYYEVFKENYRTEPRVKARQIVVDDKALAEELAAKAKAGEDFAALARQHSKVGAEQ
FT                   GGALGAGPGEAEPKPVTQVVFPTEVGEAVFALKGPGVVGPIAAGGRYYIVKVEEYLPST
FT                   LPAFEEVKDRVAQDAERAKGNGVLEAYLEELRKKAQVRFAEDNPYAYQNPPVAKVNEKE
FT                   ILLSEVLQPVFSNQQTVALVQQGLGELAVQFFLPQTLENLIDRELLVEAARKSGKPFIG
FT                   SKAEIAEAYLRYETRDVTASEEEARAFYSENPALFTVPASAKVIGVNFKEEAQAKAFRA
FT                   AALRGGDLEALAKAQEGTVTDYGTVNPNQLPAVLDRLVFKITETFPQGPLGEVSEVIKM
FT                   EDGSYTVLLISDRKAEELKGFAQVAEEARQGAVNRKRSEKAQALIQALREEAKIENRLA
FT                   EVLQALTPKTPSQDQPNSQEQPQPEEAPANNP"
FT   CDS_pept        333867..335441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0353"
FT                   /product="putative phosphoglucomutase"
FT                   /note="similar to GB:AAS81972.1 percent identity 99 in 524
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70176"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70176"
FT                   /db_xref="GOA:Q5SLE0"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="PDB:2Z0F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70176.1"
FT                   /translation="MEITRLLTLYYEATPDPQNPLEGVRFGTSGHRGSSLKATFTEAHV
FT                   LAIAQAIAELRPSFGATGPLFLAKDTHALSEPAWATALSVFAAHGIEVRVEADGDYTPT
FT                   PLVSLAILEHNAHHEAKADGVLLTPSHNPPEDGGFKYNPPTGGPANARITRAIEERANA
FT                   LLQEGLKGVKRLPLREALARAKPFDYAGLYVEKVAEAVDLEAIRASGLRIGVDPLGGAS
FT                   LRVWERLAESHGLPLEVVNPTLDPTFRFMPKDHDGKIRMDCSSPYAMAGLLALKDRFDL
FT                   AIGNDPDADRHGIVTPRGLMNPNHYLAAALHHLYTTRSWPGAKVGKTAVTSALLDRVAQ
FT                   ALGREVYETPVGFKHFVAGLLEGWLGFAGEESAGASFLRFDGRPFSTDKDGILMGLLAA
FT                   ELMAKRGQAPDALYEALAEKLGRPYYARKDLPVSPEAKARLARLSAKEVHPSTLAGEPV
FT                   LQVLDRATGNGEPLGGIKVVAANAWFAVRPSGTEDVAKVYAESFLGEAHLERVLEEATA
FT                   LLHKALA"
FT   CDS_pept        complement(335460..336302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0354"
FT                   /product="ABC transporter, permease protein, MalFG family"
FT                   /note="similar to GB:AAS81971.1 percent identity 99 in 280
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70177"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70177"
FT                   /db_xref="GOA:Q5SLD9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70177.1"
FT                   /translation="MRRASRLLGRLFFYLLVVFVVVYSVFPFYWAVISSFKPSDALFSP
FT                   DPSFLPVPFTLEHYENVFLQANFGRNLLNSLIVAGGATLLSLVLGVLAAYALGRLPFPP
FT                   KNAVMYIVLSMTMFPQIAVLGGLFLLLRQTGLFNTHLGLILTYLLFTLPFTVWVLVGYF
FT                   RGLPRELEEAAYVDGATPLQTLLKVMLPLTGPGLVTTGLLAFIAAWNEYLFALTFTVGD
FT                   SVKTVPPAIASFGGATPFEIPWGSIMAASVVVTVPLVVLVLVFQQRIVAGLTAGAVKG"
FT   CDS_pept        complement(336299..337174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0355"
FT                   /product="ABC transporter, permease protein, MalFG family"
FT                   /note="similar to GB:AAS81970.1 percent identity 100 in 291
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70178"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70178"
FT                   /db_xref="GOA:Q5SLD8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70178.1"
FT                   /translation="MLTLRQVRLAWILVLPTLLVVVLVAGYPLAQVFYWSFFKADIAFV
FT                   EPPEFVGLENYAYLFQDPDFRQALWNTLKFTVVSVSLETVLGLAIALIIHSNFRGRGLV
FT                   RTAILIPWAIPTVVSAKMWQWMLNDVYGVINVLGVKLGLLSQKVAFLARPELLLPSIIA
FT                   VDVWKTTPFMALLLLAGLQMIPEELYEAASIDGASRWQQFWSITLPLLTPALVVALIFR
FT                   TLDALRVFDVVFVMSGVNPATRTLAVYNRQTLVDFQDLGYGSAISVAILVIIFAFVLLY
FT                   MRTVGKEALK"
FT   CDS_pept        complement(337226..338515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0356"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="similar to GB:AAS81969.1 percent identity 100 in 429
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70179"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70179"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70179.1"
FT                   /translation="MQRRTFLKKLGVGVAASLVLGPALVRAQSGPVIRVAGDSTAVGEG
FT                   GRWMKEMVEAWGKKTGTRVEYIDSPADTNDRLALYQQYWAARSPDVDVYMIDVIWPGIV
FT                   APHALDLKPYLTEAELKEFFPRIVQNNTIRGKLTSLPFFTDAGILYYRKDLLEKYGYTS
FT                   PPRTWNELEQMAERVMEGERRAGNRDFWGFVFQGKPYEGLTCDALEWIYSHGGGRIVEP
FT                   DGTISVNNGRAALALNRAHGWVGRIAPQGVTSYAEEEARNVWQQGNSLFMRNWPYAYAL
FT                   GQAEGSPIRGKFGVTVLPKASADAPNAATLGGWQLMVSAYSRYPKEAVDLVKYLASYEV
FT                   QKDNAVRLSRLPTRPALYTDRDVLARNPWFRDLLPVFQNAVSRPSDVAGARYNQVSEAI
FT                   WTEVHSVLTGRKKGEQAVRDLEARIRRILR"
FT   CDS_pept        complement(338574..338729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0357"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS82394.1 percent identity 96 in 30
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70180"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70180"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70180.1"
FT                   /translation="MGGATSRARRRQCSRTSLGLASLRRKPRLPIRREIYTRPPDLCKA
FT                   SPPLPP"
FT   CDS_pept        338921..339610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0358"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS81959.1 percent identity 99 in 229
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70181"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70181"
FT                   /db_xref="GOA:Q5SLM0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70181.1"
FT                   /translation="MRPSWRGFPGNWRPISPRSPRRKAKRLRTRRRHTWRRFPPLYLMD
FT                   TTGLAYRSKDRLLRFRRGKEVRRVRGHARLLALMRWDRERRLLWPWGGVVGEGYAPDPR
FT                   LGGEVLRRFPPSRGWLLADAGFDGKEVWGVLGEAGVRPVIRLRGGGEAREEARVRAREG
FT                   WDPEVYRFRGVVEGVFGGMKTRLGGGYLWERKPWTAMARALLELIAYGLRVLLSLLPPP
FT                   PGYKAIY"
FT   CDS_pept        339710..339916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0359"
FT                   /product="cold shock protein"
FT                   /note="similar to GB:AAS81968.1 percent identity 100 in 68
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70182"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70182"
FT                   /db_xref="GOA:Q5SLD4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70182.1"
FT                   /translation="MNKGIVKWFNAEKGYGFIQQEEGPDVFVHFSAIEADGFRTLSEGE
FT                   RVEFEVEPGRNGKGPQARRVRRL"
FT   misc_feature    339975..340729
FT                   /note="TTHA0360 and TTHA0361, disrupted by frameshift"
FT   CDS_pept        339975..340466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0360"
FT                   /product="survival protein SurE"
FT                   /note="similar to GB:AAS81967.1 percent identity 99 in 159
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70183"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70183"
FT                   /db_xref="GOA:Q5SLD3"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70183.1"
FT                   /translation="MRILVSNDDGIFSPGIKALGLAMRALGEVFVVAPDMEQSAVGHGI
FT                   TVRRPLRFKHTQSAGFGEIPAYRVDGTPADCVVLGVHLLGRPDLVVSGINLGVNLGLDL
FT                   THSGTVAAALEGASLGIPSIAFSLDTSGEVLDFQEAARWALAIARAVGERGLPRGCSST
FT                   "
FT   CDS_pept        340451..340729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0361"
FT                   /product="survival protein SurE"
FT                   /note="similar to GB:AAS81967.1 percent identity 100 in 92
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70184"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70184"
FT                   /db_xref="GOA:Q5SLD2"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70184.1"
FT                   /translation="MLLNVNFPASRPKGLLVTRLSTHRFEDQVVERLDPEGKPYYWIAG
FT                   TPAGEEEEGTDLWAVRRGYVSVTPVSLDLTAHGFLEALSGLLEGVAP"
FT   CDS_pept        340726..341454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS81966.1 percent identity 98 in 242
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70185"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70185"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70185.1"
FT                   /translation="MTLLRTPLPVPHGFTTREGGVSEGPFRSLNLSAATGDDPERVAEN
FT                   QRRVLAAFGHPPVAGLRQVHGTEVHPVEGPGLWEGDGLLTRTPGLLLRVGVADCYPLLL
FT                   YHPKGAVGALHAGWRGVVGGILPKALERLEAVYRLDPTEVHLAIGPGIGGACYQVGEEV
FT                   VARFAEAGLFTFREDPAAPGKYLLDLEQALLLQARRAGLREERIYRVGLCTHCAPNLFS
FT                   HRRDRGRTGRMWGLVMLPPR"
FT   CDS_pept        341489..341974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0363"
FT                   /product="putative hydrolase, HAD superfamily"
FT                   /note="similar to GB:AAS81965.1 percent identity 100 in 161
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70186"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70186"
FT                   /db_xref="GOA:Q5SLD0"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70186.1"
FT                   /translation="MLFPREVLPSLLHLTPAWLKARGLKGVILDLDNTLLPYGEGDLPE
FT                   AYRAWLSDLKGAVPVYLLSNALPERFARVQRLLDLPGHAPALKPWFGFRKALKALGLPA
FT                   REVAAVGDQVFTDVLGGNLVGAYTVLVPPLREQEFFYTRFIRMLEAPFRRPRGGVTR"
FT   CDS_pept        341971..344640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0364"
FT                   /product="type IV pilus assembly protein PilF"
FT                   /note="similar to GB:AAS81964.1 percent identity 100 in 889
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70187"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70187"
FT                   /db_xref="GOA:Q5SLC9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="PDB:5IT5"
FT                   /db_xref="PDB:5OIU"
FT                   /db_xref="PDB:6EJF"
FT                   /db_xref="PDB:6F8L"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70187.1"
FT                   /translation="MSVLTIGDKRLGAALLDAGLLTDEELQRALERHREVGGSLAEVLV
FT                   DMGLLSERRIAQTIEDRFGIPLVELHRVEIPPKVKALLPAEKAKELKAIPFALDEEAGV
FT                   VRVAFLNPLDTLSLEEVEDLTGLVVEPYQTTKSAFLYALAKHYPELGLPVPPPPSGEGQ
FT                   KDLKLGELLLQKGWISREALEEALVEQEKTGDLLGRILVRKGLPEEALYRALAEQKGLE
FT                   FLESTEGIVPDPSAALLLLRSDALRYGAVPIGFQNGEVEVVLSDPRHKEAVAQLLNRPA
FT                   RFYLALPQAWEELFRRAYPQKNRLGEVLVQEGKLSREALKEALEVQKGLPRAKPLGEIL
FT                   VELGLARPEDVEEALQKQRRGGGRLEDTLVQSGKLRPEALAQAVATQLGYPYVDPEEDP
FT                   PDPGAPLLLPEDLCRRYGVFPHRLEGNRLVLLMKDPRNILALDDVRLALKRKGLNYEVA
FT                   PAVATEAAITKLIERFYGKAELSEIAKEFAKKQAEEEVPSPLELDESAAQKFVKQVIRE
FT                   AFLQDASDIHIEPRQNDVQVRLRIDGALRPYSTLPKGALNAVISVVKIMGGLNIAEKRL
FT                   PQDGRVRYREGAIDVDLRLSTLPTVYGEKAVMRLLKKASDIPEIEDLGFAPGVFERFKE
FT                   VISKPYGIFLITGPTGSGKSFTTFSILKRIATPDKNTQTIEDPVEYEIPGINQTQVNPQ
FT                   AGLTFARALRAFLRQDPDIIMVGEIRDSETAKIATEAALTGHLVIATLHTNDAAQAITR
FT                   LDEMGVEPFNISAALIGVLSQRLVRRVCEHCKVEVKPDPETLRRLGLSEAEIQGARLYK
FT                   GMGCERCGGTGYKGRYAIHELLVVDDEIRHAIVAGKSATEIKEIARRKGMKTLREDGLY
FT                   KALQGITTLEEVLARTIE"
FT   CDS_pept        344653..345738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0365"
FT                   /product="type IV pilus assembly protein, pilus retraction
FT                   protein PilT"
FT                   /note="similar to GB:AAL37755.1 percent identity 100 in 361
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70188"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70188"
FT                   /db_xref="GOA:Q5SLC8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70188.1"
FT                   /translation="MAKAPDVVDLLALAVERGASDLVITVGLPPMLKIDGEFHPTEYEP
FT                   LTPQETRRLMYALMDEKQQRIFEEEKELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVP
FT                   SAVKSFEELGLPKNIAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIE
FT                   DPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMRDYETIAAAITAA
FT                   ETGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGGR
FT                   VLAYELMIATPAVRALIREGKTHQLRSVIQTGGQYGMITMDACLADLYRRKLITYEMGL
FT                   ARAVDPKEFMRLAGAPEGARR"
FT   CDS_pept        345749..347158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0366"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /note="similar to GB:AAF91177.1 percent identity 100 in 469
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70189"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70189"
FT                   /db_xref="GOA:Q9LCX2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="PDB:3KFU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LCX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70189.1"
FT                   /translation="MYEAVIGLEVHLHLKTRTKMFCGCRADYFGAEPNTHTCPVCLGLP
FT                   GALPVPNRVAVEHGLRLALALGAEVPERLVFHRKNYFYPDLPKNYQISQYDLPLGRGGS
FT                   LPLGERRVRIKRLHLEEDAGKSLHLEGRTLLDLNRAGSPLIELVTEPDLKTPEEARLFL
FT                   QRIQALVQTLGISDASPEEGKLRADVNVSVRRVGEPLGTKVEIKNLNSFKSVQRALEYE
FT                   IRRQTEILRRGEKVKQATMGFEEGSGKTYPMRTKEEEADYRYFPEPDLPPVAIPRDWLE
FT                   EVRRSLPELPWEKEARYRALGIKEKDAEVLAYTPSLARFLDQALPLGLASPQALANWLL
FT                   ADVAGLLHERGLRLEETRLSPEGLARLVGLFERGEVTSRVAKSLLPEVLEGQDPEALVR
FT                   ERGLKVVADEGALKALVAEAIAAMPEAAESVRQGKVKALDALVGQVMRKTRGQARPDLV
FT                   RRLLLEALGVG"
FT   CDS_pept        347164..348165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0367"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /note="similar to GB:AAS81961.1 percent identity 99 in 333
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70190"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70190"
FT                   /db_xref="GOA:Q5SLC6"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="PDB:5AVM"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70190.1"
FT                   /translation="MRYEEAGVHIEAKAEALRRAREAIAATYTPEVLRGMGAFGGLYAA
FT                   SRLKALEEPVLVATTDGVGTKTLLALEAGDVSGLGFDLVNHSVNDLLAQGAEPLFFLDY
FT                   LAASHLDEGVLAALLASLAEACRAHGIPLLGGETAEMPGVYREGAWDIAGTLVGVVERS
FT                   RILGPERVREGDALLALPSSGPHTNGYSLIRKVVAGQDLSAPVPELGESLKEALLRPHR
FT                   AYLKEFRLLWEAGVELHAAAHITGGGLPENLPRALPPGLGAEVRRGSWPIPPVFPYLQR
FT                   LGGIPEEEMYRVFNMGLGMVLVLPQEAAEEALKLVEGFLVGRVVPGEGVRLV"
FT   CDS_pept        348162..348794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0368"
FT                   /product="phosphoglycerate mutase"
FT                   /note="similar to GB:AAS81960.1 percent identity 99 in 210
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70191"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70191"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70191.1"
FT                   /translation="MKEIWYVRHGETEWNAQRRFQGHLDIPLSPVGIGQAFRLAERLSR
FT                   SRISFDRLYASDLRRARQTAEPLAQVLGLPIATTPLLREIHVGELAGLTRAEAEARFPS
FT                   FLAEAAEDPWNARRPGGESMADLARRLQAFLEEVPPGRHLVVTHGGVIRAALKLALDLA
FT                   GDTWRRFHIQNTSITRILYPENAVLTVADAAHLEVWADWLSDEDLKG"
FT   tRNA            complement(348829..348904)
FT                   /gene="tRNA-Gly-3"
FT                   /product="tRNA-Gly"
FT                   /note="anticodon: GCC"
FT   rRNA            complement(348914..349035)
FT                   /gene="5Sb"
FT                   /product="5S ribosomal RNA"
FT   rRNA            complement(349115..352029)
FT                   /gene="23Sb"
FT                   /product="23S ribosomal RNA"
FT   CDS_pept        352186..352956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0369"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="similar to GB:AAS80350.1 percent identity 100 in 256
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70192"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70192"
FT                   /db_xref="GOA:Q5SLC4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:2D1Y"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70192.1"
FT                   /translation="MGLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEV
FT                   AEAIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRV
FT                   LEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSL
FT                   ALDLAPLRIRVNAVAPGAIATEAVLEAIALSPDPERTRRDWEDLHALRRLGKPEEVAEA
FT                   VLFLASEKASFITGAILPVDGGMTASFMMAGRPV"
FT   CDS_pept        complement(353002..353544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0370"
FT                   /product="thioredoxin reductase related protein"
FT                   /note="similar to GB:AAS80351.1 percent identity 99 in 180
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70193"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70193"
FT                   /db_xref="GOA:Q5SLC3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:2CVJ"
FT                   /db_xref="PDB:2YWL"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70193.1"
FT                   /translation="MWDVIVVGGGPSGLSAALFLARAGLKVLVLDGGRSKVKGVSRVPN
FT                   YPGLLDEPSGEELLRRLEAHARRYGAEVRPGVVKGVRDMGGVFEVETEEGVEKAERLLL
FT                   CTHKDPTLPSLLGLTRRGAYIDTDEGGRTSYPRVYAAGVARGKVPGHAIISAGDGAYVA
FT                   VHLVSDLRGEPYKDHAL"
FT   CDS_pept        353571..354890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0371"
FT                   /product="probable serine/threonine-protein kinase"
FT                   /note="similar to GB:AAS80352.1 percent identity 99 in 439
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70194"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70194"
FT                   /db_xref="GOA:Q5SLC2"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70194.1"
FT                   /translation="MLLDDRYPVLETLESRDGVTLYRVEGGLVFYFDVRTPQDKDRFYR
FT                   YRAAIRRLEELGLLEAQVSAKPGRYYAFFPERPLSGRRPPKEVLAALAPFGFGPEHVAM
FT                   GEDKVAYLAPWPLRLGAARRGRGGFWSRVAPGLFLLGLGLLLLAQGLYRYFNPPEYVVP
FT                   DLVGKTAREAFLLLRDTGLGLEVEEGNDPSRPKEVVLEQDPPPGTRLRAGRVVRLVLNQ
FT                   ARLVPVPDLRGLPRAEAEDRLSGLGFQVGRVAAVEAEEAAGTVLATSPPAGTPMAYGAR
FT                   VDLLVAGERSGERVVVPRLVGLKREDALFLLNAAGLLPQVEEVPSGAPEGLVLAQVPGP
FT                   GEAVLPGSPVRLRVAVQGAVQLPEAFPGTPLRSVVLALDLPPEAQGRQVRLLLVDARGA
FT                   QVVYEGPGEEGLRLSGTYQVLGEARFRLYLDGELFQEWAP"
FT   CDS_pept        354878..355216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80353.1 percent identity 98 in 112
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70195"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70195"
FT                   /db_xref="GOA:Q5SLC1"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70195.1"
FT                   /translation="MGALRGRWAEEEALRFLLGKGYRLLWRNRRTPFGEVDLFMEKDGV
FT                   YVVVEVKQRASARFGAPLEAITPGKVRRLLQSARFLLGRDDLPVRLEAVLVHGTPKDFR
FT                   LEHLVLEL"
FT   CDS_pept        355231..357039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0373"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase
FT                   UbiD"
FT                   /note="similar to GB:AAS80354.1 percent identity 99 in 591
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70196"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70196"
FT                   /db_xref="GOA:Q5SLC0"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70196.1"
FT                   /translation="MFRNLRAYLEALERRGELHRVRVPVSAELEIAEIADRVVKAGGPA
FT                   LLFERVVGKDFPVAIGLFGTRARTAFALGVEDLDELARKVEALLALEPGKGGLSALLGL
FT                   LPKLPLLRGFFPRRVRRAPVQEVVWRGEEVDLRRLPVLKCWPLDGGPFLTLPLVITKDP
FT                   ETGELNLGMYRMQVLDPRSTAMHWQLHKVGRRHLEKAKRLGRKLEVAVALGGDPVLTYA
FT                   ATAPLPPLPGVSEFHLAGFLRGAPIELARGVTVDLPVPAEAEFVLEGYIDPEEPLVEEG
FT                   PFGDHTGFYTPVDLYPRFHVTAVTHRKGAIYPATLVGVPPMEDAYLIEATERLFLPALR
FT                   LVLPEVVDYHMPPEGVAHNWVNVSLRKAYPGQAYKVAYGMLGLGQMMFAKVIVAVDADV
FT                   PVKPGFAALLEALKHALPGRDTLLLRGPVDVLDHSSRAFAFGGKLVIDGTRKLPEEGGE
FT                   APFVPKAHPGLPEDPEVLDQRQWPGLWGAVLAKRRPHQAWEVAERLLRAPQSAGIRLLL
FT                   LADEDTALSPEELLWYVLNNVDPERDARVMPGVEGPVLVLDGTRKLPEEGFPRVWPERI
FT                   RMDPKVKALVEARWAEYGLGWTTVGE"
FT   CDS_pept        357077..357727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80355.1 percent identity 100 in 216
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70197"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70197"
FT                   /db_xref="GOA:Q5SLB9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70197.1"
FT                   /translation="MGLHVLGVNASARTDGFTAELLDEVLEAARRKGATTERLDLVRHP
FT                   FPLCAGNYSVDPASCGPETCVQGPWDGFGKVAERILSADAVVFATPVYWFSVSSRMKAL
FT                   LERMTSMENQGLLNLGKPMALLAVAEEEGASQALAQMLLPLSYMGFVLAPLGLVYAHRK
FT                   HLTALKESPEVLEDARIAGENLVLMAERLRGTSFQEPLPSYLYRAPASRAAGD"
FT   CDS_pept        complement(357874..358422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0375"
FT                   /product="putative glycoprotein endopeptidase"
FT                   /note="similar to GB:AAS80356.1 percent identity 98 in 182
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70198"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70198"
FT                   /db_xref="GOA:Q5SLB8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70198.1"
FT                   /translation="MGRMWTLVLDTATPYLSLGLFRGEAGVGRVKRVERRHEEVLFGLL
FT                   EEVLREVGAGREEIGALVLGEGPGSYTGLRIALAAGLGLAQALGARVFGASSLLAACWP
FT                   YLKEGEPLTPLFTARNGLFYGATYTLEGGRPKEVVPPRKLKATELPQEGRLLLDAPPDP
FT                   RALYELLPFAHEGVEPLYL"
FT   misc_feature    358385..359650
FT                   /note="TTHA0376 and TTHA0377, disrupted by frameshift"
FT   CDS_pept        358385..358726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0376"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="similar to GB:AAS80357.1 percent identity 98 in 113
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70199"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70199"
FT                   /db_xref="GOA:Q5SLB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70199.1"
FT                   /translation="MAVSRTSVHILPILGPPAILRQGMRTYPLHWVLGVGVLLALGLYA
FT                   QRLGFLPAWAAWGLWAGYLLLALWGLLWGGWRAAPLALGLLAPLFPPLAFLGPLGAALA
FT                   LGRTLPEKA"
FT   CDS_pept        358751..359650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0377"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="similar to GB:AAS80357.1 percent identity 100 in 299
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70200"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70200"
FT                   /db_xref="GOA:Q5SLB6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70200.1"
FT                   /translation="MWPALALLLVWQVFPTLYAFYLSLFDRVNFLRPAAFAGLQNYRIL
FT                   LEDPLFWRALGNTFWYVVFTVPTGLLLATFVAILLNTQVAFLGLYRTLFFLPYITALTA
FT                   AAAVWRWIYHPEFGFLNWLLHTPGLDWLNTPTGVFALLLRPLGVELQGFLAGPSLAFVA
FT                   VMAMSVWHFLGYQVVILLAGLQAIPKEYYEAAELDGASFFQKHRLITWPLLSPTTFFLF
FT                   TLGLIGAFQVFTQVYVLTPTGGVLQDTLTLAFYLYNKGFRDSDFSYASAIAMVTFLVIL
FT                   ALTLVQRRLLEKRVNYEI"
FT   CDS_pept        359697..360833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0378"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="similar to GB:AAS80358.1 percent identity 99 in 378
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70201"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70201"
FT                   /db_xref="GOA:Q5SLB5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70201.1"
FT                   /translation="MMAFPFYWMLATSFKSPQEALQAEPVWVPERMKPVNWLKAARLGD
FT                   SPLFGGLGPGRSVALFFPGPEAPPPRALVPRSPGAFFDPVADGTRVEVVRGEGGWWVRL
FT                   TNTGEAGFRRVPLVVLWPKGVPLEPPLPPDARRSQGEYWRLEWVNAVPGALGYVFHNYL
FT                   EAWDAAPWGRYFFVSFFTASVQVAVGLFLAALAAFALARIPFPGKEAVFVLVLATMMVP
FT                   GEVLLIPNYVLLARLGWLDTFYALIVPWLASVFGIFLLRQFYLSLPQDLFDAARIDGAG
FT                   YLTQLFRIALPLSVPGLVSYGIFTFLGAYNALLWPLIVTQSPEMRTVQLGLLAFVSEAG
FT                   SDYGALMAASAFVIAPVVLGYFVAQRQFIQGIARTGLK"
FT   CDS_pept        360889..362142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0379"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /note="similar to GB:AAS80359.1 percent identity 99 in 417
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70202"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70202"
FT                   /db_xref="GOA:Q5SLB4"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70202.1"
FT                   /translation="MKKALLLVAALGVAFAQQAKPEDVIKEQCARAKVVAELWHGFTGG
FT                   APKAALENLVVEFNKAQQGRCVRPVPQGGYRDLSTKIKAAFAAGKVPTMAQAFENNIAL
FT                   YLEAKALLPIESLGVKLQGVNLTFLNAVRFGGVVYGVPFNKSIQVLYYNKDLLKKHGVP
FT                   VPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSYLKDGKLVLNSKEAVE
FT                   ALTLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATLPG
FT                   RTKGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGA
FT                   LKDPVYQAYAAENPDYATIVRQSRYAKFEPALAEWEQIRFDILGQAIKEAILNKADPKA
FT                   ALDRAQKLAEDLLSSRTR"
FT   CDS_pept        362204..364066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0380"
FT                   /product="aldehyde:ferredoxin oxidoreductase"
FT                   /note="similar to GB:AAS80360.1 percent identity 99 in 620
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70203"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70203"
FT                   /db_xref="GOA:Q5SLB3"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70203.1"
FT                   /translation="MPKGYHDRVAFVDLSTGKVWYESFGEAFWRRYLGGRALAAYLLLR
FT                   HVPKGADPLGPENALVFAPGILTGTPISGSGRNTVAAKSPLTGGYGDAEGGGFFGAELK
FT                   NAGLDALVVLGQAEAPVYLHVEGGEVALHPAVHLWGKDPLEVEALIKEAHGGNTRVAQI
FT                   GLAGENRVLTANVIHDLAHFAGRGGLGAVMGAKRLKAVSARAHKETLPAYHDPGLLKEL
FT                   ARRMAKERMDRAAGLVTMGTVGTVKPFNLRGVLPSHNFLDGFLEGAEALDGTSLDALGI
FT                   RIGRDTCYACAIRCKQVVKIEGTGRYDVRPEYGGPEYEGLGALGSTCGVTDPYAVTKAN
FT                   TLCNQYGLDVIGVGVTIACAMEAVEKGYLDDEGLGLRFGNGDALIAAIEKLARREGRLG
FT                   ELLAQGAKRLAESLGHPELAMHVKGQEVPMHDPRYKRALGVGYAVSPTGADHNHNLHDT
FT                   AFAKEGRALRELRFYGEDFQPLPIEDLSEAKIRMLWTKTRERGFVNSLVMCDFVPWTPE
FT                   EWQEALYAATGWRLSPEEMLEVGERTLQLTRLFNLREGISPEEDRLPERFFQPFRKGNP
FT                   EARLDPEAFREGVRAYRRLAGWEGGVDPERLKALGLEEFQNALA"
FT   CDS_pept        complement(364037..364591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0381"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80361.1 percent identity 96 in 184
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70204"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70204"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70204.1"
FT                   /translation="MRRVHWRAYAKTGRLFTRLETAPERARFRIYLDQSPSMRLHGKLP
FT                   YAREVAALLLRIARQEDPLARLEGGSPEELRPGKGVLVLVTDGLDPLPWPRLLPRRVVL
FT                   VQVLSPLELDPPPTEALLKDVETGETLPVGREEVEAYKEALAAHLKALRLLALLRGRYA
FT                   LLRVGEPPLPALLRQGVLELL"
FT   CDS_pept        364775..365251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80362.1 percent identity 97 in 158
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70205"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70205"
FT                   /db_xref="GOA:Q5SLB1"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70205.1"
FT                   /translation="MDAFADWFFVAFWVLGVLLTLLPFVPATLVILFGALVHELLVGFR
FT                   ELSLGTWLGLGALALLAMLLDNVAALVGARRYGAGRAGLWGAFLGGVLGLFFGVVGVLV
FT                   LPFLLAWLFEYLSGRRPEEALRAAWGTLVGLMGGVVAKVLVHLAMGVLVLRAIF"
FT   CDS_pept        365255..365512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0383"
FT                   /product="putative thioredoxin"
FT                   /note="similar to GB:AAS80363.1 percent identity 98 in 81
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70206"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70206"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70206.1"
FT                   /translation="MLSAMELVFVTREGCGLCEKAERALWALGVPYVRRDVDRDPELFA
FT                   RYTFRVPVLLWGEEVLLEGAFGERELVEVAARLGGGTWTR"
FT   CDS_pept        365512..366351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0384"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="similar to GB:AAS80364.1 percent identity 99 in 279
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70207"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70207"
FT                   /db_xref="GOA:Q5SLA9"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70207.1"
FT                   /translation="MVQIGPLAIRWYGVLLTLAIFLGYELARRRLRAWGWDLEPFERVV
FT                   FWAVVFGVVGARLGYVLTSPGYFLENPLEALYIWHGGLSFHGAILGGGLTFYYFHRRRG
FT                   YPLWPYLDAATPGVALGIVAGRIGNLMNGSDTAGRLTTLPIGFTWPEWARGFPGVCPGI
FT                   DDISEVYRCAELLRGPVHLTQVYGAVVGLILLFLSLYWLRKRPFYGYAFWQFVLWYSVL
FT                   RSVLEEPFRLNPLWLPVYRNDELGIGLFTATQVVSLPLVLLSLYMLRRLGKGEASRR"
FT   CDS_pept        366353..367723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0385"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="similar to GB:AAS80365.1 percent identity 99 in 456
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70208"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70208"
FT                   /db_xref="GOA:Q5SLA8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SLA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70208.1"
FT                   /translation="MGGMHAHVILAAGQGTRMRSRLPKVLHPLLGKPMLLYALEAALAL
FT                   KPERLVVVVGHGGEKVVEALEGYPVEVAWQKEQLGTAHALLQAEGLLRDFPGPFLVTQG
FT                   DTPLLSPRTLEALLRRVREGAGMALLTAELPDPTGYGRILREGEEVLGNVEEKDAPPEV
FT                   RAIREVNAGAYAFDGFLFQALKEVRNENAAREYYLPDLIAIYRAHGRRVLAVRGVAEEA
FT                   LGVNTREELARVEGVLLRRLRAEWMGKGVRMILPETIYLEPSVELAPDVTLWPGAVLKG
FT                   KTRIGEGCEVGPYAVLEDTVLEPGAKVLAHTVAQGAHLHPGASAGPFARLRPGAVLMEE
FT                   VHVGNFVEVKNSLLHKGVKAGHLAYLGDAEVGEGTNIGAGVITANYDGKRKHKTEIGKK
FT                   AFIGSNSVLVAPVRVGDRALVGAGSVITQDVPEGALAVARERQKNLEGYALRKLGEG"
FT   CDS_pept        367764..367985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0386"
FT                   /product="Sec-independent protein translocase protein TatA"
FT                   /note="similar to GB:AAS80366.1 percent identity 98 in 73
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70209"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70209"
FT                   /db_xref="GOA:Q5SLA7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70209.1"
FT                   /translation="MNLGMPEILVILLVALLIFGPRKLPELGRSLGQSIREFKRGAQEI
FT                   REELEKSIEVKDEPKPAAVQEAKEEPKA"
FT   CDS_pept        367982..368722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0387"
FT                   /product="Sec-independent protein translocase protein TatC"
FT                   /note="similar to GB:AAS80367.1 percent identity 99 in 246
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70210"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70210"
FT                   /db_xref="GOA:Q5SLA6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70210.1"
FT                   /translation="MKEAPLVEHLEELRARILWSLLAWAVGTGVAWTFRVQLLEWLKRP
FT                   LDLAAKAHGIQVNLIVLDITEPFLVSLKVAAFGGLVLALPFIVYQVWAFIAPGLYEHEK
FT                   RLAVPFLLGAGFSFALGALFAYYAFLPFAVPFLLGFLGDVVTPQISIGRYMGQILMMLT
FT                   VMGVVFEMPVVSYLLARLGILTSSFLARNWRIAVVLLLTLAAVITPTVDVVSLFIVSGP
FT                   LLVLYWVSVLVARLAERQRPQEAA"
FT   CDS_pept        368756..369823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0388"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase/chorismate mutase"
FT                   /note="similar to GB:AAS80368.1 percent identity 99 in 355
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70211"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70211"
FT                   /db_xref="GOA:Q5SLA5"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR010954"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="PDB:2D8D"
FT                   /db_xref="PDB:2D8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70211.1"
FT                   /translation="MDERIQALRKEVDRVNREILRLLSERGRLVQEIGRLQTELGLPHY
FT                   DPKREEEMLAYLTAENPGPFPDETIRKLFKEIFKASLDLEERQDQKKFLYSKRHKPEPT
FT                   RVRVKDVVFGEKPLLIAGPCSIESEEQIMATARFLAARGVRVLRGGAFKPRTSPYGFQG
FT                   LGVEGLKLGRKAADAFGMVFVTEVMDTRDVEVVAEYADILQIGARNMQNFALLKEVGKA
FT                   RRPVLLKRGLSATMEEWFYAAEYILAQGNEQVILAERGIRTFERWTRNTLDLSAVALAK
FT                   QETHLPVVVDVTHAAGRTDLLAPLARAALAVGADGVHVEVHPNPKVALSDNQQQMDFAQ
FT                   FDRFLEAIRDLLQAP"
FT   CDS_pept        369826..370773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0389"
FT                   /product="polyferredoxin"
FT                   /note="similar to GB:AAS80369.1 percent identity 95 in 252
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70212"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70212"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70212.1"
FT                   /translation="MGFLDGLLNAFLKATDPRPRYTEARCLLYKNSVGGCDKCYGVCPK
FT                   GAVRLEGWRVELDEVLCTGCGLCTGVCPGIALEYPLGAIQEALIRGKGKLRCSKAEGKG
FT                   EEVLCLGRLTPGLLAEAGSRFGKVVLARGDCEACRIGGPEVPERLARMAEEARRYFPVE
FT                   VEVVEGELPGERVGRRELFQALLGSAKRTAADLVPELPLPALEEEREGELPAELRLRRL
FT                   AASRAPEVRWPRIRVEEGCTLCPVCTNVCPTEAVRRVREGEEYVLYLQVAACTGCGACV
FT                   ESCPPQVIRLEEAPKEEVGKELLLFRGKPPWYDL"
FT   misc_feature    370798..371878
FT                   /note="TTHA0390 and TTHA0391, disrupted by frameshift"
FT   CDS_pept        370798..371238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80371.1 percent identity 96 in 133
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70213"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70213"
FT                   /db_xref="GOA:Q5SLA3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014614"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70213.1"
FT                   /translation="MDADLVVVGGGLAGLVVATEVAQRGKRVLLLEQEPYLGGQAFWSF
FT                   GGLFLVDSPEQRRLGIRDSVELAFQDWMGAAGYDREEDAWGRRFAEAYLEFAAGEKRAW
FT                   LASLGVRFFPVVGWAERGGGLATGHGNSVRLGDPAVPAEHRL"
FT   CDS_pept        371201..371878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80371.1 percent identity 97 in 225
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70214"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70214"
FT                   /db_xref="GOA:Q5SLA2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014614"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70214.1"
FT                   /translation="METLRYLRSTGFDWSWFILDLPTLKKEFALSGSEQNPDLTGKSWL
FT                   GVVRNRLLGPAAPVRAFLERGKDFLVAQDLSELMRKMEALAPGVLDPGRLEREVKARDR
FT                   ELLNPFAKDGQVLMVHAFRRYVGDRLFRVAKPHPFLSGKGPLVAVRLWTLTRKTLGGIQ
FT                   TDLKGRALKPLGEPLPGLFAAGEAAGFGGGAFHGYKALEGTFLGGCLFSGLQAAKGVLE
FT                   GLE"
FT   CDS_pept        371883..372275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0392"
FT                   /product="probable methylmalonyl-CoA epimerase"
FT                   /note="similar to GB:AAS80372.1 percent identity 100 in 130
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70215"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70215"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70215.1"
FT                   /translation="MRLHHVGIAVEDLEEAKARYQSLGFRVVAEGEVAHQGVRVALLRG
FT                   EGEALLELLSPLGPETPVGRFLAKRGPGLHHLAFATSRIEEDLARLKAEGAKLIDEAPR
FT                   PGFGGHRVAFLHPSFGLGVLWELVEA"
FT   CDS_pept        372275..372613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80373.1 percent identity 96 in 112
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70216"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70216"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SLA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70216.1"
FT                   /translation="MRPFYALLALLWMGVLWWLSERPFPGAGLPHPWDKLAHFLAYALL
FT                   GALWRRGLGRFLPAFLLAALYGVVDEWHQSLVPGREAFGLDLVADFLGAYVGARGAGRW
FT                   EAPEASRP"
FT   CDS_pept        complement(372567..373250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0394"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="similar to GB:AAS80374.1 percent identity 98 in 227
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70217"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70217"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70217.1"
FT                   /translation="MLQGKAFLITGAGGALSRALIPAFHQAGARLFLSDPRPERMAERA
FT                   QAVGAKTFVADLTRLEEALALARFVEEEAPLYGVVHTVGGFAAGRFLDTDPGLYDWMLD
FT                   LNLRTTFNLLKAVLPYMAKRGEGFFAAFAAGPAWTGAGPGRALYTAAKTALASLLRSLQ
FT                   GEVEGVRFLVVYPMGTLDTEANRKAMPEADFSRWIAPELVAKVVVEAAGAKGGRLLELP
FT                   IYPPL"
FT   CDS_pept        complement(373255..374244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0395"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80375.1 percent identity 98 in 329
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70218"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70218"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70218.1"
FT                   /translation="MKRLGFLLLLFLTACTGSQEPPLPALLAAGGGDEVRFYRAQDLQR
FT                   GTGTPVETWATPGLQDLAYSPTFQRLYLLFPDRVEAYDATGFSETSVPKGTAADQGLPP
FT                   GVDCTGGYLRLGQGALLLHCPAAARAFLWPLDGSGSLLEADLTGLDPAARLALLPQGSL
FT                   DLLAYLTSAAMGFRPAQDPEGTPSLERPLSPPLDAAPFDLRADAAKGRLLGLGSLNLEA
FT                   RLYTLQGEALGSQRVLGDFFGVPRLALDPVAGLAVYGRGFQVLEPRASSVLEAYTDFAA
FT                   GAMGQDGYLYLASGSLLYVYDLVPSPPQRVAILSLGLAPKALAFLPVE"
FT   CDS_pept        complement(374241..376715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80376.1 percent identity 97 in 824
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70219"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70219"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70219.1"
FT                   /translation="MRWLPLLLFLLLPALAEERVIKVLEAERLELRQEGGEEVYVLVGE
FT                   PVRLEREGETLEAKRVVYFRERRLLLLSGGVRYRDREGRLIEAEELQVDLADESFDALE
FT                   VRIEAENLLLTGPVCQRAAGAILLERGYATPCASCGQEVPDYAFRAREIVLYPGDRVVA
FT                   RDVTLLVQEKPVLTLPVLLLYLSERRPRLEVGQDEGGLYVKADLPYVAAFGLGYTLLRY
FT                   YQGRGYGFGLDHYGTGEAKERYFFLHTPPDTFQYRGEYGLKRAGFSVAALVERDDTQEK
FT                   LTRFRLEALLPGTPTPQDWRYALRLEGFLDHDPSTPPPRALQRLPELEAQSPTLRQGPF
FT                   SLQLSLQAGRYLAETNPLNRSARALGPYAEAGRLLLAHTESLVLAPWPGATLRGENRFR
FT                   GFYYTTQNPDGEHERQVDWSTSLAFRQALGGVSLEAGYLRSVQEGESPFRFDALPQRRT
FT                   HQATLGLGFRERPLALSLKGGWDLEKEAYLPLEAEARLQDRGYGLLLYHKRDLEEGPLE
FT                   TRLEGSLTPYPFSLRASLRYDHPKALFDPLLLQGAYALPAGSLNLAHRHGLNGEGALET
FT                   SLTLAYREGQEAYTLQARRDWPKDTLQASGQAILGRQSLSLQATLDPTALAYQAGFRSG
FT                   SAPGPLLDLLLSGRYQEGFRGTNLRLGLTQALPEATFRLTANLHLPEVEDGEVYLKDLA
FT                   LSGGLELWGPTPPDERGENALPGLALSGSLTYTRSPTSPEGYALALRNFGPTLTFLGRE
FT                   NTKLHLAALLTQNLPGTPLKPKFLLTLDRCCWAMRFTLDAAKNEVRLAFLYGGQAAEVL
FT                   MDEEGVRLGGLP"
FT   CDS_pept        complement(376712..377755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80377.1 percent identity 99 in 347
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70220"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70220"
FT                   /db_xref="GOA:Q5SL96"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70220.1"
FT                   /translation="MKTLDRYLLRETLPLFGGGLLVIVLLFLGGAVYEVLAPLVAKGAD
FT                   PYTLLRYLLFRTPEALARGAPVAYLFALLVLLSRLGEDAELKALLALGVRRERLLLPFL
FT                   LLGTAIALAAFLLGEGLVPQALAKGQDLLRREVLERPRALLTPGATFQDAQGRVVYVGK
FT                   VEGEAIGALRVLSREEVLLAERGSFRGGVLHVEEGTRITYEGSRPRTLARFQRGELVLK
FT                   DLTFDPWQNPANRMTLAELRKEVQRLRQMGVRAGLEATTYYRRFAEPLAAPVFALFAVG
FT                   LAFYLLGGSRSLGLVGVAVLTFFYYATWSVGRIMGEQNALDPFLAAFGPNLLYGALGLF
FT                   LFLGGRR"
FT   CDS_pept        complement(377752..378762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80378.1 percent identity 99 in 336
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70221"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70221"
FT                   /db_xref="GOA:Q5SL95"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70221.1"
FT                   /translation="MLGRYVLREVLVPYLVGVFLFAALLTFDLLSSLSGVLLSRGVGAR
FT                   EVGLLVLYRLPWTLSLALPLGLVFAVLVGLAGLIRRSELKAAYAAGVPPLALLRPLVLL
FT                   ALAVSLLNLLNLAELRPRSQEAYDGLLGRILYGEGGASGVLRRQVYAPPGLGVYFAEEV
FT                   YPEPEGNRLRGVRVVDERGRVYSAEEGLWDEEGWRLKGYVVEGEEVRPFEGVLPFPARF
FT                   RPKESLGSRDPYDSTPLEELWARAQVEPEARFAFHRRLADALGGLVLGAAAAALGLSLR
FT                   EAAWAFLGVVLLIFGYYVLWTLAAQLARYDVSPLLAYLPDLFYGALAGALAWRLR"
FT   CDS_pept        complement(378818..379234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0399"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80379.1 percent identity 100 in 138
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70222"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70222"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70222.1"
FT                   /translation="MARYLVVAHRTAKSPELAAKLKELLAQDPEARFVLLVPAVPPPGW
FT                   VYEENEVRRRAEEEAAAAKRALEAQGIPVEEAKAGDISPLLAIEEELLAHPGAYQAIVL
FT                   STLPPGPSRWLRLDVHTQAERFGLPVIHVIAQAA"
FT   CDS_pept        complement(379402..380436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0400"
FT                   /product="zinc-binding dehydrogenase"
FT                   /note="similar to GB:AAS80380.1 percent identity 100 in 344
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70223"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70223"
FT                   /db_xref="GOA:Q5SL93"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70223.1"
FT                   /translation="MRAVVYKGPFQVAVEEVPEPRLEADTDALLEVELSAICGSDLHIY
FT                   HGKIAGVLPGTVLGHEFVGRIVEKGPLVPFPVGERVVGSFQVACGECPACRKGQFFACS
FT                   RGGVFGFGLALGNLPGAQAERVRVPFARHTLFPIGDLPAEEAILAGDILTTAYGGVRPF
FT                   LTPGMSVAVVGSGPVGLMAQMVAHALGAGQVYAIDPEEARLEKAKALGSLPIHPKAEDP
FT                   VARVRRETEGLGADLVVEAVGGDGEALKLALRLAGPGGVVSSLGVPTAERLDYPWLPAF
FT                   SRGITLRSALANVPRWIGEVLALQKAGRLKGSFVFSHRLPLEEAPEGYRLFHERKATKV
FT                   ALVP"
FT   CDS_pept        complement(380433..380825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0401"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80381.1 percent identity 100 in 130
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70224"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70224"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="PDB:1WFR"
FT                   /db_xref="PDB:2CX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70224.1"
FT                   /translation="MELFTEAWAQAYCRKLNESEAYRKAASTWEGSLALAVRPDPKAGF
FT                   PKGVAVVLDLWHGACRGAKAVEGEAEADFVIEADLATWQEVLEGRLEPLSALMRGLLEL
FT                   KKGTIAALAPYAQAAQELVKVAREVA"
FT   CDS_pept        380870..381298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0402"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80382.1 percent identity 98 in 142
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70225"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70225"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70225.1"
FT                   /translation="MVYLLDLSGVYCEPVEPRLLRLLAEESGEPVFYLSEAFYALLPRL
FT                   KAEGAQALEALFPGASRLYPKAFRPRGLAFPEPFHLVSDLPPPEGVLAYHAPDKLEALA
FT                   LALEALGLAPGEAVYWDDNPLWVERARGLGVRAELFLP"
FT   CDS_pept        complement(381284..383140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0403"
FT                   /product="cell division protein FtsH"
FT                   /note="similar to GB:AAS80383.1 percent identity 99 in 618
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70226"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70226"
FT                   /db_xref="GOA:Q5SL90"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70226.1"
FT                   /translation="MPQRFNPFNLLLLVLLGYLVYTALSGPPAPTLAYTEFRELVRQGK
FT                   VAEVTLEETRITGLLKAPERFPTPQGTVQVSRRFQVPLPPAQVQDPELLRFLEENGVTI
FT                   VTKAPSIWPQVLLYVAPTLILIAFFWFFFMRAQGGAGQVMQFGQSRAKLYGKERKVNTT
FT                   FKDVAGHEEAKRELMEVVDFLKNPKKYLEIGAEIPKGVLLVGPPGTGKTLLARAVAGEA
FT                   GVPFFSVSASEFMEMFVGVGASRVRSLFEDARRNAPSIIFIDELDSIGRKRGAGIGGGH
FT                   DEREQTLNQILSEMDGFEKDTSVIVLAATNRPDILDPALLRPGRFDRQVVVGLPSLEER
FT                   KEILLVHMRGKPIAEDVDALELAHLTPGFSGADLRNLVNEAALLAARNGEKRIRKEHFL
FT                   KALDKIVLGLERSALKLSEEERRAVAYHEAGHAVVGEVLPHADKTEKVSIVPRGMALGA
FT                   RWSKPEERVLVSREHLMDELAVLMAGRVAEELFTGTVTTGAQDDFKRATGIAKRMVLDW
FT                   GMGEHFKNVAWGSDSGPVFLGEEIAKKKDHSEETARLIDQDIMKILDEAYERARKVLST
FT                   HREAVHKIAEELLREETIPGDRVRAILRETQAVERAEDLGQE"
FT   CDS_pept        383192..384565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80384.1 percent identity 99 in 457
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70227"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70227"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70227.1"
FT                   /translation="MWYPLAAMKGVLEALHQGDYDTAIDLLTRKALFGREREAKEAWLL
FT                   LAEVYALYGEEGLEKAHHALEEAYALGGLEYDPLYRSLLAELLALEGRPEREVLPLFLP
FT                   SRDPRVRYHQAQALFYLGRLEEALEALEAGLPPHLAWRAEGLKGRILERLGRHGEAALA
FT                   YERGAELALGLERYWLLLDAAAMWLEAGEGERALLALKEAEAAVGEEDPEDAATRHYLL
FT                   ARAHLLLGNPGLALEEIRKALALEEESGHKAYGTPLVEGQALLQLGRYEEAMASFREAL
FT                   ARADAGERPHVLHEMGVAALDHGAYPEAEEHLRALVREEGYPYLAQAYADLAEALYRQG
FT                   RYQEAEAAAREAVARGAVAAGELVLGHVAYDLLHLEEALEHYRKAAESAEEGSREWVGA
FT                   QEMVVDTLAQLGYRFPEEMVRRGQAVLPYLHPADEWHAALTAYVERAQALLREGKRLN"
FT   CDS_pept        complement(384586..385617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0405"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80385.1 percent identity 99 in 343
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70228"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70228"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70228.1"
FT                   /translation="MIRATLSELDLGELLRALEAARKSAVVSFRGRIYGRVHLLGGRIL
FT                   YARTEPGPHLGEYLVRLGHLTLEEVQELVERQDRENPGTPLGALALELGLIGEEELREA
FT                   LTAQVLEALATLLGEKEGEVVAEPMVEGSQVALPLTFGTGWALMEAARKLDEWRRGQVD
FT                   PDEVLHLVEDPTRHPLPPEAWSVLEHLDGVRRARSIALLSGLPEEEVYHLLHEMKARGL
FT                   LRPSTLLLEDPLVAVLAESGVVRRLLLYLLEAHRFRVLLARDVEGLLRLLKSRPKGVIL
FT                   QGEKAVEAARKVRATPEGRLASLYLVSETPPGLLLRPLRLLHLPKPLRSQEVLKALEPL
FT                   RRG"
FT   CDS_pept        complement(385614..386588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0406"
FT                   /product="RuvB, Holliday junciton DNA helicase"
FT                   /note="similar to GB:AAS80386.1 percent identity 99 in 324
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70229"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70229"
FT                   /db_xref="GOA:Q5SL87"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="PDB:1HQC"
FT                   /db_xref="PDB:1IXR"
FT                   /db_xref="PDB:1IXS"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SL87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70229.1"
FT                   /translation="MEDLALRPKTLDEYIGQERLKQKLRVYLEAAKARKEPLEHLLLFG
FT                   PPGLGKTTLAHVIAHELGVNLRVTSGPAIEKPGDLAAILANSLEEGDILFIDEIHRLSR
FT                   QAEEHLYPAMEDFVMDIVIGQGPAARTIRLELPRFTLIGATTRPGLITAPLLSRFGIVE
FT                   HLEYYTPEELAQGVMRDARLLGVRITEEAALEIGRRSRGTMRVAKRLFRRVRDFAQVAG
FT                   EEVITRERALEALAALGLDELGLEKRDREILEVLILRFGGGPVGLATLATALSEDPGTL
FT                   EEVHEPYLIRQGLLKRTPRGRVATELAYRHLGYPPPVGPLLEP"
FT   CDS_pept        386614..387399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0407"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /note="similar to GB:AAS80387.1 percent identity 99 in 261
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70230"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70230"
FT                   /db_xref="GOA:Q5SL86"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SL86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70230.1"
FT                   /translation="MRRTVKDFRNAKGQRLVYLTAYDYPTARLAEAAGVDAILVGDSLG
FT                   MVVLGYPSTVPVTLEEMLHHTKAARRGAPETFLVADLPYLAYATLDRALLAAERLLKEG
FT                   GADAVKLEGGEEVAEIVQGLVRAGVPVLGHVGLTPQTASQLGGYKLQGRRPEEAERILK
FT                   GALALEEAGAYGVVLEMVPARLAKEVTERLSVHTVGIGAGPHTDAQVLVFHDVVGLYGD
FT                   FKPRFVKRYLEAGRLIQEALSRYAQEVREGVFPGEEHSF"
FT   CDS_pept        387447..388373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0408"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /note="similar to GB:AAS80388.1 percent identity 99 in 300
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70231"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70231"
FT                   /db_xref="GOA:Q5SL85"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70231.1"
FT                   /translation="MVRFRREGVRLDQAVAEALSVSRAKAQAWIQAGRVRVGDRVVLKP
FT                   AYRLKGEEVAVEPVEEAPMVLPEDLPIPILYEDEDVLALNKPPGLLTHPAPGVYSGTVV
FT                   NLLLARYYGPVEKGPPELVRPGIVHRLDKDTSGVLVVAKHGGVLEGLARAFRDRLVMKR
FT                   YLAITEGHPREGVLIAPIGRHPRERHKMHVGGLAARYAETEFQVLATAGPYALVEARPH
FT                   TGRTHQIRVHLKYLGAPILGDELYGRKSPHIGRQALHAYELRIPHPRTGRILELLAPVP
FT                   QDMAAAWEALGGRWPEEVVREGYAGAQ"
FT   CDS_pept        388370..389263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0409"
FT                   /product="putative modification methylase"
FT                   /note="similar to GB:AAS80389.1 percent identity 98 in 296
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70232"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70232"
FT                   /db_xref="GOA:Q5SL84"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:2ZIE"
FT                   /db_xref="PDB:2ZIF"
FT                   /db_xref="PDB:2ZIG"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70232.1"
FT                   /translation="MRSFPKAKEAFSEGEKVSFGVHRLHVGDAREVLASFPEASVHLVV
FT                   TSPPYWTLKRYEDTPGQLGHIEDYEAFLDELDRVWREVFRLLVPGGRLVIVVGDVAVAR
FT                   RRFGRHLVFPLHADIQVRCRKLGFDNLNPIIWHKHTNASLEVEGRGVFLGKPYEPGAII
FT                   KTEIEYILMQRKPGGYRKPTQEQREKSRLPKEDFHRFFRQIWDDIPGESTKDHPAPFPL
FT                   ELAERLVRMFSFVGDVVLDPFAGTGTTLIAAARWGRRALGVELVPRYAQLAKERFAREV
FT                   PGFSLEVLDGATHPRR"
FT   CDS_pept        389286..389927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0410"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80390.1 percent identity 96 in 105
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70233"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70233"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70233.1"
FT                   /translation="MIRTSSQDSGRQGVLAGYLEERLRERLPPHLWPHLEREVSVPGLA
FT                   REKKWDLGLVYPAGSSLPKKPRLLISLKSILKNPSGSWPNRLDDLVGEVSSVQLLFPEV
FT                   VVGYVVVLDYGAPTKRRGGVYRPPQGNELDPVYARFKQGLAALAQRRPPLWPQGLVEGC
FT                   WVLEIDTRRAPLLLRPEEAVAEGEAFLDALVRELRRREPLLFLDQGQKPL"
FT   CDS_pept        complement(389901..391094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0411"
FT                   /product="alpha-aminoadipate aminotransferase"
FT                   /note="similar to GB:AAS80391.1 percent identity 99 in 397
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70234"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70234"
FT                   /db_xref="GOA:Q5SL82"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70234.1"
FT                   /translation="MKPLSWSEAFGKSAGRIQASTIRELLKLTQRPGILSFAGGLPAPE
FT                   LFPKEEAAEAAARILREKGEVALQYSPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQAL
FT                   DLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGEEGPDLDALEEVLKRERP
FT                   RFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYFGEARLPSLFELA
FT                   REAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHEL
FT                   LKEGFSERLERVRRVYREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGL
FT                   FRRALEENVAFVPGGPFFANGGGENTLRLSYATLDREGIAEGVRRLGRALKGLLALV"
FT   CDS_pept        complement(391190..392320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0412"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase,
FT                   putative"
FT                   /note="similar to GB:AAS80392.1 percent identity 99 in 376
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70235"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70235"
FT                   /db_xref="GOA:Q5SL81"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="PDB:2DQB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70235.1"
FT                   /translation="MRFSREALLELEASRLAPYAQKARDTRGRAHPEPESLYRTPYQKD
FT                   RDRILHTTAFRRLEYKTQVLPGWAGDYYRTRLTHTLEVAQVSRSIARALGLNEDLTEAI
FT                   ALSHDLGHPPFGHTGEHVLNALMQDHGGFEHNAQALRILTHLEVRYPGFRGLNLTYEVL
FT                   EGIATHEAAYSPGFKPLYEGQGTLEAQVVDLSDAIAYAAHDLDDGLRAGLLHPEELKEV
FT                   ELLQALALEEGLDLLRLPELDRRVLVRQLLGYFITAAIEATHRRVEEAGVQSAEAVRRH
FT                   PSRLAALGEEAEKALKALKAFLMERFYRHPEVLRERRKAEAVLEGLFAAYTRYPELLPR
FT                   EVQAKIPEEGLERAVCDYIAGMTDRFALEAYRRLSP"
FT   CDS_pept        complement(392320..393546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0413"
FT                   /product="3-oxoacyl-[acyl carrier protein] synthase II"
FT                   /note="similar to PDB:1BKG percent identity 100 in 408 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70236"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70236"
FT                   /db_xref="GOA:Q5SL80"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="PDB:1J3N"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70236.1"
FT                   /translation="MRRVVVTGLGALTPIGVGQEAFHKAQLAGKSGVRPITRFDASALP
FT                   VRIAAEVDVDPGAYLDRKELRRLDRFVQYALIAAQLALEDAGLKPEDLDPERVGTLVGT
FT                   GIGGMETWEAQSRVFLERGPNRISPFFIPMMIANMASAHIAMRYGFTGPSSTVVTACAT
FT                   GADALGSALRMIQLGEADLVLAGGTEAAITPMAIGAFAVMRALSTRNEEPEKASRPFTL
FT                   SRDGFVMGEGAGVLVLEAYEHAKKRGARIYAELVGFGRSADAHHITEPHPEGKGAALAM
FT                   ARALKDAGIAPEQVGYINAHGTSTPVGDRAEVLAIKRVFGDHAKRLMVSSTKSMIGHLL
FT                   GAAGAVEAIATVQALYHGVIPPTINLEDPDPELDLDFVPEPREAKVDYALSNSFAFGGH
FT                   NAVLAFKRV"
FT   CDS_pept        complement(393666..393908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0414"
FT                   /product="acyl carrier protein"
FT                   /note="similar to GB:AAS80394.1 percent identity 100 in 80
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70237"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70237"
FT                   /db_xref="GOA:Q5SL79"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="PDB:1X3O"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SL79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70237.1"
FT                   /translation="MTEQEIFEKVKAVIADKLQVEPEKVTLEARFIEDLGADSLDTVEL
FT                   IMGLEDEFGLEISDEEAEKIRTVKDAVEYIKAKLG"
FT   CDS_pept        complement(393941..394678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0415"
FT                   /product="3-oxoacyl-[acyl carrier protein] reductase"
FT                   /note="similar to GB:AAS80395.1 percent identity 99 in 245
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70238"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70238"
FT                   /db_xref="GOA:Q5SL78"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:2PH3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70238.1"
FT                   /translation="MRKALITGASRGIGRAIALRLAEDGFALAIHYGQNREKAEEVAEE
FT                   ARRRGSPLVAVLGANLLEAEAATALVHQAAEVLGGLDTLVNNAGITRDTLLVRMKDEDW
FT                   EAVLEANLSAVFRTTREAVKLMMKARFGRIVNITSVVGILGNPGQANYVASKAGLIGFT
FT                   RAVAKEYAQRGITVNAVAPGFIETEMTERLPQEVKEAYLKQIPAGRFGRPEEVAEAVAF
FT                   LVSEKAGYITGQTLCVDGGLTPH"
FT   CDS_pept        complement(394671..395588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0416"
FT                   /product="malonyl CoA-[acyl carrier protein] transacylase"
FT                   /note="similar to GB:AAS80396.1 percent identity 100 in 305
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70239"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70239"
FT                   /db_xref="GOA:Q5SL77"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="PDB:2CUY"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70239.1"
FT                   /translation="MYAALFPGQGSHRVGMGRALYEASPAAKEVLDRAEAALPGLLKLM
FT                   WEGPEEALTLTENQQPALLAAGYAAYRAFLEAGGKPPALAAGHSLGEWTAHVAAGTLEL
FT                   EDALRLVRLRGRYMQEAVPVGEGAMAAVLKLPLEEIQKALEGLEGVEIANLNAPEQTVI
FT                   SGRRQAVEEAAERLKERRARVVFLPVSAPFHSSLMAPARKRLAEDLAQVPLRRPRFPVY
FT                   SNVTARPEEDPERIRALLLEQITAPVRWVEILRDMEARGVKRFLEFGSGEVLKGLVLRT
FT                   LKEAEALSVQDPDSLRKALEVERA"
FT   CDS_pept        complement(395588..396556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0417"
FT                   /product="3-oxoacyl-[acyl carrier protein] synthase III"
FT                   /note="similar to GB:AAS80397.1 percent identity 100 in 322
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70240"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70240"
FT                   /db_xref="GOA:Q5SL76"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70240.1"
FT                   /translation="MSGILALGAYVPERVMTNADFEAYLDTSDEWIVTRTGIKERRVAA
FT                   EDEYTSDLAFKAVEDLLRRHPGALEGVDAVIVATNTPDALFPDTAALVQARFGLKAFAY
FT                   DLLAGCPGWIYALAQAHALVEAGLAQKVLAVGAEALSKIIDWNDRATAVLFGDGGGAAV
FT                   VGKVREGYGFRSFVLGADGTGAKELYHACVAPRLPDGTSMKNRLYMNGREVFKFAVRVM
FT                   NTATLEAIEKAGLTPEDIRLFVPHQANLRIIDAARERLGLPWERVAVNVDRYGNTSTAS
FT                   IPLALKEAVDAGRIREGDHVLLVSFGAGLTWAAAVLTWGGA"
FT   CDS_pept        complement(396721..396903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0418"
FT                   /product="50S ribosomal protein L32"
FT                   /note="similar to GB:AAS80398.1 percent identity 98 in 60
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70241"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70241"
FT                   /db_xref="GOA:P80339"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="PDB:1VVJ"
FT                   /db_xref="PDB:1VY4"
FT                   /db_xref="PDB:1VY5"
FT                   /db_xref="PDB:1VY6"
FT                   /db_xref="PDB:1VY7"
FT                   /db_xref="PDB:4L47"
FT                   /db_xref="PDB:4L71"
FT                   /db_xref="PDB:4LEL"
FT                   /db_xref="PDB:4LFZ"
FT                   /db_xref="PDB:4LNT"
FT                   /db_xref="PDB:4LSK"
FT                   /db_xref="PDB:4LT8"
FT                   /db_xref="PDB:4P6F"
FT                   /db_xref="PDB:4P70"
FT                   /db_xref="PDB:4TUA"
FT                   /db_xref="PDB:4TUB"
FT                   /db_xref="PDB:4TUC"
FT                   /db_xref="PDB:4TUD"
FT                   /db_xref="PDB:4TUE"
FT                   /db_xref="PDB:4V4P"
FT                   /db_xref="PDB:4V4X"
FT                   /db_xref="PDB:4V4Y"
FT                   /db_xref="PDB:4V4Z"
FT                   /db_xref="PDB:4V51"
FT                   /db_xref="PDB:4V5A"
FT                   /db_xref="PDB:4V5C"
FT                   /db_xref="PDB:4V5D"
FT                   /db_xref="PDB:4V5E"
FT                   /db_xref="PDB:4V5F"
FT                   /db_xref="PDB:4V5G"
FT                   /db_xref="PDB:4V5J"
FT                   /db_xref="PDB:4V5K"
FT                   /db_xref="PDB:4V5L"
FT                   /db_xref="PDB:4V5M"
FT                   /db_xref="PDB:4V5N"
FT                   /db_xref="PDB:4V5P"
FT                   /db_xref="PDB:4V5Q"
FT                   /db_xref="PDB:4V5R"
FT                   /db_xref="PDB:4V5S"
FT                   /db_xref="PDB:4V68"
FT                   /db_xref="PDB:4V6A"
FT                   /db_xref="PDB:4V6F"
FT                   /db_xref="PDB:4V6G"
FT                   /db_xref="PDB:4V7J"
FT                   /db_xref="PDB:4V7K"
FT                   /db_xref="PDB:4V7L"
FT                   /db_xref="PDB:4V7M"
FT                   /db_xref="PDB:4V7W"
FT                   /db_xref="PDB:4V7X"
FT                   /db_xref="PDB:4V7Y"
FT                   /db_xref="PDB:4V7Z"
FT                   /db_xref="PDB:4V87"
FT                   /db_xref="PDB:4V8A"
FT                   /db_xref="PDB:4V8B"
FT                   /db_xref="PDB:4V8C"
FT                   /db_xref="PDB:4V8D"
FT                   /db_xref="PDB:4V8E"
FT                   /db_xref="PDB:4V8F"
FT                   /db_xref="PDB:4V8G"
FT                   /db_xref="PDB:4V8H"
FT                   /db_xref="PDB:4V8I"
FT                   /db_xref="PDB:4V8J"
FT                   /db_xref="PDB:4V8N"
FT                   /db_xref="PDB:4V8O"
FT                   /db_xref="PDB:4V8Q"
FT                   /db_xref="PDB:4V8U"
FT                   /db_xref="PDB:4V8X"
FT                   /db_xref="PDB:4V90"
FT                   /db_xref="PDB:4V95"
FT                   /db_xref="PDB:4V97"
FT                   /db_xref="PDB:4V9A"
FT                   /db_xref="PDB:4V9B"
FT                   /db_xref="PDB:4V9H"
FT                   /db_xref="PDB:4V9I"
FT                   /db_xref="PDB:4V9R"
FT                   /db_xref="PDB:4V9S"
FT                   /db_xref="PDB:4W2E"
FT                   /db_xref="PDB:4W2F"
FT                   /db_xref="PDB:4W2G"
FT                   /db_xref="PDB:4W2H"
FT                   /db_xref="PDB:4W2I"
FT                   /db_xref="PDB:4W4G"
FT                   /db_xref="PDB:4WPO"
FT                   /db_xref="PDB:4WQ1"
FT                   /db_xref="PDB:4WQF"
FT                   /db_xref="PDB:4WQR"
FT                   /db_xref="PDB:4WQU"
FT                   /db_xref="PDB:4WQY"
FT                   /db_xref="PDB:4WR6"
FT                   /db_xref="PDB:4WRA"
FT                   /db_xref="PDB:4WRO"
FT                   /db_xref="PDB:4WSD"
FT                   /db_xref="PDB:4WSM"
FT                   /db_xref="PDB:4WT1"
FT                   /db_xref="PDB:4WT8"
FT                   /db_xref="PDB:4WU1"
FT                   /db_xref="PDB:4WZD"
FT                   /db_xref="PDB:4WZO"
FT                   /db_xref="PDB:4Y4O"
FT                   /db_xref="PDB:4Y4P"
FT                   /db_xref="PDB:4YPB"
FT                   /db_xref="PDB:4YZV"
FT                   /db_xref="PDB:4Z3S"
FT                   /db_xref="PDB:4Z8C"
FT                   /db_xref="PDB:4ZER"
FT                   /db_xref="PDB:4ZSN"
FT                   /db_xref="PDB:5A9Z"
FT                   /db_xref="PDB:5AA0"
FT                   /db_xref="PDB:5CZP"
FT                   /db_xref="PDB:5D8B"
FT                   /db_xref="PDB:5DFE"
FT                   /db_xref="PDB:5DOX"
FT                   /db_xref="PDB:5DOY"
FT                   /db_xref="PDB:5E7K"
FT                   /db_xref="PDB:5E81"
FT                   /db_xref="PDB:5EL4"
FT                   /db_xref="PDB:5EL5"
FT                   /db_xref="PDB:5EL6"
FT                   /db_xref="PDB:5EL7"
FT                   /db_xref="PDB:5F8K"
FT                   /db_xref="PDB:5FDU"
FT                   /db_xref="PDB:5FDV"
FT                   /db_xref="PDB:5HAU"
FT                   /db_xref="PDB:5HCP"
FT                   /db_xref="PDB:5HCQ"
FT                   /db_xref="PDB:5HCR"
FT                   /db_xref="PDB:5HD1"
FT                   /db_xref="PDB:5IB7"
FT                   /db_xref="PDB:5IB8"
FT                   /db_xref="PDB:5IBB"
FT                   /db_xref="PDB:5IMQ"
FT                   /db_xref="PDB:5IMR"
FT                   /db_xref="PDB:5J30"
FT                   /db_xref="PDB:5J3C"
FT                   /db_xref="PDB:5J4B"
FT                   /db_xref="PDB:5J4C"
FT                   /db_xref="PDB:5J8B"
FT                   /db_xref="PDB:5NDJ"
FT                   /db_xref="PDB:5NDK"
FT                   /db_xref="PDB:5OT7"
FT                   /db_xref="PDB:5UQ7"
FT                   /db_xref="PDB:5UQ8"
FT                   /db_xref="PDB:5VP2"
FT                   /db_xref="PDB:5VPO"
FT                   /db_xref="PDB:5VPP"
FT                   /db_xref="PDB:5W4K"
FT                   /db_xref="PDB:5WIS"
FT                   /db_xref="PDB:5WIT"
FT                   /db_xref="PDB:5ZLU"
FT                   /db_xref="PDB:6BUW"
FT                   /db_xref="PDB:6BZ6"
FT                   /db_xref="PDB:6BZ7"
FT                   /db_xref="PDB:6BZ8"
FT                   /db_xref="PDB:6C5L"
FT                   /db_xref="PDB:6CAE"
FT                   /db_xref="PDB:6CFJ"
FT                   /db_xref="PDB:6CFK"
FT                   /db_xref="PDB:6CFL"
FT                   /db_xref="PDB:6CZR"
FT                   /db_xref="PDB:6FKR"
FT                   /db_xref="PDB:6GSJ"
FT                   /db_xref="PDB:6GSK"
FT                   /db_xref="PDB:6GSL"
FT                   /db_xref="PDB:6GZQ"
FT                   /db_xref="PDB:6GZX"
FT                   /db_xref="PDB:6GZZ"
FT                   /db_xref="PDB:6N1D"
FT                   /db_xref="PDB:6N9E"
FT                   /db_xref="PDB:6N9F"
FT                   /db_xref="PDB:6ND5"
FT                   /db_xref="PDB:6ND6"
FT                   /db_xref="PDB:6NDK"
FT                   /db_xref="PDB:6O97"
FT                   /db_xref="PDB:6OF1"
FT                   /db_xref="PDB:6Q95"
FT                   /db_xref="PDB:6QNQ"
FT                   /db_xref="PDB:6QNR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80339"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70241.1"
FT                   /translation="MAKHPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTV
FT                   CPECGYYAGRKVLEV"
FT   CDS_pept        complement(396963..397499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80399.1 percent identity 99 in 178
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70242"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70242"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70242.1"
FT                   /translation="MDYTTATSINLARLLKEGGTARAQGVVQEAFVVGEERFPLQGEAS
FT                   WRVAISSVGGNEYWLSGEVEGVVLMECRRCLRPTPTRIHAHFQHLLHYEPGLEEVVFHE
FT                   EGEEEFYAFGLPDLDLLPFLTEAFVTEMPYTVLCEEGCKGLCPVCGADRNVEDCGHEPE
FT                   AFHPFLGLKDLLPEL"
FT   CDS_pept        complement(397588..398067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0420"
FT                   /product="putative flavoprotein"
FT                   /note="similar to GB:AAS80400.1 percent identity 99 in 159
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70243"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70243"
FT                   /db_xref="GOA:Q5SL73"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="PDB:1YOA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70243.1"
FT                   /translation="MNLEAKKKVLRSFTYGLYVLTAKDGDEVAAGTVNWVTQASFQPPL
FT                   VAVGLKRDSHLHALVERTGKLALMTLAHDQKAIAQDFFKPTVREGDRLNGHPFEPSPTF
FT                   GLPLLTELPYWLEAEVRHLYPGGDHSLVVAEVVEAGVRREEKPLVMWDTGWFYGG"
FT   CDS_pept        complement(398091..399977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0421"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80401.1 percent identity 99 in 628
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70244"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70244"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70244.1"
FT                   /translation="MRRFLAGLWLLGLALGQGLVLPFEGPKGYGLAQAFAQGLKAPPPT
FT                   LLALLLPDLPWRGSYELAGGLYTKAGARLARAATGADWVLLGREEEGGLRLILAREGGS
FT                   EERLFKTPELAWLWLQGKGLAPRLSPLPTPGLPEERLRALAQGEAPDPLHRSALDLKEG
FT                   RGSGLLEGLLPERLLLLWQGKLPRAYEAFRLLAEGKREEALALAEAMEEGDVLERTAAH
FT                   LLFRALEDERWKASARRLAEAFPELSLAWEEVSFAAFQEGKGEEAKEALLKALALRPDY
FT                   WLYWTNLGWAYYLTGDLPRAIQASERAVALSPNATAYYNLGLFKAIYGDFLGAKAAYDR
FT                   ALRLDQGEDYPEALKDLEEREEPLALFFRAYLAERTGLEAEPLYRAFLEAHPRHPAAFA
FT                   ARRALATLKAGGLSLEVERLTLVPGGPDARPFRAGEAIFPEVRLEGRPYLRQASLFTAL
FT                   YREGRKVAEEEKPVGFPPLTVALLEVAPPVVPEAPGRYRLEVRYAEARAVLDLEVGAPS
FT                   LARRLFALGLEVRDLSGRPLLTPKEALGEDGERLLLERAREALMEAAPLATTERLTQPL
FT                   EKGPVAGRSVQEVLRDPDPEILRAFFQAVLENPERLAETDVVNAFVNWLLEP"
FT   CDS_pept        complement(399987..400691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0422"
FT                   /product="UDP-N-acetyl-D-mannosaminuronic acid transferase"
FT                   /note="similar to GB:AAS80402.1 percent identity 100 in 234
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70245"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70245"
FT                   /db_xref="GOA:Q5SL71"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70245.1"
FT                   /translation="MERLTLLGLPLDPVDMEEALKRIGGFLQEERTHQVVTLNPEIAVR
FT                   AQEDEALRRAVLEAELVTPDGVGILWAVRRLHGLSLKERVTGIDLTLALLRRFPGVRVY
FT                   LLGGKPGVAEGAAREVERLGGVVVGLHHGYFQEEAPVVAAIQKAAPDLLLVGMGERQEA
FT                   FIHRHKPHLEARVAIGVGGTLDVLAGEARRPPLWAQRLGLEWLLRVGLDPKRWRRAPRL
FT                   FRFAYLVLKEKR"
FT   CDS_pept        complement(400679..401395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80403.1 percent identity 98 in 238
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70246"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70246"
FT                   /db_xref="GOA:Q5SL70"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70246.1"
FT                   /translation="MCRVDLCLRPARGPLILVEVLPAGSVLTRLLALGAREVWVAPGPK
FT                   VARLLAEAFPEEALLLGEVEGFPPEGFHGRLSLLDLEAAEVRGRRAVLSAPTLNASLLP
FT                   EEEEVYLASLRNAKAVLEAARGLKAPTLRPSGAPEPLLSAVVALGFLERKLAPEAPPSL
FT                   PALLLKAFPDPQEALFQSPEGQTLHRQGRTEELAWASLIGVDPVVPKLAEVRFFPKEAH
FT                   GLSRDRYAQRFIPWKG"
FT   CDS_pept        401423..402358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0424"
FT                   /product="thiamin-monophosphate kinase"
FT                   /note="similar to GB:AAS80404.1 percent identity 96 in 311
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70247"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70247"
FT                   /db_xref="GOA:Q5SL69"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="PDB:2YXZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70247.1"
FT                   /translation="MRLKDLGERALLARLAPLGYPPEAPLPPGDDAGGVWAEGRAWLLK
FT                   TDGFLYREVALKGMGPFEVGFRGVAATASDLLAKMGRPLGFTLGLFLPEDLEEGFVLEL
FT                   VRGAAEAAKRLGAFLLGGDTNRGVEVALTVSGYALAEAPLPRKALPGDLLYLAGDRWGR
FT                   TGAAIRAHYEGRSLEGFPKIREAAFYPLPRLELLALSGLLRGSLDSSDGLAETLWQLAD
FT                   LGVGVEVEALPLYPDVLAFAGSEEAALELVLYGGEEFEAVLVVPQEGAAAVEARAKAKG
FT                   LPLFRAGRVVAGEGVYLRGAPLPRKGYAHF"
FT   CDS_pept        402495..403112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0425"
FT                   /product="NADH oxidase (H2O2-forming)"
FT                   /note="similar to GB:AAS80405.1 percent identity 99 in 205
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70248"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70248"
FT                   /db_xref="GOA:Q60049"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="PDB:1NOX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60049"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70248.1"
FT                   /translation="MEATLPVLDAKTAALKRRSIRRYRKDPVPEGLLREILEAALRAPS
FT                   AWNLQPWRIVVVRDPATKRALREAAFGQAHVEEAPVVLVLYADLEDALAHLDEVIHPGV
FT                   QGERREAQKQAIQRAFAAMGQEARKAWASGQSYILLGYLLLLLEAYGLGSVPMLGFDPE
FT                   RVRAILGLPSHAAIPALVALGYPAEEGYPSHRLPLERVVLWR"
FT   CDS_pept        complement(403109..403468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80406.1 percent identity 97 in 119
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70249"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70249"
FT                   /db_xref="GOA:Q5SL67"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70249.1"
FT                   /translation="MPVRSLGSSVLRWPSREEVEEALKAWLSRHPIPGLLAAGYFGSYA
FT                   RGEAGVGSDLDLLLLVAHSPLPPWKRPLGLSLEELPVPAEALVYTLEEWKGLPQRSPRL
FT                   ARVLREETRWLLPPP"
FT   CDS_pept        complement(403425..403805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to EMB:CAE06995.1 percent identity 48 in 133
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70250"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70250"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70250.1"
FT                   /translation="MNRARDWLLQAEKDLETAEIARNAGRHEWACFATQQAAEKAVKAL
FT                   HLHLGQEAWGHLVARLLKELPLQVPQELVEKARYLDGLYIPTRHPDAFPEGPLAEHYGP
FT                   LQSEDAIGYAREILGFVRAQMA"
FT   CDS_pept        403834..404877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0428"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="similar to GB:AAS80408.1 percent identity 98 in 347
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70251"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70251"
FT                   /db_xref="GOA:Q5SL65"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70251.1"
FT                   /translation="MRAFKAHLRGLSPYPYKKEEAPVKLDQNESPFDLPGALKEEALGR
FT                   LRAIPWNRYPEIHAESLRKRLSALLDWPEEGIVLAPGSNLLILALSLAAEEVLDLRPSF
FT                   PHYAHAAKVAGTPYRAVPLGEGFSLDLKALLAAFRGGVLFLPNPHAPTGALFPEEALRA
FT                   LAERAKEVGGLLVVDEAYREFAGTDFRFLARENPHVALLRTFSKAFSLGGVRAGYLLGS
FT                   PEVAGVVREVLPPFVLPAHTGAVLEVVLENPGYVEKVVEEVVAQRERVYRELLAHPTWR
FT                   PYPSRTNFLLVRTPDAEEAFRHLLSQGVLVRRQDRYPGLAGCLRVTVGRREEMDAFLRA
FT                   AFGVAYA"
FT   CDS_pept        404870..405454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0429"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /note="similar to GB:AAS80409.1 percent identity 99 in 194
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70252"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70252"
FT                   /db_xref="GOA:Q5SL64"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SL64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70252.1"
FT                   /translation="MREATVERATAETWVWLRLGLDGPTGGKVDTGLPFLDHMLLQLQR
FT                   HGRFLLEVEARGDLEVDVHHLVEDVGIALGMALKEALGDGVGLERYAEAFAPMDETLVL
FT                   CVLDLSGRPHLEFRPEAWPVVGEAGGVNHYHLREFLRGLVNHGRLTLHLRLLSGREAHH
FT                   VVEASFKALARALHKATRRTGEGVPSTKGVL"
FT   CDS_pept        405570..406166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0430"
FT                   /product="amidotransferase HisH"
FT                   /note="similar to GB:AAS80410.1 percent identity 100 in 198
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70253"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70253"
FT                   /db_xref="GOA:Q7SIC0"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:1KA9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7SIC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70253.1"
FT                   /translation="MKALLIDYGSGNLRSAAKALEAAGFSVAVAQDPKAHEEADLLVLP
FT                   GQGHFGQVMRAFQESGFVERVRRHLERGLPFLGICVGMQVLYEGSEEAPGVRGLGLVPG
FT                   EVRRFRAGRVPQMGWNALEFGGAFAPLTGRHFYFANSYYGPLTPYSLGKGEYEGTPFTA
FT                   LLAKENLLAPQFHPEKSGKAGLAFLALARRYFEVL"
FT   CDS_pept        complement(406137..407057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0431"
FT                   /product="sugar kinase"
FT                   /note="similar to GB:AAS80411.1 percent identity 99 in 306
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70254"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70254"
FT                   /db_xref="GOA:Q5SL62"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70254.1"
FT                   /translation="MRFFVLGDVSVDLLFFLERIPEPGEEVPSRRALMKPGGAGGTLAA
FT                   QLASLGHRVFLAGRVGKDPFAELALSRVREVGVDLRHLQEDPEHTTSSVLILVVPGGER
FT                   AMVSAEGASRYLDPALFKPRFLDQVDAVVLSAYALVGGPSRSYAAEVLEAARRRELPVF
FT                   ADLGAGAVRAAGKELLKHLRGVGWLLMNEGELKTLTGASSISQGVARLRQEGFQHLAVK
FT                   VGAMGSIVVTPEGEELIEPFPVEDIVDSTGAGDAYTAAFAHAILEGLSPVEAGRLANLA
FT                   GALAATAIGAQGRLVTLEDLKVAAG"
FT   CDS_pept        407202..408683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0432"
FT                   /product="'IMP dehydrogenase/GMP reductase"
FT                   /note="similar to GB:AAS80412.1 percent identity 99 in 493
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70255"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70255"
FT                   /db_xref="GOA:Q5SL61"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70255.1"
FT                   /translation="MDEGKILYEGLTFDDVLLLPDYSEVLPKEVSVRTRLTKRLFLNIP
FT                   ILSAAMDTVTEAEMAIAMAREGGLGVIHKNLSIEAQAAMVRKVKRSEAGMIQDPVTLPP
FT                   TATLEDAERLMREYRIGGLPVVDVYGRLLGLVTNRDLRFERDLKRPVTEVMTPVERLVT
FT                   ARPGTTLEEAEELLRRHKVEKLPLVDESGRLKGLITLKDIVKRRQYPNAVKDAQGRLLV
FT                   GAAVGASKDLPERAQALVEAGVDVLVLDSAHGHSKGILEALAYLKETFGERVEVIAGNV
FT                   ATREGARALAERGADAVKVGIGPGSICTTRVVTGVGVPQITAILEAVAGVKDLDVPVIA
FT                   DGGIKYTGDVAKAIAAGAHAVMLGSMLAGTDEAPGEEVLKDGRRYKLYRGMGSLGAMKQ
FT                   GSADRYFQDPEKGETEAKKLVPEGIEGMVPYKGPVADVLYQIVGGLRSAMGYVGAPDIE
FT                   TFRKKARFVRMTMAGLIESHPHDVVVVKEAPNYSR"
FT   CDS_pept        complement(408680..408910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0433"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80413.1 percent identity 100 in 76
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70256"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70256"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70256.1"
FT                   /translation="MDRKGWVMRAVEALRLATFKEIQRYLDEEGEPFSKKELLDTLKAL
FT                   VAEGLLEEKEGVYRPARKKGSAEAFRRLFGD"
FT   CDS_pept        408951..409436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0434"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80414.1 percent identity 98 in 161
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70257"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70257.1"
FT                   /translation="MDPYREYQDYVMASRLLVASGLSREILTLAQYARLRLKRLELARA
FT                   RRFRELEALDRRLRYGFWTDPLRLREHLHPLRDSPYLADPEAFERLLFPEERARLRYPG
FT                   QAGEYYLGWLRLPPLLMEPWAFEEALRAQEEKGRALPLFLNAFHLGPGGREGPWRGR"
FT   CDS_pept        complement(409381..409806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0435"
FT                   /product="disulfide bond formation protein B"
FT                   /note="similar to GB:AAS80415.1 percent identity 100 in 141
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70258"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70258"
FT                   /db_xref="GOA:Q5SL58"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR012187"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70258.1"
FT                   /translation="MLEAVERKTLYLAFAWVVALVATLGSLYYSEVRLFLPCELCWYQR
FT                   IFMYPQAVILGLALWRQDFGVWPYSLALSLLGGSVSVLHLTQQWFPGLFPLACKPPVPC
FT                   SAEYIPEFPIPLQALIAFTLIALAMGLLARQARGGRR"
FT   CDS_pept        complement(409940..410854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0436"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="similar to GB:AAS80416.1 percent identity 99 in 304
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70259"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70259"
FT                   /db_xref="GOA:Q5SL57"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70259.1"
FT                   /translation="MGLFDRLRAGLAKTRERLLKAIPWGGDPEEVLEELEMALLAADVG
FT                   VAATEELLKEVRASGRRDLKEVVKEKLVQMLEPDERRATLRKLGFRPQKLRPVEPQGHV
FT                   VMVVGVNGVGKTTTIAKLGRLYQGLGKKVLFCAGDTFRAAGGAQLAEWGKRLGIPVIQG
FT                   PEGADPAALAFDAAKARRARGLDLLFVDTAGRLHTKQGLMEELKKVKRAIAKADPGEPG
FT                   EVWLVLDAVTGQNGLEQAKRFHEAVGLTGVIVTKLDGTAKGGVLVPIVRTLKVPIRFIG
FT                   VGEGPDDLQPFDAEAFVEALLEA"
FT   CDS_pept        complement(410854..411294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80417.1 percent identity 94 in 146
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70260"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70260"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70260.1"
FT                   /translation="MRRLLVVLLALLGLASAQGAIGMRFGYGEGLGLTFGAGMENRLRQ
FT                   NLSGRLAADLAPEAPGVALEALLLFKPDLGQYDPALKGLLPYVGGGLAGVVGPAPTLGV
FT                   SLALGLEGLLDPTTGLFAEGGYTYGFADFPKVFRLAFGVSFR"
FT   CDS_pept        complement(411311..412717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0438"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="similar to PDB:1BKG percent identity 100 in 468 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70261"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70261"
FT                   /db_xref="GOA:P27000"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="PDB:1G59"
FT                   /db_xref="PDB:1GLN"
FT                   /db_xref="PDB:1J09"
FT                   /db_xref="PDB:1N75"
FT                   /db_xref="PDB:1N77"
FT                   /db_xref="PDB:1N78"
FT                   /db_xref="PDB:2CUZ"
FT                   /db_xref="PDB:2CV0"
FT                   /db_xref="PDB:2CV1"
FT                   /db_xref="PDB:2CV2"
FT                   /db_xref="PDB:2DXI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27000"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70261.1"
FT                   /translation="MVVTRIAPSPTGDPHVGTAYIALFNYAWARRNGGRFIVRIEDTDR
FT                   ARYVPGAEERILAALKWLGLSYDEGPDVGGPHGPYRQSERLPLYQKYAEELLKRGWAYR
FT                   AFETPEELEQIRKEKGGYDGRARNIPPEEAEERARRGEPHVIRLKVPRPGTTEVKDELR
FT                   GVVVYDNQEIPDVVLLKSDGYPTYHLANVVDDHLMGVTDVIRAEEWLVSTPIHVLLYRA
FT                   FGWEAPRFYHMPLLRNPDKTKISKRKSHTSLDWYKAEGFLPEALRNYLCLMGFSMPDGR
FT                   EIFTLEEFIQAFTWERVSLGGPVFDLEKLRWMNGKYIREVLSLEEVAERVKPFLREAGL
FT                   SWESEAYLRRAVELMRPRFDTLKEFPEKARYLFTEDYPVSEKAQRKLEEGLPLLKELYP
FT                   RLRAQEEWTEAALEALLRGFAAEKGVKLGQVAQPLRAALTGSLETPGLFEILALLGKER
FT                   ALRRLERALA"
FT   CDS_pept        412772..413500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0439"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="similar to GB:AAS80419.1 percent identity 100 in 242
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70262"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70262"
FT                   /db_xref="GOA:Q5SL54"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70262.1"
FT                   /translation="MDGELRAQGLRKRYGPKEVVRGVDLALRRGEIVALFGPNGAGKTT
FT                   TFYMVVGFIRPTGGRIYLKGQEITALPMYKRARLGLGYLPQEPSAFRRMTALENLLAVL
FT                   EFQPLSKKERLEKAKALLEELSIYHLRDRMAYSLSGGERRRLEIARALATDPDFLLLDE
FT                   PFTGVDPKNVREIQKVIAELRERRGVGVFITDHAVRETLAITDRVYLMYDGQVLFHGDP
FT                   ETFAKDQGVRRHYLGEDYEL"
FT   CDS_pept        413503..414846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80420.1 percent identity 99 in 447
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70263"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70263"
FT                   /db_xref="GOA:Q5SL53"
FT                   /db_xref="InterPro:IPR021435"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70263.1"
FT                   /translation="MTFWALLFLVLFLSALVAYLGDKVAKWAGKRHYRLFGLRPRQTAT
FT                   LVAVFTGVGIALLSYLGFLLVFRDAREVILQAEAIRAERDRLKEQRAALEAEAARALAE
FT                   VNALRGERGALLQALERVEGLREAASRELAALREEVARLEARGKALEEALRAREAEVRA
FT                   KEEALRALEARLREAEAELAQARKEREALLGERERLEADLVALQGRVLDLRRSREVLEE
FT                   EASRLREALARVRQELAEEERRVQGLLVQARVLEGQKGQLAEGLARLSQGLYLGEVRLG
FT                   PEEGPVALEEAARRRALLLGFKGVRLLGGAKGPGLAVLEGAGYEDGVLLVRARFYPEKR
FT                   LWPAGEVLASATFLNTGEPRARAVLLEVGERVRKRLLEEGVPPEYARFPTETDLAQGLL
FT                   LLRGRSGVVRVGVVALREVWTVEPPLLAFRLLGGPPGPEVPVPTREVR"
FT   CDS_pept        complement(414139..415641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0441"
FT                   /product="methyltransferase, HemK family"
FT                   /note="similar to GB:AAS80421.1 percent identity 97 in 500
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70264"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70264"
FT                   /db_xref="GOA:Q5SL52"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70264.1"
FT                   /translation="MPEAPGDTPLALDLLRRLRRALGAAGLPELEAWDLLAAATGWPRK
FT                   ALYGRLTSSLPQEALDRAEALLKRRLQGYPLQYLVGEVEFFGLPLRVEEGVLIPRPETE
FT                   GLVELALGLPLPPAPRILDVGTGTGAIALALKRALPEAEVYATEVDPKALALARENAER
FT                   LGLSVAFLPAPLTGGLRDLDLVVSNPPYLPEAYREKAPRELGYESPLALYAGPEGLSVA
FT                   RPLAEEARRSLKPGGYLLLELAPENVHLLARELREKGWKEVAVLPDLAGRDRYLRARRP
FT                   PEEAEGEEGRLHRPHLPQSHHPHPDHPGPPPEEEEALGQVRLRGEAGVLRGHALLQKAL
FT                   PDPFPHLQEDGPGPGLPRVEEGGAGENLPRGPQALFRVKAGPDEEDAVLVPCPFQNSKP
FT                   RALGPAEKPHALEAQEEGPPPGRLFQRHGALLRAQAHLPQVEPLAQAGEAFRELALLPL
FT                   QHPGLDEEALDPPLLLGELLAYPGQGLPEPGGLLLQNLPGAP"
FT   CDS_pept        complement(415654..416223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0442"
FT                   /product="probable DNA/RNA-binding protein (Jag-related
FT                   protein)"
FT                   /note="similar to GB:AAS80422.1 percent identity 99 in 189
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70265"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70265"
FT                   /db_xref="GOA:Q5SL51"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70265.1"
FT                   /translation="MNERKKSIDELLSDLGVLEEAPVEVELKESGTPEAQGDPRAFLEE
FT                   FLGGLLLLLDPGHRLEVRVEGETLKAEVKGGDLGRFIGKEGRTLRAVEHLARVVLARRF
FT                   GTGYRLVLDAAGYRSRAEARIRRLAEEAALTVAMTGEPLHLPPMPPGERRIVHMLLKNH
FT                   PRVTTESQGEGEERHVVVYPRREAQG"
FT   CDS_pept        complement(416233..417525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0443"
FT                   /product="putative membrane protein"
FT                   /note="similar to GB:AAS80423.1 percent identity 99 in 430
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70266"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70266"
FT                   /db_xref="GOA:Q5SL50"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70266.1"
FT                   /translation="MKRLLAAFLFLLPALALEVGFKDADVNGDGTPEKVAVTNLMDLAF
FT                   DEAGQVVGWYVKAYKGTAFGDYARAPNLAANGPVLSPVGFRPLEAEFAVEDGHLLARFR
FT                   GEEGTLTYRIPKERYTAEVTADFPLVLKLSAQGNPKALLEGAAEPAPSGEGRLVYLAWQ
FT                   TRPKAGYALVAFGEGPLEGRLVGREGEVRLGPGEILRVYGGQNELVRFHVEGLLSFPGL
FT                   FSPNLWGQLSLGLLWIMEAAYRFTGNWGLAILFLTLVVRLLLWPLMHQQFKSMAEIQRL
FT                   QPLIQKINEKYKDDPNKRAEATMKLYQEHRVNPAAGCLPLLIQMPILFILWKVIANYEF
FT                   GQGFLWIPDLALPDPYYILPVLYVASTFLSTWLSAHGNRDLIRQSLFMNLIFVFLVLQF
FT                   PSGVTLYWVLSTLIGLVQQWLINKSLAPLKA"
FT   CDS_pept        complement(417522..417770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0444"
FT                   /product="alpha-hemolysin"
FT                   /note="similar to GB:AAS80424.1 percent identity 98 in 82
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70267"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70267"
FT                   /db_xref="GOA:Q5SL49"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SL49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70267.1"
FT                   /translation="MREVLILLIRFYRRFLSPLKPRTCRFHPTCSAYALEALERHGAFW
FT                   GSYLAVRRVLRCHPWNPGGLDPVPVLFPPGKVRGGAE"
FT   CDS_pept        complement(417775..418008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0445"
FT                   /product="ribonuclease P protein component"
FT                   /note="similar to GB:AAS80425.1 percent identity 100 in 77
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70268"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70268"
FT                   /db_xref="GOA:Q7X5K6"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7X5K6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70268.1"
FT                   /translation="MKWLPAAELRVGIVVSKKVGKAVVRNKVKRRLREILRRLHLPQAH
FT                   LLVVASPEAREADFAELFRDVVRALRKSGLVQ"
FT   CDS_pept        complement(418113..418262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0446"
FT                   /product="ribosomal protein L34"
FT                   /note="similar to GB:AAO88976.1 percent identity 100 in 49
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70269"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70269"
FT                   /db_xref="GOA:P80340"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="PDB:1VVJ"
FT                   /db_xref="PDB:1VY4"
FT                   /db_xref="PDB:1VY5"
FT                   /db_xref="PDB:1VY6"
FT                   /db_xref="PDB:1VY7"
FT                   /db_xref="PDB:4L47"
FT                   /db_xref="PDB:4L71"
FT                   /db_xref="PDB:4LEL"
FT                   /db_xref="PDB:4LFZ"
FT                   /db_xref="PDB:4LNT"
FT                   /db_xref="PDB:4LSK"
FT                   /db_xref="PDB:4LT8"
FT                   /db_xref="PDB:4P6F"
FT                   /db_xref="PDB:4P70"
FT                   /db_xref="PDB:4TUA"
FT                   /db_xref="PDB:4TUB"
FT                   /db_xref="PDB:4TUC"
FT                   /db_xref="PDB:4TUD"
FT                   /db_xref="PDB:4TUE"
FT                   /db_xref="PDB:4V4I"
FT                   /db_xref="PDB:4V4J"
FT                   /db_xref="PDB:4V4X"
FT                   /db_xref="PDB:4V4Y"
FT                   /db_xref="PDB:4V4Z"
FT                   /db_xref="PDB:4V51"
FT                   /db_xref="PDB:4V5A"
FT                   /db_xref="PDB:4V5C"
FT                   /db_xref="PDB:4V5D"
FT                   /db_xref="PDB:4V5E"
FT                   /db_xref="PDB:4V5F"
FT                   /db_xref="PDB:4V5G"
FT                   /db_xref="PDB:4V5J"
FT                   /db_xref="PDB:4V5K"
FT                   /db_xref="PDB:4V5L"
FT                   /db_xref="PDB:4V5M"
FT                   /db_xref="PDB:4V5N"
FT                   /db_xref="PDB:4V5P"
FT                   /db_xref="PDB:4V5Q"
FT                   /db_xref="PDB:4V5R"
FT                   /db_xref="PDB:4V5S"
FT                   /db_xref="PDB:4V63"
FT                   /db_xref="PDB:4V67"
FT                   /db_xref="PDB:4V68"
FT                   /db_xref="PDB:4V6A"
FT                   /db_xref="PDB:4V6F"
FT                   /db_xref="PDB:4V6G"
FT                   /db_xref="PDB:4V7J"
FT                   /db_xref="PDB:4V7K"
FT                   /db_xref="PDB:4V7L"
FT                   /db_xref="PDB:4V7M"
FT                   /db_xref="PDB:4V7P"
FT                   /db_xref="PDB:4V7W"
FT                   /db_xref="PDB:4V7X"
FT                   /db_xref="PDB:4V7Y"
FT                   /db_xref="PDB:4V7Z"
FT                   /db_xref="PDB:4V83"
FT                   /db_xref="PDB:4V84"
FT                   /db_xref="PDB:4V87"
FT                   /db_xref="PDB:4V8A"
FT                   /db_xref="PDB:4V8B"
FT                   /db_xref="PDB:4V8C"
FT                   /db_xref="PDB:4V8D"
FT                   /db_xref="PDB:4V8E"
FT                   /db_xref="PDB:4V8F"
FT                   /db_xref="PDB:4V8G"
FT                   /db_xref="PDB:4V8H"
FT                   /db_xref="PDB:4V8I"
FT                   /db_xref="PDB:4V8J"
FT                   /db_xref="PDB:4V8N"
FT                   /db_xref="PDB:4V8O"
FT                   /db_xref="PDB:4V8Q"
FT                   /db_xref="PDB:4V8U"
FT                   /db_xref="PDB:4V8X"
FT                   /db_xref="PDB:4V90"
FT                   /db_xref="PDB:4V95"
FT                   /db_xref="PDB:4V97"
FT                   /db_xref="PDB:4V9A"
FT                   /db_xref="PDB:4V9B"
FT                   /db_xref="PDB:4V9H"
FT                   /db_xref="PDB:4V9I"
FT                   /db_xref="PDB:4V9J"
FT                   /db_xref="PDB:4V9K"
FT                   /db_xref="PDB:4V9L"
FT                   /db_xref="PDB:4V9M"
FT                   /db_xref="PDB:4V9N"
FT                   /db_xref="PDB:4V9Q"
FT                   /db_xref="PDB:4V9R"
FT                   /db_xref="PDB:4V9S"
FT                   /db_xref="PDB:4W29"
FT                   /db_xref="PDB:4W2E"
FT                   /db_xref="PDB:4W2F"
FT                   /db_xref="PDB:4W2G"
FT                   /db_xref="PDB:4W2H"
FT                   /db_xref="PDB:4W2I"
FT                   /db_xref="PDB:4W4G"
FT                   /db_xref="PDB:4WPO"
FT                   /db_xref="PDB:4WQ1"
FT                   /db_xref="PDB:4WQF"
FT                   /db_xref="PDB:4WQR"
FT                   /db_xref="PDB:4WQU"
FT                   /db_xref="PDB:4WQY"
FT                   /db_xref="PDB:4WR6"
FT                   /db_xref="PDB:4WRA"
FT                   /db_xref="PDB:4WRO"
FT                   /db_xref="PDB:4WSD"
FT                   /db_xref="PDB:4WSM"
FT                   /db_xref="PDB:4WT1"
FT                   /db_xref="PDB:4WT8"
FT                   /db_xref="PDB:4WU1"
FT                   /db_xref="PDB:4WZD"
FT                   /db_xref="PDB:4WZO"
FT                   /db_xref="PDB:4XEJ"
FT                   /db_xref="PDB:4Y4O"
FT                   /db_xref="PDB:4Y4P"
FT                   /db_xref="PDB:4YPB"
FT                   /db_xref="PDB:4YZV"
FT                   /db_xref="PDB:4Z3S"
FT                   /db_xref="PDB:4Z8C"
FT                   /db_xref="PDB:4ZER"
FT                   /db_xref="PDB:4ZSN"
FT                   /db_xref="PDB:5A9Z"
FT                   /db_xref="PDB:5AA0"
FT                   /db_xref="PDB:5CZP"
FT                   /db_xref="PDB:5D8B"
FT                   /db_xref="PDB:5DFE"
FT                   /db_xref="PDB:5DOX"
FT                   /db_xref="PDB:5DOY"
FT                   /db_xref="PDB:5E7K"
FT                   /db_xref="PDB:5E81"
FT                   /db_xref="PDB:5EL4"
FT                   /db_xref="PDB:5EL5"
FT                   /db_xref="PDB:5EL6"
FT                   /db_xref="PDB:5EL7"
FT                   /db_xref="PDB:5F8K"
FT                   /db_xref="PDB:5FDU"
FT                   /db_xref="PDB:5FDV"
FT                   /db_xref="PDB:5HAU"
FT                   /db_xref="PDB:5HCP"
FT                   /db_xref="PDB:5HCQ"
FT                   /db_xref="PDB:5HCR"
FT                   /db_xref="PDB:5HD1"
FT                   /db_xref="PDB:5IB7"
FT                   /db_xref="PDB:5IB8"
FT                   /db_xref="PDB:5IBB"
FT                   /db_xref="PDB:5IMQ"
FT                   /db_xref="PDB:5IMR"
FT                   /db_xref="PDB:5J30"
FT                   /db_xref="PDB:5J3C"
FT                   /db_xref="PDB:5J4B"
FT                   /db_xref="PDB:5J4C"
FT                   /db_xref="PDB:5J4D"
FT                   /db_xref="PDB:5J8B"
FT                   /db_xref="PDB:5NDJ"
FT                   /db_xref="PDB:5NDK"
FT                   /db_xref="PDB:5OT7"
FT                   /db_xref="PDB:5UQ7"
FT                   /db_xref="PDB:5UQ8"
FT                   /db_xref="PDB:5V8I"
FT                   /db_xref="PDB:5VP2"
FT                   /db_xref="PDB:5VPO"
FT                   /db_xref="PDB:5VPP"
FT                   /db_xref="PDB:5W4K"
FT                   /db_xref="PDB:5WIS"
FT                   /db_xref="PDB:5WIT"
FT                   /db_xref="PDB:5ZLU"
FT                   /db_xref="PDB:6B4V"
FT                   /db_xref="PDB:6BOH"
FT                   /db_xref="PDB:6BUW"
FT                   /db_xref="PDB:6BZ6"
FT                   /db_xref="PDB:6BZ7"
FT                   /db_xref="PDB:6BZ8"
FT                   /db_xref="PDB:6C5L"
FT                   /db_xref="PDB:6CAE"
FT                   /db_xref="PDB:6CFJ"
FT                   /db_xref="PDB:6CFK"
FT                   /db_xref="PDB:6CFL"
FT                   /db_xref="PDB:6CZR"
FT                   /db_xref="PDB:6FKR"
FT                   /db_xref="PDB:6GSJ"
FT                   /db_xref="PDB:6GSK"
FT                   /db_xref="PDB:6GSL"
FT                   /db_xref="PDB:6GZQ"
FT                   /db_xref="PDB:6GZX"
FT                   /db_xref="PDB:6GZZ"
FT                   /db_xref="PDB:6N1D"
FT                   /db_xref="PDB:6N9E"
FT                   /db_xref="PDB:6N9F"
FT                   /db_xref="PDB:6ND5"
FT                   /db_xref="PDB:6ND6"
FT                   /db_xref="PDB:6NDK"
FT                   /db_xref="PDB:6O97"
FT                   /db_xref="PDB:6OF1"
FT                   /db_xref="PDB:6Q95"
FT                   /db_xref="PDB:6QNQ"
FT                   /db_xref="PDB:6QNR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80340"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70269.1"
FT                   /translation="MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPA
FT                   VRKR"
FT   CDS_pept        418427..419188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0447"
FT                   /product="branched-chain amino acid transporter ATP-binding
FT                   protein"
FT                   /note="similar to GB:AAS80426.1 percent identity 99 in 253
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70270"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70270"
FT                   /db_xref="GOA:Q5SL46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70270.1"
FT                   /translation="MAQLDVEGVTLTFGGVAALSGVSMRVEAGELVSIIGPNGAGKTSL
FT                   LNCISGFYHPERGRILFEGQDLTRASPHEVTRKGIARAFQNIELFSGLTVLENLLLARH
FT                   THLSYGLLQAGLFYGRALAEEVRNRRVVEEVIDFMELEPYRKALVGNLPYGVRKRVEVA
FT                   RALALSPKLLLLDEPMAGMTLEEKEDMVRFILEIRARGTTVVLIEHDLGVVMDISDRVY
FT                   VLDFGQVIAEGRPEEVARNPRVQEAYMGVEV"
FT   CDS_pept        419185..421119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0448"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /note="similar to GB:AAS80427.1 percent identity 99 in 644
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70271"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70271"
FT                   /db_xref="GOA:Q5SL45"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70271.1"
FT                   /translation="MKALRPSYEMKRYTLPQLLRLRAEHEGDRVALREKDYGIWNEITY
FT                   AQYYENVLLFAHGLLSLGFGPGERLAVIADNIPEWLYAELGAQAVRGISVGVYQSSLPP
FT                   EIAYMLQYTGASVVLAEDQEQVDKLYEIRSEIPHVRYVIYEDEKGMRGYKDPWLLSFAE
FT                   VLERGREHRRKHPDAVERLLLEASPEEVCHLSSTSGTTGRPKAAMLRHRNLIHMGVALQ
FT                   EVDPLLPTDDYLSFLPLAWIGEQMMSVAMALTGGFAVNFPEEVETALQDLKEIGPHVMF
FT                   SPPRVWEGIQSQVWVRISESPWFNRFVYERLLKVGYRAAEYRMRGRPMPLGLRLAYWFA
FT                   DQVLFKPLRDQLGFLRLRRAYTGGAALGPDVFRFFHAIGVNLKQVYGQTEIIGIAFVHR
FT                   DGDVRHDTVGLPIPGTEVRISEAGEILLRSDAVCAGYWERPEATQETFGDGWLHTGDAG
FT                   YLTEDGHLVVIDRLSDVMRTEKGTVFSPQFLENKLKFSPYIKEAVVFGDRKPYLAAFIN
FT                   IDPQTVGKWAEDRGLAYTTYLDLSLKPEVAELIRKEVEKVNKELPEELRIQRFVLLYKL
FT                   LDADDEELTRTGKVRRGHIAKKYAPLVEALYSGAKEVEVEAEYRYQDGTLQRLRARVPV
FT                   LGFAEEVPA"
FT   CDS_pept        421116..422009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0449"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="similar to GB:AAS80428.1 percent identity 98 in 297
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70272"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70272"
FT                   /db_xref="GOA:Q5SL44"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70272.1"
FT                   /translation="MSFFLQLLFSGVVLGLVYALAALGFVLIYKASRVVNFAQGQFIAI
FT                   GAFLAYWAMVALGAPFLLAAALALALTALLGFGVERVFLKRMVGQPIISVIMATIGLAS
FT                   LLDGLIHLTPFGAGNFSYPAFLPSGGVALLGVQVSYPQLLALGFTLAFLALFTWFFQRS
FT                   TLGIAMRSVADDQMAAMSLGVSVEKVFALAWAAAGLTAAAAGIVVGTIAGLNLDGLVHI
FT                   GLKVFPVVILGGLDSIPGAVVAGILIGVLENLAAGYLDPFVPGGGTRDVFPFLVLLLVL
FT                   WFKPHGLFGTEEIERV"
FT   CDS_pept        422006..423073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0450"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="similar to GB:AAS80429.1 percent identity 87 in 271
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70273"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70273"
FT                   /db_xref="GOA:Q5SL43"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70273.1"
FT                   /translation="MRNPWAQTGNYRTRYEQDASIFATHRELASLLLFLGFLLVLPQFL
FT                   SRTQVFILDLILVYSIAVLGLNITTGYAGLINIGQAAFMGVGAYTAALLAPAGLPFYLV
FT                   LPAAGLAGAFFGYLVGIPSLRVKHLYLAMATLAFQVVFEWTVGHLPLLNQGGAMPLPRV
FT                   SLLGYEVGFRNHYHFWYYVSFAVLVLLALFFRNLLRTKYGRALVAVRDNDRAADAMGMD
FT                   PGRTKLFAFALGAFYAGVAGALYAYLSRAVVIEDYTFSVSIKLLAMAIVGGLGTLVGSF
FT                   LGPAFLELLDVNMEALSNLIKALGFSVAGVDVASALRPLAFGLVIVLFLVFEPRGLYNW
FT                   WRVMRSYFRTWPFRY"
FT   CDS_pept        423086..424309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0451"
FT                   /product="probable branched-chain amino acid ABC
FT                   transporter, amno acid binding protein"
FT                   /note="similar to GB:AAS80430.1 percent identity 98 in 398
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70274"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70274"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:3LKB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70274.1"
FT                   /translation="MGLAKGGKRMRRTLAGIAAVLGLALGQQQVTLFWSGAITGPTSDA
FT                   GAPYGAAVEDYCKWANERKLVPGVVFNCVVRDDQYNNANTQRFFEEAVDRFKIPVFLSY
FT                   ATGANLQLKPLIQELRIPTIPASMHIELIDPPNNDYIFLPTTSYSEQVVALLEYIAREK
FT                   KGAKVALVVHPSPFGRAPVEDARKAARELGLQIVDVQEVGSGNLDNTALLKRFEQAGVE
FT                   YVVHQNVAGPVANILKDAKRLGLKMRHLGAHYTGGPDLIALAGDAAEGFLWATSFYMAH
FT                   EDTPGIRLQKEIGRKYGRPENFIESVNYTNGMLVASIAVEAIRRAQERFKRITNETVYQ
FT                   AIVGMNGPNAFKPGFAVSTKQGVEIDFTKSEHTGAEGLRILEAKGGRFVPVTEPFTSAL
FT                   FRKVHYGK"
FT   CDS_pept        424354..425187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0452"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="similar to GB:AAS80431.1 percent identity 99 in 277
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70275"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70275"
FT                   /db_xref="GOA:Q5SL41"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70275.1"
FT                   /translation="MDALNPIRPEDLGPILLLVNNIEVVYHDVIQVLRGVSLKVPEGRI
FT                   TALLGPNGAGKTTTLRAISGLLIPEDGEVVRGEILFRGTPIQGRPPEEIVKLGIVQVLE
FT                   GRRVFKHLTVEENLKVGTLTRRGVNLKEELDRIYHYFPRLAELRHRLAGYCSGGEQQMI
FT                   AIGRALLAKPRLLLLDEPSLGLAPLLVREIFDIVARVNAEEGVTVLVVEQNARVALSIA
FT                   HYGYIMESGRIVLEGDRAYLLENPDVQEFYLGVAKEGGRKSFKEVKAYKRRKRFM"
FT   CDS_pept        425254..425994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0453"
FT                   /product="Mn2+/Zn2+ ABC transporter, ATP-binding protein"
FT                   /note="similar to GB:AAS80432.1 percent identity 99 in 246
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70276"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70276"
FT                   /db_xref="GOA:Q5SL40"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70276.1"
FT                   /translation="MWAVETQGLAVRFGQYQALEDVSLRVPEGSFVAVVGPNGAGKSTL
FT                   LKALLGLVPFRGEVRIFGRPLGQADPFWFGYVPQIKTFDRTFPALALELVVSGLRRAWP
FT                   FRVGEEERRRALEALGRVGALELAHRPLGRLSGGQLQRVYLARALVRRPRLLLLDEPAT
FT                   GVDRLGEVDLYRHLEAYQEETGATILMITHDWEAAHHASHVLVLNRRVIGFGPPERALS
FT                   EECLRQAFGHLGHEHALFLGGGRA"
FT   CDS_pept        425987..426793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0454"
FT                   /product="Mn2+/Zn2+ ABC transporter, permease protein"
FT                   /note="similar to GB:AAS80433.1 percent identity 99 in 268
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70277"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70277"
FT                   /db_xref="GOA:Q5SL39"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70277.1"
FT                   /translation="MLEALGYPFFQRALLAGLLVSLLGGALSAFVVQRRLSFLGDGLAH
FT                   AAFAGVALGLFLREEPLYLALPFTLAVALAITYVKERSGLSEDTAIGVFFALSVALGAV
FT                   FLAKARGYVGDAMGYLFGSLLAVGPGDLWAVGGVVLLGLALLPLWGALAYATFDRELAL
FT                   ADRVPVGLHDYLLSAYLALALVVAVKVVGVLLVAAFLVIPGAAARLLGRTFAGMTLLAL
FT                   LFALSATLLGLYASFLLDWPSGASVVLAQALLFGLAFLKTAFSGGK"
FT   CDS_pept        426818..427267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0455"
FT                   /product="rrf2 family protein, transcriptional regulator"
FT                   /note="similar to GB:AAS80434.1 percent identity 100 in 149
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70278"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70278"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70278.1"
FT                   /translation="MWVSTKAQYGLRALVEIGLRAPRAVPLKEVAEAQGISQHYLEQIA
FT                   AQLRNAGFIRSVRGAKGGYRLARPPEKVTALEVVEALEGSLAPVSCLEDPESCDKVGRC
FT                   STELLWRRVDLAMRQVLGGTTLKDLIEERRLLEARGVIPLEARVS"
FT   CDS_pept        427283..428407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0456"
FT                   /product="cysteine desulfurase/cysteine sulfinate
FT                   desulfinase"
FT                   /note="similar to GB:AAS80435.1 percent identity 98 in 374
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70279"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70279"
FT                   /db_xref="GOA:Q5SL37"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70279.1"
FT                   /translation="MRGVYLDYAATTPLDPEVREAMRAVEEVFGNPSSIHRFGQEARKV
FT                   LEEARERVAEALGARPREVVFTAGGSEADALALLGPALARGRGHVVSTAVEHAAVLGAL
FT                   RLLERLGFAVTLLKPDSLGMVYPEQVEEALRPDTFLVSVMTANNELGNLYPVREIAEVA
FT                   HRHGALFHTDAVQAVGQVPFRMDEVGADLVSLSAHKFYGPKGVGALLVRQGVELMAVVP
FT                   GKQEGGRRGGTQSPVLAHGMAVALELALKRLPEEAARLAALRRRLEAGLLAVEGVELNG
FT                   HPERRLPKLVNVTVKGADGEALLLAMDLLGVAVSSGSACSAGNLEPSHVLLAIGRSYAE
FT                   AKASLRFSLGRFTTEEEVDRAVAVFREAVARARA"
FT   CDS_pept        428440..429723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0457"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="similar to GB:AAS80436.1 percent identity 99 in 427
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70280"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70280"
FT                   /db_xref="GOA:Q5SL36"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SL36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70280.1"
FT                   /translation="MDAFRLAPCGPLRGRLRVPGDKSVTHRGLMLLALAEGEGRLFYPL
FT                   KAGDTLSTARVLQALGAEVREEGPHFLVRGRGLRFQEPEDVLDCGNAGTLMRLLLGLLA
FT                   GQEGLFAVLTGDASLRRRPMGRVVAPLRAMGARVDGREEGERAPLAVRGAPLRGLRYTL
FT                   PVPSAQVKSALLLAGLFAEGVTEVEEPTPTRDHTERLFRHFGLPLEVEGRKVRTWRTGP
FT                   FPAKDLVVPGDFSSAAFFLVAALVTPGSEVVVEGVGLNPTRTGLLTVLKAMGADLEWQV
FT                   LEGEAGEPVGWVRARHSLLKGVAVDPGLIPLMVDEVPVLAAAAAWAEGETYIPGLSELR
FT                   VKESDRVRAIAENLRALGVEVEEGPDWLRIRGGGVRPGRVRPFHDHRIAMAFAVAGLPV
FT                   GVEVEEPHWAEISYPGFFQDLLRLCAAS"
FT   CDS_pept        429708..430334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0458"
FT                   /product="cytidylate kinase"
FT                   /note="similar to GB:AAS80437.1 percent identity 99 in 208
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70281"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70281"
FT                   /db_xref="GOA:Q5SL35"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:3AKC"
FT                   /db_xref="PDB:3AKD"
FT                   /db_xref="PDB:3AKE"
FT                   /db_xref="PDB:3W8N"
FT                   /db_xref="PDB:3W90"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SL35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70281.1"
FT                   /translation="MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLAL
FT                   RAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLP
FT                   GVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRARERPQAYEE
FT                   VLRDLLRRDERDKAQSAPAPDALVLDTGGMTLDEVVAWVLAHIRR"
FT   CDS_pept        430338..431111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0459"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80438.1 percent identity 93 in 257
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70282"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70282"
FT                   /db_xref="GOA:Q5SL34"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70282.1"
FT                   /translation="MVPGAKERPVQEFLNALLFRPLAHLVVLLLLRTPVRPHHLVLFHT
FT                   GLVLGAAWLLLRGEDLGAALLLQLKTVLDNADGQLARLRGEVTEFGRYLDTGMDFLGNL
FT                   ALFLALGLRTGFLEKALLAFLVFTLVQSYDFNLERLYRLSRGLPLPEGPRDPETPWLRL
FT                   FRGLYALLFAPQDRAIVALERFLQGRLRLDPSRFWDEGALAGVVNLGLTTQLFFLGVFL
FT                   LFHEPGAYLTFVLLQAVYLGLWYLWRIARSIPSPR"
FT   CDS_pept        431075..431485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0460"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to GB:AAS80439.1 percent identity 100 in 136
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70283"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70283"
FT                   /db_xref="GOA:Q5SL33"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70283.1"
FT                   /translation="MEDRPQYPIPTVGALAEKEGLVLLVRTAKWRGLWGVPGGKVAWGE
FT                   ALEEALRREFREEVGLALSQVRFALVQEAIFSPEFYKPTHMLLFNYFARAEGEVRPNEE
FT                   ILEWAWVEPEKGLAYPLNAFTRALLVRYLEGR"
FT   CDS_pept        431482..432186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0461"
FT                   /product="dihydropteridine/dihydrofolate reductase"
FT                   /note="similar to GB:AAS80440.1 percent identity 100 in 234
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70284"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70284"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70284.1"
FT                   /translation="MRTALVTGSAKGIGRAILLALAREGYAVAVHYRTSEALAEATRQE
FT                   AEALGVKAIKVRADLTREEEVDRLVEEVRYHLGGVGVLVNNVGDYLYKPIEEVSLEEWR
FT                   WILDTNLTATFLLTQRVLPLMVAQGFGRIVNLGYAGAGNLLARTHITPYVIAKTGVILY
FT                   TKAIAKRFAASGITANVVAPGVAENSVSKPLHEIPMGRLALLQEIAQAVLFFVREPYLT
FT                   GQVLEVAGGWNL"
FT   tRNA            complement(432252..432327)
FT                   /gene="tRNA-Met-3"
FT                   /product="tRNA-Met"
FT                   /note="anticodon: CAT"
FT   CDS_pept        432397..432588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80441.1 percent identity 100 in 63
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70285"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70285"
FT                   /db_xref="GOA:Q5SL31"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70285.1"
FT                   /translation="MPVNESTTDRVIRFLLSLVLFYFAFQSAAPWNWILGIVAAVLLFT
FT                   AITGFCGLYRVLGISTKR"
FT   CDS_pept        432585..433115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80442.1 percent identity 98 in 176
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70286"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70286"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70286.1"
FT                   /translation="MSPAWPLRPGQKVRVEFYKYPEEALHYFWEAEVVEVRPEGVLTLL
FT                   PQGGVFHHVGKGRSLVLDHDAYVAFFPGAWYSGGPDVREGRVLEYYWNVQTPALWTGEA
FT                   FRQYDLELDVKCRADHTCEVFDREEFLAKRPLYPRAWVEEAERAVEAVFRHMREGRWPV
FT                   LPPGKPLPWMERI"
FT   CDS_pept        complement(433112..434122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0464"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAH72618.1 percent identity 38 in 97
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70287"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70287"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70287.1"
FT                   /translation="MRLAPRVLGLWVAALLLGALPVPPGPPPSPSLRSLLPYPPEKREA
FT                   LVARHLANKASLHLLFGEKAARAYDRLLRLELANQQSGKRSAFATAEEALEAAHRFLLA
FT                   IGQAVRKAPVNLEGLPMAPRHVLPHAREIRAAAHALGLPPGVLAAIVDNEQHGGDKALG
FT                   LSRGVREVADGVALTLGEAPFSRTLGLAQMSWEDALKQEARLRRFGAWDPLRPFPHTEA
FT                   EARRALLDPYLNLLFTASRLRGYFNALLSLPPEDTRPLEDPWLYYLGPAWHNYPLRAQN
FT                   LETWDDSFNGFFKGLLYQAVLEGYWTLQGRRLLPLKPLGPGSLEAPSPPVPHLFP"
FT   CDS_pept        complement(434151..435158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0465"
FT                   /product="thioredoxin reductase"
FT                   /note="similar to GB:AAS80444.1 percent identity 99 in 335
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70288"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70288"
FT                   /db_xref="GOA:Q5SL28"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:2ZBW"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SL28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70288.1"
FT                   /translation="MAADHTDVLIVGAGPTGLFAGFYVGMRGLSFRFVDPLPEPGGQLT
FT                   ALYPEKYIYDVAGFPKVYAKDLVKGLVEQVAPFNPVYSLGERAETLEREGDLFKVTTSQ
FT                   GNAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKAEFQGKRVLIVGGGDS
FT                   AVDWALNLLDTARRITLIHRRPQFRAHEASVKELMKAHEEGRLEVLTPYELRRVEGDER
FT                   VRWAVVFHNQTQEELALEVDAVLILAGYITKLGPLANWGLALEKNKIKVDTTMATSIPG
FT                   VYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYANPALKVNPGHSSEKAAPGT"
FT   CDS_pept        complement(435191..436222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0466"
FT                   /product="alcohol dehydrogenase"
FT                   /note="similar to GB:AAS80445.1 percent identity 99 in 343
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70289"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70289"
FT                   /db_xref="GOA:Q5SL27"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:2EIH"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70289.1"
FT                   /translation="MRAVVMRARGGPEVLEVADLPVPEPGPKEVRVRLKAAALNHLDVW
FT                   VRKGVASPKLPLPHVLGADGSGVVDAVGPGVEGFAPGDEVVINPGLSCGRCERCLAGED
FT                   NLCPRYQILGEHRHGTYAEYVVLPEANLAPKPKNLSFEEAAAIPLTFLTAWQMVVDKLG
FT                   VRPGDDVLVMAAGSGVSVAAIQIAKLFGARVIATAGSEDKLRRAKALGADETVNYTHPD
FT                   WPKEVRRLTGGKGADKVVDHTGALYFEGVIKATANGGRIAIAGASSGYEGTLPFAHVFY
FT                   RQLSILGSTMASKSRLFPILRFVEEGKLKPVVGQVLPLEAAAEGHRLLEERRVFGKVVL
FT                   QVG"
FT   CDS_pept        complement(436289..436717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0467"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS81959.1 percent identity 100 in 142
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70290"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70290"
FT                   /db_xref="GOA:Q5SL26"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70290.1"
FT                   /translation="MWPWGGVVGEGYAPDPRLGGEVLRRFPPSRGWLLADAGFDGKEVW
FT                   GVLGEAGVRPVIRLRGGGEAREEARVRAREGWDPEVYRFRGVVEGVFGGMKTRLGGGYL
FT                   WERKPWTAMARALLELIAYGLRVLLSLLPPPPGYKAIY"
FT   CDS_pept        complement(436731..437261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0468"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80749.1 percent identity 90 in 134
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70291"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70291.1"
FT                   /translation="MGKRGFLRREASPKEVLEHCLRLAREVAPPTPKGKRGRPWRYSHA
FT                   LYLALLLFRAFFHLTYRETEASLQDLMEGPFPSHQSLARYALKHLDPKLLEALLERLSR
FT                   ELEAHLAPESSPEGEAASDEAPAHLAALSPPLPHGHHGAGLPEQGPASPLSSGEGGAAG
FT                   AGARAASGPDAVG"
FT   CDS_pept        437374..439119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0469"
FT                   /product="peptide ABC transporter, periplasmic
FT                   peptide-binding protein"
FT                   /note="similar to GB:AAS80446.1 percent identity 97 in 582
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70292"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70292"
FT                   /db_xref="GOA:Q5SL24"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70292.1"
FT                   /translation="MRKAVLLVGILALAGVASAQTFVWPQKWTVAKPSEAKRGGTLRGY
FT                   TISDYRTFNPFLTAEANSIPDLINPYGLVRRDPTTGDWIPYMAESWTISPNKLEITFKI
FT                   RKGMKWSDGRPITADDWIMTWRIHTDKAVGSNSYDSFFIDGKPIVLRKLDDYTIRFIYP
FT                   KTDAEAFAIASFAPWPAHVFGPVYQKEGAEGIKKMWTLNEDPAKIVSAGPWVVESYRPG
FT                   ERVVLKRNPSFGEWNKDEAGNPLPYLDRYEIRIVKDVNAALAEFLAGNIDIFNPSTVDQ
FT                   ISQIRQAVQQGRLDATIKVNASPVASSQFMVFNWNKASDPFKQSLFRSDKFRRAMSHLV
FT                   NRQAVIDIVYGGLGIPMYSSVYPVLTQWINPKVPKYEYDPKQAAKLLAELGFTKKDREG
FT                   YLVDSKGRRIEFNLATNAGNTQREQIAKLIVDEAKKVGVKVNFQAIDFNTLVGQLLSSG
FT                   PDRPFDAIIIGLTGGGLDWPFGSNVVPCKGNLHMWNKSGQCLDPRETLMEKLYYQGRTE
FT                   LDFKKRVEIGYRMQEVEAELLPVIYIAGPNYHPAWNNRLGGEHPDAIISSIWGSREVEL
FT                   TFIKK"
FT   CDS_pept        439161..440159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0470"
FT                   /product="peptide ABC transporter, permease protein"
FT                   /note="similar to GB:AAS80447.1 percent identity 100 in 332
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70293"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70293"
FT                   /db_xref="GOA:Q5SL23"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70293.1"
FT                   /translation="MSWKAMASYILKRILSLIPTFFGATFLAFLIIQMAPGDYLTQLEL
FT                   DPKVTPETIARLRAQFGLDRPFHEQYLLWMHNLLHLNLGYSFAYQAPVLEIVWPRVLNS
FT                   MVLVVPSTVLLFLIAVPVGVYGALRQYSLGDRVVSFLAYLGLAIPNFFLALILMYLVLQ
FT                   VYFRTGVMVFPVSGMTSSGFEQFSFWQKVVDVAWHAVLPIVVLTTSDIAGFSRIMRGQM
FT                   LEALSQDYVRTARAKGLPERVVVYKHALRNAIIPIVANIGGILPTLISGAGLVEVVTAW
FT                   PGITPLLLDAISQQDLYVVAGFLTMGLVLLMIGNLLSDLLLAWVDPRIRYE"
FT   CDS_pept        440167..441513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0471"
FT                   /product="peptide ABC transporter, permease protein"
FT                   /note="similar to GB:AAS80448.1 percent identity 100 in 448
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70294"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70294"
FT                   /db_xref="GOA:Q5SL22"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70294.1"
FT                   /translation="MDALAPKSESLFQVAWAQFRRHRLAVWGGRILLVLYFVAAFAGFF
FT                   SPYDPNYYELYPPKGHHPPTRIHFVDPETGRLSRPFVYATRRTIDPVSLQPRYEEDPSQ
FT                   GKFYIRFFVRTPDQPYTIFRVFRADLRLFGVDPPGRIFLMGTDNFGRDLFSRLVYGAQV
FT                   SLTIGILSALVSFALGLLLGGIAGFYAGRPFVLALPLRAWRGRGLVLGPLSWLLWGGLA
FT                   AGALYLAWTYIRLTGFGFFQALALLAALWLAGFLVLTLPFRPIQVDVDNLIMRLVEVIA
FT                   AIPTLFLLISLRAVFPANVDPLTTFYLVVGLLGFIGWGGLARVVRGVVLSVREQDYVQA
FT                   ARALGASDGRILARHVLPATASYVIVSLSLTIPGFILAESGLSFLGLGVTEPYTSWGLL
FT                   LQAAQQGGFASFVDRPWVLWPGFFIFVSIMAWNFVGDGLRDAFDPRRRQ"
FT   CDS_pept        441587..442609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0472"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /note="similar to GB:AAS80449.1 percent identity 99 in 340
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70295"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70295"
FT                   /db_xref="GOA:Q5SL21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70295.1"
FT                   /translation="MDEKRLLEVKDLKVHFFTDDGVVKAVDGVSFHVNKGETLAVVGES
FT                   GSGKSVTSLAIMRLIPSPPGRIVGGEILFRGKDGKVRDLTKLSEAEMRRIRGNDIAMIF
FT                   QEPMTSLNPVYTVGDQIAEAIMLHQGKSRKEAMELAAHMLELVGIPEPKKRLSNYPHQM
FT                   SGGMRQRVMIAMALSCNPSLLIADEPTTALDVTIQAQILELMKKLQEEIGMSILFITHN
FT                   LGVVAEMADRVVVMYAGRAVEESDVVPLFQNPLHPYTEGLLHSVPRLDLAAEHRQRLEA
FT                   IPGNVPNPLYLPPGCAFHPRCKYYVEGVCDREVPPLEEAGEGRRVRCVRWREIRKGVGA
FT                   "
FT   CDS_pept        442606..443589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0473"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /note="similar to GB:AAS80450.1 percent identity 99 in 327
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70296"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70296"
FT                   /db_xref="GOA:Q5SL20"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70296.1"
FT                   /translation="MSTNGVLVEVRDLKKHFPIRGGVLSRVVASVKAVDGVSFAIRRGE
FT                   VLGLVGESGSGKTTVGRTLLRLIEPTGGRIFFDGQDITELPREKLRPFRRRMQIIFQDP
FT                   FSSLNPRMTVGDIIAEPLLIHGIGKTPKERTERVAELLKLVGLSPDHMRRYPHEFSGGQ
FT                   RQRIGIARALAVAPEFIVADEPVSALDVSIQAQVVNLLQDLKEELGLTLLFIAHDLAVV
FT                   EYISDRVAVMYLGKVMELAPARELYRNPKHPYTEALLSAVPIPDPTVKRERIVLQGDIP
FT                   SPINPPSGCVFRTRCRYALPECAQVVPELKEVAPGHYKACIRDDIL"
FT   CDS_pept        443648..444274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0474"
FT                   /product="acetoin utilization protein AcuB (acetoin
FT                   dehydrogenase)"
FT                   /note="similar to GB:AAS80451.1 percent identity 100 in 208
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70297"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70297"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70297.1"
FT                   /translation="MLVRDVMKSPVLTVGPEATLEEAYKLLLERGIRHLPVVEEGRLVG
FT                   IVTDRDIRLATSHLNPKGPCPGCTRVGEVMTREVVTAHPLDPVEEAARVMRERKIGCLP
FT                   VLEDEALVGIVTGIDLLDALLRLTGVTEPSGRLEVRLPDRPGELARLTGFLAGRGVNIH
FT                   SLLSYPEGREFVRAVVRVNTLETHLLAEALRREGFDVLWPPKKPW"
FT   CDS_pept        444268..445392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0475"
FT                   /product="acetoin utilization protein AcuC (putative
FT                   T-histone deacetylase)"
FT                   /note="similar to GB:AAP04525.1 percent identity 99 in 375
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70298"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70298"
FT                   /db_xref="GOA:Q5SL18"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003085"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70298.1"
FT                   /translation="MVIYREEYRLYNFGPDHPFSPVRLEMLTSLLQALGVWRAPLSPPE
FT                   ASREEVLSVHSERLVKRVEAASRGELYPDLEHYLGTGDTPVFPGMDRAARILVGGTLEG
FT                   ARRIMAGEKRVLQLGGGLHHAQYDRASGFCVYNDLSVAIRHMTQVGLRVAYVDIDVHHG
FT                   DGVQWIHYEEGEVLTLSLHESGRYLFPGTGHVYEIGRGAGLGKKLNLPLEPFTEDESYL
FT                   EVFEALVPWALKAFRPDVLVVQAGADAHYLDPLADLLLTARAYERLFRLLLEYAEAYAG
FT                   GRVLFTLGGGYSLDGTVRVWALLYHLFHGLPLPERLPEGWLRTWEARLGRPLTPTLHDP
FT                   EGAYPEIPRREEIAKRNRLTLQRLTELVAPHLLH"
FT   CDS_pept        445397..445594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80453.1 percent identity 98 in 65
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70299"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70299"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70299.1"
FT                   /translation="MRVVLRLPERKEVEVKGNRPLREVLEELGLNPETVVAVRGEELLT
FT                   LEDEVREEDTLEVLSAISGG"
FT   CDS_pept        445596..446558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0477"
FT                   /product="probable ATP pyrophosphatase, PP-loop
FT                   superfamily"
FT                   /note="similar to GB:AAS80454.1 percent identity 96 in 319
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70300"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70300"
FT                   /db_xref="GOA:Q5SL16"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70300.1"
FT                   /translation="MVCKVCGQKAQVEMRSRGLALCREHYLDWFVKETERAIRRHRMLL
FT                   PGERVLVAVSGGKDSLALWDVLSRLGYQAVGLHIELGIGEYSKRSLEVTQAFARERGLE
FT                   LLVVDLKEAYGFGVPELARLSGRVACSACGLSKRYIINQVAVEEGFRVVATGHNLDDEA
FT                   AVLFGNLLNPQEETLSRQGPVLPEKPGLAARVKPFYRFSEREVLSYTLLRGIRYLHEEC
FT                   PNAKGAKSLLYKEALNLVERSMPGAKLRFLEGFLEKIRPRLDVGEEVALRECERCGYPT
FT                   TGAVCAFCRMWDAVYRRAKKRRLLPEEAVFHPKAPVARG"
FT   CDS_pept        complement(446574..449471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0478"
FT                   /product="trehalose synthase"
FT                   /note="similar to GB:AAQ16097.1 percent identity 99 in 965
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70301"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70301"
FT                   /db_xref="GOA:Q5SL15"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70301.1"
FT                   /translation="MDPLWYKDAVIYQLHVRSFFDANNDGYGDFEGLRRKLPYLEELGV
FT                   NTLWLMPFFQSPLRDDGYDISDYYQILPVHGTLEDFKRFLDEAHGRGMKVIIELVLNHT
FT                   SIDHPWFQEARKPNSPMRDWYVWSDTPEKYKGVRVIFKDFETSNWTFDPVAKAYYWHRF
FT                   YWHQPDLNWDNPEVEKAIHQVMFFWADLGVDGFRLDAIPYLYEREGTSCENLPETIEAV
FT                   KRLRKALEERYGPGKILLAEANMWPEETLPYFGDGDGVHMAYNFPLMPRIFMALRREDR
FT                   GPIETMLKETEGIPETAQWALFLRNHDELTLEKVTEEEREFMYEAYAPDPKFRINLGIR
FT                   RRLMPLLGGDRRRYELLTALLLTLKGTPIVYYGDEIGMGDNPFLGDRNGVRTPMQWSQD
FT                   RNAGFSRAPYHALFLPPVSEGPYSYHFVNVEAQRENPHSLLSFNRRFLALRNQHAKIFG
FT                   RGSLTLLPVENRRVLAYLREHEGERVLVVANLSRYTQAFDLPLEAYQGLVPVELFSQQP
FT                   FPPVEGRYRLTLGPHGFALFALKPVEAVLHLPSPDWAEEPAPEEADLPRVHMPGGPEVL
FT                   LVDTLVHERGREELLNALAQTLKEKSWLALKPQKVALLDALRFQKDPPLYLTLLQLENH
FT                   RTLQVFLPLLWSPQRREGPGLFARTHGQPGHFYELSLDPGFYRLLLARLKEGFEGRSLR
FT                   AYYRGRHPGPVPEAVDLLRPGLAAGEGVWVQLGLVQDGGLDRTERVLPRLDLPWVLRPE
FT                   GGLFWERGASRRVLALTGSLPPGRPQDLFAALEVRLLESLPRLRGHAPGTPGLLPGALH
FT                   ETEALVRLLGVRLALLHRALGEVEGVEGGHPLLGRGLGAFLELEGEVYLVALGAEKRGT
FT                   VEEDLARLAYDVERAVHLALEALEAELWAFAEEVADYLHAAFLQAYRSALPEEALEEAG
FT                   WTRHMAEVAAEHLHREERPARKRIHERWQAKAGKA"
FT   CDS_pept        complement(449475..450179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0479"
FT                   /product="trehalose-6-phosphate phosphatase"
FT                   /note="similar to GB:AAQ16096.1 percent identity 100 in 234
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70302"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70302"
FT                   /db_xref="GOA:Q5SL14"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70302.1"
FT                   /translation="MRAENPVFFLDYDGTLAPIAQRPEEAFPHPEAPRVLRALMERHPV
FT                   YVVTGRRVRDLEPLLPLPGLPVVGGHGLEEGVLFGEVRPLFPVDLGPLRARLPSCPGVR
FT                   VEDKGFALALHYRGAEDEEKARACLEAWLKAVEGLLEALGLEALPGKKVLELKPKGVDK
FT                   GQAVLRLLGRHPDHTPVYIGDDTTDEAAFLALRGRGLTFKVGEGPTAAQGRLKDVEEVL
FT                   AYLQTYLRPTSL"
FT   CDS_pept        complement(450176..450460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0480"
FT                   /product="trehalose-phosphate synthase related protein"
FT                   /note="similar to GB:AAQ16095.1 percent identity 98 in 71
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70303"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70303"
FT                   /db_xref="GOA:Q5SL13"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70303.1"
FT                   /translation="MPRSLPSPSTTGRGRGVSLKKGRVLSNLAGAAEYLKEALLVNPYD
FT                   LDGMAQALDRALRMPGGERRERLAALKARIEALDVQGWAERFLASLEEG"
FT   CDS_pept        450566..452155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0481"
FT                   /product="oligo-1,6-glucosidase"
FT                   /note="similar to DBJ:BAB18518.1 percent identity 99 in 529
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70304"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70304"
FT                   /db_xref="GOA:Q5SL12"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70304.1"
FT                   /translation="MSWWQRAVIYQVYPRSFQDTNGDGVGDLEGIRRRLPYLKSLGVDA
FT                   LWLSPFYKSPMKDFGYDVADYCDVDPVFGTLQDFDRLLEEAHALGLKVLVDLVPNHTSS
FT                   EHPWFLESRASRNSPKRDWYIWKDPAPDGGPPNNWQSFFGGPAWTLDEATGQYYLHLFL
FT                   PEQPDLNWRNPEVREAIKEVMRFWLRRGVDGFRVDVLWLLGKDPLFRDEPGSPLWRPGL
FT                   PDRARHEHLYTEDQPETYAYVREMRQVLDEFSEPGRERVMVGEIYLPLPRLVRYYAAGC
FT                   HLPFNFSLVTEGLSDWRPENLARIVETYEGLLSRWDWPNWVLGNHDQPRLASRLGEPQA
FT                   RVAAMLLFTLRGTPTWYYGDELALPNGLIPPEKVQDPAALRQRDREPTAYHTLGRDPER
FT                   TPMPWDASPYGGFSTVEPWLPLNPDYRTRNVAAQEKDPRSMLHLVKRLIALRKDPDLLY
FT                   GAYRTYRAREGVYAYLRGEGWLVALNLTEKEKALELPRGGRVVLSTHLDREERVGERLF
FT                   LRPDEGVAVRLD"
FT   CDS_pept        452160..452798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80456.1 percent identity 95 in 212
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70305"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70305"
FT                   /db_xref="GOA:Q5SL11"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:2GS9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70305.1"
FT                   /translation="MDPFASLAEAYEAWYGTPLGAYVIAEEERALKGLLPPGESLLEVG
FT                   AGTGYWLRRLPYPQKVGVEPSEAMLAVGRRRAPEATWVRAWGEALPFPGESFDVVLLFT
FT                   TLEFVEDVERVLLEARRVLRPGGALVVGVLEALSPWAALYRRLGEKGVLPWAQARFLAR
FT                   EDLKALLGPPEAEGEAVFLAPEAHPPYEEADLAGRRAGNRPALYLGRWR"
FT   CDS_pept        452789..453538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0483"
FT                   /product="probable transcriptional regulator, ArsR family"
FT                   /note="similar to GB:AAS80457.1 percent identity 100 in 249
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70306"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70306"
FT                   /db_xref="GOA:Q5SL10"
FT                   /db_xref="InterPro:IPR011522"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70306.1"
FT                   /translation="MAVKALFALYPLLQGDYRAVEKALLALEESGASYRVFPTHSEVSG
FT                   KEEEVFLTLQRAFQKAAEEGALVMWALLTNACEAGDPFRKEERLRRFPPGEIARKALEG
FT                   LKAKSVLDIGTGTGVFAEAFAALGLFVVGLDPRADRLEVARAKVKGARFVEGRAEALPF
FT                   PDGSFDLAFFGLALHHLDPVPALREASRVARRVAVLEWPYREEEVGPPLGRRFSLEALE
FT                   GLFREALGSPPRFLVAEGYVLALWDKG"
FT   tRNA            complement(453603..453689)
FT                   /gene="tRNA-Leu-5"
FT                   /product="tRNA-Leu"
FT                   /note="anticodon: CAA"
FT   CDS_pept        complement(453668..455098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0484"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="similar to GB:AAS80459.1 percent identity 97 in 234
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70307"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70307"
FT                   /db_xref="GOA:Q5SL09"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70307.1"
FT                   /translation="MKVREDPKAHGPILPPPPSKPGEKEPGSPYGGRVKALALGLLLAL
FT                   TLPPFPLGFLAPFVLAFLLKGGFREGFWAGLGFWGLHLVWLPQSFAQNFGPWGAVPFLP
FT                   LVLVKALSFGLLFALTPNAPMRLGGWVLLEWLTEQGELAFPWGFLGYALVEAPGRILAA
FT                   WGGVYLLSLLVLLVAYGLRARRPWVLLLWALLWLLPLPEAHPEGKALLVQGNINPLRKF
FT                   QGELDEAVYLRLTEAGLRAHPEADLVVWPETAVWRIPQEAEALLQGRPLLTGLNLLGPN
FT                   RAVLYREGKLLGHYDKTRLVPFGERFPFREALGGVYAFFFRAMGLGDLQDRTPGEKVAP
FT                   IGPYGVLICYESVFPSVARGLAREGARVLVLLTNDAWFGPSFGGRQHFALGRLRAVETG
FT                   RWLLRAGNDGITASVDPFGRVVAEIPPHQEGFLLAPYALRTGLTPYARFGDWAVGLALT
FT                   IFLLGLILRVRPPGWRNR"
FT   CDS_pept        455069..455773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0485"
FT                   /product="phosphoesterase-related protein"
FT                   /note="similar to GB:AAS80458.1 percent identity 99 in 476
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70308"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70308"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70308.1"
FT                   /translation="MRLGVLSDLHANLPALEAALEALRAEGVDEVLVLGDLVGYGPHPR
FT                   QVIHRIWEEGLAAIAGAWDLRVAYPLPGPLPEGVGKATLEWTRAQLGEKELAYLRSLRL
FT                   SHRKSYGGMRLVAFHGKPGDPEGRVDLLGPARDLAFFLERYGAEALLLGGSHLPLARRV
FT                   GRGLVADPGSVGLSLTGEHGADAMVLDTETLGARFLKVPYDLGPLLFDLRAWGLPPVLE
FT                   QVYRFGRFPKKG"
FT   CDS_pept        complement(455681..456814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0486"
FT                   /product="probable iron-sulfur protein"
FT                   /note="similar to GB:AAS80460.1 percent identity 98 in 377
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70309"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70309"
FT                   /db_xref="GOA:Q5SL07"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70309.1"
FT                   /translation="MVKDLLEERARELGLLFAWAPLDLPQEAEARHRAWLEAGRHGGMA
FT                   YLEAPERFHPRKRFPWAKSALLLFAPYAYPDPGTPPGGLRVGRVARYAWTRDYHLVLGE
FT                   ALKALEETARGLGLKAKGYVDHGPLPERTLAALSGAGWIGKSGYFLSQAFGVHAFIGVL
FT                   LTPLEVEAAPLHPSRCGRCARCLSACPTEALLGDGTLDARACVSYLTIEHKGPIPPSLW
FT                   PGIGDWLFGCDLCGEACPWERFGKVWKALRPEPELAHPDLLDFFRLSGRAFGRKYAGTA
FT                   FLRAGRARMARNALIVLFNLGLGEALFLEATRDPNPLVRRTALRALHLMGKPLDPFLQD
FT                   PGLREEALALLGEAPEAVHLLQDGREAPGPEVKEQGA"
FT   CDS_pept        complement(456808..457200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80461.1 percent identity 98 in 130
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70310"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70310"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70310.1"
FT                   /translation="MGRRYLLDTHVLIWALTEPERLSPRVRALLEDPDTPLLVSSASAW
FT                   EMATKHRLGKLSGAEAVLEGLEGHLSRLGAEELPIRLAHALLAGRLPGEQRDPFDRILA
FT                   AQSLVEGLVLLTTDRAFPSFGVETLW"
FT   CDS_pept        complement(457179..457409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0488"
FT                   /product="antitoxin of toxin-antitoxin stability system"
FT                   /note="similar to GB:AAS80462.1 percent identity 97 in 76
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70311"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70311"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70311.1"
FT                   /translation="MKAFTVHQAKTHLSRLLKAVEEGEEVVILRGKTPVARLVPYRKGK
FT                   RPLGFVPGKLPESFFEPLPEEELALWEGATS"
FT   CDS_pept        457462..458460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0489"
FT                   /product="homoserine dehydrogenase"
FT                   /note="similar to GB:AAS80463.1 percent identity 100 in 332
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70312"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70312"
FT                   /db_xref="GOA:Q5SL04"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:2EJW"
FT                   /db_xref="PDB:5XDF"
FT                   /db_xref="PDB:6A0R"
FT                   /db_xref="PDB:6A0S"
FT                   /db_xref="PDB:6A0T"
FT                   /db_xref="PDB:6A0U"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70312.1"
FT                   /translation="MEALKIALLGGGTVGSAFYNLVLERAEELSAFGVVPRFLGVLVRD
FT                   PRKPRAIPQELLRAEPFDLLEADLVVEAMGGVEAPLRLVLPALEAGIPLITANKALLAE
FT                   AWESLRPFAEEGLIYHEASVMAGTPALSFLETLRGSELLELHGILNGTTLYILQEMEKG
FT                   RTYAEALLEAQRLGYAEADPTLDVEGIDAAHKLTLLARLLVDPGFPFAEVEAQGIARLT
FT                   PEVLQKAEARGERVRLVASLFGEGGRWRAAVAPRRLPQDHPLARARGNALWVRARPLGE
FT                   AFVTGPGAGGGATASGLFADLLRFLSGAPGHLPAPRARPPLEEGSPWPGVE"
FT   CDS_pept        458465..459028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80464.1 percent identity 98 in 187
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70313"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70313"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70313.1"
FT                   /translation="MPLLDLLRPVSDEELRVLSERNPGWQFERLADGRLIVSPTGGESG
FT                   RIRAAVLGPLYRWNEARGLGVVFDASTGFKLPDGSVLAPDAAFLLGKRWQALSQEAREG
FT                   FPPLAPDAVFEVRSRSQGLEELREKAAWYLANGVRLVVLLDPYLHRVEVFRPGGVEGHQ
FT                   GPERVPLDPGLPGFALETRGLFLP"
FT   CDS_pept        459060..460115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0491"
FT                   /product="threonine synthase"
FT                   /note="similar to PDB:1BKG percent identity 100 in 351 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70314"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70314"
FT                   /db_xref="GOA:Q5SL02"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="PDB:3AEX"
FT                   /db_xref="PDB:3AEY"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70314.1"
FT                   /translation="MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARKKGI
FT                   RLYAKYEGLNPTGSFKDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAI
FT                   VVLPAGYVALGKVAQSLVHGARIVQVEGNFDDALRLTQKLTEAFPVALVNSVNPHRLEG
FT                   QKTLAFEVVDELGDAPHYHALPVGNAGNITAHWMGYKAYHALGKAKRLPRMLGFQAAGA
FT                   APLVLGRPVERPETLATAIRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLARE
FT                   EGIFCEPASAAAMAGVFKLLREGRLEPESTVVLTLTGHGLKDPATAERVAELPPPVPAR
FT                   LEAVAAAAGLL"
FT   CDS_pept        460128..460436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0492"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80466.1 percent identity 100 in 102
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70315"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70315"
FT                   /db_xref="GOA:Q5SL01"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70315.1"
FT                   /translation="MAERARKKVPEPFPGAYYLAGAITVALMLLFLALGASLPPGVAGF
FT                   LVAFVLGLTVSPRYVPFFLLAGVFSAVMGFLGREPQVAWGGVALVLSQLVVRRFVKD"
FT   CDS_pept        460439..460735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0493"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80467.1 percent identity 98 in 98
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70316"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70316"
FT                   /db_xref="GOA:Q5SL00"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SL00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70316.1"
FT                   /translation="MGPDRLSQALSLLGIAGYVYFLWFRPNQEGLALALGLALGGAAVA
FT                   YGERPFLVPLFAVLYGGILFLQLFYGHPWAFLLGGLLGAGLPYAFYRLRKPRR"
FT   CDS_pept        complement(460708..461046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0494"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80468.1 percent identity 100 in 112
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70317"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70317"
FT                   /db_xref="GOA:Q5SKZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70317.1"
FT                   /translation="MLEPLLFPLLLAVAFRLRRLAPLFALGFWANLLWFVYQNEWGSGW
FT                   LTYLRGLGAGLFLAAGYGEPLLAWSLLPWPLLLYAKLQVRELLPYLPGLTEGLGLGLLL
FT                   YLLGFRKR"
FT   CDS_pept        complement(461039..462466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0495"
FT                   /product="2-phosphoglycerate kinase"
FT                   /note="similar to GB:AAS80469.1 percent identity 98 in 475
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70318"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70318"
FT                   /db_xref="GOA:Q5SKZ8"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70318.1"
FT                   /translation="MRLRRGRWPLSKGLLVEALLPLGVPTEVAHALAHTVEERLKRLRR
FT                   KGGVTPRTLRRIFLEEVERELGPEKARLLAKQTLPFEEIFVVEGRKQRPFSKGLLTRSL
FT                   EDAGFSLREAHELAKAVERRLRLEGVRRIPAKRLEKVVAEEARRLYGPEAGERYRARLL
FT                   YAGELFVEEAPGAPRVPFSKGILAQSLMAIGLSPDRAFRLAREMEVALHREGVQVIRRD
FT                   ELRRRVHQALLREAGEEMARRYLILRSLRKQPRPVHILIGGVTGVGKSVLASALAYRLG
FT                   ITHIVPSDAVREVFRVSLSKDLLPTLHLSTFEAWRALSPGLGLEGESYEVQVMRGFLDQ
FT                   VAKVAVGLKAIQERSALEGTSIVLEGVHVVPRFLQHPYQDRVFTIPMLVAVQDENLHRD
FT                   RFLLRDRETGHARPKERYLQHFEEIRLIQNHLLRWAREEGIPVIPGEDLDEGIEKALEV
FT                   LVAYLEAQGQRLEEAHA"
FT   tRNA            462567..462641
FT                   /gene="tRNA-Cys"
FT                   /product="tRNA-Cys"
FT                   /note="anticodon: GCA"
FT   tRNA            462650..462726
FT                   /gene="tRNA-Val-2"
FT                   /product="tRNA-Val"
FT                   /note="anticodon: GAC"
FT   CDS_pept        462767..463156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80470.1 percent identity 99 in 129
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70319"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70319"
FT                   /db_xref="GOA:Q5SKZ7"
FT                   /db_xref="InterPro:IPR021093"
FT                   /db_xref="InterPro:IPR038458"
FT                   /db_xref="PDB:2FUG"
FT                   /db_xref="PDB:2YBB"
FT                   /db_xref="PDB:3I9V"
FT                   /db_xref="PDB:3IAM"
FT                   /db_xref="PDB:3IAS"
FT                   /db_xref="PDB:3M9S"
FT                   /db_xref="PDB:4HEA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SKZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70319.1"
FT                   /translation="MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRME
FT                   RPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLKRIGLRLPRAHIHLHAHYEPGKGLV
FT                   TGKIPLTKERFFALADRAREALAFA"
FT   CDS_pept        complement(463159..464256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0497"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="similar to GB:AAS80471.1 percent identity 97 in 365
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70320"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70320"
FT                   /db_xref="GOA:Q5SKZ6"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70320.1"
FT                   /translation="MASLYVHVPFCPTLCPYCDFHVVRRGPGWVEAYLRRLKEEAQALH
FT                   ERFPKPLRTLYLGGGTPSYLRDRELVALFQSLPWALAEGAEVTLEANPGTLSPGRLRLL
FT                   QDLGVNRLSLGVQSFQELVLKFLGRAHGRKGALRAVEMALEWGFRVSIDLILGLPMQDV
FT                   EADLKEAARLGVGHVSAYTLQVEKGTPFALLGLKEDPEREAWAMERAEEVLGETGLFRY
FT                   EVSNFAREGEEARHNLVYWRAGFWLALGPAATGQYPGEGGAYALRRTAPPLPRWLRGEA
FT                   PKEEAISPLEHAKESLMLGLRLREGVDVGAVEERTGLALFPLLQGRAVELAQEGLLQVL
FT                   GKRLLPTPKAFPLLHRVVLALWEAL"
FT   CDS_pept        complement(464249..464647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAN50079.1 percent identity 33 in 125
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70321"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70321"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70321.1"
FT                   /translation="MPREATDPLAWLVRAKSSLARARAGRISPEVLWEEPCFDAQQAAE
FT                   KALKALLVALGIPFPKTHDLERLLELIRPRIPVPLELEALVRLNPFAVASRYPGDLPEA
FT                   TEEDWREALALAERAVAWVEEVLKSSRG"
FT   CDS_pept        complement(464637..464954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0499"
FT                   /product="putative nucleotidyltransferase protein"
FT                   /note="similar to PDB:1BKG percent identity 44 in 86 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70322"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70322"
FT                   /db_xref="GOA:Q5SKZ4"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70322.1"
FT                   /translation="MEYPELAPVLEAILKTVPAQKVILFGSRARGEARPESDYDLLVVV
FT                   PPEYKTMRVWKDLYLAVSKAKRGFSLDLLLATAEDLEKYRDAWATLYPKVLREGRVLYA
FT                   P"
FT   CDS_pept        complement(464959..466179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0500"
FT                   /product="glycerate dehydrogenase/hydroxypyruvate
FT                   reductase"
FT                   /note="similar to GB:AAS80472.1 percent identity 98 in 406
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70323"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70323"
FT                   /db_xref="GOA:Q5SKZ3"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70323.1"
FT                   /translation="MEALLKEAFLEALKATDPYRLTAKHLPPWRPDLVLAVGKAAAPML
FT                   QAALDRYGEVPYHLTLPKGQKAPGLKAVFARHPVPDEESVRAAEEVLGLLQGLSPRARV
FT                   LALLSGGGSALWCAPLGISLEEKRALTEALLKSGASIHEMNAVRKHLSQIKGGRALLAT
FT                   RAKVHVLLLSDVPGDDPSVIASGPFHPDPTTYAEALALLDRYGLAFPGARAVLRQGVEG
FT                   RLPETLKPQDPALRRLAWRLVGTNLHLLRAAQRFLRARGFRAAVLSDRFGGEARALARF
FT                   HAELIEAIRAHGVPFRKPLFLLSGGEAQVRVVGRGRGGRNLEFLLALYAHLKTPLYALA
FT                   ADSDGLDGNSGAAGALLTPAVWEKGLDPRPFLEENDSLGFFQEAGTLLKTGPTGTNLND
FT                   FRLLLVD"
FT   CDS_pept        complement(466164..466556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80473.1 percent identity 95 in 130
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70324"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70324"
FT                   /db_xref="GOA:Q5SKZ2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70324.1"
FT                   /translation="MVLDTSALLGILFREEGYEELLEQLRRTRPHKVAAPTLAEAGIVL
FT                   GARLGFERVHLLFELLTELQAEIVPFTERHAREAISAYRRYGRGKHPAGLNFGDCLSYA
FT                   LARVEGEPLLYKGQGFDRTDLAWKPS"
FT   CDS_pept        complement(466556..466816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80474.1 percent identity 96 in 86
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70325"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70325"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70325.1"
FT                   /translation="MALTIRNKEVERLAEEVARLAGETKTEAVRKALEMRLRELQRKRS
FT                   FDRVIRFLEEEVWPQIPPELLGKGLSKEEEEEILGYGKEGY"
FT   CDS_pept        complement(466849..468105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0503"
FT                   /product="glycolate oxidase iron-sulfur subunit GlcF"
FT                   /note="similar to GB:AAS80475.1 percent identity 97 in 418
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70326"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70326"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70326.1"
FT                   /translation="MQHQIPVEKLGKEGEVMAHAVEACVHCGFCLPTCPTYVVLQEEMD
FT                   SPRGRIFLMKEVLEGNLGLEEALPYLDRCLACQACVTACPSGVPYGELIATFRLWSEEK
FT                   RHRFPLERVFRLGLLRTLPYPERFRPLAKLGAGLKPLLRPLPLPKPLKAPLALLPDRLP
FT                   EEAPYGEVYPAKGERRARVGLLLGCAQRVLRPSINQATIRVLQENGVEVVAVPEQACCG
FT                   ALNLHAGDKEGARALARKNLKAFRDVDYVVTNAAGCGSGMKEYPLLFRGEPEEEEARAL
FT                   AAKVKDLSVLLDELGFTPPPPPRRPLRVAYHDACHLAHAQGVREAPRRLLQAAGLEVLE
FT                   PREWELCCGSAGTYNLFQPEIAEALGRRKAENLKATGADLVATGNIGCLTQIQAYLDLP
FT                   VLHTAELLALLYEGKDPLA"
FT   CDS_pept        complement(468110..469153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0504"
FT                   /product="glycolate oxidase subunit GlcE"
FT                   /note="similar to GB:AAS80476.1 percent identity 97 in 347
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70327"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70327"
FT                   /db_xref="GOA:Q5SKY9"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70327.1"
FT                   /translation="MPTLRPESPEEVQEAVRAYPRLRAQGGGTKPALSTPKEGEVLLDL
FT                   SRLRGLLAYEPEEFVFTAFAGTPIAEVEEALRAHGQYLPFDPPLAGKGATLGGTVAAGL
FT                   SGPLRHRYGGLRDFLLGVRFVDGEGKVVRGGGKVVKNAAGFPFHRLMVGALGAFGVMVE
FT                   LSFKVFPRPRTTRTLRVRREGLEEALADLERLRLLPLDLLALDFIPPATLELRLGGFER
FT                   SVEARLKRLQDLLGEGEVLAEDEAHWEAVRDLGFLEGSPVWVKVPAKPHLIPRLEALPL
FT                   GPRRYLDGGEVLYAGTTEEGLKALREAGLPHLVLRGAEAPLFPEPQGAFFAGVKKALDP
FT                   KGRFPLG"
FT   CDS_pept        complement(469140..470522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0505"
FT                   /product="glycolate oxidase subunit"
FT                   /note="similar to GB:AAS80477.1 percent identity 98 in 460
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70328"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70328"
FT                   /db_xref="GOA:Q5SKY8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70328.1"
FT                   /translation="MGFLEELKALLPGRVLTREAELAPYESDALTAYRKRPLAVALPER
FT                   KEEVIGVVRLCHQYGVPFVARGSGTSLSGGSLPVEGGVVIALNRMNRILRLDPKARIAV
FT                   VEPGVVNLKVSQEAAPFGLYYAPDPSSQPVSTIGGNVAFNSGGAHCLKYGMTANHVLGL
FT                   EVVTPTGEVVRLGGESLEGVGPDLHGFFVGTEGLLGVAVEITLRLLPRPEAYHTVLAAY
FT                   PSLEAAGEAVSRVIRAGLLPGAMEIMDRLSIEAAEKAVRAGYPLVEGLLIVELEGPKEE
FT                   VAEEALVLERVLRESGALELRVAGSEAERQAIWKGRKAAFSAVGRLSPDYLVQDGVVPR
FT                   SRLGEALKEIQRLSREYGLRVANVFHAGDGNLHPLVLYDGKKPGELERAEALAGEILRL
FT                   CVRLGGSLTGEHGIGVEKKGYMPEMFAPEDLLAMEEVKRALDPKGLANRGKVLPEVAGA
FT                   HA"
FT   CDS_pept        complement(470584..472146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0506"
FT                   /product="malate synthase"
FT                   /note="similar to GB:AAS80478.1 percent identity 99 in 520
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70329"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70329"
FT                   /db_xref="GOA:Q5SKY7"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70329.1"
FT                   /translation="MKGVEIRKDHPLLKEVLTEEALRFVVALHREFNPVRKALLERRQA
FT                   LWERYKAGEKPDFLQETAFVRGGAWRVAEAPPDLLDRRVEITGPVDRKMIINALNSGAK
FT                   VFMADFEDALSPTWDNVIRGQKNLYDAVRRQIDFVSPEGKEYKLKEKTATLVVRPRGWH
FT                   LVEKHVYVDGEPISASLFDFGLYFFHNAHELLRRGSGPYFYLPKLESHLEARLWNEVFN
FT                   FAQDYLKIPRGTIRATVLIETILAAFEMEEILYELKEHAAGLNAGRWDYIFSCIKKFAT
FT                   TAPIFPDRAQVTMTVPFMKAYTELLVKSCHIHEAHAIGGMAAFIPSRKDPQVNERAFQQ
FT                   VRADKEREASQGFDGTWVAHPDLVPVAMEVFDRYLGDKPHQKHVKREDVHVTAADLLNF
FT                   HVPEGRVTEAGLRNNISVALQYLNQWLLGNGAAAIFNLMEDAATAEISRAQLWQWVHRG
FT                   AQLEDGRTITPELYQKVKEEELAKLGGRDKERYREAEEILDKLVLSEEFVEFLTLVAYD
FT                   YID"
FT   CDS_pept        472179..473003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0507"
FT                   /product="transcriptional regulator"
FT                   /note="similar to GB:AAS80479.1 percent identity 99 in 274
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70330"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70330"
FT                   /db_xref="GOA:Q5SKY6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70330.1"
FT                   /translation="MSRSKKIFCILKNRAAPVTLSGMARPREKPPQAVKTLERGLRVLE
FT                   ALAQAGESPLGPLAERVGLAKSTLYRLLRALAQAGFVEEEGGVYRVGPKAFAVGQAYPK
FT                   RSLSQAVRPEMEALARETGESVNLAVPLGREALYLDQVEGTKLVRLFTAPGSRAPLHAT
FT                   GVGKVFLAYLGVPEGLSLTPYTPHTLTRLPDLLRELEAVRGRGYALDNEEKELGVRCVA
FT                   APVFGASGGVVAALSLSAPASRLSLEEAHRLAPRVVEAARRASLRLGYTGEV"
FT   CDS_pept        473046..473747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0508"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="similar to GB:AAS80480.1 percent identity 99 in 233
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70331"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70331"
FT                   /db_xref="GOA:Q5SKY5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70331.1"
FT                   /translation="MDKVVDKDRPVYVISVAAELVEMHPQTLRLYERKGLIKPKRSSGK
FT                   TRLYSERDIEKLREIRRLTQELGVNLAGVEEIMRLRAELEALQARFEAEVARLKAEIGD
FT                   RFQELERRALPPPGQTEKPSPKDRPVYVISVAAELVEMHPQTLRLYERKGLIKPKRSSG
FT                   KTRLYSERDIEKLREIRRLTQELGVNLAGVEEIMRLRAELEALQARFEAEVARLKLLLL
FT                   EKEKEEALGGG"
FT   CDS_pept        473807..475105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0509"
FT                   /product="N-acyl-L-amino acid amidohydrolase"
FT                   /note="similar to GB:AAS80481.1 percent identity 99 in 432
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70332"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70332"
FT                   /db_xref="GOA:Q5SKY4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70332.1"
FT                   /translation="MDLTELFAFLSIPSVSTDPARREDVRRAALWLEERLKARGFRTEL
FT                   HETPLHPILYAERFVDEKAPTVLVYGHYDVQPPDPLELWESPPFSPVVREGRIYARGAS
FT                   DDKGQLFAHVLAAEEAPVNLKFLVEGEEEIGSPHLPPFVRANREKLRADVVLVSDGAMF
FT                   APHTPTLTYGLRGLCYLEVRLRGARRDLHSGAFGGVAPNPIQALGWLLARLKDEGTGRV
FT                   LIPGFYERVRPVPEEEKALWPSLDEEALKRELGVEILPGEEGYAPLERLWARPTLDPNG
FT                   IWGGYQGEGSKTVIPAEAGMKLSMRLVPDQDPEEVADQAEAYLKAVCPPGYALEVRRLH
FT                   GGRPVLTDPFSPPMRLMARALEEVWGRPPVYTREGGTIPVVAELKETLGAPIVLLGLGL
FT                   PDDNLHAPNEKLDLVNLEKGVEVIRRFHRLLAG"
FT   CDS_pept        complement(475128..475457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0510"
FT                   /product="CsaA protein"
FT                   /note="similar to DBJ:BAB21608.1 percent identity 100 in
FT                   109 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70333"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70333"
FT                   /db_xref="GOA:Q5SKY3"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR008231"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70333.1"
FT                   /translation="MTPLEAFQILDLRVGRVLRAEPHEKARKPSYKLWVDLGPLGVKQS
FT                   SAQITELYRPEDLVGRLVVCAVNLGAKRVAGFLSEVLVLGVPDEAGRVVLLAPDREVPL
FT                   GGKVF"
FT   CDS_pept        complement(475498..476640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0511"
FT                   /product="probable phenylaceate-CoA ligase/coenzyme F390
FT                   synthetase"
FT                   /note="similar to GB:AAS80483.1 percent identity 99 in 380
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70334"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70334"
FT                   /db_xref="GOA:Q5SKY2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70334.1"
FT                   /translation="MDVDRLARFREVVAKAKAHPVYREKLRDVDPEKLTLKDLSSLPPT
FT                   TREEWLAYLGENPKPPEGASLMHLTPSPVLGWMPEYLSQEDLHYQAEALAAHYRRLGLV
FT                   GKKVLVAFSYHVFAGGWLFHQALWRAGNLVFPHGPGEAKRVAELGERYGFDVLVTNPSF
FT                   ALKVAQAGGRFPLLLAGGEPFTSVPGFRERVEEALGGVALDAYGTSELGIVAGERPEKD
FT                   GLWEIPEMAVLEVLDPETLRPVADGEKGELVVTALSRTLMPMVRFRTGDLAVAERREGL
FT                   TVLPRGVFGRTDQMVKVKGVKLYPTELAPVLAGFGLDPKGFQVVVERKLEGTDKLVLRL
FT                   KAEKVPPGLFEAIQKATGLKVDEVELVETLEGGLLVDRRF"
FT   CDS_pept        complement(476688..477743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80484.1 percent identity 99 in 351
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70335"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70335"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70335.1"
FT                   /translation="MTISELEETLKEEARLFLSRARGLRGPHTEDLFARRVYIGPEDVH
FT                   VENYPRRPLAVFNPGAVLEGEVVHLFPRLVFEYYSYASAIGHATLPLKDLLAGRIPKPL
FT                   PVRILLYPTELFEAVRGCEDARAHRREEGYALFYTGVGKLGDARNTDSKEVFTAILSLA
FT                   EFDEAFQLKRKAPIRIGLSGEETGLALYLPTKNATFLEGDHVLLRPSLSGLPDLCWRGR
FT                   LDPKTLKAYDLRPVLAPEAFEYKVGWSTNALRLPDGTYLVAYHGILRHDLSYRHGFMRL
FT                   SPEGRPLGLSHYLLAPQGLAECYGDRPLTLYGNGLLLHGEELVFVGGVGDYAIGVFTAP
FT                   LEEVLKRVVPL"
FT   CDS_pept        complement(477740..478849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0513"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit (PurK)"
FT                   /note="similar to GB:AAS80485.1 percent identity 98 in 369
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70336"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70336"
FT                   /db_xref="GOA:Q5SKY0"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="PDB:3AW8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70336.1"
FT                   /translation="MIGILGGGQLGRMLALAGYPLGLSFRFLDPSPEACAGQVGELVVG
FT                   EFLDEGALLRFAEGLALVTYEFENVPVEAARRLEGRLPLYPPAKALEVAQDRLREKTFF
FT                   QGLGVPTPPFHPVDGPEDLEEGLKRVGLPALLKTRRGGYDGKGQALVRTEEEALEALKA
FT                   LGGRGLILEGFVPFDREVSLLAVRGRTGEVAFYPLVENRHWGGILRLSLAPAPGASEAL
FT                   QKKAEAYALRAMEALDYVGVLALEFFQVGEELLFNEMAPRVHNSGHWTIEGAETSQFEN
FT                   HLRAVLGLPLGSTAPRGQSAMVNLIGEKPPFAEVLKVEGAHLHWYGKAVRPGRKVGHIT
FT                   LRRDGLKALEEGLARLSRLVSELPWEGRV"
FT   CDS_pept        complement(478846..479340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0514"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit (PurE)"
FT                   /note="similar to GB:AAS80486.1 percent identity 100 in 164
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70337"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70337"
FT                   /db_xref="GOA:Q5SKX9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70337.1"
FT                   /translation="MAPLVGLIMGSRSDWETMRHAAETLEALGIPYEVRVVSAHRTPDL
FT                   MAEYAKTAEERGIQVIIAGAGGAAHLPGMTAAHTALPVLGVPVESRALGGLDSLLSIVQ
FT                   MPAGVPVGTLAIGKAGAVNAALLAASILGLKHPEILKRLKAYRKAQTEAVLAHPDPREE
FT                   A"
FT   CDS_pept        479389..480345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80487.1 percent identity 98 in 318
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70338"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70338"
FT                   /db_xref="GOA:Q5SKX8"
FT                   /db_xref="InterPro:IPR010293"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70338.1"
FT                   /translation="MDALELLRLNLLSPMVLAYFLGVAARLLKSDLAFPEALYTALSIY
FT                   LLFAIGFKGGVELSHTPLAVVLLPALLTLALGLFRPFPAYLLARRFLRVGREDAAALAA
FT                   HYGSVSAVTFLAALTFVQAVGDAAPGFMPTLVALLEVPGIVVALLLAKRREGRLGEALH
FT                   EVLTGKSVVLLLGGLLVGLLSGEEGMKKVEAFFVEPFQGALTLFLLDLGMVAASRLSVL
FT                   RQVGLRLVLFGVGLALFHGALGVYLGLLVGLGVGGAAVLGAMAASASYIAAPAAVRIAL
FT                   PEANPSLYLTASLAVTFPFNLVLGIPLYRALAVLWGG"
FT   CDS_pept        480349..480651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80488.1 percent identity 99 in 100
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70339"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70339"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="PDB:2CZ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70339.1"
FT                   /translation="MDLVPLKLVTIVAESLLEKRLVEEVKRLGAKGYTITPARGEGSRG
FT                   IRSVDWEGQNIRLETIVSEEVALRILQRLQEEYFPHYAVIAYVENVWVVRGEKYV"
FT   CDS_pept        complement(480677..481213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0517"
FT                   /product="DedA family protein"
FT                   /note="similar to GB:AAS80489.1 percent identity 99 in 178
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70340"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70340"
FT                   /db_xref="GOA:Q5SKX6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70340.1"
FT                   /translation="MNALLLLAPLSLFLETGLPIGLFVPGGDTLLLALGALAAEGGLEA
FT                   FPLLPLLFLGSFLGHLLGYALGRYGGKALRRRFPEDLWKKGERLALRYGPLLLLLAPFI
FT                   GGVRTLTPFLFGAWGFPFSRFLPLVALGSLLWTQGLFLLGYFLGQHLPLWAILLGLLLL
FT                   GGIGLLLSRRPYSAG"
FT   CDS_pept        complement(481210..481902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0518"
FT                   /product="TerC family protein"
FT                   /note="similar to GB:AAS80490.1 percent identity 97 in 230
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70341"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70341"
FT                   /db_xref="GOA:Q5SKX5"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70341.1"
FT                   /translation="MELTGALSAIFTLIVLEVILSADNALILGVLVQRLPVHLRRKALF
FT                   YGILGAYILRGLALLFASLVIQLWWAQALGAAYLLYIALKHFLKPEEAHAPPPLEVSAA
FT                   QFWKVVAQVELMDLAFAVDSVLVAVAISDELWVIYTGVFLGILALRMLASFVVSLLDRY
FT                   PRFKHLAYLVVGLAGAKLAVAGWDKFAKEVLHRPELALGLDKEAFSLFILAVLLLGSLW
FT                   ATRKPAPA"
FT   CDS_pept        482059..482436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80491.1 percent identity 99 in 125
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70342"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70342"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70342.1"
FT                   /translation="MGGRGAGLGAILKAMDEARKELPTKEQVLEALKVVYDPEIPVNIV
FT                   DLGLVYDVEVHENGVVDVTMTLTAIGCPAQDVVKADAEMAVMRLPGVQGVNVEFVWTPP
FT                   WTPARMTEEGKRMMRMFGFNV"
FT   CDS_pept        482455..484185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0520"
FT                   /product="NAD-dependent malic enzyme (malate
FT                   dehydrogenase)"
FT                   /note="similar to GB:AAS80492.1 percent identity 100 in 576
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70343"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70343"
FT                   /db_xref="GOA:Q5SKX3"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70343.1"
FT                   /translation="MPISRYYDVKRDEKGERYLEPYVTGFLLLRLPLLNKGTAFTEEER
FT                   RLLGLEGLLPPHVHTLEEQKERVYRRYRLIQSPLEKHIYLRHLQDRNEVLFYALVVDHL
FT                   EEMLPILYTPTVGEAVREFSHIYRYPRGFTASTKNIDRIDEALQNVPLEDVRLIVATDS
FT                   SAILGIGDQGYGGMAISIGKLTLYTAAGGVGPDKTLPVELDVGTDREDLLKDPLYLGVR
FT                   HRRLRGEEYFRFLDRFVEAVRRRYPKALIQWEDFAKETAFQVLERYRKVIPSFNDDIQG
FT                   TGAVALAGVLSACRLKGERLSDQVVVVYGAGAGGIGVAWALVEGMKREGLSEEEAKARV
FT                   LVLDSKGLLVEGRSMEDYKRPYAQRPERLWGWRFAGEYPNLLETITNARATVLLGLSGQ
FT                   AGSFTEPVVRAMLANTPRPVIFPLSNPTSATEALPDDLVYWTEGRALVAAGSPFPPVGF
FT                   KGRTVPIGQGNNAFVFPGLGLGAVLSRAREVTDGMVLEAAYALYDYTREHFPERIYPPV
FT                   GRLREVSPYVAARVMQRALEEGVAEEARVQGLTLEALLDFVKSRFWEPRYLPYRPAPVI
FT                   "
FT   CDS_pept        484190..485071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80493.1 percent identity 98 in 245
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70344"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70344"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70344.1"
FT                   /translation="MAWRLLRLEPLGLQEGPASPPEPGAFRLLEEPWEAKRGGQAPWPE
FT                   PLYFVDGRERAEALVAQGPRLALLGCVAAGAVALKGGRVEVLGLRVRRVGVGLEEALWA
FT                   GELVYEPAPTLGEGLEGLQAGLRAAREALEKEVAEGLEGGLLVVDGPVRLLRKGPLLGY
FT                   IKTHWVRYLPKEREALLEALAPGERTPAFRVHRKGLELASWYVRLPLPPEGLRPPLAGL
FT                   LRVETPLAGPFLELADLSLGLFPALASHPVKDPRAPQNLLPVGGLERELSRRMGRPEVV
FT                   GRMLARYLGGAR"
FT   CDS_pept        485068..486798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80495.1 percent identity 99 in 575
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70345"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70345"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70345.1"
FT                   /translation="MKRIGVVLGRREATPLEFWVGVEGDGLLRLDDLVVVEGFHPQVGQ
FT                   VRFFGMVDHVAKVHEGESFDTDTFLAVEGKIPVSLAYVAHVSVTRILPEEFFPPDPGSP
FT                   VYLAQEEDLELALYYDAMRNQRGSTKLPAGLLKNGEVAYLNLEFLNGVKGGHVNISGIS
FT                   GVAAKTSYATFLLKSLLESGVLEDAHQARVLLFNVKGEDLFFLDKPNARLTEEARKAYA
FT                   RLGLPATPFQSVAFLAPPKKAGYLPDVDTRLEGVEAYHWDLVQFCQRGLLPFLFADRAA
FT                   MTNLGFLVAHVTEKLKRLAEGQKGPHLQVEDWPGGEASEGMSFDQLGKARLKSFSDLVR
FT                   YLEYKLLGPETGEGEGDRGWTARQAKGTLEAFVRRLRSSVENVAHLVRGDRPGSPPDPL
FT                   SGKAQVHVVDLAKLSPQAQMFVVGSLLKDLFERKERGQYRGRVFIVLDELNKYAPREEE
FT                   SPIKDVLLDIAERGRSLGVILIGAQQTASEVERRVVGNAAIRVVGRLDAAEAERPEYRY
FT                   LPTSFRQRALILPQGAVILHQPEIPVPLLVHFPFPAWATKREEVLEDNSAEALRREFFR
FT                   "
FT   CDS_pept        486811..487860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0523"
FT                   /product="glycine cleavage system T protein (probable
FT                   aminomethyltransferase)"
FT                   /note="similar to GB:AAS80496.1 percent identity 97 in 349
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70346"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70346"
FT                   /db_xref="GOA:Q5SKX0"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SKX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70346.1"
FT                   /translation="MKKTPLYEAHLRLGARMVDFAGYLLPLQYTSIVEEHLAVRRAVGV
FT                   FDVSHMGEFLVRGKEALAFLQWATANDAGKLKVGRAQYSMLPNERGGVVDDIYLYRLGE
FT                   EEYLMVVNAANIAKDLAHLQALAKGFRVELEDASERTALLALQGPKAASLLQGLTDLDL
FT                   SQKRKNDVFPARVAGRPARLARTGYTGEDGFELFLAPEDAEPVFLALVEAGAKPAGLGA
FT                   RDSLRLEAGFPLYGHELTEETNPLCTPWAWVVKKEKAFLGKEAMLAQACRERLVGLVLE
FT                   GGIPREGYRVLSGGRPVGRVTSGGYSPLLQRGIALAYVEEGAEGPFQVEVRGRAVPAAL
FT                   SPLPFVPLK"
FT   CDS_pept        487879..488265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0524"
FT                   /product="glycine cleavage system H protein"
FT                   /note="similar to PDB:1BKG percent identity 100 in 128 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70347"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70347"
FT                   /db_xref="GOA:Q5SKW9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="PDB:1ONL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SKW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70347.1"
FT                   /translation="MDIPKDRFYTKTHEWALPEGDTVLVGITDYAQDALGDVVYVELPE
FT                   VGRVVEKGEAVAVVESVKTASDIYAPVAGEIVEVNLALEKTPELVNQDPYGEGWIFRLK
FT                   PRDMGDLDELLDAGGYQEVLESEA"
FT   CDS_pept        488375..489691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0525"
FT                   /product="glycine dehydrogenase (decarboxylating) subunit
FT                   1"
FT                   /note="similar to GB:AAS80498.1 percent identity 100 in 438
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70348"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70348"
FT                   /db_xref="GOA:Q5SKW8"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="PDB:1WYT"
FT                   /db_xref="PDB:1WYU"
FT                   /db_xref="PDB:1WYV"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70348.1"
FT                   /translation="MDYTPHTEEEIREMLRRVGAASLEDLFAHLPKEILSPPIDLPEPL
FT                   PEWKVLEELRRLAAQNLPAHKAFLGGGVRSHHVPPVVQALAARGEFLTAYTPYQPEVSQ
FT                   GVLQATFEYQTMIAELAGLEIANASMYDGATALAEGVLLALRETGRMGVLVSQGVHPEY
FT                   RAVLRAYLEAVGAKLLTLPLEGGRTPLPEVGEEVGAVVVQNPNFLGALEDLGPFAEAAH
FT                   GAGALFVAVADPLSLGVLKPPGAYGADIAVGDGQSLGLPMGFGGPHFGFLATKKAFVRQ
FT                   LPGRLVSETVDVEGRRGFILTLQAREQYIRRAKAKSNITTNAQLTALMGAMYLAALGPE
FT                   GLREVALKSVEMAHKLHALLLEVPGVRPFTPKPFFNEFALALPKDPEAVRRALAERGFH
FT                   GATPVPREYGENLALFAATELHEEEDLLALREALKEVLA"
FT   CDS_pept        489688..491112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0526"
FT                   /product="glycine dehydrogenase subunit 2 (P-protein)"
FT                   /note="similar to GB:AAS80499.1 percent identity 99 in 473
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70349"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70349"
FT                   /db_xref="GOA:Q5SKW7"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="PDB:1WYT"
FT                   /db_xref="PDB:1WYU"
FT                   /db_xref="PDB:1WYV"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SKW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70349.1"
FT                   /translation="MSFPLIFERSRKGRRGLKLVKAVPKAEDLIPKEHLREVPPRLPEV
FT                   DELTLVRHYTGLSRRQVGVDTTFYPLGSCTMKYNPKLHEEAARLFADLHPYQDPRTAQG
FT                   ALRLMWELGEYLKALTGMDAITLEPAAGAHGELTGILIIRAYHEDRGEGRTRRVVLVPD
FT                   SAHGSNPATASMAGYQVREIPSGPEGEVDLEALKRELGPHVAALMLTNPNTLGLFERRI
FT                   LEISRLCKEAGVQLYYDGANLNAIMGWARPGDMGFDVVHLNLHKTFTVPHGGGGPGSGP
FT                   VGVKAHLAPYLPVPLVERGEEGFYLDFDRPKSIGRVRSFYGNFLALVRAWAYIRTLGLE
FT                   GLKKAAALAVLNARYLKELLKEKGYRVPYDGPSMHEFVAQPPEGFRALDLAKGLLELGF
FT                   HPPTVYFPLIVKEALMVEPTETEAKETLEAFAEAMGALLKKPKEWLENAPYSTPVRRLD
FT                   ELRANKHPKLTYFDEG"
FT   CDS_pept        complement(491161..492045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0527"
FT                   /product="riboflavin kinase/FMN adenylyltransferase"
FT                   /note="similar to GB:AAS80507.1 percent identity 87 in 294
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70350"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70350"
FT                   /db_xref="GOA:Q5SKW6"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70350.1"
FT                   /translation="MLFSEVADVPKGPKVVAVGSFDGVHLGHQYLLRQALSEAKTLKAP
FT                   LLVYTFDPPTKVFTRGEGFLMDLQEKVEALREVGVELILAVPFNEEFARRPPEAFLEDL
FT                   RALQASRIYVGEDFRFGQGRAGGPEALERVAPTRVVPLLSLGGEAVKSSRIRALLREGR
FT                   VEEARHLLGRLYGAYGVVVEGDRMGRRLGFPTANLAVHPLKVLPPGVFAVEAEGAFGRY
FT                   KGVANVGTRPTLGGEERRLEVHLLGFAGELYGEEVRVRFLKRLREERRFPSLEALRAQI
FT                   AEDVAEARAYFGL"
FT   CDS_pept        complement(492023..492535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0528"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /note="similar to GB:AAS80508.1 percent identity 100 in 170
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70351"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70351"
FT                   /db_xref="GOA:Q5SKW5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="PDB:3X0I"
FT                   /db_xref="PDB:3X0J"
FT                   /db_xref="PDB:3X0K"
FT                   /db_xref="PDB:3X0L"
FT                   /db_xref="PDB:3X0M"
FT                   /db_xref="PDB:3X0N"
FT                   /db_xref="PDB:3X0O"
FT                   /db_xref="PDB:3X0P"
FT                   /db_xref="PDB:3X0Q"
FT                   /db_xref="PDB:3X0R"
FT                   /db_xref="PDB:3X0S"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70351.1"
FT                   /translation="MGRVYYGGVERTYLYRGRILNLALEGRYEIVEHKPAVAVIALREG
FT                   RMLFVRQMRPAVGLAPLEIPAGLIEPGEDPLEAARRELAEETGLSGDLTYLFSYFVSPG
FT                   FTDEKTHVFLAENLKEVEAHPDEDEAIEVVWMRPEEALERHQRGEVEFSATGLVGVLYY
FT                   HAFLRGR"
FT   CDS_pept        492679..492873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0529"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80509.1 percent identity 100 in 64
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70352"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70352"
FT                   /db_xref="GOA:Q5SKW4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70352.1"
FT                   /translation="MDLSGLKDPEAVAREVLWAHTLGASLAAGWADYGRIAPGARADLT
FT                   LWEGKRPVGRVYRGNLEIF"
FT   CDS_pept        492900..493406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80510.1 percent identity 100 in 168
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70353"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70353"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70353.1"
FT                   /translation="MYGVLVWPPEDLRRFMEELQAARGVRGFGPPHLNLRQPFDWPYEE
FT                   EALRIALAGILRGHPPFRVRLGDWRFFPQGVVYLRAYGGGAFRRLYHALEPLAPPLKEI
FT                   EGPSYIPHLTLALGLSPEEAKALAQSLPPPPRRSFLVREAALVRDEGEGLVEVARFPLG
FT                   PSPER"
FT   CDS_pept        complement(493390..494217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80511.1 percent identity 100 in 275
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70354"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70354"
FT                   /db_xref="GOA:Q5SKW2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70354.1"
FT                   /translation="MDASLLLPLGFGLLSALTWGAGDFGGGMASRRAHAQAVVLWASGI
FT                   GLLLFLLLAQVFGEAPQGRDLPYALLGGASGALGLLAFYRALAQGEMGLAAPVAGVVGA
FT                   ALPVALGALLEGWPGLFPALGMGLGLLAVWLVSRPEGRARPGNLGLALLAGLGFGGFYA
FT                   FMDRVEGLFYPAAWAKLTAFLLVLPAALRARPWPGGREAPWVLLAGLGDAGGNLFFLLA
FT                   AQAGRLDVAAVLSSFYPVFTVLLAWLVLKERLSRRRLTGVGLSLLAMALIALG"
FT   CDS_pept        complement(494266..495537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0532"
FT                   /product="RNA polymerase pricipal sigma factor (RpoD)"
FT                   /note="similar to GB:AAS80512.1 percent identity 99 in 423
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70355"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70355"
FT                   /db_xref="GOA:Q5SKW1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="PDB:1IW7"
FT                   /db_xref="PDB:1SMY"
FT                   /db_xref="PDB:1ZYR"
FT                   /db_xref="PDB:2A68"
FT                   /db_xref="PDB:2A69"
FT                   /db_xref="PDB:2A6E"
FT                   /db_xref="PDB:2A6H"
FT                   /db_xref="PDB:2BE5"
FT                   /db_xref="PDB:2CW0"
FT                   /db_xref="PDB:3DXJ"
FT                   /db_xref="PDB:3EQL"
FT                   /db_xref="PDB:3WOD"
FT                   /db_xref="PDB:4G7H"
FT                   /db_xref="PDB:4G7O"
FT                   /db_xref="PDB:4G7Z"
FT                   /db_xref="PDB:4MQ9"
FT                   /db_xref="PDB:4OIN"
FT                   /db_xref="PDB:4OIO"
FT                   /db_xref="PDB:4OIP"
FT                   /db_xref="PDB:4OIQ"
FT                   /db_xref="PDB:4OIR"
FT                   /db_xref="PDB:4Q4Z"
FT                   /db_xref="PDB:4Q5S"
FT                   /db_xref="PDB:5D4C"
FT                   /db_xref="PDB:5D4D"
FT                   /db_xref="PDB:5D4E"
FT                   /db_xref="PDB:5E17"
FT                   /db_xref="PDB:5E18"
FT                   /db_xref="PDB:5I2D"
FT                   /db_xref="PDB:5TMC"
FT                   /db_xref="PDB:5TMF"
FT                   /db_xref="PDB:5VO8"
FT                   /db_xref="PDB:5VOI"
FT                   /db_xref="PDB:5XJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70355.1"
FT                   /translation="MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDL
FT                   TLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELAR
FT                   KVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKL
FT                   KSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIR
FT                   AVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQE
FT                   LGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPS
FT                   PVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQ
FT                   IENKALRKLKYHESRTRKLRDFLD"
FT   CDS_pept        complement(495541..496668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0533"
FT                   /product="probable ribosomal RNA small subunit
FT                   methyltransferase"
FT                   /note="similar to GB:AAS80513.1 percent identity 99 in 375
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70356"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70356"
FT                   /db_xref="GOA:Q5SKW0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:2ZUL"
FT                   /db_xref="PDB:2ZWV"
FT                   /db_xref="PDB:3DMF"
FT                   /db_xref="PDB:3DMG"
FT                   /db_xref="PDB:3DMH"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70356.1"
FT                   /translation="MSLTREAYHRLTPLPHPGGRLFIKPGARGYRDPVHDLLQKTVEPF
FT                   GERALDLNPGVGWGSLPLEGRMAVERLETSRAAFRCLTASGLQARLALPWEAAAGAYDL
FT                   VVLALPAGRGTAYVQASLVAAARALRMGGRLYLAGDKNKGFERYFKEARALLGYGVVVR
FT                   REGPYRVALLEKEKEAPPLPSLWRAFSARILGAEYTFHHLPGVFSAGKVDPASLLLLEA
FT                   LQERLGPEGVRGRQVLDLGAGYGALTLPLARMGAEVVGVEDDLASVLSLQKGLEANALK
FT                   AQALHSDVDEALTEEARFDIIVTNPPFHVGGAVILDVAQAFVNVAAARLRPGGVFFLVS
FT                   NPFLKYEPLLEEKFGAFQTLKVAEYKVLFAEKRGR"
FT   CDS_pept        496759..497976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0534"
FT                   /product="aspartokinase (aspartate kinase) [contains:
FT                   aspartokinase alpha subunit; aspartokinase beta subunit]"
FT                   /note="similar to GB:AAS80514.1 percent identity 100 in 405
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70357"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70357"
FT                   /db_xref="GOA:Q5SKV9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70357.1"
FT                   /translation="MALVVQKYGGTSVGDLERIHKVAQRIAHYREKGHRLAVVVSAMGH
FT                   TTDELIALAKRVNPRPPFRELDLLTTTGEQVSVALLSMQLWAMGIPAKGFVQHQIGITT
FT                   DGRYGDARILEVNPARIREALEQGFVAVIAGFMGTTPEGEITTLGRGGSDTTAVAIAAA
FT                   LGAKECEIYTDTEGVYTTDPHLIPEARKLSVIGYDQMLEMAALGARVLHPRAVYYAKRY
FT                   GVVLHVRSSFSYNPGTLVKEVAMEMDKAVTGVALDLDHAQIGLIGIPDQPGIAAKVFQA
FT                   LAERGIAVDMIIQGVPGHDPSRQQMAFTVKKDFAQEALEALEPVLAEIGGEAILRPDIA
FT                   KVSIVGVGLASTPEVPAKMFQAVASTGANIEMIATSEVRISVIIPAEYAEAALRAVHQA
FT                   FELDKA"
FT   CDS_pept        497976..498440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0535"
FT                   /product="purine phosphoribosyltransferase
FT                   (xanthine-guanine phosphoribosyltransferase)"
FT                   /note="similar to DBJ:BAA07148.1 percent identity 100 in
FT                   154 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70358"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70358"
FT                   /db_xref="GOA:Q5SKV8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70358.1"
FT                   /translation="MERLHLSWEDLLRLVRRLAEALSGEPFDLVLGVARGGLIPTALLA
FT                   QALGARNILTAAVMFYEGEEALPEPVFLQFPPDVLLFGKRVLVVDDVWDSGRTAFAVKA
FT                   RVRRAGGVPVVATLHFKPGRNRVPDRPDFYAEETAAWVVYPWALEAWPKG"
FT   CDS_pept        complement(498584..499567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0536"
FT                   /product="malate dehydrogenase"
FT                   /note="similar to GB:AAS80516.1 percent identity 99 in 327
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70359"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70359"
FT                   /db_xref="GOA:Q5SKV7"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SKV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70359.1"
FT                   /translation="MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQ
FT                   AMKALEGVVMELEDCAFPLLAGLEATDDPKVAFKDADYALLVGAAPRKAGMERRDLLQV
FT                   NGKIFTEQGRALAEVAKKDVKVLVVGNPANTNALIAYKNAPGLNPRNFTAMTRLDHNRA
FT                   KAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGRPALELVDMEWYEKVFIPTV
FT                   AQRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQGEYGIPEGIVYS
FT                   FPVTAKDGAYRVVEGLEINEFARKRMEITAQELLDEMEQVKALGLI"
FT   CDS_pept        complement(499582..500448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0537"
FT                   /product="succinyl-CoA synthetase alpha chain"
FT                   /note="similar to PDB:1BKG percent identity 99 in 288 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70360"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70360"
FT                   /db_xref="GOA:Q5SKV6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70360.1"
FT                   /translation="MILVNRETRVLVQGITGREGQFHTKQMLSYGTKIVAGVTPGKGGM
FT                   EVLGVPVYDTVKEAVAHHEVDASIIFVPAPAAADAALEAAHAGIPLIVLITEGIPTLDM
FT                   VRAVEEIKALGSRLIGGNCPGIISAEETKIGIMPGHVFKRGRVGIISRSGTLTYEAAAA
FT                   LSQAGLGTTTTVGIGGDPVIGTTFKDLLPLFNEDPETEAVVLIGEIGGSDEEEAAAWVK
FT                   DHMKKPVVGFIGGRSAPKGKRMGHAGAIIMGNVGTPESKLRAFAEAGIPVADTIDEIVE
FT                   LVKKALG"
FT   CDS_pept        complement(500445..501620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0538"
FT                   /product="succinyl-CoA synthetase beta chain"
FT                   /note="similar to GB:AAS80518.1 percent identity 99 in 391
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70361"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70361"
FT                   /db_xref="GOA:Q5SKV5"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70361.1"
FT                   /translation="MPLTGVARQGRWVLNLHEYQAKEILARYGVPVPPGKVAYTPEEAK
FT                   RIAEEFGKRVVIKAQVHVGGRGKAGGVKLADTPQEAYEKAQAILGMNIKGLTVKKVLVA
FT                   EAVDIAKEYYAGLILDRAKKRVVLMLSKEGGVDIEEVAAERPEAIHKFWIDPHKGFRPF
FT                   EAREMVKRAGLEGNLNKLAQVLVALYRAYEGVDASIAEINPLVVTTDGGIVAADAKIVL
FT                   DDNALFRHPDLAELREVEAEHPLEVEASNYGFAYVKLDGNIGIIGNGAGLVMYTLDLVN
FT                   RVGGKPANFLDIGGGAKADVVYNALKVVLKDPDVKGVFINIFGGITRADEVAKGVIRAL
FT                   EEGLLTKPVVMRVAGTAEEEAKKLLEGKPVYMYPTSIEAAKVIVAMVGGAA"
FT   CDS_pept        501665..502699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80519.1 percent identity 100 in 344
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70362"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70362"
FT                   /db_xref="GOA:Q5SKV4"
FT                   /db_xref="InterPro:IPR002723"
FT                   /db_xref="InterPro:IPR014435"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70362.1"
FT                   /translation="MNKEALVQVAEEVRRATGLPVGWRDVERTLGALRATRDLWEAVRL
FT                   SRVPLRFLVPIWEGLARRGLLRVEEGLDLLAEVPAPRPGEAACPACEGRGLVGERLPGR
FT                   AAERFLAWAKERPEAIQDFDQGYVTPESTLARVALAWNWGDLEGKEVLVLGDDDLTGLA
FT                   AALTGLPKRVVVLDADPRIVRFLERAAKAEGLPLEAHVHDLREPLPEAWVHAFHTFFTD
FT                   PVEGPLGLQAFVGRGLLALEGEGCAGYVGLTHVEASLAKWADFQRFLLENGAVITELRD
FT                   GFHVYENWGYIEQMRAWPWLPVKRRPEKPWYTSALIRLELLRRADLENARVEGDLQDEE
FT                   ATTY"
FT   CDS_pept        complement(502693..503703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80520.1 percent identity 98 in 336
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70363"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70363"
FT                   /db_xref="GOA:Q5SKV3"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="PDB:3IX7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SKV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70363.1"
FT                   /translation="MKTRHLVYLAFALLGLGLAGLLEDWGLLPQSPSLLSLNRLYLALA
FT                   GLLTGLLLGPRLEGALEARLKRLRSLPPEVVVATTLGSTIGLLLAVLLTTLLAQVPGFS
FT                   PVHSLLLALGLVALFVYLALGYRAYFRLPEPKPAPRGGKVLDTSVLVDGRVAEVAAVGF
FT                   LEGPLWVPHFVLKELQHFADSQDPLRRAKGRRGLETLERLREAAPLEVLETTPKGESVD
FT                   EKLLFLARDLEAALVTNDHALLQMARIYGVKALSIQALAQALRPQLQVGDTLKLLILKE
FT                   GKEPHQGVGYLEDGSMVVVDGGSRYRGQEIEVVVTQAIQTQVGRLFFARPAQGAQ"
FT   CDS_pept        complement(503700..504971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0541"
FT                   /product="DNA repair protein RadA"
FT                   /note="similar to GB:AAS80521.1 percent identity 99 in 423
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70364"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70364"
FT                   /db_xref="GOA:Q5SKV2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="PDB:5H45"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70364.1"
FT                   /translation="MAKATYACVECGYRTPKPLGRCPSCGSWESFQEVAPAPASRRAKP
FT                   SPLPLLALSQVDEAEERRFSSGLSEVDRVLGGGFVTGEVVLLGGEPGVGKSTLLLEMAK
FT                   RMPQRVYYVAGEESPAQIKLRAQRLGVKDLLLVRETRLEPLLALLEEDPPEVLFVDSVQ
FT                   TLEAGGSPGSLVAVREATSALVRFAKERGVAVVLVGHVTKEGVVAGPKSVEHAVDATLY
FT                   LETAGPYRVLRSAKNRFGPVGEIGVFRMEEAGLLEVENPSEAFLKERPLGVPGSAVALA
FT                   LAGERALALEVQALAAKTPFPAPRRVVQGLDGRRVDVVLAVLERRLGLPLANLDVYVNL
FT                   AGGLKVQDPGLDLAVALAVYSAVVGRPLPADLALVGEVGLAGEVRRVAGLERRLREGER
FT                   AGFGRFLHPGNLKRLQEAVEAYLA"
FT   CDS_pept        complement(504982..507192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0542"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   (ClpA)"
FT                   /note="similar to GB:AAS80522.1 percent identity 100 in 736
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70365"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70365"
FT                   /db_xref="GOA:Q5SKV1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70365.1"
FT                   /translation="MNRYDDRARLVFHYAREEGSRLGHSMIGPEHLLLGLMREGGTAAR
FT                   ILQEYGASLEAMRRMVEELVGRGEGGRTGEPPAITPRARRVMELASAEARNMGSPVIGT
FT                   EHILLGIIREGDGIAYRILSHFAKDVDAIRWRVLAMAEGREREKPVNTPFLDEYGRDLT
FT                   KEAREGKLDPVIGRQEEINRVIQILARRTKNNPVLIGDPGVGKTAIVEGLAQAIVEGRV
FT                   PPILKGARVVAIDLAGVVAGTKYRGEFEERLRQIIEELKNAKVIAFIDELHTLIGAGGA
FT                   EGTLDAANILKPALARGEIQVIGATTTGEYHRYIEKDAALERRFQPVIVLEPSPEETLE
FT                   ILKGLRPRYEAHHGVIIPDEILELAVKIGIRSLPGRNFPDKAIDLIDEAASRVRLNASL
FT                   GLPVAEEEDGTPIVTREDVEAVVDSWGGVYVDDKDDEKLMRLEEELRKRVVGQEEAIRA
FT                   LANALRRARVGLGGRTRVAASFLFVGQSGVGKTQLAKALAEVLFGSERALIRFDMSEFQ
FT                   EPHSISKLIGAPPGYVGYEQGGRLTEAVRRQPFSVVLLDEIEKAHPDIYNTFLQVLDEG
FT                   RLTDGMGRTVDFRRVILIMTSNTGYNVGPAIGFTSKEVDTESPLKALFTPEFLDRLDEV
FT                   IRFRPLTEEELVRVAEMMLEDIRKELQARDVQVSFAPELARFLVDQAPKTGSARALRSV
FT                   LRERIEDPLAVALLRKPTGRIHVSVEGGQVAFHEVEGEELLV"
FT   CDS_pept        507321..508841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0543"
FT                   /product="glycyl-tRNA synthetase"
FT                   /note="similar to GB:AAS80523.1 percent identity 99 in 506
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70366"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70366"
FT                   /db_xref="GOA:P56206"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="PDB:1ATI"
FT                   /db_xref="PDB:1B76"
FT                   /db_xref="PDB:1GGM"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56206"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70366.1"
FT                   /translation="MPASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNN
FT                   LKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNRITKKRYRLDHLL
FT                   KEQPEEVLKRLYRAMEVEEENLHALVQAMMQAPERAGGAMTAAGVLDPASGEPGDWTPP
FT                   RYFNMMFKTYVGPVEDEASLAYLRPETAQGIFVNFKNVLDATSRKLPFGIAQIGKAFRN
FT                   EITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQP
FT                   PEELAHYAKATVDILYRFPHGLEELEGIANRTDFDLGSHTKDQEALGITARVLRNEHST
FT                   QRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAP
FT                   IKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVT
FT                   VDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW"
FT   CDS_pept        509022..509258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80524.1 percent identity 100 in 78
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70367"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70367.1"
FT                   /translation="MGKKKGTHLTAPRQEVLGIPEPIWRELWEEVERARALYQEMQVAP
FT                   SRELERELFGALTHLVGHVSAMWEEAEFLEEDA"
FT   CDS_pept        509255..510250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0545"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /note="similar to GB:AAS80525.1 percent identity 99 in 331
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70368"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70368"
FT                   /db_xref="GOA:Q5SKU8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:2YV3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70368.1"
FT                   /translation="MRVAVVGATGAVGREILKVLEARNFPLSELRLYASPRSAGVRLAF
FT                   RGEEIPVEPLPEGPLPVDLVLASAGGGISRAKALVWAEGGALVVDNSSAWRYEPWVPLV
FT                   VPEVNREKIFQHRGIIANPNCTTAILAMALWPLHRAFQAKRVIVATYQAASGAGAKAME
FT                   ELLTETHRFLHGEAPKAEAFAHPLPFNVIPHIDAFQENGYTREEMKVVWETHKIFGDDT
FT                   IRISATAVRVPTLRAHAEAVSVEFARPVTPEAAREVLKEAPGVEVVDEPEAKRYPMPLT
FT                   ASGKWDVEVGRIRKSLAFENGLDFFVVGDQLLKGAALNAVQIAEEWLKGA"
FT   CDS_pept        complement(510237..510944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0546"
FT                   /product="hemolysin"
FT                   /note="similar to GB:AAS80526.1 percent identity 97 in 235
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70369"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70369"
FT                   /db_xref="GOA:Q5SKU7"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70369.1"
FT                   /translation="MRLDRYLVERGLVESREKAKRLIQEGKVRVEGKVVQKPAHPVPEG
FT                   ARVELLAEERYVGRGAYKLLGALEAFPVEPRGKVAADLGASTGGFTQVLLERGARRVYA
FT                   VDVGKGQLHPRLREDPRVVALEEQDARTLVLPEPVDLVVMDVSFISSTLLLPKVLELLK
FT                   PQGEALVLVKPQFELGPKAHKGVVREEAKRREALRRVREKALELGFQVLGEKESPLPGK
FT                   EGNLEYWLWLRRP"
FT   CDS_pept        510962..511273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0547"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80527.1 percent identity 98 in 103
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70370"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70370"
FT                   /db_xref="InterPro:IPR021628"
FT                   /db_xref="PDB:2Z0R"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70370.1"
FT                   /translation="MAPDLSGTWYVLEGDPGEHLVVEALGERLSGIWTSRELAEAFLAH
FT                   HPHLGMRVSALESRALKEAYLRALGMLQVEAVMVDYRPGTHRAQVARVKDLLEEVRRA"
FT   CDS_pept        511266..511694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0548"
FT                   /product="hypothetical protein"
FT                   /note="similar to GB:AAS80528.1 percent identity 96 in 140
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70371"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70371"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70371.1"
FT                   /translation="MRRLLAALLLVLAFGVAQRAEVSVGSPFGLQGGVRFPLVPLLLDG
FT                   RVYGGVGLEAMGGGVDLLLKLPLTDLYLGLGGFYGTGPTLTFPQEGRGQGGVRGVLGTW
FT                   LNLPLPLLGAYLEAQPVYYLTPVQSFGVGLALGLSVGL"
FT   CDS_pept        complement(511785..513431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0549"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /note="similar to GB:AAS80529.1 percent identity 98 in 548
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70372"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70372"
FT                   /db_xref="GOA:Q5SKU4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="PDB:5ZDK"
FT                   /db_xref="PDB:5ZDL"
FT                   /db_xref="PDB:5ZDO"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70372.1"
FT                   /translation="MGLVPECFITELVERDLKEGKYAKLVTRFPPEPNGYLHIGHARSI
FT                   VLNFGLAQDYGGECNLRFDDTNPETEKEEYARAIEEDVRWLGFRPTRVLYASDYFETMY
FT                   QCALVLIQEGKAYVDDLPEEEMSELRAQGKPSPYRERSVEENLELFERMRRGEFPTGSR
FT                   VLRAKIDPAHPNFKLRDPVLYRIVHAPHYHVGDRWVIYPMYDFAHPLEDFIEGVTHSLC
FT                   TLEFENNRTVYDWVIENLKGKCGLPTSPRPHQYEFARLDLSHTVLSKRKLIKLVEGGYV
FT                   SGWDDPRLPTLRGLRRRGVRPEAIVEFVRKTGISRNEAQIEMDLFEEVVRDDLNPIAPR
FT                   VLGVVDPLKVVLTNYEGEEWIEAPYWPRDIPKEGTRPLPFSPELYIERTDFSLNPPKGW
FT                   KRLAPGQRVRLRHAYVIELEDVVEEGGEVRLLKARIVPGTLGANPEDGVRPKGVIHWVS
FT                   ARHALPVEFRLYGRLFRTKDPEEGGDFLQNLNPEALVVKRGFIEPSVAQDPEDTRYQLE
FT                   RLGYFWRDPVDSRPEALVMNRIVPLKEGYRV"
FT   CDS_pept        complement(513445..514206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0550"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /note="similar to GB:AAS80530.1 percent identity 98 in 253
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70373"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70373"
FT                   /db_xref="GOA:Q5SKU3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70373.1"
FT                   /translation="MVQVEKGHVAVVFLNDPERRNPLSPEMALSLLQALDDLEADPGVR
FT                   AVVLTGRGKAFSAGADLAFLERVTELGAEENYRHSLSLMRLFHRVYTYPKPTVAAVNGP
FT                   AVAGGAGLALACDLVVMDEEARLGYTEVKIGFVAALVSVILVRAVGEKAAKDLLLTGRL
FT                   VEAREAKALGLVNRIAPPGKALEEAKALAEEVAKNAPTSLRLTKELLLALPGMGLEDGF
FT                   RLAALANAWVRETGDLKEGIRAFFEKRPPRF"
FT   CDS_pept        514382..514816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0551"
FT                   /product="translation initiation factor 3 (IF-3)"
FT                   /note="similar to GB:AAS80531.1 percent identity 100 in 144
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70374"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70374"
FT                   /db_xref="GOA:Q5SKU2"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="PDB:1I96"
FT                   /db_xref="PDB:5LMN"
FT                   /db_xref="PDB:5LMO"
FT                   /db_xref="PDB:5LMP"
FT                   /db_xref="PDB:5LMQ"
FT                   /db_xref="PDB:5LMR"
FT                   /db_xref="PDB:5LMS"
FT                   /db_xref="PDB:5LMT"
FT                   /db_xref="PDB:5LMU"
FT                   /db_xref="PDB:5LMV"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SKU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70374.1"
FT                   /translation="MDTREALRLAQEMDLDLVLVGPNADPPVARIMDYSKWRYEQQMAE
FT                   KEARKKAKRTEVKSIKFRVKIDEHDYQTKLGHIKRFLQEGHKVKVTIMFRGREVAHPEL
FT                   GERILNRVTEDLKDLAVVEMKPEMLGRDMNMLLAPVKVSA"
FT   CDS_pept        514909..515106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0552"
FT                   /product="50S ribosomal protein L35"
FT                   /note="similar to SP:P80341 percent identity 100 in 65 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70375"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70375"
FT                   /db_xref="GOA:Q5SKU1"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="PDB:1VVJ"
FT                   /db_xref="PDB:1VY4"
FT                   /db_xref="PDB:1VY5"
FT                   /db_xref="PDB:1VY6"
FT                   /db_xref="PDB:1VY7"
FT                   /db_xref="PDB:4L47"
FT                   /db_xref="PDB:4L71"
FT                   /db_xref="PDB:4LEL"
FT                   /db_xref="PDB:4LFZ"
FT                   /db_xref="PDB:4LNT"
FT                   /db_xref="PDB:4LSK"
FT                   /db_xref="PDB:4LT8"
FT                   /db_xref="PDB:4P6F"
FT                   /db_xref="PDB:4P70"
FT                   /db_xref="PDB:4TUA"
FT                   /db_xref="PDB:4TUB"
FT                   /db_xref="PDB:4TUC"
FT                   /db_xref="PDB:4TUD"
FT                   /db_xref="PDB:4TUE"
FT                   /db_xref="PDB:4V4P"
FT                   /db_xref="PDB:4V4X"
FT                   /db_xref="PDB:4V4Y"
FT                   /db_xref="PDB:4V4Z"
FT                   /db_xref="PDB:4V51"
FT                   /db_xref="PDB:4V5C"
FT                   /db_xref="PDB:4V5D"
FT                   /db_xref="PDB:4V5E"
FT                   /db_xref="PDB:4V5F"
FT                   /db_xref="PDB:4V5G"
FT                   /db_xref="PDB:4V5J"
FT                   /db_xref="PDB:4V5K"
FT                   /db_xref="PDB:4V5L"
FT                   /db_xref="PDB:4V5M"
FT                   /db_xref="PDB:4V5N"
FT                   /db_xref="PDB:4V5P"
FT                   /db_xref="PDB:4V5Q"
FT                   /db_xref="PDB:4V5R"
FT                   /db_xref="PDB:4V5S"
FT                   /db_xref="PDB:4V68"
FT                   /db_xref="PDB:4V6A"
FT                   /db_xref="PDB:4V6F"
FT                   /db_xref="PDB:4V6G"
FT                   /db_xref="PDB:4V7J"
FT                   /db_xref="PDB:4V7K"
FT                   /db_xref="PDB:4V7L"
FT                   /db_xref="PDB:4V7M"
FT                   /db_xref="PDB:4V7W"
FT                   /db_xref="PDB:4V7X"
FT                   /db_xref="PDB:4V7Y"
FT                   /db_xref="PDB:4V7Z"
FT                   /db_xref="PDB:4V87"
FT                   /db_xref="PDB:4V8A"
FT                   /db_xref="PDB:4V8B"
FT                   /db_xref="PDB:4V8C"
FT                   /db_xref="PDB:4V8D"
FT                   /db_xref="PDB:4V8E"
FT                   /db_xref="PDB:4V8F"
FT                   /db_xref="PDB:4V8G"
FT                   /db_xref="PDB:4V8H"
FT                   /db_xref="PDB:4V8I"
FT                   /db_xref="PDB:4V8J"
FT                   /db_xref="PDB:4V8N"
FT                   /db_xref="PDB:4V8O"
FT                   /db_xref="PDB:4V8Q"
FT                   /db_xref="PDB:4V8U"
FT                   /db_xref="PDB:4V8X"
FT                   /db_xref="PDB:4V90"
FT                   /db_xref="PDB:4V95"
FT                   /db_xref="PDB:4V97"
FT                   /db_xref="PDB:4V9A"
FT                   /db_xref="PDB:4V9B"
FT                   /db_xref="PDB:4V9H"
FT                   /db_xref="PDB:4V9I"
FT                   /db_xref="PDB:4V9R"
FT                   /db_xref="PDB:4V9S"
FT                   /db_xref="PDB:4W2E"
FT                   /db_xref="PDB:4W2F"
FT                   /db_xref="PDB:4W2G"
FT                   /db_xref="PDB:4W2H"
FT                   /db_xref="PDB:4W2I"
FT                   /db_xref="PDB:4W4G"
FT                   /db_xref="PDB:4WPO"
FT                   /db_xref="PDB:4WQ1"
FT                   /db_xref="PDB:4WQF"
FT                   /db_xref="PDB:4WQR"
FT                   /db_xref="PDB:4WQU"
FT                   /db_xref="PDB:4WQY"
FT                   /db_xref="PDB:4WR6"
FT                   /db_xref="PDB:4WRA"
FT                   /db_xref="PDB:4WRO"
FT                   /db_xref="PDB:4WSD"
FT                   /db_xref="PDB:4WSM"
FT                   /db_xref="PDB:4WT1"
FT                   /db_xref="PDB:4WT8"
FT                   /db_xref="PDB:4WU1"
FT                   /db_xref="PDB:4WZD"
FT                   /db_xref="PDB:4WZO"
FT                   /db_xref="PDB:4Y4O"
FT                   /db_xref="PDB:4Y4P"
FT                   /db_xref="PDB:4YPB"
FT                   /db_xref="PDB:4YZV"
FT                   /db_xref="PDB:4Z3S"
FT                   /db_xref="PDB:4Z8C"
FT                   /db_xref="PDB:4ZER"
FT                   /db_xref="PDB:4ZSN"
FT                   /db_xref="PDB:5A9Z"
FT                   /db_xref="PDB:5AA0"
FT                   /db_xref="PDB:5CZP"
FT                   /db_xref="PDB:5D8B"
FT                   /db_xref="PDB:5DFE"
FT                   /db_xref="PDB:5DOX"
FT                   /db_xref="PDB:5DOY"
FT                   /db_xref="PDB:5E7K"
FT                   /db_xref="PDB:5E81"
FT                   /db_xref="PDB:5EL4"
FT                   /db_xref="PDB:5EL5"
FT                   /db_xref="PDB:5EL6"
FT                   /db_xref="PDB:5EL7"
FT                   /db_xref="PDB:5F8K"
FT                   /db_xref="PDB:5FDU"
FT                   /db_xref="PDB:5FDV"
FT                   /db_xref="PDB:5HAU"
FT                   /db_xref="PDB:5HCP"
FT                   /db_xref="PDB:5HCQ"
FT                   /db_xref="PDB:5HCR"
FT                   /db_xref="PDB:5HD1"
FT                   /db_xref="PDB:5IB7"
FT                   /db_xref="PDB:5IB8"
FT                   /db_xref="PDB:5IBB"
FT                   /db_xref="PDB:5IMQ"
FT                   /db_xref="PDB:5IMR"
FT                   /db_xref="PDB:5J30"
FT                   /db_xref="PDB:5J3C"
FT                   /db_xref="PDB:5J4B"
FT                   /db_xref="PDB:5J4C"
FT                   /db_xref="PDB:5J8B"
FT                   /db_xref="PDB:5NDJ"
FT                   /db_xref="PDB:5NDK"
FT                   /db_xref="PDB:5OT7"
FT                   /db_xref="PDB:5UQ7"
FT                   /db_xref="PDB:5UQ8"
FT                   /db_xref="PDB:5VP2"
FT                   /db_xref="PDB:5VPO"
FT                   /db_xref="PDB:5VPP"
FT                   /db_xref="PDB:5W4K"
FT                   /db_xref="PDB:5WIS"
FT                   /db_xref="PDB:5WIT"
FT                   /db_xref="PDB:5ZLU"
FT                   /db_xref="PDB:6BUW"
FT                   /db_xref="PDB:6BZ6"
FT                   /db_xref="PDB:6BZ7"
FT                   /db_xref="PDB:6BZ8"
FT                   /db_xref="PDB:6C5L"
FT                   /db_xref="PDB:6CAE"
FT                   /db_xref="PDB:6CFJ"
FT                   /db_xref="PDB:6CFK"
FT                   /db_xref="PDB:6CFL"
FT                   /db_xref="PDB:6CZR"
FT                   /db_xref="PDB:6FKR"
FT                   /db_xref="PDB:6GSJ"
FT                   /db_xref="PDB:6GSK"
FT                   /db_xref="PDB:6GSL"
FT                   /db_xref="PDB:6GZQ"
FT                   /db_xref="PDB:6GZX"
FT                   /db_xref="PDB:6GZZ"
FT                   /db_xref="PDB:6ND5"
FT                   /db_xref="PDB:6ND6"
FT                   /db_xref="PDB:6NDK"
FT                   /db_xref="PDB:6O97"
FT                   /db_xref="PDB:6OF1"
FT                   /db_xref="PDB:6Q95"
FT                   /db_xref="PDB:6QNQ"
FT                   /db_xref="PDB:6QNR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SKU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70375.1"
FT                   /translation="MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKG
FT                   RKFVLAKPEAERIKLLLPYE"
FT   CDS_pept        515118..515474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0553"
FT                   /product="50S ribosomal protein L20"
FT                   /note="similar to GB:AAS80533.1 percent identity 100 in 118
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70376"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70376"
FT                   /db_xref="GOA:P60491"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="PDB:1VVJ"
FT                   /db_xref="PDB:1VY4"
FT                   /db_xref="PDB:1VY5"
FT                   /db_xref="PDB:1VY6"
FT                   /db_xref="PDB:1VY7"
FT                   /db_xref="PDB:4L47"
FT                   /db_xref="PDB:4L71"
FT                   /db_xref="PDB:4LEL"
FT                   /db_xref="PDB:4LFZ"
FT                   /db_xref="PDB:4LNT"
FT                   /db_xref="PDB:4LSK"
FT                   /db_xref="PDB:4LT8"
FT                   /db_xref="PDB:4P6F"
FT                   /db_xref="PDB:4P70"
FT                   /db_xref="PDB:4TUA"
FT                   /db_xref="PDB:4TUB"
FT                   /db_xref="PDB:4TUC"
FT                   /db_xref="PDB:4TUD"
FT                   /db_xref="PDB:4TUE"
FT                   /db_xref="PDB:4V4P"
FT                   /db_xref="PDB:4V4X"
FT                   /db_xref="PDB:4V4Y"
FT                   /db_xref="PDB:4V4Z"
FT                   /db_xref="PDB:4V51"
FT                   /db_xref="PDB:4V5A"
FT                   /db_xref="PDB:4V5C"
FT                   /db_xref="PDB:4V5D"
FT                   /db_xref="PDB:4V5E"
FT                   /db_xref="PDB:4V5F"
FT                   /db_xref="PDB:4V5G"
FT                   /db_xref="PDB:4V5J"
FT                   /db_xref="PDB:4V5K"
FT                   /db_xref="PDB:4V5L"
FT                   /db_xref="PDB:4V5M"
FT                   /db_xref="PDB:4V5N"
FT                   /db_xref="PDB:4V5P"
FT                   /db_xref="PDB:4V5Q"
FT                   /db_xref="PDB:4V5R"
FT                   /db_xref="PDB:4V5S"
FT                   /db_xref="PDB:4V68"
FT                   /db_xref="PDB:4V6A"
FT                   /db_xref="PDB:4V6F"
FT                   /db_xref="PDB:4V6G"
FT                   /db_xref="PDB:4V7J"
FT                   /db_xref="PDB:4V7K"
FT                   /db_xref="PDB:4V7L"
FT                   /db_xref="PDB:4V7M"
FT                   /db_xref="PDB:4V7W"
FT                   /db_xref="PDB:4V7X"
FT                   /db_xref="PDB:4V7Y"
FT                   /db_xref="PDB:4V7Z"
FT                   /db_xref="PDB:4V87"
FT                   /db_xref="PDB:4V8A"
FT                   /db_xref="PDB:4V8B"
FT                   /db_xref="PDB:4V8C"
FT                   /db_xref="PDB:4V8D"
FT                   /db_xref="PDB:4V8E"
FT                   /db_xref="PDB:4V8F"
FT                   /db_xref="PDB:4V8G"
FT                   /db_xref="PDB:4V8H"
FT                   /db_xref="PDB:4V8I"
FT                   /db_xref="PDB:4V8J"
FT                   /db_xref="PDB:4V8N"
FT                   /db_xref="PDB:4V8O"
FT                   /db_xref="PDB:4V8Q"
FT                   /db_xref="PDB:4V8U"
FT                   /db_xref="PDB:4V8X"
FT                   /db_xref="PDB:4V90"
FT                   /db_xref="PDB:4V95"
FT                   /db_xref="PDB:4V97"
FT                   /db_xref="PDB:4V9A"
FT                   /db_xref="PDB:4V9B"
FT                   /db_xref="PDB:4V9H"
FT                   /db_xref="PDB:4V9I"
FT                   /db_xref="PDB:4V9R"
FT                   /db_xref="PDB:4V9S"
FT                   /db_xref="PDB:4W2E"
FT                   /db_xref="PDB:4W2F"
FT                   /db_xref="PDB:4W2G"
FT                   /db_xref="PDB:4W2H"
FT                   /db_xref="PDB:4W2I"
FT                   /db_xref="PDB:4W4G"
FT                   /db_xref="PDB:4WPO"
FT                   /db_xref="PDB:4WQ1"
FT                   /db_xref="PDB:4WQF"
FT                   /db_xref="PDB:4WQR"
FT                   /db_xref="PDB:4WQU"
FT                   /db_xref="PDB:4WQY"
FT                   /db_xref="PDB:4WR6"
FT                   /db_xref="PDB:4WRA"
FT                   /db_xref="PDB:4WRO"
FT                   /db_xref="PDB:4WSD"
FT                   /db_xref="PDB:4WSM"
FT                   /db_xref="PDB:4WT1"
FT                   /db_xref="PDB:4WT8"
FT                   /db_xref="PDB:4WU1"
FT                   /db_xref="PDB:4WZD"
FT                   /db_xref="PDB:4WZO"
FT                   /db_xref="PDB:4Y4O"
FT                   /db_xref="PDB:4Y4P"
FT                   /db_xref="PDB:4YPB"
FT                   /db_xref="PDB:4YZV"
FT                   /db_xref="PDB:4Z3S"
FT                   /db_xref="PDB:4Z8C"
FT                   /db_xref="PDB:4ZER"
FT                   /db_xref="PDB:4ZSN"
FT                   /db_xref="PDB:5A9Z"
FT                   /db_xref="PDB:5AA0"
FT                   /db_xref="PDB:5CZP"
FT                   /db_xref="PDB:5D8B"
FT                   /db_xref="PDB:5DFE"
FT                   /db_xref="PDB:5DOX"
FT                   /db_xref="PDB:5DOY"
FT                   /db_xref="PDB:5E7K"
FT                   /db_xref="PDB:5E81"
FT                   /db_xref="PDB:5EL4"
FT                   /db_xref="PDB:5EL5"
FT                   /db_xref="PDB:5EL6"
FT                   /db_xref="PDB:5EL7"
FT                   /db_xref="PDB:5F8K"
FT                   /db_xref="PDB:5FDU"
FT                   /db_xref="PDB:5FDV"
FT                   /db_xref="PDB:5HAU"
FT                   /db_xref="PDB:5HCP"
FT                   /db_xref="PDB:5HCQ"
FT                   /db_xref="PDB:5HCR"
FT                   /db_xref="PDB:5HD1"
FT                   /db_xref="PDB:5IB7"
FT                   /db_xref="PDB:5IB8"
FT                   /db_xref="PDB:5IBB"
FT                   /db_xref="PDB:5IMQ"
FT                   /db_xref="PDB:5IMR"
FT                   /db_xref="PDB:5J30"
FT                   /db_xref="PDB:5J3C"
FT                   /db_xref="PDB:5J4B"
FT                   /db_xref="PDB:5J4C"
FT                   /db_xref="PDB:5J8B"
FT                   /db_xref="PDB:5NDJ"
FT                   /db_xref="PDB:5NDK"
FT                   /db_xref="PDB:5OT7"
FT                   /db_xref="PDB:5UQ7"
FT                   /db_xref="PDB:5UQ8"
FT                   /db_xref="PDB:5VP2"
FT                   /db_xref="PDB:5VPO"
FT                   /db_xref="PDB:5VPP"
FT                   /db_xref="PDB:5W4K"
FT                   /db_xref="PDB:5WIS"
FT                   /db_xref="PDB:5WIT"
FT                   /db_xref="PDB:5ZLU"
FT                   /db_xref="PDB:6BUW"
FT                   /db_xref="PDB:6BZ6"
FT                   /db_xref="PDB:6BZ7"
FT                   /db_xref="PDB:6BZ8"
FT                   /db_xref="PDB:6CAE"
FT                   /db_xref="PDB:6CZR"
FT                   /db_xref="PDB:6FKR"
FT                   /db_xref="PDB:6GSJ"
FT                   /db_xref="PDB:6GSK"
FT                   /db_xref="PDB:6GSL"
FT                   /db_xref="PDB:6GZQ"
FT                   /db_xref="PDB:6GZX"
FT                   /db_xref="PDB:6GZZ"
FT                   /db_xref="PDB:6ND5"
FT                   /db_xref="PDB:6ND6"
FT                   /db_xref="PDB:6NDK"
FT                   /db_xref="PDB:6O97"
FT                   /db_xref="PDB:6OF1"
FT                   /db_xref="PDB:6Q95"
FT                   /db_xref="PDB:6QNQ"
FT                   /db_xref="PDB:6QNR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60491"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70376.1"
FT                   /translation="MPRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNY
FT                   AYAHRKRRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVREPQ
FT                   VFAELVERAKAAQG"
FT   CDS_pept        515517..515987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0554"
FT                   /product="small multidrug export protein"
FT                   /note="similar to GB:AAS80534.1 percent identity 96 in 156
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70377"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70377"
FT                   /db_xref="GOA:Q5SKT9"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70377.1"
FT                   /translation="MPFPPEVYVLLVAALPVVELRGAIPLGVALGLSPWESFLWALLGN
FT                   LLVVPLALGLFPWAVGLATRVPLFARAWWALEARVRLKGEAQVQRLGALGLFLFVAVPL
FT                   PGTGAWSGAVLAVVLGVRRRYAFPALALGVVAAGLLVLLLTGGTVHGLNYLR"
FT   CDS_pept        515984..517645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80535.1 percent identity 99 in 553
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70378"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70378"
FT                   /db_xref="GOA:Q5SKT8"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR021194"
FT                   /db_xref="InterPro:IPR035015"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70378.1"
FT                   /translation="MTALLLSLAYLVGALPLGYWLARRRGVDLRTASPYTLGLESALRR
FT                   LGLGLLLLSFLLDFLKGYLPLLLGRALGLDLAGLLALGVAVYLGHLYPLFFRDPWPLRA
FT                   KGAGVLLGILSGLPLPPALGLVPVALGLVLYALTGYASLAALGLPLGLLGATLFGGFGL
FT                   AERLSALALFLLALWRYKENLGRVLEGTEPKLGDPLPLPSEKQVVCAFLIHPLTVEDFW
FT                   QSPRFRWLRPLVRLGLLKQEWIERLAERFRPMKVGEVRGVRTADGREVLCHLISAPLLP
FT                   HQIKAKPELAVRRAIQGARLAKELGATVVGLGAFWSVVGEKGKRVQEAVPGIEVTNGGA
FT                   YTAGTVRAAIPKILAHFAQSGKDLKGATAAVVGANGVVAFGIARQIAPLVGRLILVGRD
FT                   LERLKRAAESLRKNLERKGEAPEILATTEIAAIREADLVFTATSDPNPVIYPEHVKPGA
FT                   WIYDEGVPPDVHPSVREVPGVRVTPGGVVRLPGEARATLDLHFGAPDQVPACLAETMIL
FT                   AAEEAFDRKSLGGEVRAENVQFFVERAEALGFRVVE"
FT   CDS_pept        517645..518322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AAS80536.1 percent identity 97 in 225
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70379"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70379"
FT                   /db_xref="GOA:Q5SKT7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SKT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70379.1"
FT                   /translation="MWLLLSPTRLEAPFLEGEPFAFLAWRGLKGTGFVYLETGIGKVNA
FT                   AMALAAYAARNPVEKALLFGLAGAYPGGPSLGEAVLVEEEVEADLGLKEGLAPLGFPAL
FT                   ALGERRYFNRFPLDPGLTGELARGLGLKVAVGLTRDLVSETPEEALALARRWGASLENM
FT                   EGAAFARACLALGVRGAELRALSNPAGVRDKAHWRTKEALSALARAVRRLLAEEGGARR
FT                   PPG"
FT   CDS_pept        complement(518335..518949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0557"
FT                   /product="superoxide dismutase [Mn]"
FT                   /note="similar to GB:AAS80537.1 percent identity 100 in 204
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70380"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70380"
FT                   /db_xref="GOA:P61503"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="PDB:1MNG"
FT                   /db_xref="PDB:3MDS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61503"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70380.1"
FT                   /translation="MPYPFKLPDLGYPYEALEPHIDAKTMEIHHQKHHGAYVTNLNAAL
FT                   EKYPYLHGVEVEVLLRHLAALPQDIQTAVRNNGGGHLNHSLFWRLLTPGGAKEPVGELK
FT                   KAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVLSTPNQDNPVMEGFTPI
FT                   VGIDVWEHAYYLKYQNRRADYLQAIWNVLNWDVAEEFFKKA"
FT   CDS_pept        complement(519024..520424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0558"
FT                   /product="fumarate hydratase class II (EC 4.2.1.2)"
FT                   /note="similar to GB:AAS80538.1 percent identity 99 in 466
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70381"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70381"
FT                   /db_xref="GOA:Q5SKT5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70381.1"
FT                   /translation="MEYRIERDTMGEVRVPADKYWGAQTQRSLENFRIGTDRFRMPLEI
FT                   IRAYGMLKKAAARANLELGELPEEIAKAIIQAAEEVVQGKWDDHFPLVVFQTGSGTQTN
FT                   MNVNEVIANRASEILGKPLGSKYVHPNDHVNRGQSSNDTFPTAMYVAVALALHQRLYPA
FT                   VEGLIRTFTAKAQAFDQIVKVGRTHLMDAVPITLGQEIGSWAAQLKTTLAAVKEMEKGL
FT                   YNLAIGGTAVGTGLNAHPRFGELVAKYLAEETGLPFRVAENRFAALAAHDELVNVMGAI
FT                   RTLAGALMKIGNDVRWLASGPYAGIGEITIPANEPGSSIMPGKVNPTQVEALTMVVVRV
FT                   YGNDHTVAFAGSQGNFQLNVYKPVMAYSTLESINLLADAVASFDAHLAQGIEPNLERIE
FT                   EHLQKNPMLATALNKAIGYDKAAEIVKKALKEKKTLKQAALELGYLTEEEFDRIVVPMR
FT                   LAKPHEGA"
FT   CDS_pept        520477..521667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TTHA0559"
FT                   /product="acetyl coenzyme A acetyltransferase (thiolase)"
FT                   /note="similar to GB:AAS80539.1 percent identity 98 in 396
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAD70382"
FT                   /db_xref="EnsemblGenomes-Tr:BAD70382"
FT                   /db_xref="GOA:Q5SKT4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SKT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD70382.1"
FT                   /translation="MREVYVVAAVRTPIGKFGGVFKDVSPVDLGAHAMREALARAGVEG
FT                   KALDLYIFGNVLRAGHGQLLPRQAALKAGIPKEVDGYQVDMVCASGMMAALNAVQFLRT
FT                   GEAHLVLAGGMESMSQAGFYLSHRARWGYKFLLGAPENLQDILLRDGLSDPFTGEAMGE
FT                   QAERLAQDHGVTRREIDEAAYLSHKRAAEATEKGLFAWEIAPMEVQGRKGPVVVDRDEG
FT                   IRPETTLESLAALRPAFKKDGVLTAGNSSQISDGAAALLLASEEAVKAHGLKPIAKVLG
FT                   GAWAAGESWRFPEAPIPAAKRLLDRLGMRVSDFGLFENNEAFALNNVLFSRLLDVPYER
FT                   LNVFGGAVALGHPIGASGARILVTLLNALRAKGEERGLAAICHGTGGSVAFAVEVV"
FT   CDS_pept        complement(521678..521986)
FT